BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25859_g1_i1 len=2022 path=[1981:0-224 2206:225-230 2212:231-301
2283:302-305 2287:306-357 2339:358-418 2400:419-434 2416:435-514
7875:515-531 5510:532-556 2538:557-649 2631:650-662 2644:663-802
2784:803-818 2800:819-834 2816:835-859 8017:860-871 2853:872-880
2862:881-888 2870:889-915 2897:916-946 2928:947-971 2953:972-991
2973:992-1027 3009:1028-1038 3020:1039-1039 3021:1040-1063
3045:1064-1141 3123:1142-1160 3142:1161-1364 8259:1365-1396
8287:1397-1471 6166:1472-1490 3472:1491-1572 8346:1573-1583
5952:1584-1588 3570:1589-1598 3580:1599-1623 8380:1624-1629
7508:1630-1644 3626:1645-1674 3656:1675-1698 6416:1699-1883
3846:1884-1911 3874:1912-2021]

Length=2022
                                                                      Score     E

ref|XP_009607163.1|  PREDICTED: cytochrome P450 CYP749A22-like          702   0.0      
ref|XP_006348652.1|  PREDICTED: cytochrome P450 734A1-like              689   0.0      
ref|XP_011070909.1|  PREDICTED: cytochrome P450 CYP749A22-like          685   0.0      
ref|XP_010320842.1|  PREDICTED: cytochrome P450 CYP749A22               662   0.0      
gb|EYU22575.1|  hypothetical protein MIMGU_mgv1a004725mg                645   0.0      
emb|CDP00469.1|  unnamed protein product                                617   0.0      
ref|XP_004297206.1|  PREDICTED: cytochrome P450 734A1-like              612   0.0      
ref|XP_008243892.1|  PREDICTED: cytochrome P450 CYP749A22-like          605   0.0      
ref|XP_008243779.1|  PREDICTED: cytochrome P450 CYP749A22-like          598   0.0      
ref|XP_009357376.1|  PREDICTED: cytochrome P450 CYP749A22-like          597   0.0      
ref|XP_008243806.1|  PREDICTED: cytochrome P450 CYP749A22-like          595   0.0      
ref|XP_007226407.1|  hypothetical protein PRUPE_ppa022752mg             595   0.0      
ref|XP_009356202.1|  PREDICTED: cytochrome P450 CYP749A22-like          595   0.0      
ref|XP_007222985.1|  hypothetical protein PRUPE_ppa004328mg             593   0.0      
ref|XP_008219236.1|  PREDICTED: cytochrome P450 CYP749A22-like          593   0.0      
ref|XP_009356447.1|  PREDICTED: cytochrome P450 CYP749A22-like          593   0.0      
ref|XP_007223137.1|  hypothetical protein PRUPE_ppa004329mg             593   0.0      
ref|XP_007221838.1|  hypothetical protein PRUPE_ppa023692mg             592   0.0      
ref|XP_008389250.1|  PREDICTED: cytochrome P450 CYP749A22-like          591   0.0      
ref|XP_007201527.1|  hypothetical protein PRUPE_ppa016887mg             591   0.0      
ref|XP_009607162.1|  PREDICTED: cytochrome P450 CYP749A22-like          589   0.0      
ref|XP_007226531.1|  hypothetical protein PRUPE_ppa025196mg             587   0.0      
emb|CDP00470.1|  unnamed protein product                                586   0.0      
ref|XP_008243778.1|  PREDICTED: cytochrome P450 CYP749A22-like          586   0.0      
ref|XP_010091621.1|  Cytochrome P450 734A1                              585   0.0      
ref|XP_007226762.1|  hypothetical protein PRUPE_ppa018724mg             584   0.0      
ref|XP_004297211.1|  PREDICTED: cytochrome P450 734A1-like              581   0.0      
ref|XP_004297209.1|  PREDICTED: cytochrome P450 734A1-like              580   0.0      
ref|XP_007224470.1|  hypothetical protein PRUPE_ppa022621mg             580   0.0      
ref|XP_008350887.1|  PREDICTED: cytochrome P450 CYP749A22-like          579   0.0      
ref|XP_007226180.1|  hypothetical protein PRUPE_ppa015588mg             579   0.0      
ref|XP_011009723.1|  PREDICTED: cytochrome P450 CYP749A22-like          578   0.0      
ref|XP_007226460.1|  hypothetical protein PRUPE_ppa024660mg             578   0.0      
ref|XP_008243803.1|  PREDICTED: cytochrome P450 CYP749A22-like          578   0.0      
ref|XP_002316010.2|  hypothetical protein POPTR_0010s14950g             578   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW86467.1|  hypothetical protein EUGRSUZ_B03135                     577   0.0      
ref|XP_007222983.1|  hypothetical protein PRUPE_ppa004319mg             577   0.0      
ref|XP_008367032.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    577   0.0      
ref|XP_008243777.1|  PREDICTED: cytochrome P450 CYP749A22-like          595   0.0      
ref|XP_011070908.1|  PREDICTED: cytochrome P450 CYP749A22-like          577   0.0      
gb|KCW82725.1|  hypothetical protein EUGRSUZ_C04102                     576   0.0      
ref|XP_010044379.1|  PREDICTED: cytochrome P450 CYP749A22-like          576   0.0      
ref|XP_008364583.1|  PREDICTED: cytochrome P450 CYP749A22-like          576   0.0      
ref|XP_010044380.1|  PREDICTED: cytochrome P450 CYP749A22-like          576   0.0      
ref|XP_010049898.1|  PREDICTED: cytochrome P450 CYP749A22-like          575   0.0      
ref|XP_007223262.1|  hypothetical protein PRUPE_ppa004463mg             574   0.0      
ref|XP_007034363.1|  Cytochrome P450                                    575   0.0      
ref|XP_007224155.1|  hypothetical protein PRUPE_ppa016800mg             573   0.0      
ref|XP_008243804.1|  PREDICTED: cytochrome P450 CYP749A22-like          573   0.0      
ref|XP_008367031.1|  PREDICTED: cytochrome P450 CYP749A22-like          573   0.0      
ref|XP_007034362.1|  Cytochrome P450                                    576   0.0      
ref|XP_008360080.1|  PREDICTED: cytochrome P450 CYP749A22-like          573   0.0      
ref|XP_008243887.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    591   0.0      
ref|XP_010049895.1|  PREDICTED: cytochrome P450 CYP749A22-like          572   0.0      
ref|XP_011101779.1|  PREDICTED: cytochrome P450 CYP749A22-like          571   0.0      
ref|XP_007045779.1|  Cytochrome P450, putative                          571   0.0      
ref|XP_008243805.1|  PREDICTED: cytochrome P450 CYP749A22-like          571   0.0      
ref|XP_004303121.1|  PREDICTED: cytochrome P450 734A1-like              570   0.0      
ref|XP_009762791.1|  PREDICTED: cytochrome P450 CYP749A22-like          570   0.0      
ref|XP_011102247.1|  PREDICTED: cytochrome P450 CYP749A22-like          570   0.0      
ref|XP_007045778.1|  Cytochrome P450                                    570   0.0      
ref|XP_011008174.1|  PREDICTED: cytochrome P450 CYP749A22-like          568   0.0      
ref|XP_008346697.1|  PREDICTED: cytochrome P450 CYP749A22-like          568   0.0      
ref|XP_007224838.1|  hypothetical protein PRUPE_ppa023100mg             568   0.0      
gb|KCW82720.1|  hypothetical protein EUGRSUZ_C04097                     568   0.0      
ref|XP_004298349.1|  PREDICTED: cytochrome P450 734A1-like              568   0.0      
ref|XP_004239025.1|  PREDICTED: cytochrome P450 CYP749A22-like          568   0.0      
gb|EYU22577.1|  hypothetical protein MIMGU_mgv1a004830mg                567   0.0      
ref|XP_002325505.1|  hypothetical protein POPTR_0019s09980g             568   0.0      Populus trichocarpa [western balsam poplar]
gb|KCW44246.1|  hypothetical protein EUGRSUZ_L02324                     566   0.0      
ref|XP_004297212.1|  PREDICTED: cytochrome P450 734A1-like              566   0.0      
gb|EYU22578.1|  hypothetical protein MIMGU_mgv1a004881mg                565   0.0      
ref|XP_008356573.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    565   0.0      
ref|XP_011015632.1|  PREDICTED: cytochrome P450 CYP749A22-like          565   0.0      
ref|XP_004298348.1|  PREDICTED: cytochrome P450 734A1-like              565   0.0      
ref|XP_011102246.1|  PREDICTED: cytochrome P450 CYP749A22-like          565   0.0      
ref|XP_006484252.1|  PREDICTED: cytochrome P450 734A1-like              565   0.0      
ref|XP_008243895.1|  PREDICTED: cytochrome P450 CYP749A22-like          582   0.0      
ref|XP_008351041.1|  PREDICTED: cytochrome P450 CYP749A22-like          582   0.0      
ref|XP_010049897.1|  PREDICTED: cytochrome P450 CYP749A22-like          564   0.0      
ref|XP_006437870.1|  hypothetical protein CICLE_v10031156mg             565   0.0      
ref|XP_009356542.1|  PREDICTED: uncharacterized protein LOC103947363    583   0.0      
ref|XP_008374265.1|  PREDICTED: cytochrome P450 CYP749A22-like          565   0.0      
ref|XP_002316006.2|  hypothetical protein POPTR_0010s14900g             564   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007045775.1|  Cytochrome P450                                    564   0.0      
ref|XP_007222124.1|  hypothetical protein PRUPE_ppa004646mg             562   0.0      
ref|XP_010044376.1|  PREDICTED: cytochrome P450 CYP749A22-like          563   0.0      
gb|KDO70288.1|  hypothetical protein CISIN_1g009043mg                   563   0.0      
ref|XP_009346501.1|  PREDICTED: cytochrome P450 CYP749A22-like          563   0.0      
ref|XP_010091618.1|  Cytochrome P450 734A1                              564   0.0      
ref|XP_008361867.1|  PREDICTED: uncharacterized protein LOC103425555    588   0.0      
ref|XP_009356448.1|  PREDICTED: cytochrome P450 CYP749A22-like          561   0.0      
ref|XP_004298351.1|  PREDICTED: cytochrome P450 734A1-like              561   0.0      
ref|XP_009346500.1|  PREDICTED: cytochrome P450 CYP749A22-like          561   0.0      
gb|KDP41351.1|  hypothetical protein JCGZ_15758                         559   0.0      
ref|XP_008340298.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    578   0.0      
ref|XP_009356543.1|  PREDICTED: uncharacterized protein LOC103947364    578   0.0      
ref|XP_002512038.1|  cytochrome P450, putative                          560   0.0      Ricinus communis
ref|XP_008390037.1|  PREDICTED: uncharacterized protein LOC103452311    577   0.0      
ref|XP_006437867.1|  hypothetical protein CICLE_v10033321mg             558   0.0      
ref|XP_006484250.1|  PREDICTED: cytochrome P450 734A1-like              558   0.0      
ref|XP_004297208.1|  PREDICTED: cytochrome P450 734A1-like              558   0.0      
ref|XP_002316008.1|  hypothetical protein POPTR_0010s14920g             557   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002512037.1|  cytochrome P450, putative                          556   0.0      Ricinus communis
ref|XP_010044348.1|  PREDICTED: cytochrome P450 CYP749A22-like          556   0.0      
gb|EYU22576.1|  hypothetical protein MIMGU_mgv1a004757mg                555   0.0      
gb|KCW73229.1|  hypothetical protein EUGRSUZ_E01694                     555   0.0      
gb|AJD25262.1|  cytochrome P450 CYP749A40                               554   0.0      
gb|KCW86463.1|  hypothetical protein EUGRSUZ_B03131                     554   0.0      
ref|XP_008229697.1|  PREDICTED: cytochrome P450 CYP749A22-like          553   0.0      
ref|XP_010044378.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    555   0.0      
sp|H2DH17.1|C7A22_PANGI  RecName: Full=Cytochrome P450 CYP749A22;...    553   0.0      
ref|XP_010041584.1|  PREDICTED: cytochrome P450 CYP749A22-like          567   0.0      
ref|XP_007045776.1|  Cytochrome P450                                    551   0.0      
ref|XP_010056464.1|  PREDICTED: cytochrome P450 CYP749A22-like          554   0.0      
ref|XP_010056458.1|  PREDICTED: cytochrome P450 CYP749A22-like          551   0.0      
ref|XP_008389384.1|  PREDICTED: cytochrome P450 CYP749A22-like          550   0.0      
ref|XP_006437871.1|  hypothetical protein CICLE_v10031156mg             551   0.0      
gb|KDO70289.1|  hypothetical protein CISIN_1g009043mg                   550   0.0      
gb|KDP41353.1|  hypothetical protein JCGZ_15760                         546   0.0      
ref|XP_004297207.1|  PREDICTED: cytochrome P450 734A1-like              548   0.0      
ref|XP_004298350.1|  PREDICTED: cytochrome P450 734A1-like              546   0.0      
ref|XP_002316007.2|  hypothetical protein POPTR_0010s14910g             546   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010046611.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    563   0.0      
ref|XP_004297193.1|  PREDICTED: cytochrome P450 734A1-like              545   0.0      
ref|XP_010044377.1|  PREDICTED: cytochrome P450 CYP749A22-like is...    547   0.0      
ref|XP_004297210.1|  PREDICTED: cytochrome P450 734A1-like              545   0.0      
gb|KCW82722.1|  hypothetical protein EUGRSUZ_C04098                     543   0.0      
ref|XP_007045772.1|  Secologanin synthase, putative                     561   0.0      
gb|AJD25261.1|  cytochrome P450 CYP749A39                               543   0.0      
emb|CDP00472.1|  unnamed protein product                                562   0.0      
ref|XP_011009686.1|  PREDICTED: cytochrome P450 CYP749A22-like          541   0.0      
ref|XP_011009712.1|  PREDICTED: cytochrome P450 CYP749A22-like          541   0.0      
gb|KCW86460.1|  hypothetical protein EUGRSUZ_B03128                     539   0.0      
gb|KCW85140.1|  hypothetical protein EUGRSUZ_B01983                     539   0.0      
ref|XP_006388777.1|  hypothetical protein POPTR_0102s00210g             538   0.0      
gb|KHG09815.1|  Cytochrome P450 protein                                 537   0.0      
gb|KDO70287.1|  hypothetical protein CISIN_1g039293mg                   536   0.0      
gb|KHG18356.1|  Cytochrome P450 protein                                 535   3e-180   
gb|AJD25260.1|  cytochrome P450 CYP749A38                               534   6e-180   
gb|KHG11625.1|  Cytochrome P450 protein                                 533   1e-179   
gb|KHG26170.1|  Secologanin synthase                                    533   1e-179   
ref|XP_007045774.1|  Cytochrome P450                                    533   1e-179   
ref|XP_002325324.2|  hypothetical protein POPTR_0019s03160g             533   2e-179   Populus trichocarpa [western balsam poplar]
gb|KHG06141.1|  Cytochrome P450 protein                                 533   3e-179   
gb|KCW76384.1|  hypothetical protein EUGRSUZ_D00766                     530   9e-179   
ref|XP_006484251.1|  PREDICTED: cytochrome P450 734A1-like              531   1e-178   
gb|KHG27490.1|  Cytochrome P450 protein                                 531   1e-178   
ref|XP_008446466.1|  PREDICTED: cytochrome P450 CYP749A22-like          530   2e-178   
ref|XP_004295655.1|  PREDICTED: cytochrome P450 734A1-like              527   1e-177   
gb|KHG07569.1|  Cytochrome P450 protein                                 527   3e-177   
ref|XP_011070904.1|  PREDICTED: cytochrome P450 CYP749A22-like          526   7e-177   
ref|XP_010091620.1|  Cytochrome P450 734A1                              524   1e-176   
gb|KHG21314.1|  Secologanin synthase                                    525   2e-176   
ref|XP_008352941.1|  PREDICTED: cytochrome P450 CYP749A22-like          525   3e-176   
ref|XP_008339765.1|  PREDICTED: cytochrome P450 CYP749A22-like          525   3e-176   
ref|XP_002512040.1|  cytochrome P450, putative                          524   4e-176   Ricinus communis
gb|KHG16899.1|  Secologanin synthase                                    524   5e-176   
gb|KHG14937.1|  Cytochrome P450 protein                                 523   6e-176   
gb|KCW86459.1|  hypothetical protein EUGRSUZ_B03127                     523   1e-175   
ref|XP_010040838.1|  PREDICTED: cytochrome P450 CYP749A22-like          525   2e-175   
gb|KHG03731.1|  Secologanin synthase                                    520   2e-174   
ref|XP_009356544.1|  PREDICTED: uncharacterized protein LOC103947365    540   2e-174   
gb|KHG08051.1|  Cytochrome P450 protein                                 519   2e-174   
ref|XP_010052417.1|  PREDICTED: cytochrome P450 CYP749A22-like          518   7e-174   
gb|AJD25259.1|  cytochrome P450 CYP749A37                               517   2e-173   
ref|XP_002512039.1|  cytochrome P450, putative                          516   2e-173   Ricinus communis
ref|XP_004295657.1|  PREDICTED: cytochrome P450 734A1-like              516   3e-173   
gb|KHG20728.1|  hypothetical protein F383_28301                         533   3e-173   
gb|KHG14401.1|  Cytochrome P450 protein                                 523   3e-173   
ref|XP_004135429.1|  PREDICTED: cytochrome P450 734A1-like              517   4e-173   
gb|EYU22581.1|  hypothetical protein MIMGU_mgv1a004745mg                516   5e-173   
gb|KHG27367.1|  Cytochrome P450 protein                                 516   7e-173   
gb|KHG09429.1|  Cytochrome P450 protein                                 516   1e-172   
ref|XP_004170856.1|  PREDICTED: cytochrome P450 734A1-like              515   2e-172   
ref|XP_011101783.1|  PREDICTED: cytochrome P450 CYP749A22-like          512   1e-171   
ref|XP_006437868.1|  hypothetical protein CICLE_v10033709mg             511   1e-171   
gb|KHG17439.1|  Secologanin synthase                                    511   9e-171   
gb|AEM42984.1|  cytochrome P450                                         511   1e-170   
gb|KHG20842.1|  Secologanin synthase                                    510   1e-170   
ref|XP_004135431.1|  PREDICTED: cytochrome P450 734A1-like              509   3e-170   
ref|XP_002512042.1|  cytochrome P450, putative                          506   4e-170   Ricinus communis
gb|KHG08441.1|  Cytochrome P450 protein                                 508   4e-170   
gb|KHG26927.1|  Cytochrome P450 protein                                 507   8e-170   
gb|KHG24669.1|  Secologanin synthase                                    508   9e-170   
ref|XP_008446465.1|  PREDICTED: cytochrome P450 CYP749A22-like          507   1e-169   
gb|KCW76385.1|  hypothetical protein EUGRSUZ_D00767                     506   2e-169   
gb|KDO36840.1|  hypothetical protein CISIN_1g012962mg                   505   2e-169   
gb|KDP35171.1|  hypothetical protein JCGZ_10705                         506   2e-169   
ref|XP_007210003.1|  hypothetical protein PRUPE_ppa016601mg             506   2e-168   
ref|XP_010054392.1|  PREDICTED: cytochrome P450 CYP749A22-like          502   4e-168   
gb|KCW86465.1|  hypothetical protein EUGRSUZ_B03133                     502   2e-167   
emb|CDP12576.1|  unnamed protein product                                501   6e-167   
ref|XP_002316009.1|  hypothetical protein POPTR_0010s14940g             500   4e-166   Populus trichocarpa [western balsam poplar]
ref|XP_008446467.1|  PREDICTED: cytochrome P450 CYP749A22-like          497   2e-165   
gb|KCW44611.1|  hypothetical protein EUGRSUZ_L01872                     494   7e-165   
ref|XP_007224911.1|  hypothetical protein PRUPE_ppa021901mg             493   9e-165   
gb|KDP35170.1|  hypothetical protein JCGZ_10704                         495   2e-164   
ref|XP_006348799.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      491   2e-164   
gb|KHG20729.1|  hypothetical protein F383_28301                         508   3e-164   
gb|KCW85143.1|  hypothetical protein EUGRSUZ_B01987                     493   4e-164   
gb|KHG16163.1|  Cytochrome P450 protein                                 492   5e-164   
gb|KDP35176.1|  hypothetical protein JCGZ_10710                         489   2e-163   
gb|KCW85137.1|  hypothetical protein EUGRSUZ_B01976                     490   4e-163   
gb|KHG14912.1|  Cytochrome P450 protein                                 490   6e-163   
gb|KHG26580.1|  Cytochrome P450 protein                                 488   3e-162   
gb|AAZ39644.1|  cytochrome P450 monooxygenase                           484   2e-160   Petunia x hybrida [garden petunia]
gb|KDP41345.1|  hypothetical protein JCGZ_15752                         477   7e-159   
ref|XP_011015642.1|  PREDICTED: cytochrome P450 CYP749A22-like          475   3e-158   
ref|XP_004173451.1|  PREDICTED: cytochrome P450 734A1-like              474   3e-157   
gb|KHG08575.1|  Cytochrome P450 protein                                 472   2e-156   
ref|XP_008243893.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    465   8e-155   
gb|KDO70290.1|  hypothetical protein CISIN_1g009043mg                   466   2e-154   
gb|KHG30791.1|  Cytochrome P450 protein                                 464   3e-153   
gb|KDP41344.1|  hypothetical protein JCGZ_15751                         460   4e-152   
ref|XP_006437869.1|  hypothetical protein CICLE_v10033485mg             459   7e-152   
ref|XP_010046246.1|  PREDICTED: cytochrome P450 CYP749A22-like          456   3e-150   
ref|XP_010041134.1|  PREDICTED: cytochrome P450 CYP749A22-like          448   1e-147   
gb|KCW44686.1|  hypothetical protein EUGRSUZ_L01780                     441   5e-145   
gb|KHG29404.1|  Cytochrome P450 protein                                 441   1e-144   
gb|KDP41343.1|  hypothetical protein JCGZ_15750                         436   9e-143   
ref|XP_010041049.1|  PREDICTED: cytochrome P450 734A1-like              445   2e-141   
ref|XP_010091619.1|  Cytochrome P450 734A1                              430   1e-139   
gb|KCW44878.1|  hypothetical protein EUGRSUZ_L01541                     426   1e-139   
ref|XP_010046249.1|  PREDICTED: cytochrome P450 CYP749A22-like          430   2e-139   
gb|ABK25130.1|  unknown                                                 430   2e-139   Picea sitchensis
ref|XP_008339617.1|  PREDICTED: cytochrome P450 CYP749A22-like          422   5e-138   
ref|XP_010046255.1|  PREDICTED: cytochrome P450 CYP749A22-like          409   1e-132   
ref|XP_008358468.1|  PREDICTED: cytochrome P450 CYP749A22-like          405   7e-132   
gb|KCW85138.1|  hypothetical protein EUGRSUZ_B01978                     404   8e-131   
gb|KCW82723.1|  hypothetical protein EUGRSUZ_C04098                     397   1e-128   
ref|XP_009784592.1|  PREDICTED: cytochrome P450 CYP749A22-like          392   2e-128   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               399   2e-127   
ref|XP_004309425.1|  PREDICTED: secologanin synthase-like               389   5e-126   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    394   2e-125   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    394   3e-125   
ref|XP_011013342.1|  PREDICTED: cytochrome P450 734A1-like              393   4e-125   
ref|XP_010046256.1|  PREDICTED: cytochrome P450 CYP749A22-like          387   2e-124   
ref|XP_011012397.1|  PREDICTED: cytochrome P450 734A1-like              391   2e-124   
gb|KCW73209.1|  hypothetical protein EUGRSUZ_E016722                    385   5e-124   
ref|XP_004508536.1|  PREDICTED: cytochrome P450 734A1-like              390   5e-124   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          390   8e-124   
ref|XP_003569398.1|  PREDICTED: cytochrome P450 72A15-like              389   2e-123   
gb|KCW44245.1|  hypothetical protein EUGRSUZ_L02323                     382   2e-123   
ref|XP_010058553.1|  PREDICTED: cytochrome P450 CYP749A22-like          386   2e-123   
ref|XP_002324347.2|  hypothetical protein POPTR_0018s06550g             389   2e-123   Populus trichocarpa [western balsam poplar]
dbj|BAF98466.1|  cytochrome P450                                        388   3e-123   Coptis japonica var. dissecta
ref|XP_006644394.1|  PREDICTED: secologanin synthase-like               388   5e-123   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          388   5e-123   
gb|KHN27404.1|  Cytochrome P450 734A1                                   387   7e-123   
ref|XP_003524531.1|  PREDICTED: cytochrome P450 734A1-like              387   8e-123   
gb|KHG16086.1|  Secologanin synthase                                    380   1e-122   
ref|XP_006830577.1|  hypothetical protein AMTR_s00117p00134960          386   1e-122   
emb|CDP07542.1|  unnamed protein product                                386   2e-122   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     385   3e-122   
gb|ABR16379.1|  unknown                                                 386   4e-122   Picea sitchensis
dbj|BAF56240.1|  cytochrome P450 enzyme                                 385   4e-122   Pisum sativum [garden pea]
ref|XP_002524439.1|  cytochrome P450, putative                          385   5e-122   Ricinus communis
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          385   5e-122   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              385   6e-122   
gb|KHG09430.1|  Secologanin synthase                                    379   7e-122   
gb|ABR16167.1|  unknown                                                 385   9e-122   Picea sitchensis
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        385   1e-121   Zea mays [maize]
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             384   1e-121   
dbj|BAN19916.1|  cytochrome P450                                        384   1e-121   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              384   1e-121   
ref|XP_009790069.1|  PREDICTED: cytochrome P450 734A1                   384   2e-121   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    384   2e-121   
ref|XP_006830579.1|  hypothetical protein AMTR_s00117p00135700          383   2e-121   
ref|XP_003549781.1|  PREDICTED: cytochrome P450 734A1-like              383   3e-121   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    383   3e-121   
gb|KHG16087.1|  Secologanin synthase                                    377   3e-121   
ref|XP_007043676.1|  Cytochrome P450, putative                          382   4e-121   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          383   4e-121   
gb|KHN14193.1|  Secologanin synthase                                    383   4e-121   
gb|KDP32358.1|  hypothetical protein JCGZ_13283                         383   5e-121   
ref|XP_007154955.1|  hypothetical protein PHAVU_003G161200g             383   5e-121   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              382   6e-121   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              382   8e-121   
gb|AAQ13549.1|AF123610_5  cytochrome P450                               382   9e-121   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    382   1e-120   
dbj|BAN19928.1|  cytochrome P450                                        382   1e-120   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          382   1e-120   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               382   1e-120   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     382   1e-120   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    382   1e-120   
ref|XP_002455092.1|  hypothetical protein SORBIDRAFT_03g004210          382   1e-120   
ref|XP_002285021.2|  PREDICTED: cytochrome P450 734A1                   381   2e-120   
gb|AAQ13551.1|AF123610_7  cytochrome P450                               381   3e-120   
ref|XP_003569494.2|  PREDICTED: cytochrome P450 734A6                   381   3e-120   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    380   4e-120   
emb|CDJ26325.1|  unnamed protein product                                381   4e-120   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             380   6e-120   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            380   6e-120   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    379   7e-120   
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          380   8e-120   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               379   9e-120   
emb|CBI28155.3|  unnamed protein product                                380   1e-119   
ref|XP_002879001.1|  hypothetical protein ARALYDRAFT_901457             379   1e-119   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              379   1e-119   
ref|XP_010098987.1|  Cytochrome P450 734A1                              379   2e-119   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          379   2e-119   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             379   2e-119   
gb|EAY75042.1|  hypothetical protein OsI_02938                          379   2e-119   
dbj|BAJ99602.1|  predicted protein                                      379   2e-119   
ref|XP_009417780.1|  PREDICTED: cytochrome P450 734A6-like              378   2e-119   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          378   3e-119   
dbj|BAB87118.1|  cytochrome P450                                        378   3e-119   
ref|XP_004968389.1|  PREDICTED: cytochrome P450 734A6-like isofor...    378   3e-119   
ref|XP_004969234.1|  PREDICTED: secologanin synthase-like               378   3e-119   
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               378   3e-119   
ref|NP_180239.1|  cytochrome P450 734A1                                 378   4e-119   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          378   5e-119   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    377   1e-118   
ref|XP_009588274.1|  PREDICTED: cytochrome P450 734A1-like              376   1e-118   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              376   1e-118   
ref|NP_001059471.1|  Os07g0418500                                       377   1e-118   
ref|XP_010510871.1|  PREDICTED: cytochrome P450 734A1                   376   1e-118   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              376   1e-118   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             376   1e-118   
ref|XP_008675320.1|  PREDICTED: cytochrome P450 72A13-like              377   2e-118   
gb|AAQ13548.1|AF123610_4  cytochrome P450                               376   2e-118   
ref|XP_002463247.1|  hypothetical protein SORBIDRAFT_02g040500          375   2e-118   
ref|XP_010541892.1|  PREDICTED: cytochrome P450 734A1-like              375   2e-118   
gb|KHN47456.1|  Secologanin synthase                                    376   3e-118   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       375   3e-118   
ref|NP_001043635.1|  Os01g0627900                                       375   3e-118   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      376   3e-118   
ref|XP_010254323.1|  PREDICTED: cytochrome P450 734A1-like              376   4e-118   
ref|XP_009405064.1|  PREDICTED: cytochrome P450 734A6-like              376   4e-118   
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          375   4e-118   
ref|XP_010417817.1|  PREDICTED: cytochrome P450 734A1-like              374   6e-118   
ref|XP_002461089.1|  hypothetical protein SORBIDRAFT_02g040510          374   6e-118   
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          374   7e-118   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               374   7e-118   
ref|XP_010254918.1|  PREDICTED: cytochrome P450 734A1                   374   7e-118   
ref|XP_009409325.1|  PREDICTED: cytochrome P450 734A6-like              375   7e-118   
ref|XP_010098361.1|  Secologanin synthase                               374   8e-118   
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               375   8e-118   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    374   9e-118   
ref|XP_009784939.1|  PREDICTED: cytochrome P450 734A1-like              374   1e-117   
gb|EMT23021.1|  Secologanin synthase                                    374   1e-117   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              374   1e-117   
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    374   1e-117   
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          374   1e-117   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    374   1e-117   
gb|ACG45585.1|  cytochrome P450 CYP734A8                                373   2e-117   
ref|XP_006397283.1|  hypothetical protein EUTSA_v10028574mg             374   2e-117   
ref|XP_003562608.1|  PREDICTED: cytochrome P450 734A6-like              373   2e-117   
ref|XP_010473056.1|  PREDICTED: cytochrome P450 734A1-like              373   2e-117   
gb|KHG02010.1|  Cytochrome P450 protein                                 373   2e-117   
ref|XP_002281661.1|  PREDICTED: cytochrome P450 734A1                   372   3e-117   
gb|KFK33156.1|  hypothetical protein AALP_AA6G337900                    373   3e-117   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    373   3e-117   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               373   3e-117   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    372   4e-117   
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      373   4e-117   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              372   4e-117   
ref|XP_010046258.1|  PREDICTED: cytochrome P450 CYP749A22-like          367   4e-117   
ref|XP_010909557.1|  PREDICTED: cytochrome P450 734A6-like              372   5e-117   
ref|XP_006293376.1|  hypothetical protein CARUB_v10022970mg             372   5e-117   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          372   5e-117   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               372   5e-117   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          372   6e-117   
ref|XP_008673122.1|  PREDICTED: putative cytochrome P450 superfam...    372   6e-117   
ref|XP_002281622.1|  PREDICTED: cytochrome P450 734A1                   371   8e-117   
ref|XP_008776863.1|  PREDICTED: cytochrome P450 72A15-like isofor...    372   9e-117   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              371   9e-117   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              372   1e-116   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          372   1e-116   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          372   1e-116   
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               371   1e-116   
ref|XP_006451003.1|  hypothetical protein CICLE_v10007914mg             372   1e-116   
gb|KHN36820.1|  Secologanin synthase                                    370   1e-116   
gb|EAZ04830.1|  hypothetical protein OsI_27008                          371   2e-116   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              371   2e-116   
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    371   2e-116   
ref|XP_010232048.1|  PREDICTED: cytochrome P450 72A15-like              371   2e-116   
ref|XP_003609250.1|  Cytochrome P450                                    371   2e-116   
ref|XP_010926871.1|  PREDICTED: cytochrome P450 72A15-like isofor...    370   2e-116   
emb|CDP19609.1|  unnamed protein product                                370   3e-116   
gb|EAY75040.1|  hypothetical protein OsI_02936                          370   3e-116   
ref|NP_001060386.1|  Os07g0635500                                       370   4e-116   
ref|XP_010241317.1|  PREDICTED: cytochrome P450 CYP72A219-like          370   4e-116   
ref|XP_006658008.1|  PREDICTED: cytochrome P450 734A6-like              370   4e-116   
gb|KHG14489.1|  Secologanin synthase                                    370   5e-116   
ref|XP_009388531.1|  PREDICTED: cytochrome P450 734A6-like              371   5e-116   
ref|NP_001168846.1|  uncharacterized protein LOC100382651               370   6e-116   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    372   6e-116   
ref|XP_006841892.1|  hypothetical protein AMTR_s00042p00080860          369   8e-116   
emb|CAN60080.1|  hypothetical protein VITISV_019082                     369   8e-116   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               369   8e-116   
ref|XP_002455991.1|  hypothetical protein SORBIDRAFT_03g028590          369   9e-116   
gb|EMT11454.1|  Secologanin synthase                                    369   9e-116   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             369   1e-115   
sp|B9X287.1|C7346_ORYSJ  RecName: Full=Cytochrome P450 734A6            370   1e-115   
ref|XP_010533180.1|  PREDICTED: cytochrome P450 734A1                   369   1e-115   
emb|CDM83378.1|  unnamed protein product                                369   1e-115   
ref|XP_006473472.1|  PREDICTED: cytochrome P450 734A1-like              368   1e-115   
emb|CDP15982.1|  unnamed protein product                                369   1e-115   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             369   1e-115   
ref|XP_007013339.1|  Cytochrome P450                                    369   2e-115   
ref|XP_010943694.1|  PREDICTED: cytochrome P450 734A6-like              368   2e-115   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          369   2e-115   
ref|XP_006434955.1|  hypothetical protein CICLE_v10000905mg             368   2e-115   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              369   2e-115   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          368   2e-115   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          368   2e-115   
ref|XP_008361238.1|  PREDICTED: cytochrome P450 734A1-like              368   3e-115   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    368   3e-115   
gb|EAY74842.1|  hypothetical protein OsI_02734                          368   3e-115   
gb|KHG18227.1|  Secologanin synthase                                    368   3e-115   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    367   3e-115   
ref|XP_003562610.1|  PREDICTED: cytochrome P450 734A6-like              367   4e-115   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    367   4e-115   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              367   4e-115   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    367   5e-115   
ref|XP_004958442.1|  PREDICTED: cytochrome P450 734A6-like              367   5e-115   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              367   5e-115   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          367   6e-115   
gb|KHN44057.1|  Secologanin synthase                                    367   6e-115   
ref|XP_004951512.1|  PREDICTED: cytochrome P450 734A2-like              368   6e-115   
gb|ABC69417.1|  CYP72A54                                                366   8e-115   
ref|XP_002455994.1|  hypothetical protein SORBIDRAFT_03g028650          367   8e-115   
emb|CDP15975.1|  unnamed protein product                                366   8e-115   
gb|ACG29333.1|  cytochrome P450 CYP734A7                                368   9e-115   
ref|XP_004958443.1|  PREDICTED: cytochrome P450 734A6-like              366   9e-115   
gb|KHN44056.1|  Secologanin synthase                                    366   1e-114   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          366   1e-114   
gb|KGN51994.1|  hypothetical protein Csa_5G606840                       361   1e-114   
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          367   1e-114   
ref|XP_002455997.1|  hypothetical protein SORBIDRAFT_03g028680          367   1e-114   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          366   1e-114   
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          366   1e-114   
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      366   1e-114   
ref|XP_009383021.1|  PREDICTED: cytochrome P450 734A6-like              365   2e-114   
ref|NP_001140686.1|  putative cytochrome P450 superfamily protein       366   2e-114   
ref|XP_009404407.1|  PREDICTED: cytochrome P450 CYP72A219-like          365   2e-114   
ref|XP_009103555.1|  PREDICTED: cytochrome P450 734A1                   365   2e-114   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          365   2e-114   
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          365   2e-114   
ref|XP_010249983.1|  PREDICTED: cytochrome P450 734A1-like              366   2e-114   
ref|XP_010242111.1|  PREDICTED: cytochrome P450 CYP72A219-like          365   2e-114   
gb|KEH38475.1|  cytochrome P450 family 72 protein                       365   2e-114   
gb|ABC69393.1|  CYP72A55v2                                              365   2e-114   
dbj|BAJ95191.1|  predicted protein                                      365   3e-114   
emb|CDY04463.1|  BnaA07g12890D                                          365   3e-114   
ref|XP_002455998.1|  hypothetical protein SORBIDRAFT_03g028690          366   3e-114   
dbj|BAJ94639.1|  predicted protein                                      365   3e-114   
ref|XP_010666256.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    365   3e-114   
gb|KHG26069.1|  hypothetical protein F383_05868                         365   3e-114   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               365   3e-114   
ref|XP_007203674.1|  hypothetical protein PRUPE_ppa026777mg             365   3e-114   
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               365   3e-114   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          365   4e-114   
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               365   4e-114   
emb|CDP11335.1|  unnamed protein product                                365   4e-114   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          365   4e-114   
dbj|BAJ89369.1|  predicted protein                                      365   4e-114   
gb|AAT68297.1|  cytochrome P450 CYP709C1                                364   4e-114   
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               365   4e-114   
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          364   5e-114   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          364   5e-114   
ref|XP_008242719.1|  PREDICTED: cytochrome P450 734A1                   365   5e-114   
ref|NP_001146246.1|  putative cytochrome P450 superfamily protein       365   6e-114   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               365   6e-114   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          364   7e-114   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              364   7e-114   
ref|NP_001043634.1|  Os01g0627800                                       364   7e-114   
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               364   8e-114   
emb|CDP15976.1|  unnamed protein product                                364   8e-114   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          364   8e-114   
gb|AAZ07706.1|  cytochrome P450 monooxygenase                           363   9e-114   
ref|XP_011082965.1|  PREDICTED: cytochrome P450 CYP72A219-like          363   1e-113   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          363   1e-113   
ref|XP_002283107.1|  PREDICTED: cytochrome P450 734A1                   363   1e-113   
ref|XP_003569207.1|  PREDICTED: cytochrome P450 72A15-like              363   1e-113   
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               363   1e-113   
ref|XP_003569401.1|  PREDICTED: cytochrome P450 72A13-like              363   1e-113   
ref|XP_004139422.1|  PREDICTED: cytochrome P450 734A1-like              363   1e-113   
ref|XP_008670605.1|  PREDICTED: cytochrome P450 734A1-like              363   1e-113   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    363   1e-113   
ref|XP_004169401.1|  PREDICTED: cytochrome P450 734A1-like              363   2e-113   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          363   2e-113   
ref|NP_001043498.1|  Os01g0602400                                       363   2e-113   
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    363   2e-113   
ref|XP_003569402.1|  PREDICTED: cytochrome P450 72A13-like              363   2e-113   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    363   2e-113   
gb|AAK38093.1|  putative cytochrome P450                                363   2e-113   
ref|XP_008385883.1|  PREDICTED: cytochrome P450 734A1                   363   2e-113   
gb|ABG85296.1|  P450 monooxygenase                                      363   2e-113   
ref|NP_001153094.1|  cytochrome P450 CYP734A7                           364   2e-113   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    363   2e-113   
gb|EMT26606.1|  Secologanin synthase                                    363   2e-113   
ref|XP_008450912.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    362   3e-113   
gb|AAK38094.1|  putative cytochrome P450                                363   3e-113   
ref|XP_010233466.1|  PREDICTED: cytochrome P450 72A15-like              363   3e-113   
ref|XP_011072254.1|  PREDICTED: cytochrome P450 734A1                   362   3e-113   
ref|XP_002461088.1|  hypothetical protein SORBIDRAFT_02g040490          362   3e-113   
gb|EMT31417.1|  Secologanin synthase                                    362   3e-113   



>ref|XP_009607163.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=507

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/506 (69%), Positives = 425/506 (84%), Gaps = 9/506 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FIS L++L   W+ +KLWW+P+ +Q LM SQGI+GP Y+FL+GNTKEI E ++   SK M
Sbjct  11    FISLLIILF--WIFKKLWWSPIRVQFLMRSQGIQGPPYKFLYGNTKEIVEMKKDSISKSM  68

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
              D LSHD+FPRILPH++SWK LYG +FLYW G QPELVVTE EL+KEILS+R  ++PKI+
Sbjct  69    -DHLSHDIFPRILPHVFSWKNLYGESFLYWYGLQPELVVTEPELLKEILSNRNNNFPKID  127

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L+G+S++LLGDG+ SSKGEKW +MRKLAN+VFHGESL+ M+P MI S ETM+E W+ +E 
Sbjct  128   LEGYSKKLLGDGVSSSKGEKWTKMRKLANHVFHGESLKSMVPMMIMSCETMLEKWKIYEE  187

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFR+LTSE+ISRTAFGS+YLEGKNIF+ML+KL  L SK+ L ++FPG+S+I K
Sbjct  188   KEIEVFEEFRILTSEIISRTAFGSSYLEGKNIFQMLMKLALLVSKDALKIKFPGISQIWK  247

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + DE+ESEKLE+G+R+ I +IIKKRE+ K GEE      SDFL KLLEA +QE  D +I 
Sbjct  248   SRDEIESEKLEQGIRDSITRIIKKREEEKIGEEHNFG--SDFLGKLLEA-YQE--DYRIS  302

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             +E +VDECKT Y AGHETTTSLLGW  LLLAT+++WQE+ARKEV+E FGQ+ PT  G++R
Sbjct  303   VEEIVDECKTIYLAGHETTTSLLGWTILLLATNKNWQEKARKEVLESFGQKVPTADGLSR  362

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIMNMI+EE+LRLYPPVP+ KRKV KK V LG +TLPP + LYISPLA+QHDP+IWG+D
Sbjct  363   LKIMNMIVEESLRLYPPVPFTKRKVNKK-VQLGKLTLPPQMQLYISPLAVQHDPKIWGED  421

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERFAEGVVKATNN+P+AFLPFGYGPRTCLGLNFAM EAK+ LSMILQRY   +S
Sbjct  422   VHIFKPERFAEGVVKATNNNPVAFLPFGYGPRTCLGLNFAMIEAKVTLSMILQRYMFTVS  481

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              SYVHSPVQLFMLRP+ GV+VILH+I
Sbjct  482   PSYVHSPVQLFMLRPEHGVKVILHKI  507



>ref|XP_006348652.1| PREDICTED: cytochrome P450 734A1-like [Solanum tuberosum]
Length=505

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/506 (66%), Positives = 410/506 (81%), Gaps = 10/506 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FIS L++L    + +KL W P H+Q +M SQGI+GPSY+FLHGN KEI E ++   +K M
Sbjct  10    FISLLVILVR--IVKKLLWTPFHVQFMMRSQGIQGPSYKFLHGNFKEIFEIKKESINKAM  67

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
              D LSHD+FPR+LPHI+SWK+LYG NFLYW G QPELVVTE EL+KEILS+R  +YPK++
Sbjct  68    -DHLSHDIFPRVLPHIFSWKKLYGPNFLYWYGLQPELVVTEPELLKEILSNRNNNYPKMD  126

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L+GF ++L GDG+ SSKGEKW +MRKLAN+VFHGESL+ M+P MI S ETM+E W+ +E 
Sbjct  127   LEGFPKKLFGDGVASSKGEKWVKMRKLANHVFHGESLKSMIPMMIMSCETMLERWKIYED  186

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFRLLTSE+ISRTAFGS+Y EGKNIF+ML+KL +L S N   VRFP +S+I K
Sbjct  187   KEIEVFEEFRLLTSEIISRTAFGSSYSEGKNIFQMLMKLASLVSGNANKVRFPRISQIWK  246

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + DE+ESEKLE+G+ + I +IIKKRE+ K GE+      SDFL KLLEA      DN+I 
Sbjct  247   SYDEIESEKLEQGIHDCITRIIKKREEEKIGEDHNFG--SDFLGKLLEAYQ----DNRIS  300

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             I+ ++DECKTFYFAGH+TTT LLGW   LLAT++ WQERARKEV+E FG + P   G++R
Sbjct  301   IDDIIDECKTFYFAGHKTTTILLGWTIFLLATNKKWQERARKEVVESFGHKVPNADGLSR  360

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIMNMIL+E+LRLYPPVP+IKRKV+KK V LG +TLPP +H YIS LA+QHD +IWG+D
Sbjct  361   LKIMNMILDESLRLYPPVPFIKRKVDKK-VELGKLTLPPEMHFYISALAVQHDCKIWGED  419

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKP+RFAEGVVKA+NN+P+A+LPFGYGPRTCLGLNFAM EAKI LSMILQRY   +S
Sbjct  420   VHVFKPDRFAEGVVKASNNNPVAYLPFGYGPRTCLGLNFAMTEAKITLSMILQRYMFTIS  479

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP  LFMLRP+ GV+VILH+I
Sbjct  480   PTYVHSPADLFMLRPQHGVKVILHKI  505



>ref|XP_011070909.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=510

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/506 (64%), Positives = 407/506 (80%), Gaps = 11/506 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FI  LL L    L +K+W  P+ +Q LM SQGI GPSYRFLHGNTKEI   +R    K M
Sbjct  16    FIYILLTLIG--LIKKVWLNPIRVQHLMRSQGINGPSYRFLHGNTKEIISMKRETMGKAM  73

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
              D++SHD+FPR+LPH++SW +LYGANFL W GPQ +LVVTEAELVKEIL+++  +YPKI+
Sbjct  74    -DEISHDIFPRVLPHVHSWAKLYGANFLNWYGPQAQLVVTEAELVKEILNNKDENYPKID  132

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L+G++++LLGDG+ SSKG+KWARMRKLAN+VFH ESL+ M+PAMI S ETM+E W+E+E 
Sbjct  133   LEGYAKKLLGDGLSSSKGQKWARMRKLANSVFHAESLKNMIPAMITSVETMLEKWKEYED  192

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFR+LTSE+ISRTA GS+Y+EGKNIF+ML+KL  + S+N   ++FPG+S  ++
Sbjct  193   KEIEVFEEFRILTSEIISRTALGSSYMEGKNIFDMLMKLTLIVSRNAHKIKFPGISLFLR  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + DE+ESEKL +G+R+ ++QII KRE   TGE    + R+DFL KLLEAN   +   +I 
Sbjct  253   SKDEIESEKLGQGIRDCVVQIITKRE---TGE----TFRTDFLGKLLEANQDTDERKRIS  305

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             +E + DECKTFYFAGHET+TS L W  LLL+ H++WQ++AR EV+E+FGQ  P P GIAR
Sbjct  306   VEDITDECKTFYFAGHETSTSSLAWTILLLSVHQEWQDKARNEVIELFGQSKPNPDGIAR  365

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKI+ MI+EE+LRLY PVP IKRKVEK+ V LG +TLPP   LYIS LAL HDP IWG+D
Sbjct  366   LKILTMIIEESLRLYCPVPAIKRKVEKE-VKLGKLTLPPQTELYISQLALHHDPNIWGED  424

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH F+PERF +G+VKATNN+P+AFLPFG+GPRTC+GLNFAM EAKI LSMILQRY L LS
Sbjct  425   VHLFRPERFEQGIVKATNNNPVAFLPFGFGPRTCVGLNFAMTEAKIALSMILQRYRLILS  484

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +Y+HSPVQ+FM+RP+ GVQVIL +I
Sbjct  485   PTYIHSPVQVFMVRPQHGVQVILQKI  510



>ref|XP_010320842.1| PREDICTED: cytochrome P450 CYP749A22 [Solanum lycopersicum]
Length=501

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/504 (65%), Positives = 399/504 (79%), Gaps = 12/504 (2%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
             SSL +L    + +KL W P H+Q +M  QGI+GP Y+FL+GN KEI E ++  T+K M D
Sbjct  10    SSLFILVG--IVKKLLWTPFHVQFMMRYQGIQGPCYKFLYGNFKEIDEMKKESTNKAM-D  66

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              LSHD+FPRILPHI+SWK+LYG NFLYW G QPELVVTE EL+KEILS+R  +YPK++L+
Sbjct  67    HLSHDIFPRILPHIFSWKKLYGPNFLYWHGLQPELVVTEPELLKEILSNRNNNYPKMDLE  126

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
             GF ++L GDG+ SSKGEKW +MRKLAN+VFHG SLR M+P MI S ETM+E W+ +E K+
Sbjct  127   GFPKKLFGDGVASSKGEKWVKMRKLANHVFHGVSLRSMIPMMIMSCETMLERWKNYEDKK  186

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE FEEFRLLTSE+ISRTAFGS+Y EGKNIF+ML+KL +L S N   VRFPG+S+I K+ 
Sbjct  187   IEVFEEFRLLTSEIISRTAFGSSYSEGKNIFQMLMKLASLVSGNANKVRFPGISQIWKSC  246

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             DE+ESEKLE+G+ +     I +  + +  EE+  +  SDFL KLLEA      DN+I IE
Sbjct  247   DEIESEKLEKGIHD----CITRIIKKREEEEEDHNFGSDFLGKLLEAYQ----DNRISIE  298

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFYFAGHETTT LLGW   LLAT++ WQE+ARKEV+E FG   P   G++RLK
Sbjct  299   DIVDECKTFYFAGHETTTILLGWTMFLLATNKKWQEKARKEVVESFGHNVPNADGLSRLK  358

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
              MNMIL+E+LRLYPPVP+IKRKV+ K V LG +TLP  +H YISPLAL HD +IWG+DVH
Sbjct  359   TMNMILDESLRLYPPVPFIKRKVDNK-VELGKLTLPGEMHFYISPLALHHDRKIWGEDVH  417

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              F+P+RFAEGVVKATNN+P+A+LPFGYGPRTCLGLNFAM EAKI LSMILQRY   +S +
Sbjct  418   VFRPDRFAEGVVKATNNNPVAYLPFGYGPRTCLGLNFAMTEAKIALSMILQRYMFTMSPT  477

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVHSP QLFMLRP+ GV+VILH+I
Sbjct  478   YVHSPAQLFMLRPQHGVEVILHKI  501



>gb|EYU22575.1| hypothetical protein MIMGU_mgv1a004725mg [Erythranthe guttata]
Length=513

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/503 (62%), Positives = 397/503 (79%), Gaps = 11/503 (2%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLS  351
             L+L       K+W  P+ IQK M  QGI+GP Y+FLHGNTKEI + R+    K M D +S
Sbjct  20    LLLTLVKFLNKVWLNPIRIQKTMRCQGIEGPPYKFLHGNTKEIIDMRKETMGKSMHD-IS  78

Query  352   HDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFS  531
             H++FPRILPH++SW  LYG NFL W GPQ +LVVTEAELVKEIL+++  +YPKI L+G +
Sbjct  79    HNIFPRILPHVHSWAILYGENFLNWYGPQAQLVVTEAELVKEILNNKDENYPKINLEGHA  138

Query  532   RRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEA  711
             ++LLGDG+ SSKGEKWA MRKLAN VFH +SL+ M+P MI S ETM+E W+E+EGKEIE 
Sbjct  139   KKLLGDGLSSSKGEKWANMRKLANRVFHADSLKNMIPEMITSVETMLEKWKEYEGKEIEV  198

Query  712   FEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDEL  891
             FEEFRLLTSE+IS+TAFGS+YLEGK+IF+ML+KL  + S+N   ++ P +SR + + D+ 
Sbjct  199   FEEFRLLTSEIISKTAFGSSYLEGKSIFDMLMKLAFIVSRNAHTIKLPFISRFLPSKDDY  258

Query  892   ESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLE-ANHQENGDNQICIEAM  1068
             ESEKLE+G+R+ I++II KRE  +T        R+DFL KLLE  N+ +N + ++ +E +
Sbjct  259   ESEKLEQGIRDCIVRIIAKRETEETS-------RNDFLGKLLETNNNNQNKNTKMSVEDI  311

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPYGIARLKI  1245
             VDECKTFYFAGHETTTSLL W  LLLA +++WQ++AR E +E FGQ  NP P  I+RLKI
Sbjct  312   VDECKTFYFAGHETTTSLLAWTVLLLAINQEWQDKARNETIESFGQTTNPNPDNISRLKI  371

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             MNMI+EE+LRLYPPVP IKRKV+KK V LG ITLPP + LYISPLALQHDP IWG+DVH 
Sbjct  372   MNMIIEESLRLYPPVPAIKRKVDKK-VTLGKITLPPQMELYISPLALQHDPNIWGEDVHF  430

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             F+PERF +G+ KA+N++ +AFLPFG+GPRTC+GL+FA+ EAKI LSMIL+RY L +S  Y
Sbjct  431   FRPERFGQGIAKASNDNTVAFLPFGFGPRTCVGLSFAITEAKIALSMILRRYRLIVSPGY  490

Query  1606  VHSPVQLFMLRPKDGVQVILHRI  1674
             +HSPVQ+FM+RP+ G+QVIL +I
Sbjct  491   IHSPVQVFMIRPQHGIQVILEKI  513



>emb|CDP00469.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/446 (67%), Positives = 360/446 (81%), Gaps = 6/446 (1%)
 Frame = +1

Query  340   DDLSHDVFPRILPHIYSWKRLYG-ANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             +D+SHD+FPRILP IYSW  +YG A +L W GPQP+LVVTE ELVKEIL+++ GDYPKI+
Sbjct  2     EDMSHDIFPRILPDIYSWVNIYGRATYLNWYGPQPQLVVTEPELVKEILNNKNGDYPKID  61

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L+G++++LLGDG+ +SKGEKWARMRKLAN VFH  SL+ MLPAMI S E M+E W+E+EG
Sbjct  62    LEGYAKKLLGDGLSASKGEKWARMRKLANQVFHAGSLKDMLPAMITSTEIMLERWKENEG  121

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KE+E FEEFRLLTSEVIS+TAFGS+YLEGKNIFEML+KL  + S+N  N+RFPG+S + K
Sbjct  122   KEVEVFEEFRLLTSEVISKTAFGSSYLEGKNIFEMLMKLTLIVSRNARNIRFPGISHLFK  181

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             ++DE+ESEKLE+G++N I  IIKKRE     E + S  + DFLEKLLEAN  E     I 
Sbjct  182   SSDEIESEKLEQGMKNCIEHIIKKRELENCKENESS--KGDFLEKLLEAN--EGSSKWIS  237

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ MVDECKT YFAG ETTTSLL W+ LLLA H++WQE AR+EV+E+FGQ  P    I R
Sbjct  238   VDDMVDECKTLYFAGQETTTSLLTWSILLLAVHKEWQETAREEVIEIFGQMKPNADAIPR  297

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK MNMILEE LRLYPPVP + RKV KK V LG +TLP +  L ISPLAL HDP+IWG+D
Sbjct  298   LKTMNMILEECLRLYPPVPALMRKVHKK-VKLGRLTLPAHTELLISPLALHHDPKIWGED  356

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERFA GV KATNN+P+AFLPFG+GPRTC+GLNFAM EAKI LSMILQ Y  +LS
Sbjct  357   VHHFKPERFAGGVSKATNNNPVAFLPFGFGPRTCVGLNFAMVEAKIALSMILQHYKFSLS  416

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSPVQ+FM+RP  GV++IL R+
Sbjct  417   RNYVHSPVQVFMVRPHHGVKIILSRV  442



>ref|XP_004297206.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=511

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/506 (58%), Positives = 374/506 (74%), Gaps = 7/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LL+LA   +  KLWW P  IQ LM+ QGI+GPSYRF+HGNT+EI+  R+   S P 
Sbjct  13    FVCVLLLLAFIKIFHKLWWTPTRIQNLMALQGIRGPSYRFVHGNTREINNMRKEAMSTP-  71

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSH++FP + PHI+SW + YG  +L W G + +LV  E EL KEIL+   G +PK E
Sbjct  72    -KSLSHNIFPEVHPHIHSWTKNYGKTYLQWHGAKAQLVTMEPELCKEILN---GAFPKTE  127

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
              + F ++LLGDG+  S+GEKW +MRKLAN+ FHGE+L+ M+PAMI SAETM+E W  H G
Sbjct  128   TKRFVKKLLGDGLTRSEGEKWVKMRKLANHAFHGENLKTMIPAMITSAETMLERWTNHNG  187

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFRL TSEVISRTAFGS+Y+EGK IFEMLIK+  L  KN  N+RFPG+S+I K
Sbjct  188   KEIEVFEEFRLFTSEVISRTAFGSSYIEGKQIFEMLIKMGFLTFKNAFNLRFPGISKIYK  247

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
              +DE+ES+KLE+G+R+ II+I+KKRE  K    Q+    SDFL  LL+A+H  N   +I 
Sbjct  248   TSDEIESDKLEKGIRDSIIEIVKKRED-KAMSGQEDYFGSDFLGLLLKAHHDSNEKQRIS  306

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ +VDECK FYFAG ET+TSLL W   LLA H DWQE AR EV+++FG++ P P G ++
Sbjct  307   MDDLVDECKAFYFAGQETSTSLLAWTVFLLALHTDWQEEARNEVLQLFGKQTPNPDGFSK  366

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M+MI+ E+LRLYPPV  ++R+VEK+ V LGN+ +P N+ L++S LAL H+P+ WG+D
Sbjct  367   LKTMSMIINESLRLYPPVLAMERRVEKE-VRLGNVIIPANVELHVSSLALHHEPQFWGQD  425

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             V  FKPERF+EG+VKAT N+ +AFLPFG GPRTC+G NFA  E KI LSMILQRYS  LS
Sbjct  426   VQLFKPERFSEGIVKATGNNIVAFLPFGMGPRTCVGFNFATIEVKIALSMILQRYSFTLS  485

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
               YVHSP     LRP+ GVQV+LH +
Sbjct  486   PGYVHSPFHFLTLRPQHGVQVLLHSL  511



>ref|XP_008243892.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=557

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/494 (57%), Positives = 367/494 (74%), Gaps = 4/494 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             + EKLWW PV +QKLM+ QGIKGPSYR +HGNTKEIS  ++   S+P    LSHD+FP++
Sbjct  68    MFEKLWWKPVRVQKLMALQGIKGPSYRLIHGNTKEISNMKKEAMSRP--KSLSHDIFPQV  125

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI  W +LYG N+L W G + +LV+TE E+ KEIL+++ G   K E  G+ ++LLGDG
Sbjct  126   QPHIQLWTKLYGKNYLQWHGSKAQLVITEPEICKEILNNKDGALQKTETLGYVKKLLGDG  185

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             +  S GEKW+++RKLAN+ FHGESL+ M+PAMI S ETM+E  + HEGKEIE ++EFR  
Sbjct  186   LTRSSGEKWSKLRKLANHAFHGESLKSMIPAMIASGETMLERLKNHEGKEIEVYDEFRFF  245

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSEVISRTAFGS+YLEGKNIFEML+KL  L  KN L +RFPG+S+I K  DE+ES +LE+
Sbjct  246   TSEVISRTAFGSSYLEGKNIFEMLMKLSFLTFKNALKLRFPGISKIFKTRDEIESAELEK  305

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G+R+ ++++IKKRE+   G E+     SDFL  LL+A+H  N   +I ++ +VDECKTFY
Sbjct  306   GIRDSVMEVIKKREKKAMGGEE-DGFGSDFLGLLLKAHHDTNEKQRISVDDLVDECKTFY  364

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             FAG ETT SLL W   LLA H DWQE ARKEV+++FG++NP P GI++LK M+MI+ E+L
Sbjct  365   FAGQETTNSLLAWTVFLLALHRDWQEEARKEVLQLFGKQNPHPEGISKLKTMSMIINESL  424

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV + +RK  ++ V LGN+ +P N+ L I  LA  HD + WG DVH FKPERF+EG
Sbjct  425   RLYPPVIFFERKAARE-VRLGNLIVPANVELQIPNLAFHHDAKFWGADVHLFKPERFSEG  483

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KAT ++ +AFLPFG GPRTC+G NFA  E KI LSMILQ YS  LS +YVHSP     
Sbjct  484   VAKATKDNMVAFLPFGMGPRTCVGFNFATTEVKIALSMILQHYSFTLSPAYVHSPFHFLT  543

Query  1633  LRPKDGVQVILHRI  1674
             +RP+ GV+V LH +
Sbjct  544   VRPQHGVRVTLHPV  557



>ref|XP_008243779.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/507 (57%), Positives = 373/507 (74%), Gaps = 5/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ IQKLM+ QGIKGPSYRF+HGNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMDRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   + PHI+SW + YG N+L W G Q +LV+TE EL K+IL+++   YPK E
Sbjct  73    -QILSHDILSVVQPHIHSWTKKYGKNYLQWHGSQAQLVITEPELCKQILNNKGSAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                  ++L+GDG + ++K EKWA++RKLA + FHGE L+ M+P MI SAETM+E W  +E
Sbjct  132   PPNLVKKLVGDGLVATTKAEKWAKLRKLATHAFHGEGLKSMIPEMIASAETMLERWTFYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +EEFRL TSEVISRTAFGS+Y+EG+NIFEML+KL  L +KNFL VR PG+S+  
Sbjct  192   GKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFEMLMKLGFLIAKNFLKVRVPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ES+KLE+G+   II++ KKRE+ KT   +  S  SDFL  LL+ANH+ N +  I
Sbjct  252   KTSDEIESDKLEKGIHASIIEMAKKREK-KTMAGEMDSFGSDFLGLLLKANHETNENQGI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ + DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG++ P   GI 
Sbjct  311   SVDELTDECKTFYFAGQETTNTLLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIG  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ E LRLYPPV  + RKVE++ V LG + +P N+ L +S +AL HDP+IWG+
Sbjct  371   KLKTMSMIINEALRLYPPVVSVIRKVERE-VRLGKLIVPGNLELIVSIVALHHDPQIWGQ  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNNH  AF+PFG GPRTC+GLNF   EAKI LSMILQRY+  L
Sbjct  430   DVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGLNFGTTEAKIALSMILQRYAFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  YVH P++   +RP+ GVQV+L  +
Sbjct  490   SPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>ref|XP_009357376.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/492 (59%), Positives = 368/492 (75%), Gaps = 6/492 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P+ IQ L++ QGIKGPSYRF+HGNTKEIS  +    S+P    LSHD+F ++ PH
Sbjct  29    KLWWTPIRIQNLVALQGIKGPSYRFVHGNTKEISSMQEEAMSRP--KSLSHDIFSQVQPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I+ W + YGANFL W G Q +L++TE EL KEIL+++   YPK E +G++RRLLGDG+  
Sbjct  87    IHLWTKTYGANFLQWYGAQAQLIITEPELCKEILTNKDKAYPKSETKGYARRLLGDGLVV  146

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             S GEKWA+MRKLAN  FHGE L+GM P MI SAETM+E W+EH+GKEI+ F+EFRL TSE
Sbjct  147   SDGEKWAKMRKLANYAFHGEILKGMAPTMIASAETMLENWKEHDGKEIDVFKEFRLYTSE  206

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAFGS+YLEGKNIFE L KL  L+ KN  N+RFP  SR +K+ DE+ESEKLE+ +R
Sbjct  207   VISRTAFGSSYLEGKNIFENLEKLAYLSFKNAFNLRFPAFSRFIKSKDEIESEKLEKSIR  266

Query  922   NGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + I+++I+KRE +   GEE   S   DFL  L++A+H  + + +  I+ +VDECKTFY  
Sbjct  267   DSIMEMIRKREDKAMVGEE--GSFGDDFLGVLIKAHHDADENQRTSIDEIVDECKTFYLG  324

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G ETT+S L W   LLA H DWQE ARKEV+++FG++NP   GIA+LKIMNMI  E+LRL
Sbjct  325   GQETTSSGLAWTVFLLAIHTDWQEEARKEVIQIFGKQNPNLDGIAKLKIMNMIFNESLRL  384

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             YPPV  ++RK+ ++ V LG   LP N+ + I  LALQH+P+IWGKDV  FKPERF+EGV 
Sbjct  385   YPPVVAMERKIGRE-VRLGKHVLPANVEITIPCLALQHEPQIWGKDVLLFKPERFSEGVA  443

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KAT N+  AFLP+G GPR+C+G NFA  E KI LSMILQR+S  LS +Y+HSP +L  +R
Sbjct  444   KATKNNIAAFLPWGLGPRSCVGSNFATMETKIALSMILQRFSFTLSPAYIHSPYRLLTVR  503

Query  1639  PKDGVQVILHRI  1674
             P+ GVQV+L  +
Sbjct  504   PQHGVQVMLRSL  515



>ref|XP_008243806.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/506 (57%), Positives = 367/506 (73%), Gaps = 5/506 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +   L LA   +  KLWW P  IQ+LM+ QGIKGP+YR +HGNTKEI   +     KP  
Sbjct  15    VCLFLFLALIKIFHKLWWKPRSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNEAMGKP--  72

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               LSHD+FPR+ PH +SW +LYG NFL W G +P+L++TE EL KEIL+D+   YPK + 
Sbjct  73    QGLSHDIFPRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRAYPKSKP  132

Query  520   QGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             + F ++LLGDG + ++  EKW ++RK+AN  FHGESL+ M PA I SAE M+E W+  +G
Sbjct  133   KSFVKQLLGDGLVTTTNTEKWGKLRKVANYAFHGESLKSMTPATIASAEIMLERWKNQDG  192

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFRLLTSEVISRTAFGS+YLEG+ IFEML+KL  L+ KNFL +R PG+S+  K
Sbjct  193   KEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNFLKLRIPGISKFYK  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
               DE+ESE LE+GV N I++I+KKRE+     E+     SDFL  LL+A+H  N +  I 
Sbjct  253   TCDEIESENLEKGVYNSIMEIVKKREKKAMAGEE-DGFGSDFLGLLLKAHHDANDNQSIS  311

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ +VDECKTFYF G ET++SLL W   LLA H DWQE ARKEV+E+FG++NP   GIAR
Sbjct  312   VDDLVDECKTFYFGGQETSSSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPNTDGIAR  371

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M MI+ ETLRLYPP+  ++R+ E++ V LGN+ +P  + L I  LA  H+P +WG+D
Sbjct  372   LKTMTMIINETLRLYPPIVVLEREAERE-VRLGNLIIPAAVELVIPCLAFHHEPGLWGQD  430

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERF+EGV KAT N+   FLPFG GPR C+GLNFA  E KIVLSMILQRYS  LS
Sbjct  431   VHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRYSFTLS  490

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP +L  +RP+ G+QV+LH +
Sbjct  491   PAYVHSPFRLLTVRPQHGLQVMLHSL  516



>ref|XP_007226407.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
 gb|EMJ27606.1| hypothetical protein PRUPE_ppa022752mg [Prunus persica]
Length=500

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/501 (57%), Positives = 368/501 (73%), Gaps = 6/501 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             LL+ A   + EKLWW P HI+KLM+ QGIKGPSYRF+HGNT EIS  +R   S+PM   L
Sbjct  3     LLLSAMIKMFEKLWWKPTHIRKLMALQGIKGPSYRFIHGNTIEISNMKREAMSRPM--SL  60

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
              HD FP+  PHI+ W +LYG N+L W G +P+LV+TEA + K+IL++  G   K E  G+
Sbjct  61    FHDSFPQAQPHIHLWTKLYGKNYLQWHGSKPQLVITEAAICKDILNNNDGAVQKAETIGY  120

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              ++LLGDG+  S GEKW++M+KLAN+ FHGE L+ M+PAMI S ETM+E  + H+G+EIE
Sbjct  121   VKKLLGDGLTRSSGEKWSKMKKLANHAFHGERLKSMIPAMIASGETMLERLKNHQGREIE  180

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              ++EFR  TSEVISRTAFGS+YLEG+NIFEML+KL  L  KN   +RFPG+S+I K  DE
Sbjct  181   VYDEFRFFTSEVISRTAFGSSYLEGENIFEMLMKLAFLTFKNTHKIRFPGISKIFKTRDE  240

Query  889   LESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEA  1065
             +ES +LE+G+RN ++++IKKRE +   GEE      SDFL  LLEA H  N   +I ++ 
Sbjct  241   IESAELEKGIRNSVMELIKKREKKAMAGEEDGFG--SDFLGLLLEARHDTNEKQRISVDN  298

Query  1066  MVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI  1245
             +VDECKTFY AG ETTTSLL W   LLA H DWQE ARKEV+++FG++ P P GIA+LK 
Sbjct  299   LVDECKTFYLAGQETTTSLLAWTVFLLALHRDWQEEARKEVLQLFGKQTPNPDGIAKLKT  358

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             M+MI+ E+LRLY P+  ++RK E++ V LGN+T+P N+ L +  LA   DP+ WG+DVH 
Sbjct  359   MSMIINESLRLYSPIVSLERKTERE-VRLGNLTVPANVELLLPNLAFHLDPKFWGEDVHL  417

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             FKPERF+EGV KAT ++ +AFLPFG GPRTC+G +F   EAKI LSMILQ +S  LS +Y
Sbjct  418   FKPERFSEGVAKATKDNMVAFLPFGMGPRTCVGFHFVTIEAKIALSMILQNHSFTLSPAY  477

Query  1606  VHSPVQLFMLRPKDGVQVILH  1668
             VHSP Q   LRP+ GV+V LH
Sbjct  478   VHSPFQFLTLRPQHGVRVTLH  498



>ref|XP_009356202.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/492 (59%), Positives = 369/492 (75%), Gaps = 6/492 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW+P+ +Q L++ QGIKGPSYRF+HGNTKEIS  +    S+P    LSHD+F R+ PH
Sbjct  29    KLWWSPIRLQNLVAMQGIKGPSYRFVHGNTKEISSMQEEAMSRP--KSLSHDIFSRVQPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I+ W + YGANFL W G Q +LV+TE EL KEIL+++   YPK E + F RRLLGDG+  
Sbjct  87    IHLWTKTYGANFLQWYGSQAQLVITEPELCKEILTNKDRAYPKSEPKSFLRRLLGDGLVV  146

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             S GEKWA+MRKLAN  FHGE L+GM P +I SAETM+E W+EH+G+EI+ FEEFRL TSE
Sbjct  147   SDGEKWAKMRKLANYAFHGEILKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRLYTSE  206

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VIS+TAFGS+YLEGKNIFE+L KL  L+ KN   +RFPG+S  +K+NDE+ES KLE+ +R
Sbjct  207   VISKTAFGSSYLEGKNIFEILDKLGHLSFKNAFKLRFPGISMFIKSNDEIESAKLEKSIR  266

Query  922   NGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + I+++IK RE +   GEE   S  +DFL  LL+A+   +   +I I+ +VDECKTFYFA
Sbjct  267   DSIMEMIKNRENKAMAGEE--DSFGNDFLGVLLKAHQDTDERKRISIDEIVDECKTFYFA  324

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G ETT S L W   LLA H DWQE ARKEV+++FG++NP   GIA+LK M+MI  E+LRL
Sbjct  325   GQETTNSALAWTVFLLAIHTDWQEDARKEVIQIFGKQNPNLDGIAKLKTMSMIFNESLRL  384

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             YPPV  I+RK+ ++ V LG   LP N+ + I  LALQH+P+IWG+DV  FKPERF+EGV 
Sbjct  385   YPPVVTIERKIGRE-VKLGKHVLPANVEITIPCLALQHEPQIWGEDVLLFKPERFSEGVA  443

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KAT N+  AFLP+G GPR+C+G NFA  E KIVLSMILQR+S  LS +Y+HSP +L  +R
Sbjct  444   KATKNNIAAFLPWGLGPRSCVGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLTVR  503

Query  1639  PKDGVQVILHRI  1674
             P+ GVQV+LH +
Sbjct  504   PQHGVQVMLHSL  515



>ref|XP_007222985.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
 gb|EMJ24184.1| hypothetical protein PRUPE_ppa004328mg [Prunus persica]
Length=516

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/507 (56%), Positives = 376/507 (74%), Gaps = 5/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ IQKLM+ QGIKGPSYRF+HGNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   + PHI+SW ++YG N+L W G + +LV+TE EL KEIL+++   Y K E
Sbjct  73    -QLLSHDILSVVQPHIHSWTKIYGKNYLQWHGCRAQLVITEPELCKEILNNKDRAYQKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                 +++LLGDG + +++ EKWA++RKLA + FHGESL+ M+P M+ SAE+M+E W  +E
Sbjct  132   PTNIAKKLLGDGLVVTTEAEKWAKLRKLATHAFHGESLKSMIPEMVASAESMLERWTVYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +EEFRL TSEVISRTAFGS+Y+EG++IFE+L+KL  L  KNFL VR PG+S+  
Sbjct  192   GKEIEVYEEFRLFTSEVISRTAFGSSYVEGQDIFEILMKLGFLIFKNFLKVRVPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ESEKLE+G+   II+++KKRE+   G E K S  SDFL  LL+ANH+ N + +I
Sbjct  252   KTSDEIESEKLEKGIHASIIEMVKKREKKTMGGE-KDSFGSDFLGLLLKANHEANENQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG++ P   GI 
Sbjct  311   SVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIG  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ E LRLYPP   + R VE++ V LG + +P N+ + +S +A+ HDP+IWG+
Sbjct  371   KLKTMSMIINEALRLYPPAVSVIRNVERE-VRLGKLIVPSNLDVVVSIVAVHHDPQIWGQ  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNN+  AFLPF  GPRTC+GLNFA+ EAKI LSMILQRY+  L
Sbjct  430   DVQLFKPERFSEGVAKATNNNIGAFLPFSMGPRTCVGLNFAITEAKIALSMILQRYAFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  YVH P+    +RP+ GVQV+LH +
Sbjct  490   SPGYVHLPLHYLTVRPQHGVQVMLHSL  516



>ref|XP_008219236.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=518

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/504 (56%), Positives = 370/504 (73%), Gaps = 6/504 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             ++ LL+LA   + EKLWW P  I+KLM+ QGIKGPS+R +HGNT EIS  +R   S+PM 
Sbjct  18    VTLLLLLAMIKMFEKLWWKPTRIRKLMALQGIKGPSFRLIHGNTIEISNMKREAMSRPM-  76

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               L HD FP++ PHI+ W +LYG N+L W G +P+LV+TEA + K+IL++  G   K E 
Sbjct  77    -SLLHDSFPQVQPHIHLWTKLYGKNYLQWHGSKPQLVITEAAICKDILNNNDGAVQKAET  135

Query  520   QGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK  699
              G+ ++LLGDG+  S GEKW++M+KLAN+ FHGE L+ M+PAMI S ETM+E  + H+G+
Sbjct  136   IGYVKKLLGDGLTRSSGEKWSKMKKLANHAFHGERLKSMIPAMIASGETMLERLKNHQGR  195

Query  700   EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKN  879
             EIE ++EFR  TSEVISRTAFGS+YLEG+NIFEML+KL  L  KN   +RFPG+S+I K 
Sbjct  196   EIEVYDEFRFFTSEVISRTAFGSSYLEGENIFEMLMKLAFLTFKNTHKIRFPGISKIFKT  255

Query  880   NDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
              DE+ES +LE+G+RN  +++IKKRE +   GEE+     SDFL  LLEA+H  N   +I 
Sbjct  256   KDEIESAELEKGIRNSAMELIKKREKKAMAGEEEGFG--SDFLGLLLEAHHDTNEKQRIS  313

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ +VDECKTFY AG ETTTSLL W   +LA H DWQE ARKEV+++FG++ P P GIA+
Sbjct  314   VDDLVDECKTFYLAGQETTTSLLAWTVFILALHRDWQEEARKEVLQLFGKQTPNPDGIAK  373

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M+MI+ E+LRLY P+  ++RK E++ V LGN+ +P N+ L +  LA  HDP+ WG+D
Sbjct  374   LKTMSMIINESLRLYSPIVSLERKTERE-VRLGNLIVPANVELLLPNLAFHHDPKFWGED  432

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERF+EGV KAT ++ +AFLPFG GPRTC+G  F   EAKI LSMILQ +S  LS
Sbjct  433   VHLFKPERFSEGVAKATKDNMVAFLPFGMGPRTCVGFQFVTIEAKIALSMILQNHSFTLS  492

Query  1597  SSYVHSPVQLFMLRPKDGVQVILH  1668
              +YVHSP Q   LRP+ GV+V LH
Sbjct  493   PAYVHSPFQFLTLRPQHGVRVTLH  516



>ref|XP_009356447.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/507 (55%), Positives = 372/507 (73%), Gaps = 5/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+   L+L    +  K+WW P  I+KLM+SQGI+GP YR +HGNTKEIS+ R+ +  +P 
Sbjct  14    FLCLFLILGLIKILHKIWWTPTRIRKLMASQGIRGPPYRLIHGNTKEISDMRKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHDV   + P++++W ++YG N+L W G   +LV+TE EL KEIL+++   YPK +
Sbjct  73    -QILSHDVLSVVQPNMHTWIKIYGKNYLQWHGSTAQLVITETELCKEILNNKDRAYPKAD  131

Query  517   LQGFSRRLLGDGIG-SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                F ++LLGDG+  +++ EKW ++RKLA + FHGE+L+ M+P M+ SAE M+E W+  E
Sbjct  132   TPNFVKKLLGDGLAATTEAEKWGKLRKLATHAFHGETLKSMIPEMVASAEAMLERWKFFE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +EEFRL TSEVISRTAFGS+Y+EGKNIFEML+KL +L  KN   VR PG+S+  
Sbjct  192   GKEIEVYEEFRLFTSEVISRTAFGSSYIEGKNIFEMLMKLSSLLFKNAFKVRVPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ES+KLE+ V   II+I+KKRE  K G E+K S  SDFL  LL+A H  N + +I
Sbjct  252   KTSDEIESDKLEKEVHATIIEIVKKREN-KAGTEEKDSFGSDFLGLLLKARHSANDNQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LLGW   LLA + DWQE ARKEV+++FG++ P   GIA
Sbjct  311   SVDELIDECKTFYFAGQETTNTLLGWTVFLLALNTDWQEEARKEVIQLFGKQTPNHDGIA  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +++ MNMI+ E LRLY P  Y+ RKVE++ V LG + +P N+ L IS +AL HDP+IWGK
Sbjct  371   KMRTMNMIINECLRLYTPAVYLTRKVERE-VKLGKLIVPANLELVISTIALHHDPQIWGK  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DVH FKP+RF+EGV+KATNN+  AF+PFG G RTC+GLNF+  EAKI LSMILQRYS  L
Sbjct  430   DVHLFKPDRFSEGVLKATNNNVGAFIPFGLGTRTCVGLNFSTTEAKIALSMILQRYSFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S SYVH P+    +RP  GVQVILH +
Sbjct  490   SPSYVHLPLHYVTVRPYHGVQVILHSL  516



>ref|XP_007223137.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
 gb|EMJ24336.1| hypothetical protein PRUPE_ppa004329mg [Prunus persica]
Length=516

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/507 (56%), Positives = 373/507 (74%), Gaps = 5/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ IQKLM+ QGIKGPSYRF+HGNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMDRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   + PHI+SW + YG N+L W G Q +LV+TE EL K+IL+++   YPK E
Sbjct  73    -QILSHDILSVVQPHIHSWTKKYGKNYLQWHGSQAQLVITEPELCKQILNNKGSAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                  ++L+GDG + ++K EKWA++RKLA + FHG+ L+ M+P M+ SAETM+E W  +E
Sbjct  132   PPNLVKKLVGDGLVATTKAEKWAKLRKLATHAFHGDGLKSMIPEMVASAETMLERWTFYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +EEFRL TSEVISRTAFGS+Y+EG+NIFEML+KL  L + NFL VR PG+S+  
Sbjct  192   GKEIEVYEEFRLFTSEVISRTAFGSSYVEGQNIFEMLMKLGFLIANNFLKVRVPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ES+KLE+G+   II++ KKRE+ KT   +  S  SDFL  LL+AN++ N +  I
Sbjct  252   KTSDEIESDKLEKGIHASIIEMAKKREK-KTMAGEMDSFGSDFLGLLLKANNEANENQGI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG++ P   GI 
Sbjct  311   SVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIG  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ E LRLYPPV  + RKVE++ V LG + +P N+ L +S ++L HDP+IWG+
Sbjct  371   KLKTMSMIINEALRLYPPVVSVIRKVERE-VRLGKLIVPSNLELIVSIVSLHHDPQIWGQ  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNNH  AF+PFG GPRTC+GLNF   EAKI LSMILQRY+  L
Sbjct  430   DVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGLNFGTTEAKIALSMILQRYAFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  YVH P++   +RP+ GVQV+L  +
Sbjct  490   SPGYVHLPLRYLTVRPQHGVQVMLQSL  516



>ref|XP_007221838.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
 gb|EMJ23037.1| hypothetical protein PRUPE_ppa023692mg [Prunus persica]
Length=516

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/506 (56%), Positives = 366/506 (72%), Gaps = 5/506 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +   L LA   +  KLWW P  IQ+LM+ QGIKGP+YR +HGNTKEI   +     KP  
Sbjct  15    VCLFLFLALIKIFHKLWWKPTSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNEAMGKP--  72

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               LSHD+F R+ PH +SW +LYG NFL W G +P+L++TE EL KEIL+D+   Y K + 
Sbjct  73    RGLSHDIFSRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRAYTKSKP  132

Query  520   QGFSRRLLGDGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             + F ++LLGDG+ ++   EKW ++RK+AN  FHGESL+ M PA I SAE M+E W+  +G
Sbjct  133   KSFVKQLLGDGLVTTTNIEKWGKLRKVANYAFHGESLKSMTPATIASAEIMLERWKNQDG  192

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFRLLTSEVISRTAFGS+YLEG+ IFEML+KL  L+ KN L +R PG+S+  K
Sbjct  193   KEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNILKLRIPGISKFYK  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
               DE+ESE LE+GV N II+I+KKRE+     E+     SDFL  LL+A H  N + +I 
Sbjct  253   TCDEIESENLEKGVYNSIIEIVKKREKKAMAGEE-DGFGSDFLGLLLKAYHDANDNQRIS  311

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ +VDECKTFYF G ET+ SLL W   LLA H DWQE ARKEV+E+FG++NP   GIAR
Sbjct  312   VDDLVDECKTFYFGGQETSNSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPNTDGIAR  371

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M+MI+ E+LRLYPP+  I RKVE++ V LG + +P N+ ++I  LA+ H+P++WG+D
Sbjct  372   LKTMSMIINESLRLYPPIVSIARKVERE-VRLGKLIVPANVEIFIPSLAIHHEPQLWGED  430

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERF+EG+ KAT     AFLPFG GPR C+GL++A  EAKIVLSMILQRYS  LS
Sbjct  431   VHLFKPERFSEGIAKATEKRIAAFLPFGMGPRNCVGLDYATTEAKIVLSMILQRYSFTLS  490

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP+Q   +RP+ G QVILH +
Sbjct  491   PAYVHSPLQYITVRPQHGAQVILHSL  516



>ref|XP_008389250.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/491 (58%), Positives = 368/491 (75%), Gaps = 6/491 (1%)
 Frame = +1

Query  205   LWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHI  384
             LWW+P+ +Q L++ QGIKGPSYRF+HGNTKEIS  +    S+P    LSHD+F R+ PHI
Sbjct  30    LWWSPIRLQNLVALQGIKGPSYRFVHGNTKEISSMQEEAMSRP--KSLSHDIFSRVQPHI  87

Query  385   YSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSS  564
             + W + YGANFL W G Q +LV+TE EL KEIL+++   YPK E + + RRLLGDG+  S
Sbjct  88    HLWTKKYGANFLQWYGSQAQLVITEPELCKEILTNKDRAYPKSEPKSYLRRLLGDGLVVS  147

Query  565   KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEV  744
              GEKWA+MRKLAN  FHGE L+GM P +I SAETM+E W+EH+G+EI+ FEEFRL TSEV
Sbjct  148   DGEKWAKMRKLANYAFHGEILKGMAPTVIASAETMLETWKEHDGQEIDVFEEFRLYTSEV  207

Query  745   ISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRN  924
             IS+TAFGS+YLEGK IF++L KL  L+ KN   +RFPG+S+ +K+NDE+ES KLE+ +R+
Sbjct  208   ISKTAFGSSYLEGKXIFDILEKLGYLSFKNAFKLRFPGISKFIKSNDEIESAKLEKSIRD  267

Query  925   GIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
              I+++IK RE +   GEE   S  +DFL  LL+A+H  +   +I I+ +VDECKTFYFAG
Sbjct  268   SIMEMIKNRENKAMAGEE--DSFGNDFLGVLLKAHHDTDEKKRISIDEIVDECKTFYFAG  325

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
              ETT S L W   LLA H DWQE ARKEV+++FG++NP   GIA+LK M+MI  E+LRLY
Sbjct  326   QETTNSALAWTVFLLAIHTDWQEEARKEVIQIFGKQNPNLDGIAKLKTMSMIFNESLRLY  385

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
             PPV  I+RK+ ++ V LG   LP N+   I  LALQH+P+IWG+DV  FKPERF+EGV K
Sbjct  386   PPVVTIERKI-RREVKLGKHVLPANVEXTIPCLALQHEPQIWGEDVLLFKPERFSEGVAK  444

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             AT N+  AFLP+G GPR+C+G NFA  E KIVLSMILQR+S  LS +Y+HSP +L  +RP
Sbjct  445   ATKNNIAAFLPWGLGPRSCVGSNFAAIETKIVLSMILQRFSFTLSPAYIHSPYRLLTVRP  504

Query  1642  KDGVQVILHRI  1674
             + GVQV+LH +
Sbjct  505   QHGVQVMLHSL  515



>ref|XP_007201527.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
 gb|EMJ02726.1| hypothetical protein PRUPE_ppa016887mg [Prunus persica]
Length=516

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/493 (57%), Positives = 367/493 (74%), Gaps = 7/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQK M  QGI+GP YR +HGN KEIS+  +   ++P    +SHD  P + PH
Sbjct  29    KLWWTPTRIQKQMGLQGIQGPPYRLIHGNNKEISQMMKEAMARP--KSISHDTLPLVQPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IG  558
             I+ W ++YG N+L W G Q +LV+TE EL K+IL+++ G YPK E+Q F ++LLGDG + 
Sbjct  87    IHYWTKIYGKNYLQWHGSQAQLVITEPELCKQILNNKDGAYPKKEVQNFVKKLLGDGLVS  146

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             ++K EKW ++RKLA   FHGESL+ M+PAM+ S ETM+  W+ +EGKEI+  +EFRLLTS
Sbjct  147   TTKAEKWEKLRKLATLSFHGESLKSMIPAMVASTETMLGRWKNYEGKEIDVLQEFRLLTS  206

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EGK+IFEML KL  +  KN+L +R P +S+  K +DE+ESEKLE+G+
Sbjct  207   EVISRTAFGSSYIEGKHIFEMLTKLGFIIYKNYLAIRVPVISKFFKTSDEIESEKLEKGI  266

Query  919   RNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             R+ II+IIKKRE+   TG E +    SD+L  L++A H  N   +I ++ +VD+CKTFY 
Sbjct  267   RDSIIEIIKKREEKAMTGVEDRFG--SDYLGLLVKAQHDANDSQRISVDEVVDDCKTFYM  324

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             +G ETTT+LL W  LLLA H DWQE+ARKEV+++FG+E P P GI++LK ++MI+ E+LR
Sbjct  325   SGQETTTTLLSWTVLLLAIHTDWQEKARKEVIQLFGKETPHPDGISKLKTISMIINESLR  384

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LYPP   I RKVEK+ V LG +TLPPN+ L IS +A+ HDPEIWG+DVH FKPERF EGV
Sbjct  385   LYPPPVSIIRKVEKE-VRLGKLTLPPNLDLVISTIAIHHDPEIWGQDVHLFKPERFLEGV  443

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KATNN+  AF+PFG GPRTC+GLNF   EAKI LSMILQRYS  LS  YVH P+    +
Sbjct  444   AKATNNNIGAFIPFGLGPRTCVGLNFGSTEAKIALSMILQRYSFTLSPGYVHFPLHYLTV  503

Query  1636  RPKDGVQVILHRI  1674
             RP+ GVQVILH +
Sbjct  504   RPQLGVQVILHSL  516



>ref|XP_009607162.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana tomentosiformis]
Length=515

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/510 (55%), Positives = 373/510 (73%), Gaps = 8/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKL----WWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
             F+ S L L   W   KL    WW P+ IQ  MS QGIKGP Y F HGNTKEIS  R    
Sbjct  10    FLFSTLCLYLLWTIIKLLYLIWWMPLQIQNRMSFQGIKGPPYSFPHGNTKEISLMRSQTM  69

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
              KPM D +SH +FPRI PH+YSW R+YG NFL W G +P L VTE EL+KEIL++++  Y
Sbjct  70    DKPMMD-ISHYIFPRIQPHVYSWTRMYGRNFLTWHGSKPYLFVTEPELIKEILANKEDSY  128

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             PK++++G++++LLG  + +++GEKWA++RKLAN+ FH ESL+ M+P M  S +TM+E W+
Sbjct  129   PKMDMEGYAKKLLGKALITNEGEKWAKVRKLANHTFHAESLKRMVPEMSASVQTMLEKWK  188

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             EHEGK+ + F++F LLT+EVISRTAFGS+Y+EGK+IFEM+ KL  +  KN  NVRFPG+S
Sbjct  189   EHEGKDFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNIYNVRFPGIS  248

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
              +++ +DE+E+EKLE G+++ I+++++KRE+ K G  +     +D+L +L++  H+ + +
Sbjct  249   MLIRTDDEIEAEKLERGIKSSILELVRKREKVKDGMFENFG--TDYLGQLMKLLHEPDTN  306

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
               I I+ M+DE K  Y AGH TTTSLLGW+  LLA H +WQE+ARKEV E  G   PT  
Sbjct  307   KSITIDQMIDEVKALYGAGHLTTTSLLGWSVFLLAHHPEWQEKARKEVFEFCGLRTPTSD  366

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
              I RL+ MNMIL E +RLYPPV  + RKVE++ V LG++TLP N+ +++  LAL HDP+I
Sbjct  367   AITRLRTMNMILNECMRLYPPVITMTRKVERE-VRLGSMTLPANMTIFMPILALHHDPQI  425

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WGKDVH FKPERFA+GV KATNN+  +F PFG GPRTC+GLNF   EAKI LSMILQRY 
Sbjct  426   WGKDVHIFKPERFAKGVAKATNNNAASFFPFGLGPRTCVGLNFTTNEAKIALSMILQRYK  485

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               LS +YVH P  +F+L PKDGV+V+L  I
Sbjct  486   FTLSPNYVHYPSDIFILTPKDGVKVVLESI  515



>ref|XP_007226531.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
 gb|EMJ27730.1| hypothetical protein PRUPE_ppa025196mg [Prunus persica]
Length=516

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/507 (56%), Positives = 365/507 (72%), Gaps = 7/507 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +   L L    +  KLWW P  IQ+LM+ QGIKGP+YR +HGNTKEI   +     KP  
Sbjct  15    VCLFLFLVLIKIFHKLWWKPTSIQRLMALQGIKGPAYRLVHGNTKEIFNMQNEAMGKP--  72

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               LSHD+F R+ PH +SW +LYG NFL W G +P+L++TE EL KEIL+D+   YPK + 
Sbjct  73    KGLSHDIFSRVQPHFHSWTKLYGKNFLQWYGLRPQLIITEPELCKEILNDKDRAYPKSKP  132

Query  520   QGFSRRLLGDGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             + F ++LLGDG+ ++   EKW ++RK+AN  FHGESL+ M PA I SAE M+E W+  +G
Sbjct  133   KSFVKQLLGDGLVTTTNIEKWGKLRKVANFAFHGESLKSMTPATIASAEIMLERWKNQDG  192

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE FEEFRLLTSEVISRTAFGS+YLEG+ IFEML+KL  L+ KN L +R PG+S+  K
Sbjct  193   KEIEMFEEFRLLTSEVISRTAFGSSYLEGEKIFEMLMKLSFLSFKNILKLRIPGISKFYK  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKR-EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
               DE+ESE LE+G+ N II+I+KKR ++   GEE      SDFL  LL+A+H  N + +I
Sbjct  253   TCDEIESENLEKGIYNSIIEIVKKRGKKAMAGEEDGFG--SDFLGLLLKAHHDANDNQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +VDECKTFY AG ET++SLL W   LLA H DWQE ARKEV+E+FG++NP   GIA
Sbjct  311   SVDDLVDECKTFYLAGQETSSSLLAWTVFLLAIHTDWQEEARKEVLEIFGKQNPNTDGIA  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLK M MI+ ETLRLYPP+  ++R+ E++ V LGN+ +P  + L I  LA  H+P  WG+
Sbjct  371   RLKTMTMIINETLRLYPPIVVLEREAERE-VRLGNLIIPATVELVIPCLAFHHEPGFWGQ  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DVH FKPERF+EGV KAT N+   FLPFG GPR C+GLNFA  E KIVLSMILQRYS  L
Sbjct  430   DVHLFKPERFSEGVAKATKNNIATFLPFGMGPRNCVGLNFATNEVKIVLSMILQRYSFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S +YVHSP +L  +RP+ G+Q++LH +
Sbjct  490   SPAYVHSPFRLLTVRPQHGLQIMLHSL  516



>emb|CDP00470.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/491 (56%), Positives = 371/491 (76%), Gaps = 5/491 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW P  I+++MSSQGI GP+Y+F +GNTKEI+  R    SKPME  +SHD+F RI PH
Sbjct  29    KVWWIPCRIKRIMSSQGISGPAYKFPYGNTKEITNMRNQSMSKPME--ISHDIFQRIQPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +Y W ++YG N++ W G Q +L VT+ E++KE+L++R+  YPK++++G +++LLG+ + +
Sbjct  87    VYLWTKIYGKNYISWHGSQAQLFVTDTEMIKEVLTNREDAYPKMDMEGIAKKLLGEALIT  146

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKWA++RKLAN+ FH ESL+ M+P M  S E M+E W+ HEGKEI+AF+EF LLT+E
Sbjct  147   NEGEKWAKVRKLANHTFHAESLKRMVPEMSASVEVMLENWKHHEGKEIDAFKEFGLLTTE  206

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VI+RTAFGS+Y EGK+IFEM+ KL  +  +N   V+FPG+S +MK++DE+E+EKLE G++
Sbjct  207   VIARTAFGSSYREGKHIFEMVAKLTAIDVRNVYKVKFPGISMLMKSSDEIEAEKLERGIK  266

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
               I++++KKRE+ + GE + ++   D+L +L++     N + +I +E M+DE K  + AG
Sbjct  267   TSILELVKKREKGRKGETEDNA--IDYLGELMKLTRDTNINKRITLEQMIDEIKALFGAG  324

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
             H TTT+LLGW   +L+ H DWQE+ARKEV E+FG +NP+  GIARLK MNMI+ E LRLY
Sbjct  325   HLTTTNLLGWCAFVLSVHGDWQEKARKEVFEIFGNKNPSSDGIARLKTMNMIINECLRLY  384

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
             PPV  + RKV  + V LGN+ LP NI++Y+  LAL H+PEIWGKDVH FKPERFAEGV K
Sbjct  385   PPVLTMTRKVGTE-VRLGNLRLPTNINIYLPILALHHNPEIWGKDVHLFKPERFAEGVAK  443

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             ATN+   AF PFG GPRTC+GLNF   EAKI LSMILQRY L LS +YVH P  +F+L P
Sbjct  444   ATNSTAAAFFPFGLGPRTCVGLNFTTNEAKIALSMILQRYKLTLSPNYVHFPADIFILTP  503

Query  1642  KDGVQVILHRI  1674
             K GVQVIL  I
Sbjct  504   KYGVQVILQAI  514



>ref|XP_008243778.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/506 (56%), Positives = 370/506 (73%), Gaps = 7/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ IQK+M+ QGIKGPSYRF++GNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRIQKVMALQGIKGPSYRFIYGNTKEISNMKKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PH++SW  +YG N+L W G + +LV+TE EL KEIL+++   YPK E
Sbjct  73    -HILSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVITEPELCKEILNNKGRAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                 S++L GDG + ++K EKWA++RKLA   FHGESL+ M+P M+ SAE MVE W+ +E
Sbjct  132   PPNISKKLFGDGLVATNKAEKWAKLRKLATLAFHGESLKSMIPDMVASAEKMVERWKVYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y EG++IFEML KL  L  KN L VR P +S++ 
Sbjct  192   GKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLGFLIFKNILKVRVPVISKLF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K +DE+ESEKLE+G+   II+++KKRE +T TGE    S  SDFL  LL+ANH+ N + +
Sbjct  252   KTSDEIESEKLEKGIHASIIEMVKKREKKTMTGE--NDSFGSDFLGLLLKANHEANENQR  309

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ ++DECKTFYFAG ET  +LL W   LLA H DWQE ARKEV+++FG++ P   GI
Sbjct  310   ISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGI  369

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +L  M+MI+ ETLRLYPP  ++ R+VE++ V LG + +P N+ L +S +AL HDP+IWG
Sbjct  370   GKLTTMSMIINETLRLYPPAVHVVRRVERE-VTLGKLIVPSNLELDVSIVALHHDPQIWG  428

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +DV  FKPERF+EGV KATNNH  AF+PF  GPR C+GLNFA  E KI LSMILQRY+  
Sbjct  429   QDVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRICVGLNFATTEVKIALSMILQRYAFT  488

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVHSP+ L  +RP+ GVQV L 
Sbjct  489   LSPGYVHSPLHLLTVRPQHGVQVRLQ  514



>ref|XP_010091621.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44887.1| Cytochrome P450 734A1 [Morus notabilis]
Length=516

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/494 (57%), Positives = 364/494 (74%), Gaps = 3/494 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P  I+ LM+ QGIKGPSYRF+HGNTKEIS   +   S+ +   LSH++FP++
Sbjct  26    VLHKLWWIPTRIRHLMAMQGIKGPSYRFIHGNTKEISTMEKEARSRAILG-LSHNIFPKV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI  W  +YG  +L WLGPQ  LV+TE E +KE+L++R   YPK +++GF R++ G+G
Sbjct  85    QPHIELWTDIYGKKYLQWLGPQAHLVITEPESIKEVLNNRNRAYPKTDVKGFVRKVFGNG  144

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +S+GEKW +MRKLAN  FHGESLRGM PAMI S ETM+E W+ +EGKE+E FEEFRLL
Sbjct  145   LVTSEGEKWGKMRKLANYAFHGESLRGMNPAMISSVETMLERWKNYEGKEVEVFEEFRLL  204

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSEVISRTAFGS+YLEGK IF+ML KL  LA +N   V F G S+  K  DE++SE LE+
Sbjct  205   TSEVISRTAFGSSYLEGKKIFDMLQKLNLLAFRNLYKVSFSGFSKFFKTKDEVKSEMLEK  264

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              + + +I++IKKRE+ K    ++ S  SDF   L+ A+H  +   +I ++ MVDECKTFY
Sbjct  265   EMCDCVIELIKKREE-KVMNGEEDSFGSDFFGVLIRAHHDADEKQRISVDDMVDECKTFY  323

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AG ETT  LLGW  LLLA H DWQE ARKEV+ +FG+E P P GI++LKIM+M++ E+L
Sbjct  324   VAGQETTNILLGWTVLLLAVHSDWQEEARKEVLNLFGREKPNPDGISKLKIMSMVINESL  383

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV  I RKV ++ + LG   LP N++L+IS LAL HDP+IWG+DV++FKPERF+EG
Sbjct  384   RLYPPVITITRKVGRE-IKLGKHILPANLNLFISNLALHHDPQIWGEDVNQFKPERFSEG  442

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V  ATNN+  AF PFG G R+C+G+NFA+ EAKI LSMILQRYS  LS +YVH P Q   
Sbjct  443   VSTATNNNAAAFFPFGIGARSCVGMNFAITEAKIALSMILQRYSFTLSPAYVHWPFQRPT  502

Query  1633  LRPKDGVQVILHRI  1674
             L P+ G+QVIL  +
Sbjct  503   LHPQHGIQVILQSL  516



>ref|XP_007226762.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
 gb|EMJ27961.1| hypothetical protein PRUPE_ppa018724mg [Prunus persica]
Length=516

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/506 (56%), Positives = 369/506 (73%), Gaps = 7/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVL    +  KLWW P+ +QKLM+ QGI+GPSYRF++GNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLGFIKILHKLWWTPIRMQKLMALQGIRGPSYRFIYGNTKEISNMQKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PH++SW  +YG N+L W G + +LVVTE EL KEIL+++   Y K E
Sbjct  73    -HILSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVVTEPELCKEILNNKGRAYLKKE  131

Query  517   LQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                 S++L GDG+ ++ K EKWA++RKLA + FHGESL+ M+P M+ SAE MVE W+ +E
Sbjct  132   APNISKKLFGDGLAATNKAEKWAKLRKLATHAFHGESLKSMIPEMVASAEKMVERWKVYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y EG++IFEML KL  L  KN L VR PG+S++ 
Sbjct  192   GKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLSFLIFKNILKVRVPGISKLF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K +DE+ESEKLE+G+   II+++KKRE +T TGE    S  SDFL  LL+ANH+ N + +
Sbjct  252   KTSDEIESEKLEKGIHASIIEMVKKREKKTMTGE--NGSFGSDFLGLLLKANHEANENQR  309

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ ++DECKTFYFAG ET  +LL W   LLA H DWQE ARKEV+++FG++ P   GI
Sbjct  310   ISVQEIIDECKTFYFAGQETANTLLCWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGI  369

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +L  M+MI+ ETLRLYPP   ++R+VE++ V LG + +P N+   +S +AL HDP+IWG
Sbjct  370   GKLTTMSMIINETLRLYPPAVQVQRRVERE-VRLGKLIVPSNLEFDVSIVALHHDPQIWG  428

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +DV  FKPERF+EGV KATNNH  AF+PF  GPR C+GLNFA  E KI LSMILQRY+  
Sbjct  429   QDVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRICVGLNFATTEVKIALSMILQRYAFT  488

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVHSP+ L  +RP+ GVQV L 
Sbjct  489   LSPGYVHSPLHLITVRPQHGVQVRLQ  514



>ref|XP_004297211.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=520

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/495 (56%), Positives = 368/495 (74%), Gaps = 5/495 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P   QK M++QGI+GPSY+ +HGN KEIS       S+P+ + LSH+V   +
Sbjct  30    IFHKLWWIPTRTQKFMAAQGIRGPSYKLIHGNNKEISNMLMEAMSRPVLN-LSHEVLSAV  88

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+SW ++YG N+L W G QP LV+TE ELVKEIL ++ G + K +   + ++LLGD 
Sbjct  89    QPHIHSWTKIYGKNYLQWYGLQPVLVITEPELVKEILHNKDGVFTKQKPSIYVKKLLGDS  148

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             I  ++GEKW+++RKL+N+ FHG+SL+ M+P MI SAETM+E W++HE KEIE +E FR  
Sbjct  149   ISMAEGEKWSKLRKLSNHAFHGDSLKNMIPDMIASAETMLEGWKKHEEKEIEVYEHFRRF  208

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSEVISRTAFGS+YLEGK+IF+ML+KL +L  +N    R PG+S+  K +DE ESEKLE+
Sbjct  209   TSEVISRTAFGSSYLEGKDIFDMLMKLGSLIFRNAHKFRVPGISKFYKTSDEKESEKLEK  268

Query  913   GVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             G+R+ I++I+KKRE +  TGEE   S  +DFL  LL+A+H  N   +I +  +V+ECKTF
Sbjct  269   GIRDTIVEIVKKREREAVTGEE--GSFGTDFLGLLLKAHHGANDKQRISVNELVEECKTF  326

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             YFAG +TT SLL W   LLA H DWQE ARKEV+++FG++ P+P G+A+LK M+MI+ E+
Sbjct  327   YFAGQDTTNSLLVWTVFLLALHPDWQEEARKEVLQIFGKQPPSPDGLAKLKTMSMIINES  386

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPPV  + R V+K+ V LGN+T+PPN+   +  LAL H+P+ WG+DV  FKPERF+E
Sbjct  387   LRLYPPVITLARNVDKE-VRLGNLTIPPNVEFLVPNLALHHEPQFWGQDVKVFKPERFSE  445

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV  ATNN+  AFLPFG GPRTC+GLNFA  EAKI L+MILQRYS  LS +YVHSP Q  
Sbjct  446   GVASATNNNMAAFLPFGMGPRTCVGLNFATIEAKIALAMILQRYSFTLSPAYVHSPFQFL  505

Query  1630  MLRPKDGVQVILHRI  1674
              +RP+ G+QVILH +
Sbjct  506   TVRPQHGLQVILHSL  520



>ref|XP_004297209.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=518

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/496 (55%), Positives = 368/496 (74%), Gaps = 5/496 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  +LWW P  IQKLM+ QGIKGPSYRF+HGN+KEIS  ++   S+P    LSHD+F  +
Sbjct  26    ILNRLWWKPTRIQKLMALQGIKGPSYRFIHGNSKEISSMQKEAMSRP--KSLSHDIFSYV  83

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PH Y W R YG NFL W G + +LV+TE +L KE+L+++   + K ++  F ++LLGDG
Sbjct  84    QPHFYLWSRAYGKNFLQWHGSRAQLVITEPDLCKEVLNNKDRTFVKTDIPIFIKKLLGDG  143

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE-GKEIEAFEEFRL  729
             + +++GEKW R+RKLAN  FHGESL+ ++PA I S E M+E W+ HE GKEIE FEEFR+
Sbjct  144   LVTTEGEKWGRLRKLANFAFHGESLKSLIPATIASTELMLERWKNHEEGKEIEIFEEFRV  203

Query  730   LTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLE  909
             LTSEVISRTAFGS+Y EGK+IF+ML+KL  L  KN    R P +S I K +D++E+E LE
Sbjct  204   LTSEVISRTAFGSSYSEGKSIFDMLMKLSFLTFKNAFKARIPIISNIFKTSDDIEAENLE  263

Query  910   EGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKT  1086
             +GVR+ I++++KKREQ   T  ++K S  SDFL  L++A+H  + + +I ++ +VDECKT
Sbjct  264   KGVRDSILEMVKKREQKAMTTSKEKQSFGSDFLGLLVKAHHDVDVNQRITVDDLVDECKT  323

Query  1087  FYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEE  1266
             FYFAG ETT SLL W   LLA + DWQE ARKEV+++FG++ P P GI++LK M MI+ E
Sbjct  324   FYFAGQETTNSLLAWTVFLLAFNTDWQEEARKEVLQLFGKQTPNPDGISKLKTMGMIINE  383

Query  1267  TLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFA  1446
             +LRLYPPV  I+RKV ++ V LG + +P ++ ++I  LALQHDP+ WG+D   FKPERF+
Sbjct  384   SLRLYPPVVSIERKVARE-VRLGKLLVPADLEIFIPALALQHDPQFWGQDAELFKPERFS  442

Query  1447  EGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             EGV KATNN+ + FLPFG GPR C+G NFA+ EAKI L+MILQR+S  LS SYVHSP ++
Sbjct  443   EGVAKATNNNMVTFLPFGMGPRNCVGYNFAINEAKIALAMILQRHSFTLSPSYVHSPFRI  502

Query  1627  FMLRPKDGVQVILHRI  1674
               +RP+ GVQV+LH +
Sbjct  503   LTVRPQHGVQVMLHSL  518



>ref|XP_007224470.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
 gb|EMJ25669.1| hypothetical protein PRUPE_ppa022621mg [Prunus persica]
Length=510

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/502 (54%), Positives = 368/502 (73%), Gaps = 4/502 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             +++LA   +  K+WW P  IQK M  QGI GP+YR +HG+TKEI   ++   S+P   ++
Sbjct  13    VILLALIRIFRKVWWVPNRIQKFMGLQGIHGPAYRLVHGSTKEIMSMKKEAMSRP--RNM  70

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+FP + PH + W ++YG NFL W G QP+L++ E EL KEIL+++   + K + QG+
Sbjct  71    SHDIFPTVQPHTHQWTKIYGKNFLQWQGTQPQLLIAEPELSKEILNNKDRLFRKQKSQGY  130

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              ++L G+ I  ++GEKW ++RKLAN+ FHGESL+GM+P MI S ETM++ W+ HEGKEIE
Sbjct  131   VKKLFGESISMAEGEKWVKLRKLANHAFHGESLKGMVPDMITSTETMLQRWKNHEGKEIE  190

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              FEEFRLLTSEVISR+AFGS+YLEGK IF+ML++L ++  +N L  RFPG+S   K + E
Sbjct  191   VFEEFRLLTSEVISRSAFGSSYLEGKRIFDMLMELTSVIFQNALRPRFPGISMFYKTSAE  250

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             + ++KLE+G+R+ I +I+KKRE  K  + +     SDFL  LL+A+H  N + +I  + +
Sbjct  251   IRADKLEKGIRDTIAEIVKKRE-NKAMKGEADEFGSDFLGVLLKAHHDTNENQRISFDDI  309

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             VDECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FGQ+ PT  GI++LK M
Sbjct  310   VDECKTFYFAGQETTNALLAWTVFLLALHPDWQEEARKEVLQLFGQQTPTLDGISKLKTM  369

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +MI+ E+LRLYPPV  + R+VE KNV LG + +P N  L++  LA  HDP+ WG+DV+ F
Sbjct  370   SMIINESLRLYPPVVSLNRQVE-KNVKLGGLVIPANAELHVPNLAFHHDPKFWGEDVNLF  428

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERF+EGV KAT ++ +AFLPFG GPRTC+G+NFA AE KI L+MILQRYS  LS  YV
Sbjct  429   KPERFSEGVAKATKSNTVAFLPFGLGPRTCVGMNFANAEVKIALAMILQRYSFTLSPGYV  488

Query  1609  HSPVQLFMLRPKDGVQVILHRI  1674
             HSP+Q   +RP  GVQVILH +
Sbjct  489   HSPIQYMTVRPHRGVQVILHSL  510



>ref|XP_008350887.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=518

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/493 (56%), Positives = 361/493 (73%), Gaps = 7/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  I KLM+SQGI+GP YRF+HGNTK+I+  R+   SKP   DLSHD+   + PH
Sbjct  31    KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKP--KDLSHDILSVVQPH  88

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IG  558
             ++SW  +YG N+L W G + + V+TE EL KEIL+++   YPK E+QGF R+LLGDG + 
Sbjct  89    MHSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKREVQGFVRKLLGDGLVS  148

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +++GEKW ++RK+AN+ FHGESL+ M   M+ SAETM+E W++++GKEIE F E +L +S
Sbjct  149   TTEGEKWGKLRKIANHAFHGESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSS  208

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EGKNIFEML  +  L  KN L +R PG+S+ +K  DE+E+EKLE+ V
Sbjct  209   EVISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAV  268

Query  919   RNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
                I++I++KRE+   TG E   S  SDFL  LL+A H  N D +I ++ +VDECKTFYF
Sbjct  269   HASIVEIVRKREEKAMTGGE--DSFGSDFLGLLLKAYHDSNDDQRISVDDLVDECKTFYF  326

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ET  +LL W   LLA H DWQE ARKEV+ +FG++ P   GIA++K M+MI+ E+LR
Sbjct  327   AGQETANTLLAWTVFLLALHTDWQEEARKEVIRLFGKQTPNHDGIAKMKRMSMIINESLR  386

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LY P   I RKVE++ V LG + +P N+ L IS +A+ HDP+IWGKDV  FKP+RF+EGV
Sbjct  387   LYTPPVSITRKVERE-VRLGQLIVPANVDLVISTIAIHHDPQIWGKDVQLFKPDRFSEGV  445

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KATNN+   F+PFG GPRTC+GLNFA  EAKI LSMILQR+S  LS  Y+HSP+     
Sbjct  446   AKATNNNVGVFIPFGLGPRTCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTC  505

Query  1636  RPKDGVQVILHRI  1674
             RP+ GVQV+LH +
Sbjct  506   RPQHGVQVMLHSL  518



>ref|XP_007226180.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
 gb|EMJ27379.1| hypothetical protein PRUPE_ppa015588mg [Prunus persica]
Length=516

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/493 (56%), Positives = 362/493 (73%), Gaps = 5/493 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P+ +QKLM+ QGIKGPSYRF+HGNTKEIS  ++ +  +P    LSHD+F  +
Sbjct  26    ILHKLWWTPIRMQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMGRP--RILSHDIFSVV  83

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+SW ++YG NFL W G + +LV+TE EL KEIL+++   YPK E    S++LLGDG
Sbjct  84    QPHIHSWTKIYGKNFLQWHGSRAQLVITEPELCKEILNNKGRAYPKREPTNISKKLLGDG  143

Query  553   -IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRL  729
              + ++K EKWA++R+LA + FHGESL+ M+P M+ SAE M+E W+ +EGKEIE +EEFRL
Sbjct  144   LVATTKAEKWAKLRRLATHAFHGESLKSMIPEMVASAENMLERWKVYEGKEIEVYEEFRL  203

Query  730   LTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLE  909
              TSEVISRTAFGS+Y EG++IF ML+KL +L  KN   VR PG+S++ K +DE++SE+LE
Sbjct  204   FTSEVISRTAFGSSYTEGQDIFGMLMKLGSLVFKNIFKVRVPGISKLFKTSDEIKSEQLE  263

Query  910   EGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             +G+   I +++KKRE TKT   +  S  SDFL  LL+ANH+ N + +I ++ ++DECKTF
Sbjct  264   KGIHASITEMVKKRE-TKTMTGENDSFGSDFLGLLLKANHETNENQRISVQEIIDECKTF  322

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             YFAG ETT +LL W   LLA H DWQE ARKEV+++FG+  P   GI +L  M+MI+ ET
Sbjct  323   YFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQLFGKGTPNLDGIGKLTTMSMIINET  382

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPP   + R VE++ V LG + +P N+ L +S +AL HDP+IWG+DV  FKPERF+E
Sbjct  383   LRLYPPAVLVLRNVERE-VRLGKLIVPSNLELVVSIVALHHDPQIWGQDVQLFKPERFSE  441

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             G+ KATNN+  AF+PF  GPR C+GLNFA  EAKI LSMILQRY+  LS  YVHSP    
Sbjct  442   GIAKATNNNVGAFIPFSMGPRICVGLNFATTEAKIALSMILQRYAFTLSPGYVHSPFHHL  501

Query  1630  MLRPKDGVQVILH  1668
              +RP+ GVQV L 
Sbjct  502   TVRPQHGVQVRLQ  514



>ref|XP_011009723.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=515

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/518 (53%), Positives = 371/518 (72%), Gaps = 17/518 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEIS  303
             F+ ++++L  + LC            KLWW P+ IQ  M+SQGI+GPSYRF+HG+TKE+ 
Sbjct  3     FLGNMIILLFSSLCIYLTFMLVKVLHKLWWTPIRIQNFMASQGIRGPSYRFIHGSTKEVL  62

Query  304   EARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEIL  483
               ++   +KPM   LSH++FP++LP IY+W   YG N+L W GP+   VV+E ELVKEIL
Sbjct  63    IMKKEAMAKPM--TLSHNIFPKVLPQIYTWINTYGRNYLSWYGPKAHFVVSEPELVKEIL  120

Query  484   SDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAE  663
             +++   YPK ++  + R LLG+G+ +S+GEKW + RKL+   F+ E+L+ M+P MI S E
Sbjct  121   NNKDRSYPKGDIPAYFRLLLGNGVSTSEGEKWTKHRKLSTYAFNAENLKDMIPEMIASVE  180

Query  664   TMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLN  843
              ++E W+++EG+EIE ++E RLLTSE+ISRTAFGS+Y+EGK+IF+ML KL  +  +N   
Sbjct  181   MLLERWKQNEGREIEVYQELRLLTSEIISRTAFGSSYVEGKDIFDMLTKLSLIIHRNIYK  240

Query  844   VRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLE  1020
             +R PG+S+  +  DE+ESEKL +G+ N +++IIKKRE+  KTGE       +DFL  LL 
Sbjct  241   LRLPGISKFWRTRDEIESEKLVKGIHNSVMEIIKKREEKVKTGEADGFG--NDFLGVLLN  298

Query  1021  ANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVF  1200
             + H  +   +I IE +VDECKTFY AG E+T SLL W  LLLA H DWQE ARKEV  +F
Sbjct  299   SYHDADEKKRISIEDLVDECKTFYIAGQESTNSLLSWTILLLAIHTDWQEEARKEVFNIF  358

Query  1201  GQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPL  1380
             G++ P   GIA+LKI+ MI+ ETLRLYPPV  + RKVE++ V +G +TLP N++LYI+  
Sbjct  359   GRQKPNLDGIAKLKILTMIINETLRLYPPVLGLMRKVERE-VQIGQLTLPANMNLYIANA  417

Query  1381  ALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVL  1560
             AL HDPEIWG+DVH FKPERF+ GV KATNN P AF PFG GPRTC+GLNFA  EAKI L
Sbjct  418   ALHHDPEIWGEDVHLFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITL  477

Query  1561  SMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SMILQ+Y   LS +Y HSP +   L P++GVQVILH +
Sbjct  478   SMILQKYLFTLSPTYTHSPYEAVTLCPRNGVQVILHSL  515



>ref|XP_007226460.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
 gb|EMJ27659.1| hypothetical protein PRUPE_ppa024660mg [Prunus persica]
Length=518

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/493 (56%), Positives = 361/493 (73%), Gaps = 5/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLW AP  +QKLM+ QGIKGP YR +HGNTK+IS   +   SKP     SHD+   + PH
Sbjct  29    KLWLAPARLQKLMALQGIKGPPYRLIHGNTKDISNMIKEAMSKPKSLSSSHDILSVVQPH  88

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IG  558
             ++SW ++YG N+L W G + +LV+TE EL KEIL+++   YPK   + F ++LLGDG + 
Sbjct  89    VHSWTKIYGKNYLQWHGSEAQLVITEPELCKEILNNKDKAYPKRVPESFVKKLLGDGLVT  148

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +++GEKWA+MR+LA + FHGESL+ M+PAM+ SAETM+E W+ +EGKEIE FEEFR  TS
Sbjct  149   TAEGEKWAKMRRLATHAFHGESLKSMIPAMVASAETMLERWKNYEGKEIEVFEEFRFFTS  208

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EG++IFEML+KL  L +KN   +R PG+S++ K  DE+ESEKLE+ V
Sbjct  209   EVISRTAFGSSYIEGQHIFEMLMKLGFLLTKNSFTIRVPGISKLFKTGDEIESEKLEKDV  268

Query  919   RNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             R  I++I++KRE+   TG E   S  SDFL  L++A+H  N   +I ++ ++D+CKTFY 
Sbjct  269   RASILEIVRKREEKVMTGGED--SFGSDFLGLLVKAHHDANDSQRISVDDLIDDCKTFYV  326

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETT SLL W   LLA H DWQE  RKEV+++FG++ P P GIA+LK M+M++ E LR
Sbjct  327   AGQETTNSLLAWTVFLLAHHTDWQEETRKEVIQMFGKQTPNPDGIAKLKTMSMVINECLR  386

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LY PV  + RK E++ V LG +T+P N+ L +S L+L HDP IWG+D   FKPERFAEGV
Sbjct  387   LYSPVGTLLRKAERE-VKLGKLTVPANVELVMSCLSLHHDPLIWGQDAQIFKPERFAEGV  445

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KA+NN+  AFLPFG GPRTC+GLNFA  EAKI LSM+LQRYS  LS  YVH P QL   
Sbjct  446   AKASNNNAGAFLPFGVGPRTCVGLNFATIEAKIALSMVLQRYSFTLSPGYVHLPFQLVTN  505

Query  1636  RPKDGVQVILHRI  1674
             RP  GVQV+LH +
Sbjct  506   RPLRGVQVMLHSL  518



>ref|XP_008243803.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=508

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/508 (56%), Positives = 369/508 (73%), Gaps = 15/508 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+   ++LA      K+WW P  IQ LM+ QGIKGPSYR +HGNTKEI   +      P 
Sbjct  14    FLCLFVLLALIKAFHKVWWTPRRIQNLMALQGIKGPSYRLIHGNTKEIFNMKMETMGSPR  73

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LS DV   + PHI SW ++YG N+L W G Q +LV+TE EL KEILS++ G YPK E
Sbjct  74    --NLSDDVLSAVQPHIRSWTKIYGKNYLQWHGSQAQLVITEPELCKEILSNKDGAYPKRE  131

Query  517   LQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
              +G+ ++L+GD +G++ + +KW+++RKLAN+ FHGESL+ M+PAMI SAETM++ W+ HE
Sbjct  132   PEGYVKKLVGDSMGTTNQADKWSKVRKLANHAFHGESLKSMIPAMIASAETMLDGWKNHE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +E+FRL TSEVISRTAF S+YLEGK+ F+ L+KL  L  KN  NVRFPG+S+I 
Sbjct  192   GKEIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFDNLMKLSFLLVKNSFNVRFPGISKIF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K++D++ESEKL++ +R+ II I+KKRE+   TGEE K    +D+L  LL+A H +  D  
Sbjct  252   KSSDDIESEKLDKAMRDSIIAIVKKREKAATTGEENKFG--NDYLGLLLKA-HLDTND--  306

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
                  +VDECKTFYFAG ET+  LL W   LLA H DWQE ARKEV+++FG++NPT   I
Sbjct  307   -----LVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKEVLQLFGKQNPTHDDI  361

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             ++LK M+MI+ E+LRLYP V  I RKV ++ V LG + +P N+ L IS LAL H+PE WG
Sbjct  362   SKLKTMSMIINESLRLYPSVLSIDRKVTRE-VKLGRLIVPANVELLISCLALHHEPEFWG  420

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +DVH FKP+RF+EGV KATNN+  AFLPFG GPRTC+G NFA  EAKI LSMILQRY   
Sbjct  421   EDVHLFKPDRFSEGVAKATNNNITAFLPFGMGPRTCVGFNFAAIEAKIALSMILQRYQFT  480

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             LS  YVHSPV    +RP+ GVQV+LH++
Sbjct  481   LSPGYVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_002316010.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
 gb|EEF02181.2| hypothetical protein POPTR_0010s14950g [Populus trichocarpa]
Length=515

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/518 (53%), Positives = 370/518 (71%), Gaps = 17/518 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEIS  303
             F+ ++++L  + LC            KLWW P+ IQ  M+ QGI+GPSYRF+HG+TKE+ 
Sbjct  3     FLGNMIILLFSSLCIYLIFTLVKVLHKLWWTPIRIQNFMAFQGIRGPSYRFIHGSTKEVL  62

Query  304   EARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEIL  483
               ++   +KPM   LSH++FP++LP IY+W   YG N+L W GP+   VV+E ELVKEIL
Sbjct  63    IMKKEAMAKPM--TLSHNIFPKVLPQIYTWINTYGRNYLSWYGPKAHFVVSEPELVKEIL  120

Query  484   SDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAE  663
             +++   YPK ++  + R LLG+G+ +S+GEKW + RKL+   F+ E+L+GM+P MI S E
Sbjct  121   NNKDRSYPKGDIPAYFRLLLGNGVTTSEGEKWTKHRKLSTYAFNAENLKGMIPEMIASVE  180

Query  664   TMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLN  843
              ++E W+++EG+EIE ++E RLLTSE+ISRTAFGS+Y+EGK+IF+ML KL  +  +N   
Sbjct  181   MLLERWKQNEGREIEVYQELRLLTSEIISRTAFGSSYVEGKSIFDMLTKLSLIIHRNIYK  240

Query  844   VRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLE  1020
             +R PG+S+  +  DE+ESEKL +G+ N +++IIKKRE+  KTGE       +DFL  LL 
Sbjct  241   LRLPGISKFWRTQDEIESEKLVKGIHNSVMEIIKKREEKVKTGEADGFG--NDFLGVLLN  298

Query  1021  ANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVF  1200
             + H  +   +I IE +VDECKTFY AG E+T SLL W  LLL  H DWQE ARKEV  +F
Sbjct  299   SYHDADEKKRISIEDLVDECKTFYIAGQESTNSLLSWTILLLGIHTDWQEEARKEVFNIF  358

Query  1201  GQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPL  1380
             GQ+ P   GIA+LKI+ MI+ ETLRLYPPV  + RKVE++ V +G +TLP N++LYI+  
Sbjct  359   GQQKPNLDGIAKLKILTMIINETLRLYPPVLGLMRKVERE-VQIGQLTLPANMNLYIANA  417

Query  1381  ALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVL  1560
             AL HDPEIWG+DVH FKPERF+ GV KATNN P AF PFG GPRTC+GLNFA  EAKI L
Sbjct  418   ALHHDPEIWGEDVHLFKPERFSGGVAKATNNIPAAFFPFGLGPRTCVGLNFATTEAKITL  477

Query  1561  SMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SMILQ+Y   LS +Y HSP +   L P++GVQVILH +
Sbjct  478   SMILQKYLFTLSPTYTHSPYEAVTLCPRNGVQVILHSL  515



>gb|KCW86467.1| hypothetical protein EUGRSUZ_B03135 [Eucalyptus grandis]
Length=515

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/508 (56%), Positives = 377/508 (74%), Gaps = 8/508 (2%)
 Frame = +1

Query  160   ISSLLVLAAAW----LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             +SSL V    W    L  +LWW P+ IQ+ M+ QGIKGP YRFLHG+T+E  + R    S
Sbjct  9     LSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGSTRETMKMRMEARS  68

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM DDLSHD+ P++ PHI SW   YG N++ W G Q +LV+TE EL+KE+L +R   +P
Sbjct  69    TPM-DDLSHDILPKVQPHIDSWINTYGRNYINWYGAQAQLVITEPELIKEVLINRDKTFP  127

Query  508   KIELQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             K   + F++ LLGDG+ S+  G KWA+ R+LAN+ FHGESL+ M+PAM++SA  M+E W+
Sbjct  128   KTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMVDSAHVMLEKWK  187

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             + EG+EIE FEEF+LLTSEVISRTAFGS+Y+EG+NIFEM+  L  L S+N L +RFPG+S
Sbjct  188   QREGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMMTNLGLLVSRNALRMRFPGIS  247

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             +I K  DE+E+EKL++G+   I++I KKRE+ K    +     +DFL +L++A H  +  
Sbjct  248   KIWKTVDEIEAEKLKKGIHVAILEIAKKREK-KVMAGEADDYGNDFLGQLVKAYHDNDES  306

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I I+ +VDECKTFYFAG ETTT++L W   LLA H DWQE ARKEV++VFG E+P   
Sbjct  307   KKITIDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVLDVFGNEDPDFD  366

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GIA+L++++MI+ E LRLYPPV    RKV+++ + LG + LPPN  ++I+ L + HDPEI
Sbjct  367   GIAKLRMISMIMNEALRLYPPVIGFSRKVDQQ-LRLGKLVLPPNTQVFIANLKIHHDPEI  425

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+DVH F+PERF+EGV KATNN+ + FLPFG+GPR C+G+NFAM EAKIVLSMILQRY+
Sbjct  426   WGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKIVLSMILQRYT  485

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
               LS  Y+HSPVQ+  +RP+ G+QVILH
Sbjct  486   FILSPGYIHSPVQILTIRPQHGLQVILH  513



>ref|XP_007222983.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
 gb|EMJ24182.1| hypothetical protein PRUPE_ppa004319mg [Prunus persica]
Length=516

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/509 (55%), Positives = 370/509 (73%), Gaps = 9/509 (2%)
 Frame = +1

Query  160   ISSLLVL---AAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK  330
             +SS+L++   A   L  K WW P   QK M  QG+KGPSYR +HGNTKEI   ++   S+
Sbjct  13    VSSMLLVFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYRLIHGNTKEIMSMKKEAMSR  72

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             P    LSHD+F  + PH + W +++G NFL W G QP+LV+ E EL KEI++++   + K
Sbjct  73    P--RSLSHDIFSAVQPHTHKWSKIFGRNFLQWHGTQPQLVIAEPELSKEIMNNKDKLFRK  130

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
              + QG+ ++LLGD I  ++GEKW ++RKLAN+ FHGESL+GM+P MI S+ETM+E W  H
Sbjct  131   QKSQGYVKKLLGDSISMAEGEKWVKLRKLANHAFHGESLKGMIPEMITSSETMLERWVNH  190

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIE +EEFRL TSEVISRTAFG++YL+GKNIFEML +L  L  KN  ++R P +SR 
Sbjct  191   EGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRF  250

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
              K +DE++SEKLE+G+RN I  I++KRE    TGE     R  DFL  LL+A+H  N + 
Sbjct  251   YKTSDEIKSEKLEKGIRNTIAGIVRKRESMAMTGEADGFGR--DFLGVLLKAHHDTNENQ  308

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ +VDECKTFYFAG ETT SLL W   LLA   DWQE ARKEV+++FG+ENP P G
Sbjct  309   RISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDG  368

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             + +LK M+MIL E+LRLYPPV  + R+ +K+ V LG + +P N+ +++  L+L HDP+ W
Sbjct  369   LNKLKTMSMILNESLRLYPPVVSLVRETDKE-VRLGKMVVPANVEVHVPNLSLHHDPKYW  427

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G+DV+ FKPERF+EGV KATNN+ +AF+PFG G RTC+G+NFA+ E+KI L+MILQRYS 
Sbjct  428   GEDVNVFKPERFSEGVAKATNNNMVAFIPFGLGSRTCVGMNFAIVESKIALAMILQRYSF  487

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              LS  YVHSP+Q   +RP+ GV VILH +
Sbjct  488   TLSPGYVHSPIQFMTVRPQRGVPVILHSL  516



>ref|XP_008367032.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/505 (56%), Positives = 361/505 (71%), Gaps = 5/505 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+    VL    +  KLWW P  IQK M+ QGIKGP YR +HGNTKEI +  +   SKP 
Sbjct  14    FLCVFFVLVIIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEIFDMIKEAMSKPX  73

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             +  LSHD+FP + PH++SW R YG N+L W G QP+LV+TE EL +EIL+++   YPK E
Sbjct  74    K--LSHDIFPIVQPHMHSWTRTYGXNYLQWQGSQPQLVITELELCREILNNKDRAYPKSE  131

Query  517   LQGFSRRLLGDGI-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
               GF R+LLGDG+  ++ GEKW +MRKL  + FHGESL+ M   M+ SAET++E W+ +E
Sbjct  132   PTGFLRKLLGDGLLTTAXGEKWKKMRKLGTHAFHGESLKSMFTEMVASAETILERWKSYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEF+L TSEVIS TAFGS+Y+EG+NIFEML KL  L  K+   +R PG+S+  
Sbjct  192   GKEIEVFEEFKLFTSEVISXTAFGSSYIEGQNIFEMLTKLTLLFFKSVYTIRLPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K++DE+E+EKLE+G+   I +I KKRE+ K+  + + S  SDFL  LL+A+H  N + +I
Sbjct  252   KSSDEIEAEKLEKGIHASIAEIFKKREK-KSLTKGRDSFGSDFLGLLLKAHHDANDNQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ MVDECK+FY AG ETT +LL W   LLA H DWQE ARKEVM++FG++ P P GIA
Sbjct  311   SVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTDWQEEARKEVMDLFGKQTPNPDGIA  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
              LK M+MIL E+LRLY PV    R+V K+ V LG + +P N  L++  LAL  DP+IWG+
Sbjct  371   NLKTMSMILNESLRLYSPVVGFVREV-KREVKLGKLIVPANCELFVPNLALHRDPQIWGE  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D   FKPERF+E V KATNN+  AF+PFG GPR+C+GLNFA  EAKIVLSMILQRYS  L
Sbjct  430   DALLFKPERFSEXVAKATNNNVXAFIPFGIGPRSCVGLNFANTEAKIVLSMILQRYSFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S  YVH PVQ   + PK GVQV+LH
Sbjct  490   SPGYVHLPVQYVTIHPKLGVQVMLH  514



>ref|XP_008243777.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1030

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/507 (56%), Positives = 376/507 (74%), Gaps = 5/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ I+KLM+ QGIKGPSYRF +GNTKEIS  ++ +  +P 
Sbjct  528   FLCLLLVLAFIKILHKLWWTPIRIKKLMALQGIKGPSYRFFYGNTKEISNMKKEVMGRP-  586

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   + PHI+SW ++YG N+L W G + +LV+TE EL KEIL++R   Y K E
Sbjct  587   -QLLSHDILSVVQPHIHSWTKIYGKNYLQWHGSRAQLVITEPELCKEILNNRGRAYSKRE  645

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                  ++LLGDG + +++ EKWA++RKLA + FHGESL+ M+P M+ SAETM+E W  +E
Sbjct  646   PPHLVKKLLGDGLVATTEAEKWAKLRKLATHAFHGESLKSMIPEMVASAETMLERWTVYE  705

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y+EG++IFEML+KL  L  KN L VR PG+S+  
Sbjct  706   GKEIEVFEEFRLFTSEVISRTAFGSSYVEGQDIFEMLMKLGFLIFKNILKVRIPGISKFF  765

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ES+KLE+G+   II++++KRE+ KT   +K+S  SDFL  LL+ANH+ N + +I
Sbjct  766   KTSDEIESDKLEKGIHASIIELVRKREK-KTMAVEKNSFGSDFLGLLLKANHEANKNQRI  824

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG++ P   GI 
Sbjct  825   SVDELIDECKTFYFAGQETTNTLLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIG  884

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ E LRLYPP  ++ R +E++ V LG + +P N+ L +S +AL HDP+IWG+
Sbjct  885   KLKTMSMIINEALRLYPPAVWVMRNIERE-VRLGKLIVPSNLELVVSIVALHHDPQIWGQ  943

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNNH  AF+PFG GPRTC+GLNFA  EAKI LSMILQ+Y+  L
Sbjct  944   DVQLFKPERFSEGVAKATNNHVGAFIPFGLGPRTCVGLNFATTEAKIALSMILQQYAFTL  1003

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  YVH P+    +RP+ GVQV+LH +
Sbjct  1004  SPVYVHLPLHYLTVRPQHGVQVMLHSL  1030


 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/503 (55%), Positives = 368/503 (73%), Gaps = 5/503 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ +Q+LM+ QGIKGPSYRF+HGN KEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRMQRLMALQGIKGPSYRFIHGNIKEISNMKKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PHI+SW ++YG NFL W G + +LV+T  EL KEIL+++   YPK E
Sbjct  73    -HILSHDIFSVVQPHIHSWTKIYGKNFLQWHGSRAQLVITAPELCKEILNNKDRAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                 S++LLGD  + +++  KWA++R+LA + FHG+SL+ M+P M+ SAE M+E W+ +E
Sbjct  132   PTKISKKLLGDSLVATTEARKWAKLRRLATHAFHGDSLKSMIPEMVASAENMLERWKVYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +EEFRL TSEVISRTAFGS+Y EG++IF ML+KL +L  KN   VR PG+S + 
Sbjct  192   GKEIEVYEEFRLFTSEVISRTAFGSSYTEGQDIFGMLMKLGSLVFKNIFKVRVPGISELF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ESE+LE+G+   I +++KKRE TKT   +  S  SDFL  LL+ANH+ N + +I
Sbjct  252   KTSDEIESEQLEKGIHASITEMVKKRE-TKTMTGENDSFGSDFLGLLLKANHETNENQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG+E P   GI 
Sbjct  311   SVQEIIDECKTFYFAGQETTNTLLAWTVFLLALHTDWQEEARKEVLQLFGKETPNLDGIG  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +L IM+MI+ ETLRLYPP  ++ R VE++ V LG + +P N+ L +S +AL HDP+IWG+
Sbjct  371   KLTIMSMIINETLRLYPPAVFVLRNVERE-VKLGKLIVPSNLELVVSIIALHHDPQIWGQ  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNN+  AF+PF  GPRTC+GLNFA  EAKI LSMILQRY+  L
Sbjct  430   DVQLFKPERFSEGVAKATNNYVGAFIPFSMGPRTCVGLNFATTEAKIALSMILQRYAFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVI  1662
             S  YVHSP     +RP+ GVQV+
Sbjct  490   SPGYVHSPFHHLTVRPQHGVQVL  512



>ref|XP_011070908.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=514

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/510 (54%), Positives = 374/510 (73%), Gaps = 9/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCE---KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             F S++L+     L +   K+WW PV +Q  MSSQGI+GP YRF HGNTKEIS  R     
Sbjct  10    FFSTMLLYLLQTLIKFLHKVWWGPVQLQAKMSSQGIRGPPYRFPHGNTKEISYMRTQSME  69

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
             KPM   +SHD+FPRI PH+Y+W + YG NFL W G + +L VTE EL+KEIL +R G +P
Sbjct  70    KPMA--ISHDIFPRIQPHVYAWTKAYGKNFLNWHGSECQLFVTEPELIKEILMNRDGAFP  127

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             K+++ G++++LLG+ + +++GEKWA++RKLAN+ FH ESL+ M+P M  S E M+  W+ 
Sbjct  128   KMDMDGYAKKLLGEALITNEGEKWAKIRKLANHTFHAESLKRMVPKMSSSIEEMLGRWKN  187

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
             +EGKEI+ F+EF LLT+EVISRTAFG+ Y++GK+ FEM+ KL  L  +N   VRFPG+S 
Sbjct  188   YEGKEIDVFKEFGLLTTEVISRTAFGNRYVDGKHTFEMVAKLTALTVRNIYKVRFPGISM  247

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             ++K++DE+E++KL++ +++ I++I+KKRE   K GE Q  S  SD+L +L+E  H+ +  
Sbjct  248   VLKSDDEVEAKKLQQRIKSSILEIVKKREINVKDGEFQ--SFGSDYLGQLVEMTHESDVK  305

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I  + M+DE K  Y AGH TTT+LLGW  LLLAT+ +WQ+RAR+EV   FG+++P   
Sbjct  306   KRITTDQMIDEIKAMYGAGHLTTTNLLGWCVLLLATNTEWQDRAREEVNRTFGRKSPDSD  365

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GIARLKI+NM++ E LRLYPPV  + RKV K+   +G + +PP I++YIS LAL H+PEI
Sbjct  366   GIARLKIINMVINECLRLYPPVLTVTRKVAKE-AKIGELRIPPKINIYISILALHHNPEI  424

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WGKDVH F+PERFAEGV KATNN+  AFLPFG GPRTC+GLNF   EAK+ LSMILQ+Y 
Sbjct  425   WGKDVHLFRPERFAEGVAKATNNNTAAFLPFGLGPRTCVGLNFTTNEAKVALSMILQKYK  484

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               LS +Y H P  +F+L PK GVQVIL  I
Sbjct  485   FVLSPNYAHHPADVFILTPKHGVQVILETI  514



>gb|KCW82725.1| hypothetical protein EUGRSUZ_C04102 [Eucalyptus grandis]
Length=508

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 360/492 (73%), Gaps = 6/492 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQ+ M+SQGI+GP Y+  +GNT EI + +   +S+P+  +LSHD+FPR+ PH
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTLEILQFKNETSSRPL--NLSHDIFPRVQPH  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I +W   YGAN+L W G  P L+VTE EL+KE+L+++   +PK E+  F ++LLGDG+ +
Sbjct  80    ISTWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVT  139

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE
Sbjct  140   AEGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSE  199

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             +ISRTAFGS+Y+EG+NIFEML KL  +AS+N   +R PG+S++ K NDELESEKLE G+R
Sbjct  200   IISRTAFGSSYVEGRNIFEMLRKLTLIASRNAFKIRLPGISKLWKTNDELESEKLENGIR  259

Query  922   NGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + +++II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY A
Sbjct  260   DAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIA  317

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             GHET+ ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK M MI+ E+LRL
Sbjct  318   GHETSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPYPDGIAKLKTMGMIINESLRL  377

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             YPPV  + RKV  K   LG + LP N+ LYI  L L H+P+IWG D   FKPERF+EGV 
Sbjct  378   YPPVVGLIRKVATK-TRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVA  436

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KATNN+  AF PFG GPRTC+G NFA AEAKI LSMILQRY+ +LS +YVHSP QL    
Sbjct  437   KATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTS  496

Query  1639  PKDGVQVILHRI  1674
             P+ G+QVI H +
Sbjct  497   PQHGLQVIFHAL  508



>ref|XP_010044379.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86464.1| hypothetical protein EUGRSUZ_B03132 [Eucalyptus grandis]
Length=515

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/508 (55%), Positives = 376/508 (74%), Gaps = 8/508 (2%)
 Frame = +1

Query  160   ISSLLVLAAAW----LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             +SSL V    W    L  +LWW P+ IQ+ M+ QGIKGP YRFLHG+T+E  + R    S
Sbjct  9     LSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGSTRETMKMRMEARS  68

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM DDLSHD+ P++ PHI SW   YG N++ W G Q +LV+TE EL+KE+L +R   +P
Sbjct  69    TPM-DDLSHDILPKVQPHIDSWINTYGRNYISWYGAQAQLVITEPELIKEVLINRDKTFP  127

Query  508   KIELQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             KI  + F++ LLGDG+ S+  G KWA+ R+LAN+ FHGESL+ M+PAM++SA  M+E W+
Sbjct  128   KIGPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMVDSAHVMLEKWK  187

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             + EG+EIE FEEF+LLTSEVISRTAFGS+Y+EG+NIFEML  L  L S+N L +RFPG+S
Sbjct  188   QQEGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMLTNLGLLVSRNALRMRFPGIS  247

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             +I K  DE+E+EKL++G+   I++I KKRE+ K    +     +DFL +L++A    +  
Sbjct  248   KIWKTADEIEAEKLKKGIHVAILEIAKKREK-KVMAGEADDYGNDFLGQLVKAYRDNDES  306

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I ++ +VDECKTFYFAG ETTT++L W   LLA H DWQE ARKEV++VFG E+P   
Sbjct  307   KKITVDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVIDVFGNEDPNSD  366

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GIA+L++++MI+ E LRLYPPV    RKV+++ + L  + LPPN  ++I+ L + HDPEI
Sbjct  367   GIAKLRMISMIMNEALRLYPPVTGFTRKVDQQ-LRLRKLVLPPNTQVFIANLKIHHDPEI  425

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+DVH F+PERF+EGV KATNN+ + FLPFG+GPR C+G+NFAM EAKIVLSMILQRY+
Sbjct  426   WGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKIVLSMILQRYT  485

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
               LS  Y+HSPVQ+  +RP+ G+QVILH
Sbjct  486   FILSPGYIHSPVQILTIRPQHGLQVILH  513



>ref|XP_008364583.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/506 (57%), Positives = 369/506 (73%), Gaps = 6/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +   LV     +  KLWW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    LLCVFLVFVLIKILHKLWWXPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTE-AELVKEILSDRKGDYPKI  513
               +LSHD+   ++PHI+SW ++YG N+L W G   +LV+TE  EL KEI+S++   YPK 
Sbjct  73    -KNLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELWKEIMSNKDKAYPKR  131

Query  514   ELQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
             E   F ++LLGDG + +++GEKW ++RKLA + FHGE L+ + P M+ SAETM+E WR +
Sbjct  132   EPTTFVKKLLGDGLVTTTEGEKWGKLRKLATHAFHGECLKSLFPDMVASAETMLERWRNY  191

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             E KEIE FEEFRLLTSEVISRTAFGS+YLEG+NIFEML+KL  L SKN L VR PG+S+ 
Sbjct  192   EEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKNALKVRIPGISKF  251

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K +DE+E+EKLE+GV   I++I+KKRE+T T  ++  S  SDFL  LL+A H  N D +
Sbjct  252   FKTSDEIEAEKLEKGVYASIMEIVKKREKTATSGDE-DSFGSDFLGLLLKARHDANDDQR  310

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +VDECKTFYFAG ETT +LL W   LLA H +WQE ARKEV+E+FG++ P   GI
Sbjct  311   ISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTNWQEEARKEVIELFGKQTPNLDGI  370

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +LK M+MI  E+LRLYPPV    RKVE++ V LGN+ +P N+ L IS  +  HDP IWG
Sbjct  371   TKLKTMSMIFNESLRLYPPVAGFARKVERE-VRLGNVIVPANVXLXISXJSFHHDPRIWG  429

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D   FKPERFAEGV KATNN+  AF+PFG GPR+C+GLNFA+ EAKI LSMILQRYS  
Sbjct  430   QDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSFT  489

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVH P+Q   +RP+ GVQV+LH
Sbjct  490   LSPGYVHLPIQYVTVRPQHGVQVMLH  515



>ref|XP_010044380.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=545

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/508 (56%), Positives = 377/508 (74%), Gaps = 8/508 (2%)
 Frame = +1

Query  160   ISSLLVLAAAW----LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             +SSL V    W    L  +LWW P+ IQ+ M+ QGIKGP YRFLHG+T+E  + R    S
Sbjct  39    LSSLFVFLILWSLTELARQLWWNPLRIQRTMARQGIKGPPYRFLHGSTRETMKMRMEARS  98

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM DDLSHD+ P++ PHI SW   YG N++ W G Q +LV+TE EL+KE+L +R   +P
Sbjct  99    TPM-DDLSHDILPKVQPHIDSWINTYGRNYINWYGAQAQLVITEPELIKEVLINRDKTFP  157

Query  508   KIELQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             K   + F++ LLGDG+ S+  G KWA+ R+LAN+ FHGESL+ M+PAM++SA  M+E W+
Sbjct  158   KTVPRSFAKYLLGDGLVSTIDGVKWAKKRRLANHTFHGESLKNMVPAMVDSAHVMLEKWK  217

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             + EG+EIE FEEF+LLTSEVISRTAFGS+Y+EG+NIFEM+  L  L S+N L +RFPG+S
Sbjct  218   QREGEEIEVFEEFKLLTSEVISRTAFGSSYVEGRNIFEMMTNLGLLVSRNALRMRFPGIS  277

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             +I K  DE+E+EKL++G+   I++I KKRE+ K    +     +DFL +L++A H  +  
Sbjct  278   KIWKTVDEIEAEKLKKGIHVAILEIAKKREK-KVMAGEADDYGNDFLGQLVKAYHDNDES  336

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I I+ +VDECKTFYFAG ETTT++L W   LLA H DWQE ARKEV++VFG E+P   
Sbjct  337   KKITIDDLVDECKTFYFAGQETTTAMLTWVIFLLAVHSDWQEEARKEVLDVFGNEDPDFD  396

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GIA+L++++MI+ E LRLYPPV    RKV+++ + LG + LPPN  ++I+ L + HDPEI
Sbjct  397   GIAKLRMISMIMNEALRLYPPVIGFSRKVDQQ-LRLGKLVLPPNTQVFIANLKIHHDPEI  455

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+DVH F+PERF+EGV KATNN+ + FLPFG+GPR C+G+NFAM EAKIVLSMILQRY+
Sbjct  456   WGEDVHLFRPERFSEGVSKATNNNAVVFLPFGFGPRMCVGMNFAMNEAKIVLSMILQRYT  515

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
               LS  Y+HSPVQ+  +RP+ G+QVILH
Sbjct  516   FILSPGYIHSPVQILTIRPQHGLQVILH  543



>ref|XP_010049898.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82721.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=508

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/492 (54%), Positives = 362/492 (74%), Gaps = 6/492 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQ+ M+SQGI+GP Y+  +GNT+EI + +   +S+P+  +LSHD+FPR+ PH
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL--NLSHDIFPRVQPH  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I +W   YGAN+L W G  P L+VTE EL+KE+L+++   +PK E+  F ++LLGDG+ +
Sbjct  80    ISTWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVT  139

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE
Sbjct  140   TEGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSE  199

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             +ISRTAFGS+Y+EG+NIFEML KL  +AS+N   +RFPG+S++ K NDELESEKLE G+R
Sbjct  200   IISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIR  259

Query  922   NGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + +++II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY A
Sbjct  260   DAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIA  317

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G++T+ ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK M MI+ E+LRL
Sbjct  318   GYDTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLKTMGMIINESLRL  377

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             YPPV  + RK+  K   LG + LP N+ LYI  L L H+P+IWG D   FKPERF+EGV 
Sbjct  378   YPPVVGLIRKIATK-TRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVA  436

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KA+NN+  AF PFG GPRTC+G NFA AEAKI LSMILQRY+ +LS +YVHSP QL    
Sbjct  437   KASNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTS  496

Query  1639  PKDGVQVILHRI  1674
             P+ G+QVI H +
Sbjct  497   PQHGLQVIFHAL  508



>ref|XP_007223262.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
 gb|EMJ24461.1| hypothetical protein PRUPE_ppa004463mg [Prunus persica]
Length=508

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/508 (56%), Positives = 366/508 (72%), Gaps = 15/508 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+   ++LA      K+WW P HIQ LM+ QGIKGPSYR +HGNTKEI   +      P 
Sbjct  14    FLCLFVLLALIKALHKVWWTPRHIQNLMALQGIKGPSYRLIHGNTKEIFNMKMETMGSPR  73

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LS DV   + PHI SW ++YG N+L W G Q +LV+ E +L KEILS++ G YPK E
Sbjct  74    --NLSDDVLSAVQPHIRSWTKIYGKNYLQWHGSQAQLVIMEPQLCKEILSNKDGAYPKRE  131

Query  517   LQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
              +G+ ++L+GD +G++ + +KW+++RKLAN  FHGESL+ M+PAMI SAETM++ W+ HE
Sbjct  132   PEGYVKKLVGDSMGTTNQADKWSKVRKLANQAFHGESLKSMIPAMIASAETMLDGWKNHE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +E+FRL TSEVISRTAF S+YLEGK+ F+ L+KL  L  KN   VRFPG+S+I 
Sbjct  192   GKEIEVYEQFRLFTSEVISRTAFSSSYLEGKSFFDNLMKLSFLLVKNSFKVRFPGISKIF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K++D++ESEKL++ +R+ II I+KKRE+   TGEE K    +D+L  LL+A H +  D  
Sbjct  252   KSSDDIESEKLDKAMRDFIIAIVKKREKAATTGEENKFG--NDYLGLLLKA-HLDTND--  306

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
                  +VDECKTFYFAG ET+  LL W   LLA H DWQE ARKEV+++FG++NPT   I
Sbjct  307   -----LVDECKTFYFAGQETSNGLLAWIIFLLALHTDWQEEARKEVLQLFGKQNPTHDDI  361

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             ++LK M+MI+ E+LRLYP V  I RKV ++ V LG + +P N+ L IS LAL H+PE WG
Sbjct  362   SKLKTMSMIINESLRLYPSVLSIDRKVTRE-VKLGRLVVPANVELLISCLALHHEPEFWG  420

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              DVH FKP+RF+EGV KATNN+  AFLPFG GPRTC+G NFA  EAKI LSMILQRY   
Sbjct  421   DDVHLFKPDRFSEGVAKATNNNIAAFLPFGMGPRTCVGFNFATIEAKIALSMILQRYQFT  480

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             LS  YVHSPV    +RP+ GVQV+LH++
Sbjct  481   LSPGYVHSPVDYLTIRPQHGVQVMLHKL  508



>ref|XP_007034363.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05289.1| Cytochrome P450 [Theobroma cacao]
Length=559

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/536 (52%), Positives = 380/536 (71%), Gaps = 7/536 (1%)
 Frame = +1

Query  76    LKFCR*SFGNYYCRLIKmmmmmiiiiiFISSL---LVLAAAWLCEKLWWAPVHIQKLMSS  246
             + FC   FG  + +  KM +++ + I+  SS    L++A   +  + WW P+ IQ L+SS
Sbjct  24    VSFCYVPFGKSHLQEKKMNVIVKLAILLTSSFCLYLLVALVKVLHQYWWVPLRIQHLLSS  83

Query  247   QGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYW  426
             QGIKGP YRF+HGN KE++  R+   SK M   L+HD+FP++LPH+YSW  +YG N+L+W
Sbjct  84    QGIKGPPYRFIHGNNKEVNHFRKEALSKHMA--LTHDIFPKVLPHVYSWINIYGKNYLFW  141

Query  427   LGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANN  606
              G Q ++ +TE ELVKE+L + +  +PK +   +  RLLGDG+ +++G+KWA+ RKLAN+
Sbjct  142   DGIQAQVAITEPELVKEVLKNSEKAFPKQKPPIYFSRLLGDGLATTEGKKWAKQRKLANH  201

Query  607   VFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGK  786
              FHGESL+ M PA+I S E M+E W+  EGKEIE F+EFRLLTSEVISRTAFGS+YLEGK
Sbjct  202   AFHGESLKNMTPAVIASVERMLEQWKGQEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGK  261

Query  787   NIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKT  966
              IF+ML++L  + S++    R PG+S+  K +D++ESEKL +G+ + +++I+KKRE  K 
Sbjct  262   KIFDMLMELSIIVSRSLFKARIPGISKFWKTDDDIESEKLAKGIHDSVMEIVKKRED-KV  320

Query  967   GEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLL  1146
                +  S  SDFL  L+ + H  +  N++ +E +VDECKTFYFAG ETT SLL W   LL
Sbjct  321   VSGEADSFGSDFLGLLIASYHDLDDKNRLSVEDLVDECKTFYFAGQETTNSLLAWTVFLL  380

Query  1147  ATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNV  1326
             A H DWQE+AR+EV+E+FG +NP   G+A+LK + MI+ ETLRLY PV  + RKV ++ V
Sbjct  381   AVHRDWQEKARREVIEIFGNQNPHSEGLAKLKTITMIMYETLRLYAPVNGLGRKVGRE-V  439

Query  1327  VLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYG  1506
              LG + LP  I   I  +AL HDP++WG DVH FKPERFAEG+ KAT  +  AF+PFG G
Sbjct  440   QLGKLVLPAGIEFMIPNMALHHDPQLWGDDVHLFKPERFAEGIAKATKYNAAAFIPFGLG  499

Query  1507  PRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             PR+C+G++FA  E K  LSMILQRY++ALS +YVHSPV    LRP+ G+QVIL  +
Sbjct  500   PRSCVGMSFATTETKTALSMILQRYTIALSPAYVHSPVSNLTLRPQHGIQVILQSL  555



>ref|XP_007224155.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
 gb|EMJ25354.1| hypothetical protein PRUPE_ppa016800mg, partial [Prunus persica]
Length=493

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/495 (55%), Positives = 361/495 (73%), Gaps = 6/495 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  K WW P   QK M  QG+KGP YR +HGNTKEI   ++   S+P    LSHD+FP +
Sbjct  4     LFYKQWWTPNRFQKFMDLQGVKGPFYRLIHGNTKEIMSLKKEAMSRPR--SLSHDIFPAV  61

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PH + W +++G NFL W G QP+LV+ E EL KE+++++   + K + QG+ ++LLGD 
Sbjct  62    QPHTHKWSKIFGTNFLQWHGTQPQLVIAEPELSKEVMNNKDKLFRKQKSQGYVKKLLGDS  121

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             I  ++GEKW ++RKLAN+ FHGESL+ M+P MI S+ETM+E W  HEGKEIE +EEFRL 
Sbjct  122   ISMAEGEKWVKLRKLANHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIEVYEEFRLF  181

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSEVISRTAFG++YL+GKNIFEML +L  L  KN  ++R P +SR  K +DE++SEKLE+
Sbjct  182   TSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKTSDEIKSEKLEK  241

Query  913   GVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             G+R+ I  I++KRE   KTG+        DFL  LL+A+H  N + +I ++ +VDECKTF
Sbjct  242   GIRDIIAGIVRKRESMAKTGDADGFGH--DFLGVLLKAHHDTNENQRISVDDIVDECKTF  299

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             YFAG ETT SLL W   LLA   DWQE ARKEV+++FG+ENP P G+ +LK M+MIL E+
Sbjct  300   YFAGQETTNSLLAWTIFLLALDTDWQEEARKEVLQLFGKENPNPDGLNKLKTMSMILNES  359

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPPV  + R+ +K+ V LG + +P N+ +++  L+L HDP  WG+DV+ FKPERF+E
Sbjct  360   LRLYPPVVSLVRETDKE-VRLGKMVVPANVEVHVPNLSLHHDPTYWGEDVNVFKPERFSE  418

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV KATNN+ +AF+PFG GPRTC+G+NFA+ EAKI L+MILQRYS  LS  YVHSP+Q  
Sbjct  419   GVAKATNNNIVAFIPFGLGPRTCVGMNFAIVEAKIALAMILQRYSFTLSPGYVHSPIQFM  478

Query  1630  MLRPKDGVQVILHRI  1674
              +RP+ GV VILH +
Sbjct  479   TVRPQRGVPVILHSL  493



>ref|XP_008243804.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/509 (54%), Positives = 369/509 (72%), Gaps = 9/509 (2%)
 Frame = +1

Query  160   ISSLLVL---AAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK  330
             +SS+L++   A   L  K WW P   QK M  QG+KGPSYR +HGNTKEI   ++   S+
Sbjct  13    VSSMLLVFLVALIRLFGKQWWTPNRFQKFMDLQGVKGPSYRLIHGNTKEIMSMKKEAMSR  72

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             P    LSHD+F  + PH + W  ++G NFL W G QP+LVV E EL KE+++++   + K
Sbjct  73    P--RSLSHDIFSAVQPHTHKWSEIFGRNFLQWHGTQPQLVVAEPELSKEVMNNKDKLFRK  130

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
              + QG+ ++LLGD I  ++GEKW ++RKLAN+ FHGESL+ M+P MI S+ETM+E W  H
Sbjct  131   QKSQGYVKKLLGDSISMAEGEKWVKLRKLANHAFHGESLKSMIPDMITSSETMLERWVNH  190

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIE +EEFRL TSEVISRTAFG++YL+GKNIFEML +L  L  KN  ++R P +SR 
Sbjct  191   EGKEIEVYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRF  250

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
              K +DE++SEKLE+G+R+ I  I++ RE    TGE     R  DFL  LL+A+H  N + 
Sbjct  251   YKTSDEIKSEKLEKGIRDTIAGIVRTRESMAMTGEADGFGR--DFLGVLLKAHHDTNENQ  308

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ +VDECKTFYFAG ETT SLL W   LLA + DWQE ARKEV+++FG+ENP P G
Sbjct  309   RISVDDIVDECKTFYFAGQETTNSLLAWTIFLLALNTDWQEEARKEVLQLFGKENPNPDG  368

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             + +LK M+MIL E+LRLYPPV  + R+ +K+ V LG + +P N+ +++  L+L HDP+ W
Sbjct  369   LNKLKTMSMILNESLRLYPPVVSLVRETDKE-VRLGKMVVPANVEVHVPNLSLHHDPKYW  427

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G+DV+ FKPERF+EGV KATNN+ +AF+PFG GPRTC+G+NFA+ E+KI L+MILQRYS 
Sbjct  428   GEDVNVFKPERFSEGVAKATNNNMVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSF  487

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              LS  YVHSP+Q   +RP+ GV VILH +
Sbjct  488   TLSPGYVHSPIQFMTVRPQRGVPVILHSL  516



>ref|XP_008367031.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=515

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/508 (54%), Positives = 364/508 (72%), Gaps = 9/508 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+   LV     +  KLWW P  +QKLM+SQGIKGPSY+ ++GNTKEIS  ++   S P 
Sbjct  7     FLCFFLVSVLISILHKLWWKPARMQKLMASQGIKGPSYKLVYGNTKEISSMKKETMSSP-  65

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   +LPH +SW  +YG  FL W G QP+LV+ + EL KEIL ++   YPK +
Sbjct  66    -KSLSHDILSHVLPHFHSWTNVYGKYFLQWHGSQPQLVIRDPELCKEILQNKDRAYPKSK  124

Query  517   LQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             ++ + ++LLGD + ++ + EKW ++RKLAN+ FHGE+L+GMLPAM+ SAE+M+E W+ +E
Sbjct  125   IKDYPKKLLGDSVLTTPEYEKWTKLRKLANHAFHGENLKGMLPAMVASAESMLERWKNYE  184

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEF+L+TSEVIS+TAFGS+YLEGK IFE+L+KL   A KNF  VRFPG+S+  
Sbjct  185   GKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFELLMKLSFFAFKNFYTVRFPGISKFY  244

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQT---KTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             K +DE+E+EK+E+ + N +++IIKKR++    + GEE +    SD+L  LL+ +   +  
Sbjct  245   KTSDEIEAEKIEKALHNSVMEIIKKRKEKAILRNGEEDRFG--SDYLGLLLKDHDDADDK  302

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I +E ++ ECK FYFAG ETTT LL W  LLLA H DWQE+ARKEV+++FG+  P   
Sbjct  303   QRISVEDLISECKAFYFAGQETTTVLLAWTVLLLAIHADWQEKARKEVLQIFGERTPNAD  362

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GI++LK M+MIL E+LRLYPP   I R V KK   LG   +P N+ L I  LAL H+PE 
Sbjct  363   GISKLKTMSMILNESLRLYPPAVSISRTV-KKEARLGKFMVPVNLDLVIPILALHHEPEF  421

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG D   FKP+RF++GV KATNN+  AF+PFG GPRTC G+NF   EAKI LSMILQRYS
Sbjct  422   WGPDAQLFKPDRFSDGVAKATNNNMGAFMPFGMGPRTCAGMNFVANEAKIALSMILQRYS  481

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              +LS +Y HSP QL  LRP+ GVQVILH
Sbjct  482   FSLSPAYTHSPFQLLTLRPRYGVQVILH  509



>ref|XP_007034362.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY05288.1| Cytochrome P450 [Theobroma cacao]
Length=596

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/501 (54%), Positives = 364/501 (73%), Gaps = 4/501 (1%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLS  351
             L++A   +  + WW P+ IQ L+SSQGIKGP YRF+HGN KE++  R+   SK M   L+
Sbjct  96    LLIALVKVLYQYWWVPLRIQHLLSSQGIKGPPYRFIHGNNKEVNHFRKEALSKHMA--LT  153

Query  352   HDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFS  531
             HD+FP++LPH+YSW  +YG N+L+W G Q ++ +TE ELVKE+L + +  +PK +   + 
Sbjct  154   HDIFPKVLPHVYSWINIYGKNYLFWDGIQAQVAITEPELVKEVLKNSEKAFPKQKPPIYV  213

Query  532   RRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEA  711
              RLLGDG+ +++GEKWA+ RKLAN VFHGESL+ M PA+I S E M+E W+  EGKEIE 
Sbjct  214   SRLLGDGLVTTEGEKWAKQRKLANYVFHGESLKNMTPAVIASVERMLEQWKGQEGKEIEV  273

Query  712   FEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDEL  891
             F+EFRLLTSEVISRTAFGS+YLEGK IF+ML++L  + S++    R PG+S+  K +D++
Sbjct  274   FQEFRLLTSEVISRTAFGSSYLEGKKIFDMLMELSIIVSRSLFKARIPGISKFWKTDDDI  333

Query  892   ESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMV  1071
             ESEKL +G+ + +++I+KKRE  K    +  S  SDFL  L+ + H  +  N++ +E +V
Sbjct  334   ESEKLAKGIHDSVMEIVKKRED-KVVSGEADSFGSDFLGLLIASYHDLDDKNRLSVEDLV  392

Query  1072  DECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMN  1251
             DECKTFYFAG ETT SLL W  LLLA H DWQE+AR+EV+E+FG +NP   G+A+LK + 
Sbjct  393   DECKTFYFAGQETTNSLLAWTVLLLAVHRDWQEKARREVIEIFGNQNPHSEGLAKLKTIT  452

Query  1252  MILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFK  1431
             MI+ ETLRLY PV  + RKV ++ + LG + LP  I   I  +AL HDPE+WG DVH FK
Sbjct  453   MIMYETLRLYAPVNGLVRKVGRE-IQLGKLVLPAGIEFMIPNMALHHDPELWGDDVHLFK  511

Query  1432  PERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVH  1611
             PERFAEG+ KAT  +  AF+PFG GPR+C+G++FA  E K  LSMILQRY++ALS +YVH
Sbjct  512   PERFAEGIAKATKYNAAAFIPFGLGPRSCVGMSFATTETKTALSMILQRYTIALSPAYVH  571

Query  1612  SPVQLFMLRPKDGVQVILHRI  1674
             SPV    LRP+ G+QVIL  +
Sbjct  572   SPVSNLTLRPQHGIQVILQSL  592



>ref|XP_008360080.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=520

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/510 (54%), Positives = 371/510 (73%), Gaps = 9/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWL--CEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK  330
             F+   LV+  A +   +KLWW P  IQ  M++QG+ GPSY+F+HGNTKEI   +R    +
Sbjct  16    FLCLFLVILLALIKNFQKLWWTPNRIQNRMAAQGVHGPSYKFIHGNTKEIWSMKRETMGR  75

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             P    L+HD+F  + PHI++W ++YG NFL W G QP++++ E EL KE+L+++  +Y K
Sbjct  76    P--RSLTHDIFSAVQPHIHAWNKIYGKNFLQWYGVQPQMIIAEPELCKEVLNNKDRNYRK  133

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
                QG+ ++LLGD I  ++GEKW ++RKLA++ FHGESL+ M+P MI+S+ETMV+ W+ +
Sbjct  134   QRSQGYIKKLLGDSISMAEGEKWVKLRKLAHHAFHGESLKNMIPEMIKSSETMVKRWKTY  193

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIE  EEFR  TSEVISRTAFGS++LEGK+IFEML +L +L  +N   +R PG+S  
Sbjct  194   EGKEIEVNEEFRFFTSEVISRTAFGSSFLEGKDIFEMLRELTSLIFRNTFKLRLPGISMF  253

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDN  1047
              K +DE++S+KLE+G+R+ I +I++KRE+T  TGE       SD+L  LL+A+H  +   
Sbjct  254   YKTSDEIKSDKLEKGIRDSITEIVRKREKTAMTGEADGFG--SDYLGILLKAHHDAHEKQ  311

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPY  1224
             +I ++ +VDECKTFYFAG ETT SLL W   LLA H DWQE ARKEV+E+FG+ E P   
Sbjct  312   RISVDDLVDECKTFYFAGQETTNSLLAWTVFLLALHTDWQEEARKEVLELFGKDETPNSD  371

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             G+ +LK M MI+ E+LRLYPPV  + R+   K V LG + +P ++ L++S LAL H+ E 
Sbjct  372   GLNKLKTMGMIINESLRLYPPVVSLTRE-SLKEVRLGQVVVPADVELHVSNLALHHEREY  430

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WGKDV  FKPERF+EGV KATNN+ +AF+PFG GPRTC+G+NFA+ EAKI LSMILQRYS
Sbjct  431   WGKDVQLFKPERFSEGVAKATNNNAVAFMPFGMGPRTCVGMNFAIIEAKIALSMILQRYS  490

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               LS  YVHSP+Q   +RP+ GVQVILH +
Sbjct  491   FTLSPGYVHSPIQFLTVRPQHGVQVILHPV  520



>ref|XP_008243887.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103342098 
[Prunus mume]
Length=1035

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/530 (55%), Positives = 381/530 (72%), Gaps = 23/530 (4%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             LL+L+   +  KLWWAP  IQKLM+ QGIKGPSYR +HGNTKEI   +R I  +PM   L
Sbjct  19    LLLLSFLNIFYKLWWAPTRIQKLMALQGIKGPSYRPIHGNTKEILNMKREIIGRPM--SL  76

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+   + PH++SW ++YG NFL W G Q +LV+ E EL KEIL+++ G + K + Q +
Sbjct  77    SHDIVSAVRPHVHSWTKIYGMNFLQWYGSQAQLVIMEPELCKEILNNKDGAFAKRKPQSY  136

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              ++LLGDG+G++ GEKW ++RKLAN+ FH ESL+ M+P M+ SAETM+E W+  EGKEIE
Sbjct  137   VKKLLGDGLGTTDGEKWGKLRKLANHAFHAESLKSMVPEMVASAETMLEGWKNSEGKEIE  196

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              FE FR+ TSEVISRTAFGS+YLEG+N FE L+KL  L  KN L VRFPG+S+  K +DE
Sbjct  197   VFEPFRMFTSEVISRTAFGSSYLEGQNFFENLMKLSFLIFKNALTVRFPGISKFFKTSDE  256

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             +ESEKLE+G+ + II+I++KREQ     E   S  SDFL  LL+A+H  N   +I ++ +
Sbjct  257   IESEKLEKGMHDSIIEIVEKREQKAMDGE--DSFGSDFLGLLLKAHHDTNDSQRISVDDL  314

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             VDECKTFYFAG ETT S+L W   LLA + DWQE ARKEV+++FG++NP P G+++LK M
Sbjct  315   VDECKTFYFAGQETTNSMLAWTVFLLALNTDWQEEARKEVLQLFGRQNPNPDGLSKLKTM  374

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +MI+ E+LRLYPPV  ++RKV ++ V LG + +P N+ L I  LA+ H+PE WG+DV  F
Sbjct  375   SMIINESLRLYPPVVSVERKV-RREVKLGKLIVPANVELIIPILAIHHEPEFWGEDVQLF  433

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERFAEGV KATNN+  AFLPFG GPRTC+G NFA+ EAKI LSMILQRY+        
Sbjct  434   KPERFAEGVAKATNNNIAAFLPFGMGPRTCVGFNFAITEAKISLSMILQRYT-------X  486

Query  1609  HSPVQLFMLRPKDGVQVILHRI***SLLACIN-----SWFL-DNILLVST  1740
             HSP +   +RP+ GVQV+LH     SL   IN     SW L D++  VS+
Sbjct  487   HSPYEYLTVRPQHGVQVVLH-----SLGKHINQEKEMSWLLGDSMFTVSS  531


 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/502 (55%), Positives = 367/502 (73%), Gaps = 4/502 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             +++LA   +  K+WW P  IQK M  QGI GP+YR +HG+TKEI   ++   S+P   ++
Sbjct  538   VILLALIRIFRKVWWVPNRIQKFMGLQGIHGPAYRLVHGSTKEIMSMKKEAMSRP--RNM  595

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+FP + PH + W ++YG NFL W G QP+L++ E EL KEIL+++   + K + QG+
Sbjct  596   SHDIFPTVQPHTHQWTKIYGKNFLQWQGTQPQLLIAEPELSKEILNNKDRLFRKQKSQGY  655

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              ++L G+ I  ++GEKW ++RKLAN+ FHGESL+GM+P MI S ETM++ W+ HEGKEIE
Sbjct  656   VKKLFGESISMAEGEKWVKLRKLANHAFHGESLKGMVPDMITSTETMLQRWKNHEGKEIE  715

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              FEEFRLLTSEVISR+AFGS+YLEGK IF+ML++L ++  +N L  RFPG+S   K + E
Sbjct  716   VFEEFRLLTSEVISRSAFGSSYLEGKRIFDMLMELTSVIFQNALKPRFPGISMFYKTSAE  775

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             + ++KLE+G+R+ I +I+KKRE  K    +     SDFL  LL+A+H  N + +I  + +
Sbjct  776   IRADKLEKGIRDTIAEIVKKRE-NKAMNGEADEFGSDFLGVLLKAHHDTNENQRISFDDI  834

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             VDECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FGQ+ PT  GI++LK M
Sbjct  835   VDECKTFYFAGQETTNALLAWTVFLLALHPDWQEEARKEVLQLFGQQTPTLDGISKLKTM  894

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +MI+ E+LRLYPPV  + R+VE KNV LG + +P N  L++  LA  HDP+ WG+DV+ F
Sbjct  895   SMIINESLRLYPPVVSLNRQVE-KNVKLGGLVIPANAELHVPNLAFHHDPKFWGEDVNLF  953

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERF+EGV KAT N+ +AFLPFG GPRTC+G+NFA AE KI L+MILQRYS  LS  YV
Sbjct  954   KPERFSEGVAKATKNNTVAFLPFGLGPRTCVGMNFANAEVKIALAMILQRYSFTLSPGYV  1013

Query  1609  HSPVQLFMLRPKDGVQVILHRI  1674
             HSP+Q   +RP  GVQVILH +
Sbjct  1014  HSPIQYMTVRPHRGVQVILHSL  1035



>ref|XP_010049895.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82719.1| hypothetical protein EUGRSUZ_C04097 [Eucalyptus grandis]
Length=514

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 364/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  I + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE +L+KE+L +R+  YPKI  + F+++L+G
Sbjct  78    KIHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKIGTKDFAKKLVG  137

Query  547   DG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG +G+  G+KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVGTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFREF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+R PG+ R+ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIRRLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  I+ +VDEC
Sbjct  258   LEKGIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDTDKSKKFTIDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ET  S++ W   LLA + +WQE AR+EV+ VFG E+P   G+ +LK ++MI+
Sbjct  316   KTFYIAGQETANSMMTWMLFLLAINPEWQEEARREVLNVFGNEDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG + LP N  ++I  L L HDPEIWG+D H+FKPER
Sbjct  376   NETLRLYPPVVGLTRKVGKK-LRLGRLVLPANSQIFIPTLKLHHDPEIWGEDAHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F +AEAKI+LSMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVVAEAKILLSMILQRYTFELSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  495   QLLTTRPQHGLQIRFH  510



>ref|XP_011101779.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 371/505 (73%), Gaps = 5/505 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F  SL +   + L  KLW  P+H+Q+ + SQG+KGPSY+ LHGNTKEI   R+     P 
Sbjct  9     FCLSLTLAVFSRLVYKLWLGPIHMQQKLQSQGLKGPSYKLLHGNTKEIISMRKEAIKAPC  68

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
              D   HD+FPRILPH+ +W +LYG NFL W+G QP++VVTE ELV+EIL+D++G Y KI+
Sbjct  69    -DLGQHDMFPRILPHLNTWMKLYGKNFLIWIGNQPQIVVTEPELVREILTDKEGVYRKIK  127

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                ++++LLGDG+  ++GEKW+++RKLAN+ FHGESL+ M+ AM+ES +TM+E WR HEG
Sbjct  128   PISYAKKLLGDGLVVAEGEKWSKLRKLANHAFHGESLKDMVSAMVESVDTMLERWRYHEG  187

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE  +EF+LLTS+VISRTAFGS+Y+EGKNIF+M++KL  L +KN   +R  G+ +I +
Sbjct  188   KEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFDMMMKLGVLIAKNTFKIRLFGLKKIWR  247

Query  877   NNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             + D++ES+K+E+ + + I+ ++KKRE + K GE       +DFL  LL+ +H  +  ++I
Sbjct  248   SKDDIESDKIEQSLHDSILSLVKKREDKVKAGESDNFG--NDFLGSLLKVHHDIDPKSRI  305

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +VDECK FY AGHETT++LL W   LL+   +WQE+AR EV++VFGQE PT  GIA
Sbjct  306   SVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTEWQEKARDEVVQVFGQEKPTAEGIA  365

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLKI+ MI+ E LRLY PV  I R+V  +N+ LG   +P N+ + +  LAL  +PEIWGK
Sbjct  366   RLKILTMIVYEALRLYSPVLSITRRVH-RNIKLGKYEIPANVQVNVPTLALHRNPEIWGK  424

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H FKPERFAEG+  A N + +AFLPF  GPR+C+G NFA+ EAK+ LSMILQRY LAL
Sbjct  425   DAHMFKPERFAEGLANAANRNSMAFLPFAAGPRSCVGNNFAVNEAKMTLSMILQRYRLAL  484

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S +Y+H+P Q   ++P+ GVQ+ILH
Sbjct  485   SPNYIHAPYQFLTVQPQHGVQIILH  509



>ref|XP_007045779.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY01611.1| Cytochrome P450, putative [Theobroma cacao]
Length=517

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/506 (54%), Positives = 357/506 (71%), Gaps = 4/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F    L++       +LWW P +IQ L+ SQGIKGPSY F+HGNTK+I + R    SKPM
Sbjct  14    FFCLCLLIVLFRFLHRLWWTPFYIQYLLGSQGIKGPSYNFIHGNTKDILKMRNEALSKPM  73

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+FPR+ P  YSW   YG N+L W G QP+LV+TE  L+KE+L++R   YPK+ 
Sbjct  74    A--LSHDIFPRVQPQAYSWINKYGKNYLNWNGAQPQLVITETALIKEVLNNRDRAYPKVG  131

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L  +  +L+GDG+ +S+GEKWA+ RKL N VF GESL+ M+P MI S E M+E W+ HEG
Sbjct  132   LPFYVMKLMGDGLATSEGEKWAKHRKLLNYVFQGESLKNMIPEMIVSVEKMLETWKHHEG  191

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             K IE F+EFRLLTSEVISRTAFGS+YLEGKNIF+MLI    ++ +N   VRFPG+S+I K
Sbjct  192   KGIEVFDEFRLLTSEVISRTAFGSSYLEGKNIFDMLINYSVISRRNAFKVRFPGISKIWK  251

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
               D++E++KL   + N +++IIK+RE+ K       S  +DFL  LL A H  N + ++ 
Sbjct  252   TADQIEADKLLRVMHNSVMEIIKRREE-KIKNGDVDSFGTDFLGLLLNAYHDVNENKRLH  310

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             +E ++DECKTFY AG ET+ SLL W  LLLA H DWQ++AR EV+E+FG +NP P G+++
Sbjct  311   VEDLIDECKTFYIAGQETSNSLLSWTVLLLAIHTDWQQKARAEVIELFGDQNPHPDGLSK  370

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK + MI+ E LRLYPP     RK E++ V LG + LP N++L+I+ LA+ HDP+IWG D
Sbjct  371   LKTITMIINEALRLYPPAIGFIRKCERE-VRLGKLILPANLNLFITNLAVHHDPQIWGDD  429

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H F PERF+EGV KATNN+  A+ PFG GPRTC+G NFA    K+ L+MILQ ++  LS
Sbjct  430   SHVFNPERFSEGVAKATNNNVAAYFPFGIGPRTCVGFNFATVGTKVALAMILQHHTFTLS  489

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSPV  F L P+ G+QVILH +
Sbjct  490   PAYVHSPVFHFTLVPQHGIQVILHSL  515



>ref|XP_008243805.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=516

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/503 (54%), Positives = 366/503 (73%), Gaps = 6/503 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             + ++A   L  K WW P   QK M  QG+KGPSY  +HGNTKEI   ++G  S+P    L
Sbjct  19    VFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYTLVHGNTKEIMSMKKGAMSRP--RSL  76

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+F  + PH + W +++G NFL W G QP+LVV E EL KE++ ++   + K + QG+
Sbjct  77    SHDIFSAVQPHTHKWSKIFGRNFLQWYGTQPQLVVAEPELSKEVMINKDRIFRKQKSQGY  136

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
             ++++LG+ I  S+GEKW ++R+L+N+ FHGESL+ M+P MI S+ETM+E W  HEGKEIE
Sbjct  137   TKKILGESISMSEGEKWVKLRRLSNHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIE  196

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              +EEFRL TSEVISRTAFG++YL+GKNIFEML +L  L  KN  ++R P +SR  K +DE
Sbjct  197   VYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRFYKTSDE  256

Query  889   LESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEA  1065
             ++SEKLE+G+R+ I  I++KRE   KTGE        DFL  LL+A+H  N + +I ++ 
Sbjct  257   IKSEKLEKGIRDIIAGIVRKRESMAKTGEADGFGH--DFLGVLLKAHHDTNENQRISVDD  314

Query  1066  MVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI  1245
             +VDECKTFYFAG ETT SLL W   LLA + DWQE ARKEV+++FG+ENP P G+ +LK 
Sbjct  315   IVDECKTFYFAGQETTNSLLAWTIFLLALNTDWQEEARKEVLQLFGKENPNPDGLNKLKT  374

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             M+MI  E+LRLYPPV  + R+ EK+ V LG + +P N+ +++  L+L HDP+ WG+DV+ 
Sbjct  375   MSMIFNESLRLYPPVVSLIRETEKE-VRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVNV  433

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             FKPERF+EGV KATNN+ +AF+PFG GPRTC+G+NFA+ E+KI L+MILQRYS  LS  Y
Sbjct  434   FKPERFSEGVAKATNNNMVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSFTLSPGY  493

Query  1606  VHSPVQLFMLRPKDGVQVILHRI  1674
             VHSP+Q   +RP+ G+ VILH +
Sbjct  494   VHSPIQFMTVRPQHGIPVILHSL  516



>ref|XP_004303121.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=513

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/511 (53%), Positives = 369/511 (72%), Gaps = 13/511 (3%)
 Frame = +1

Query  160   ISSLLVLAAAWLC---------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEAR  312
             +  L+V+ +   C          K+WW P  IQKLM+SQGI+GP YR +HGNTKEIS   
Sbjct  4     LGGLVVIISVLFCFVALLFKTLHKIWWTPNRIQKLMASQGIRGPPYRLIHGNTKEISNMH  63

Query  313   RGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDR  492
             +   S+P+   LSH++F  + PH+ SW ++YG N+L W G   +LV+ E EL K+IL+++
Sbjct  64    KEARSRPL--GLSHNIFAYVEPHVDSWSKIYGKNYLQWHGSGAQLVIREPELCKQILNNK  121

Query  493   KGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMV  672
              G YPK   + F+++LLG G+ +++ EKW ++RK++N+ FHGESL+ M+P MI   E M+
Sbjct  122   DGAYPKKPPEDFAKKLLGYGLVTAEAEKWVKLRKISNHAFHGESLKTMIPDMIAGTEIML  181

Query  673   EAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRF  852
             E WR +EGKEIE FEEFRL TS+VISRTAFGS+YLEG++IFEML+KL  L  KN L ++ 
Sbjct  182   ERWRNYEGKEIEVFEEFRLFTSDVISRTAFGSSYLEGQHIFEMLMKLTLLLFKNSLKIKV  241

Query  853   PGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQ  1032
             PG+S+    +DE+ESEKLE+ +R+ II+++KKRE   T  E+ +S  SDFL  LL+A+H 
Sbjct  242   PGISKFFDTSDEIESEKLEKEIRDSIIELVKKREHKATSGEE-NSFGSDFLGSLLKAHHD  300

Query  1033  ENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQEN  1212
              N + +I ++ +VD+CKTFYFAG ETT +L+ W   LLA H DWQE ARKEV+++FG+EN
Sbjct  301   ANQNQRISVDDLVDDCKTFYFAGQETTNTLIAWTVFLLAHHTDWQEEARKEVLQLFGKEN  360

Query  1213  PTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQH  1392
             P P GI++LK M+MIL E+LRLYPP+  I R   ++ V LG + +P N+ L +S LA  H
Sbjct  361   PHPDGISKLKTMSMILNESLRLYPPIVGIPRNTGRE-VRLGKLIVPANVDLLVSVLAPHH  419

Query  1393  DPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMIL  1572
             +P+ WG DVH FKPERF+ GVVKATNN+  AF+PFG GPRTC+G+NFA  EAKI LSMIL
Sbjct  420   EPQFWGPDVHIFKPERFSGGVVKATNNNGGAFVPFGIGPRTCVGMNFATIEAKIALSMIL  479

Query  1573  QRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             QRYS  LS +Y+HSP     LRP+ G+QV+L
Sbjct  480   QRYSFTLSPAYIHSPTHKITLRPQYGLQVLL  510



>ref|XP_009762791.1| PREDICTED: cytochrome P450 CYP749A22-like [Nicotiana sylvestris]
Length=515

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/510 (55%), Positives = 374/510 (73%), Gaps = 8/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEK----LWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
             F  S L L   W   K    +WW P+ IQ  MS QGIKGP Y F HGNTKEIS  R    
Sbjct  10    FFFSTLCLYLLWTIIKFLYLVWWIPLQIQNRMSFQGIKGPLYSFPHGNTKEISLMRSQTM  69

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
              KPM D +SH +FPRI PH+YSW R+YG NFL W G +P L VTE EL+KEIL++++  Y
Sbjct  70    DKPMMD-ISHYIFPRIQPHVYSWTRMYGRNFLTWHGSKPYLFVTEPELIKEILANKEDTY  128

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             PK++++G++++LLG+ + +++GEKWA++RKLAN+ FH ESL+ M+P M  S +TM+E W+
Sbjct  129   PKMDMEGYAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKHMVPEMSASVQTMLEKWK  188

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             +HEGKE + F++F LLT+EVISRTAFGS+Y+EGK+IFEM+ KL  +  KN  NVRFPG+ 
Sbjct  189   KHEGKEFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNIYNVRFPGII  248

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
              +++ NDE+E+EKLE G+++ I+++++KRE+ K  +    +  +D+L +L++  H+ + +
Sbjct  249   MLIRTNDEIEAEKLERGIKSSILELVRKREKVK--DRTFENFGTDYLGQLMKLLHESDMN  306

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
               I I+ M+DE K  + AGH TTTSLLGW+  LLA H +WQE+ARKEV+E  G +NPT  
Sbjct  307   KSITIDQMIDEVKALFGAGHLTTTSLLGWSVFLLAHHPEWQEKARKEVLEFCGLKNPTSD  366

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
              I RL+ MNMIL E +RLYP V  + RKV K+ V LG++TLP N+ +++  LAL HDP+I
Sbjct  367   AITRLRTMNMILNECMRLYPRVITMTRKV-KREVRLGSMTLPANMTIFMPILALHHDPQI  425

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WGKDVH FKPERFAEGV KATNN+  AF PFG GPRTC+GLNF   EAKI LSMILQRY 
Sbjct  426   WGKDVHIFKPERFAEGVAKATNNNAAAFFPFGLGPRTCVGLNFTTNEAKIALSMILQRYK  485

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               LS +YVH+P  +F+L PKDGV+V+L  I
Sbjct  486   FTLSPNYVHNPCDIFILTPKDGVKVVLESI  515



>ref|XP_011102247.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 370/505 (73%), Gaps = 5/505 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F  SL +   + L  KLW  P+H+Q+ + SQG+KGPSY+ LHGNTKEI   R+     P 
Sbjct  9     FCLSLTLAVFSRLVYKLWLGPIHMQQKLQSQGLKGPSYKLLHGNTKEIISMRKEAIKAPC  68

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
              D   HD+FPRILPH+ +W +LYG NFL W+G QP++VVTE ELV+EIL+D++G Y KI+
Sbjct  69    -DLGQHDMFPRILPHLNTWMKLYGKNFLIWIGNQPQIVVTEPELVREILTDKEGVYRKIK  127

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                 +++LLGDG+  ++GEKW+++RKLAN+ FHGESL+ M+ AM+ES +TM+E WR HEG
Sbjct  128   PISHAKKLLGDGLVVAEGEKWSKLRKLANHAFHGESLKDMVSAMVESVDTMLERWRYHEG  187

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE  +EF+LLTS+VISRTAFGS+Y+EGKNIF+M++KL  L +KN   +R  G+ +I +
Sbjct  188   KEIEVSKEFKLLTSDVISRTAFGSSYVEGKNIFDMMMKLGVLIAKNTFKIRLFGLKKIWR  247

Query  877   NNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             + D++ES+K+E+ + + I+ ++KKRE + K GE       +DFL  LL+ +H  +  ++I
Sbjct  248   SKDDIESDKIEQSLHDSILSLVKKREDKVKAGESDNFG--NDFLGSLLKVHHDIDPKSRI  305

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +VDECK FY AGHETT++LL W   LL+   +WQE+AR EV++VFGQE PT  GIA
Sbjct  306   SVDDIVDECKVFYIAGHETTSTLLSWTVFLLSIFTEWQEKARDEVVQVFGQEKPTAEGIA  365

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLKI+ MI+ E LRLY PV  I R+V  +N+ LG   +P N+ + +  LAL  +PEIWGK
Sbjct  366   RLKILTMIVYEALRLYSPVLSITRRVH-RNIKLGKYEIPANVQVNVPTLALHRNPEIWGK  424

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H FKPERFAEG+  A N + +AFLPF  GPR+C+G NFA+ EAK+ LSMILQRY LAL
Sbjct  425   DAHMFKPERFAEGLANAANRNSMAFLPFAAGPRSCVGNNFAVNEAKMTLSMILQRYRLAL  484

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S +Y+H+P Q   ++P+ GVQ+ILH
Sbjct  485   SPNYIHAPYQFLTVQPQHGVQIILH  509



>ref|XP_007045778.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01610.1| Cytochrome P450 [Theobroma cacao]
Length=516

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/516 (54%), Positives = 365/516 (71%), Gaps = 16/516 (3%)
 Frame = +1

Query  163   SSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEA  309
             + LL+L  ++ C            + WW P  IQ  MS QGIKGP Y F+HGN K  +  
Sbjct  5     AKLLILVISFCCLFFLIALLRFFHRYWWIPFRIQYTMSLQGIKGPPYEFIHGNNKASTYM  64

Query  310   RRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSD  489
             R     KPM   L+HD+ PR++P IYSW  +YG N+L W G +P+LV+TE ELVKE+L +
Sbjct  65    RMEAYRKPMAA-LTHDIVPRVMPQIYSWINIYGKNYLTWQGIRPQLVITEVELVKEVLRN  123

Query  490   RKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETM  669
              +G + K + + F  +++GDG+ +++GEKWAR RKLAN+ FHGESL+ M PA+I S E M
Sbjct  124   SEGAFRKKKAEDFIHKIIGDGLVATEGEKWARQRKLANHAFHGESLKSMTPAVIASVEAM  183

Query  670   VEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVR  849
             +E W+  EGKEIE FEEFRLLTSEVISRTAFGS+YLEG+ IFE L+KL  +A++NF   R
Sbjct  184   LEKWKGREGKEIEVFEEFRLLTSEVISRTAFGSSYLEGEKIFEKLMKLSIIANRNFHKAR  243

Query  850   FPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEAN  1026
              PG+S+I K  DE+ESEKL +G+ + ++ ++KKRE+   TGE    S  +DFL  L++A 
Sbjct  244   IPGISKIWKPADEIESEKLAKGIHDCVMDMVKKREEKVLTGE--ADSFGTDFLGLLVKAY  301

Query  1027  HQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ  1206
             H E+  N++ +E +VDECKTFYFAG ETT SLL W  L+LA H DWQE+AR+EV+EVFG 
Sbjct  302   HDEDERNRLSVEDLVDECKTFYFAGQETTNSLLAWTVLVLAIHTDWQEKARREVIEVFGN  361

Query  1207  ENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLAL  1386
             +NP   GIA LK MN+I+ ETLRLYPPV    R+V K+ V LG + LP NI + I  +AL
Sbjct  362   KNPHSEGIANLKTMNLIINETLRLYPPVVATVREVGKE-VHLGKLVLPDNIEVLIPNMAL  420

Query  1387  QHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSM  1566
              HDP++WG DVH FKP+RFAEG  KAT  +  AF+PF  GPR+C+G++FA  E K  LSM
Sbjct  421   HHDPDLWGDDVHLFKPDRFAEGTAKATKYNAAAFIPFSLGPRSCVGMSFATTETKTALSM  480

Query  1567  ILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             ILQRY+L LS +YVHSP  + ML+P+ G+QV+LH +
Sbjct  481   ILQRYTLTLSPAYVHSPFTILMLQPQHGIQVMLHSL  516



>ref|XP_011008174.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/500 (55%), Positives = 359/500 (72%), Gaps = 5/500 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             LLV+   +L  K+WWAP  +Q  M SQGI+GP YRFL+G+T EI      +     E  L
Sbjct  16    LLVILLKFL-NKVWWAPTRVQSFMKSQGIEGPPYRFLYGSTTEILNIINAMDGGSQE--L  72

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SH+ F RILPH YSW ++YG NFLYW GPQP L+VTE E+VKEILS++ G Y KI ++  
Sbjct  73    SHNTFARILPHAYSWVKVYGMNFLYWYGPQPHLMVTEPEMVKEILSNKDGAYKKIPVETH  132

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              +RLLGDG+ +S GEKW +MRKL N  FHGESL+ M+P MI S E M++ WR HEG+EI+
Sbjct  133   VKRLLGDGLVTSSGEKWFKMRKLGNQAFHGESLKAMIPDMIASVEVMLKRWRNHEGEEID  192

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
             AF+EF++LTSEVISRTAFGS+YLEG++IF+M++ +  +  +N   +  P + +I K++D+
Sbjct  193   AFQEFKVLTSEVISRTAFGSSYLEGQHIFDMIMNMIDIIYRNNYRISIPFIGKIFKSSDD  252

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             +ESE LE+ VR  II+++KKRE+  T   Q     +DF   LL+A H  +   +I ++ +
Sbjct  253   IESENLEKRVRESIIKMMKKREEEATS-GQLDGYGNDFFGLLLKAYHDLDNSKKISVDDL  311

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             +DECKT Y AG ETTTSLL W  LLLA + DWQ+R RKEV+E+ GQ+NP P  + +LKIM
Sbjct  312   IDECKTIYVAGQETTTSLLSWTVLLLAIYPDWQDRVRKEVLELIGQQNPGPDSMTKLKIM  371

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +M++ E+LRLY P  Y+ RKV+K+ V LGN+ LP N+ +Y+S LA  ++PEIWG+DVH F
Sbjct  372   SMVINESLRLYAPSNYLARKVDKE-VRLGNLILPANMEIYMSTLAHHYNPEIWGEDVHLF  430

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERFAEGV KATN    AFLPFG GPRTCLG N+A+ E KI LSMILQ Y   LS +YV
Sbjct  431   KPERFAEGVAKATNKSIAAFLPFGMGPRTCLGFNYAIIEGKIALSMILQSYRFTLSPTYV  490

Query  1609  HSPVQLFMLRPKDGVQVILH  1668
             H PV L  + PK G+QVIL 
Sbjct  491   HHPVHLLTVCPKRGIQVILQ  510



>ref|XP_008346697.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=517

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/506 (56%), Positives = 365/506 (72%), Gaps = 6/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +   LV     +  KLWW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    LLCVFLVFVLIKILHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTE-AELVKEILSDRKGDYPKI  513
               +LSHD+   ++PHI+SW ++YG N+L W G   +LV+TE  EL K ILS++   YPK 
Sbjct  73    -KNLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELCKVILSNKDKSYPKR  131

Query  514   ELQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
             E     ++LLGDG + + + EKW ++RKLA + F+GE L+ M P M+ SAETM+E WR +
Sbjct  132   EPTTLEKKLLGDGLVTTPEAEKWGKLRKLATHAFNGECLKSMFPDMVASAETMLERWRNY  191

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             E KEIE FEEFRL TSEVISRTAFGS+YLEG+ IFEML+KL  L SKN L VR PG+S++
Sbjct  192   EEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQXIFEMLMKLAFLVSKNALXVRIPGISKV  251

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K +DE+E+EKLE+GV   I+ I KKRE+T T  ++  S  SDFL  LL+A H  N D +
Sbjct  252   FKTSDEIEAEKLEKGVYASIMDIAKKREKTATSGDE-DSFGSDFLGLLLKARHDANDDQR  310

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +VDECKTFYFAG ETT +LLGW   LLA H +WQE ARKEV+E+FG++ P   GI
Sbjct  311   ISVDDLVDECKTFYFAGQETTNTLLGWTVFLLALHTNWQEEARKEVIELFGKQTPNLDGI  370

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +LK M+MI  E+LRLYPPV    RKVE++ V LGN+ +P N+ L+IS L+  HDP IWG
Sbjct  371   TKLKTMSMIFNESLRLYPPVAGFARKVERE-VRLGNVIVPANVVLFISKLSFHHDPRIWG  429

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D   FKPERFAEGV KATNN+  AF+PFG GPR+C+GLNFA+ EAKI LSMILQRYS  
Sbjct  430   QDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSFT  489

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVH P+Q   +RP+ GVQV+LH
Sbjct  490   LSPGYVHLPIQYVTVRPQHGVQVMLH  515



>ref|XP_007224838.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
 gb|EMJ26037.1| hypothetical protein PRUPE_ppa023100mg [Prunus persica]
Length=501

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/503 (53%), Positives = 366/503 (73%), Gaps = 6/503 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             + ++A   L  K WW P   QK M  QG+KGPSY  +HGNTKEI   ++   S+P    L
Sbjct  4     VFLVALIRLFYKQWWTPNRFQKFMDLQGVKGPSYTLVHGNTKEIMSMKKEAMSRP--RSL  61

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+F  + PH + W +++G NFL W G QP+LVV E EL KE+++++   + K + QG+
Sbjct  62    SHDIFSAVQPHTHKWSKMFGRNFLQWYGTQPQLVVAEPELSKEVMNNKDRIFRKQKSQGY  121

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
             ++++LG+ I  S+GEKW ++R+LAN+ FHGESL+ M+P MI S+ETM+E W  HEGKEIE
Sbjct  122   TKKILGESISMSEGEKWVKLRRLANHAFHGESLKSMIPEMITSSETMLERWVNHEGKEIE  181

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              +EEFRL TSEVISRTAFG++YL+GKNIFEML +L  L  KN  ++R P +SR+ K  DE
Sbjct  182   VYEEFRLFTSEVISRTAFGTSYLDGKNIFEMLGQLTFLIFKNNFSLRLPIISRLYKPRDE  241

Query  889   LESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEA  1065
             +E EKLE+GVR+ I  I++KRE +  TG+     R  DFL  LL+A+H  + + +I ++ 
Sbjct  242   IEMEKLEKGVRDTIAGIVRKRESKAMTGDADGFGR--DFLGVLLKAHHDTDENQRISMDE  299

Query  1066  MVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI  1245
             +VDECKTFYFAG ETT SLL W   LLA + DWQE ARKEV+++FG+ENP P G+ +LK 
Sbjct  300   IVDECKTFYFAGQETTNSLLAWTIFLLAQNTDWQEEARKEVLQLFGKENPNPDGLNKLKT  359

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             M+MI  E+LRLYPPV  + R+ EK+ V LG + +P N+ +++  L+L HDP+ WG+DV+ 
Sbjct  360   MSMIFNESLRLYPPVVSLIRETEKE-VRLGKMVVPANVEVHVPNLSLHHDPKYWGEDVNV  418

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             FKPERF+EGV KATNN+ +AF+PFG GPRTC+G+NFA+ E+KI L+MILQRYS  LS  Y
Sbjct  419   FKPERFSEGVAKATNNNIVAFIPFGLGPRTCVGMNFAIVESKIALAMILQRYSFTLSPGY  478

Query  1606  VHSPVQLFMLRPKDGVQVILHRI  1674
             VHSP+Q   +RP+ G+ VILH +
Sbjct  479   VHSPIQFMTVRPQHGIPVILHSL  501



>gb|KCW82720.1| hypothetical protein EUGRSUZ_C04097 [Eucalyptus grandis]
Length=513

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/496 (54%), Positives = 364/496 (73%), Gaps = 7/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  I + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE +L+KE+L +R+  YPKI  + F+++L+G
Sbjct  78    KIHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKIGTKDFAKKLVG  137

Query  547   DG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG +G+  G+KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVGTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFREF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+R PG+ R+ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGI-RLWKTADEVEAEK  256

Query  904   LEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE+    GEE       DFL +L++A H  +   +  I+ +VDEC
Sbjct  257   LEKGIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDTDKSKKFTIDNLVDEC  314

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ET  S++ W   LLA + +WQE AR+EV+ VFG E+P   G+ +LK ++MI+
Sbjct  315   KTFYIAGQETANSMMTWMLFLLAINPEWQEEARREVLNVFGNEDPDSDGLGKLKKISMIM  374

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG + LP N  ++I  L L HDPEIWG+D H+FKPER
Sbjct  375   NETLRLYPPVVGLTRKVGKK-LRLGRLVLPANSQIFIPTLKLHHDPEIWGEDAHEFKPER  433

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F +AEAKI+LSMILQRY+  LS +Y+H P 
Sbjct  434   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVVAEAKILLSMILQRYTFELSPTYIHCPG  493

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  494   QLLTTRPQHGLQIRFH  509



>ref|XP_004298349.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=506

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/505 (56%), Positives = 370/505 (73%), Gaps = 6/505 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LL+LA      KLWW PV +Q +M+ QGIKGPSYR L+GN  EI+  ++   S+P+
Sbjct  5     FVCVLLLLALINAFHKLWWTPVRLQNMMALQGIKGPSYRLLYGNATEITNMKKEAMSRPI  64

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PHI++W + YG NFL W G +P LVVTE EL KEIL+++ G Y K +
Sbjct  65    --SLSHDIFSHVQPHIHAWTKSYGKNFLQWYGVKPVLVVTEPELCKEILNNKDGVYVKPK  122

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                  ++L GD +  ++GEKWA++RKL+N+ FHGESLR M P MI SAE MVE W+ HEG
Sbjct  123   PSIVVKKLFGDSVAMTEGEKWAKLRKLSNHAFHGESLRNMFPDMIASAEAMVERWKHHEG  182

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
              EIE FEEFRLLTSEVISRTAFGS+YLEGK IFEML++L ++  +N   +RFPGMS++ +
Sbjct  183   NEIEVFEEFRLLTSEVISRTAFGSSYLEGKKIFEMLMRLSSIIVRNLFGIRFPGMSKLFR  242

Query  877   NNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
              +D++ESEK+E+G+RN I++I+KKRE + K GEE    +  DFL  LL+A+H  N    I
Sbjct  243   TSDDIESEKVEKGIRNSIMEIVKKREKEAKAGEEDSFGK--DFLGLLLKAHHATNDKQMI  300

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +++ECKTFYFAG ETT +LL W TLLLA H +WQE AR EV++ FG+E PT  GIA
Sbjct  301   SVDELLEECKTFYFAGQETTNTLLAWTTLLLALHPEWQEEARNEVLQFFGKEPPTYDGIA  360

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ ETLRLYPP   + RKV ++ V LG I +P N+ L +  LAL H+P++WG+
Sbjct  361   KLKTMSMIINETLRLYPPAILLARKVSRE-VRLGKILVPANVELLVPTLALHHEPQLWGE  419

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             +V  FKPERF+EG+ KATN++  AF+PFG GPR C+G NFA  EAKI +SMILQRYS  L
Sbjct  420   EVELFKPERFSEGIAKATNDNMAAFMPFGLGPRICVGFNFAALEAKIAMSMILQRYSFTL  479

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S  YVHSP Q   +RP++GVQVILH
Sbjct  480   SPGYVHSPFQYVTVRPQNGVQVILH  504



>ref|XP_004239025.1| PREDICTED: cytochrome P450 CYP749A22-like [Solanum lycopersicum]
Length=515

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/510 (54%), Positives = 372/510 (73%), Gaps = 8/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEK----LWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
             F  S L     W   K    +WW P+  Q  M+SQGIKGPSY F HGNTK+IS  R    
Sbjct  10    FFFSTLCFYLLWTLLKFVYSVWWMPLQTQNKMNSQGIKGPSYSFPHGNTKDISLMRSQTM  69

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
              KPM  D+SHD+F RI PH+++W R+YG NFL W G +P L VTE EL+KE+LS+++  Y
Sbjct  70    DKPM-IDISHDIFSRIQPHVHTWTRMYGRNFLTWHGSKPYLFVTEPELIKEVLSNKEDIY  128

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             PK++++G++++LLG+ + +++GEKWA++RKLAN+ FH ESL+ M+P M ES   M+E W+
Sbjct  129   PKMDMEGYAKKLLGEALITNEGEKWAKVRKLANHTFHAESLKRMVPEMSESVAEMLERWK  188

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             EHEGKE + F++F LLT+EVISRTAFGS+Y+EGK+IFEM+ KL  +  KN   V+FPG+S
Sbjct  189   EHEGKEFDVFKDFGLLTTEVISRTAFGSSYMEGKHIFEMVAKLTAITVKNLYTVKFPGIS  248

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
              +++ +DE+E+EKLE G++N I++++ KRE+ K G  +K    +D+L +L++  H+ + +
Sbjct  249   WLIRTDDEIEAEKLERGIKNSILELVSKREKGKDGMYEKFG--NDYLGQLMKLLHESDTN  306

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I I+ M+DE +T Y AGH TTTSLLGW+  LLA H +WQE+ARKEV    G E PT  
Sbjct  307   KRITIDQMIDEVRTLYGAGHLTTTSLLGWSVFLLALHPEWQEKARKEVFLFCGLEKPTSD  366

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
              IARL+ MNMIL E +RLYPPV  + RKVE++ V LG++TLP N+ +++  LAL HDP+I
Sbjct  367   AIARLRTMNMILNECMRLYPPVITVTRKVERE-VRLGSMTLPGNMTIFMPILALHHDPQI  425

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+DVH FKPERFAEGV KATNN   AF PFG GPRTC+GLNF   E KI LSMILQRY 
Sbjct  426   WGEDVHVFKPERFAEGVAKATNNKAAAFFPFGLGPRTCVGLNFTTNETKITLSMILQRYK  485

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               LS +YVH P  +F+L PKDGV+V+L  I
Sbjct  486   FTLSPNYVHYPSDIFLLTPKDGVKVVLESI  515



>gb|EYU22577.1| hypothetical protein MIMGU_mgv1a004830mg [Erythranthe guttata]
Length=508

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/490 (55%), Positives = 357/490 (73%), Gaps = 6/490 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWWAP+  Q  M SQGIKGPSY+F+HG+TKEI   +   ++ PME  LSHD+FPRI PH
Sbjct  22    KLWWAPLQFQHQMKSQGIKGPSYKFIHGSTKEIITIKNQTSNTPME--LSHDIFPRIQPH  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +YSW +LYG N LYW+G QP ++VTEA+L+KEI S+++G Y K  + G+ ++LLGDGI  
Sbjct  80    LYSWTKLYGNNLLYWIGAQPHILVTEADLIKEIFSNKEGTYTKTRITGYLKKLLGDGIVF  139

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW ++RKLAN+ FHGE L+ MLP+M+ S E M+E ++ HEGKEIE   EFRLLTSE
Sbjct  140   TEGEKWIKLRKLANHAFHGECLKDMLPSMVASVEAMLEKFKCHEGKEIEVCSEFRLLTSE  199

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAFGS+Y+EG+ IF+ML KL  L S+N   +RF  + +  +  DE+E++K+E+ + 
Sbjct  200   VISRTAFGSSYVEGRKIFDMLTKLGVLTSRNSHKIRFAVLQKFARTKDEIEADKIEKSLH  259

Query  922   NGIIQIIKKR-EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + I++++ +R ++ KTG+       SDFL  LL+A+H  +  N+I    ++DECKTFYFA
Sbjct  260   DSIMEMVNRRQDEVKTGKSNDFG--SDFLGSLLKAHHSIDKKNRISALEIIDECKTFYFA  317

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G ETT SLL WA LLLA + DWQERAR EV+E+FG+ENP   GI+RLK M+MI+ ETLRL
Sbjct  318   GQETTYSLLSWAVLLLAINTDWQERARTEVLELFGRENPVSEGISRLKTMSMIIYETLRL  377

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             Y PV  I R+ + K V LG    P N++L I PL+L  +P+IWG+D   F P+RFAEG+ 
Sbjct  378   YSPVTAITRRTDSK-VGLGKYEFPANVNLVIPPLSLHRNPDIWGQDCQLFNPDRFAEGLA  436

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KAT  +  AFL FGYGPR C+GLNFA  EAKI LSMILQRY   LS +YVHSP  +   +
Sbjct  437   KATGGNATAFLGFGYGPRICVGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTTQ  496

Query  1639  PKDGVQVILH  1668
             P+ GV+++L 
Sbjct  497   PQHGVKILLQ  506



>ref|XP_002325505.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
 gb|EEE99886.1| hypothetical protein POPTR_0019s09980g [Populus trichocarpa]
Length=567

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/496 (55%), Positives = 357/496 (72%), Gaps = 5/496 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             LLV+   +L  K+WWAP+ +Q LM SQGI+GP YRFL+G+T EI      +     E  L
Sbjct  16    LLVILLKFL-NKVWWAPIRVQSLMKSQGIEGPPYRFLYGSTTEILNIINAMDGSSQE--L  72

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SH+ F RILPH YSW ++YG NFLYW GPQP L+VTE ELVKEILS++ GDY KI ++  
Sbjct  73    SHNTFARILPHAYSWVKVYGMNFLYWYGPQPHLMVTEPELVKEILSNKDGDYKKIPVETH  132

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              +RLLGDG+ +S GEKW +MRKL N  FHGESL+GM+P MI S E M++ WR HEGKEI+
Sbjct  133   VKRLLGDGLVTSSGEKWFKMRKLGNQAFHGESLKGMIPDMIASVEVMLKRWRNHEGKEID  192

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              F+EF++LTSEVISRTAFGS+YLEG++IF+M++ +  +  +N   +  P + +I K++D+
Sbjct  193   TFQEFKVLTSEVISRTAFGSSYLEGQHIFDMIMNMIDIIYRNNYRISIPFIGKIFKSSDD  252

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             +ESE LE+ VR  II+++KKRE+  T         +DF   LL+A H  +   +I ++ +
Sbjct  253   IESENLEKRVRESIIKMMKKREEEATS-GHLDGYGNDFFGLLLKAYHDPDNSKKISVDDL  311

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             +DECKT Y AG ETTTSLL W  LLLA   DWQ++ RKEV+E+ GQ+NP+P  + +LKIM
Sbjct  312   IDECKTIYVAGQETTTSLLSWTVLLLAICPDWQDKVRKEVLELIGQQNPSPDRMTKLKIM  371

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +M++ E+LRLY P  Y+ RKV+K+ V LGN+ LP N+ +Y+S LA  ++PEIWG+DVH F
Sbjct  372   SMVINESLRLYAPSNYLARKVDKE-VRLGNLILPANMEIYMSTLAHHYNPEIWGEDVHLF  430

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERFAEGV KATN     F PFG GPRTCLG N+A+ E KI LSMILQRY   LS +YV
Sbjct  431   KPERFAEGVAKATNKSIATFFPFGMGPRTCLGFNYAIIEGKIALSMILQRYRFTLSPTYV  490

Query  1609  HSPVQLFMLRPKDGVQ  1656
             H PV L  + PK G+Q
Sbjct  491   HHPVHLLTVCPKRGIQ  506



>gb|KCW44246.1| hypothetical protein EUGRSUZ_L02324 [Eucalyptus grandis]
Length=514

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/496 (54%), Positives = 363/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L   LWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  I + PM ++LSHD+FP
Sbjct  19    AKLLHNLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE +L+KE+L +R+  YPK   + F+++LLG
Sbjct  78    KIHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLG  137

Query  547   DGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+  G+KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVSTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+RFPG+ ++ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  ++ +VDEC
Sbjct  258   LEKGIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDTDKSKKFTVDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ET  S++ W   LLA + +WQE AR+EV+ VFG ++P   G+ +LK ++MI+
Sbjct  316   KTFYIAGQETVNSMMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG + LP N  ++I  L L HDPEIWG+DVH+FKPER
Sbjct  376   NETLRLYPPVVGLTRKVGKK-LRLGRLVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F  AEAKI+LSMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFKLSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  495   QLATTRPQHGLQIRFH  510



>ref|XP_004297212.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/504 (55%), Positives = 366/504 (73%), Gaps = 8/504 (2%)
 Frame = +1

Query  166   SLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDD  345
               LV     +  K+WW P+ +QKLM+SQGIKGP YR L GN KEIS   + + S+ +  D
Sbjct  16    CFLVAVIFKIFHKIWWTPIRVQKLMASQGIKGPPYRLLAGNAKEISNMGKDVMSRSL--D  73

Query  346   LSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG  525
             LSH++ P +LPH+++W ++YG N+L W G  P+LVVTE EL KEI +++ G Y K + + 
Sbjct  74    LSHNILPVVLPHVHAWTKIYGKNYLQWHGTLPQLVVTEVELCKEIFTNKDGVYLKPKFRP  133

Query  526   FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE-GKE  702
             +++++ G+G+ + +GEKW + RKLAN+ FHGESL+ M+P MI SAETM++ W+ HE GKE
Sbjct  134   YAQKVFGNGLPALEGEKWVKSRKLANHAFHGESLKNMIPDMIASAETMLDRWKGHEEGKE  193

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             +E +EEFRLLTSEVISRTAFGS+Y EGKNIF ML K  +L  KN   ++F  +S++ K N
Sbjct  194   MEVYEEFRLLTSEVISRTAFGSSYAEGKNIFVMLTKF-SLLLKNDFKLKF--ISKLFKTN  250

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D++ESEKLE+G+R+ I+ I+KKRE+    EEQKS   SDFL  LL+A+H  N  + I ++
Sbjct  251   DDIESEKLEKGIRDSIMGIVKKREEKAMSEEQKSFG-SDFLGLLLKAHHDSNDIHWISVD  309

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECK+FYF G ET+ +LL W   LLA H DWQE ARKEV+++FG++ P P G+A+LK
Sbjct  310   DLVDECKSFYFVGQETSNTLLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGLAKLK  369

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
              M+MI  E+LRLY P   + R+V KK+V LGN+ +P N  L I  LAL H+PE WG+DV 
Sbjct  370   TMSMIFNESLRLYSPAVTVTRRV-KKDVRLGNLIVPANTELIIPYLALHHEPESWGQDVQ  428

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERF+EGV KATNN+   FLPFG G R C+GLNFA  EAKI LSMILQRYS  LS +
Sbjct  429   HFKPERFSEGVAKATNNNIALFLPFGMGSRVCVGLNFATMEAKIALSMILQRYSFTLSPA  488

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVHSP +   LRP+ GVQV+L+ +
Sbjct  489   YVHSPFRSMTLRPQHGVQVMLYSL  512



>gb|EYU22578.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22579.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
 gb|EYU22580.1| hypothetical protein MIMGU_mgv1a004881mg [Erythranthe guttata]
Length=506

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/491 (54%), Positives = 357/491 (73%), Gaps = 6/491 (1%)
 Frame = +1

Query  199   EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILP  378
             +KLWWAP+ +Q+LM SQGIKGPSY+F+HG+TKEI       +  PME  LSHD+FPRI P
Sbjct  19    QKLWWAPLRVQQLMESQGIKGPSYKFIHGSTKEIITINNQTSDTPME--LSHDIFPRIQP  76

Query  379   HIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIG  558
             H YSW +LYG N LYW+G QP ++VTEA+L+KEIL +++G + K    G+ ++LLGDGI 
Sbjct  77    HFYSWTKLYGNNLLYWIGAQPHILVTEADLIKEILWNKEGTFTKTRTTGYLKKLLGDGIV  136

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
              ++GEKW ++RKLAN+ FHGE L+ M P+M+ S E M+E ++ HEGKEIE   EFRLLTS
Sbjct  137   LTEGEKWIKLRKLANHAFHGECLKDMFPSMVASVEAMLEKFKCHEGKEIEVCSEFRLLTS  196

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EG+ IF+ML KL  LAS+N  N+R   + +  +  DE+E++K+E+ +
Sbjct  197   EVISRTAFGSSYVEGRKIFDMLTKLGVLASRNSHNIRLAVLQKFARTKDEIEADKIEKSL  256

Query  919   RNGIIQIIKKR-EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
              + I++++ +R ++ K G+ +     SDFL  LL+A+H  +  NQ+    ++DECKTFYF
Sbjct  257   HDSIVEMVNRRQDEVKIGKSKDFG--SDFLGSLLKAHHNIDKKNQLSALEIIDECKTFYF  314

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETT SLL WA LLLA + DWQERAR EV+E+FG++NP   GI+RLK M+MI+ ETLR
Sbjct  315   AGQETTYSLLSWAVLLLAINTDWQERARNEVLELFGRQNPVSEGISRLKTMSMIVYETLR  374

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LY PV  I R+ + K V LG    P N++L I PL+L  +P+IWG+D   F P+RFAEG+
Sbjct  375   LYSPVIAITRRTDSK-VGLGKYEFPANVNLVIPPLSLHRNPDIWGQDCQLFNPDRFAEGL  433

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KAT  +  AFL FGYGPR CLGLNFA  EAKI LSMILQRY   LS +YVHSP  +   
Sbjct  434   AKATGGNATAFLGFGYGPRICLGLNFASNEAKIALSMILQRYKFTLSPNYVHSPYIVLTA  493

Query  1636  RPKDGVQVILH  1668
             +P+ GV+++L 
Sbjct  494   QPQHGVKILLQ  504



>ref|XP_008356573.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Malus domestica]
Length=516

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 368/508 (72%), Gaps = 7/508 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+    V     +  KLWW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    FLCVFXVFVLIKIVHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LSHD+F  ++PHI+SW ++YG N+L W G   +LV+TE EL KEI+S++   YPK +
Sbjct  73    -KNLSHDIFSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEPELCKEIMSNKDKAYPKRD  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                F ++LLGDG + +++ EKW ++RKLA + FHGE L+ M P M+ SAETM+E WR +E
Sbjct  132   PTTFVKKLLGDGLVTTTESEKWGKLRKLATHAFHGECLKIMFPDMVASAETMLERWRNNE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
              KEIE FEEFRL TSEVISRTAFGS+YLEG+NIFEML+KL  L SKN L V  PG+S+  
Sbjct  192   EKEIEMFEEFRLFTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKNALTVGIPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K +DE+E++KL +GV   I+ I  KR++T  +GEE  +S  SDF   LL+A+H  + D +
Sbjct  252   KTSDEIEADKLVKGVYASIMDIANKRQKTVISGEE--ASFGSDFFGLLLKAHHDASDDQR  309

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +VDECKTFYFAG ETT + LGW   LLA H +WQ+ ARKEV+E+FG++ P   GI
Sbjct  310   ISVDDLVDECKTFYFAGQETTNTSLGWTVFLLALHTNWQDEARKEVIELFGKQAPNLDGI  369

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             A++K M+MIL E+LRLYPPV    RKVE++ V LGN+T+P N+ L +S L+  HDP IWG
Sbjct  370   AKMKTMSMILNESLRLYPPVASFGRKVERE-VRLGNVTVPANVELIVSNLSFHHDPRIWG  428

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D   FKPERFAEG+ KATNN+   F+PFG GPR+C+GLNFA+ EAKIVLSMILQRYS  
Sbjct  429   EDTQLFKPERFAEGIAKATNNNIGVFVPFGIGPRSCVGLNFAINEAKIVLSMILQRYSFT  488

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             L   YVH P Q   +RP+ GVQV+LH +
Sbjct  489   LXPGYVHLPTQYVTVRPQHGVQVMLHSL  516



>ref|XP_011015632.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=517

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/508 (53%), Positives = 359/508 (71%), Gaps = 8/508 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLC----EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
             + SS L+L+   +      K+WW P+ IQ  M SQGIKGPSYRFLHGNTKEI      I 
Sbjct  7     YFSSCLLLSIVIILVKFFHKVWWTPIRIQSSMKSQGIKGPSYRFLHGNTKEIINMISKIR  66

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
             S P E  + H  FP I PHIYSW +LYG NFL W GPQP+L++TE EL+KEIL+++   Y
Sbjct  67    SSPKE--VLHHTFPIIQPHIYSWIKLYGMNFLQWYGPQPQLIITEPELIKEILNNKDRAY  124

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             PK +   + ++LLGDG+ +S+GEKW +MRKLAN+ FHG SL+ M+PAMI S+E M++ WR
Sbjct  125   PKAKAPNYVKQLLGDGLVTSEGEKWLKMRKLANHAFHGGSLKNMIPAMIASSEIMLQRWR  184

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
              +E KEI+ F EF++LTSE+ISRTAFGS+YLEG++IF+ML ++  + S N   +R PG+ 
Sbjct  185   HYESKEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDMLTRMAHIISGNNYRIRIPGIG  244

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             +  K  DE+ESE LE  +R+  + ++KKREQ +           DF   LLEA H     
Sbjct  245   KFFKTIDEIESENLEATIRSSFMNMMKKREQ-EAMLGNIDGYGHDFFGLLLEAYHHTEKT  303

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I ++ ++DECKTFY AG ETT+S L W+ LLLA H DWQ++ R EV+E+FGQ+NP+  
Sbjct  304   KKISVDDLIDECKTFYVAGQETTSSSLTWSVLLLAIHTDWQDKVRNEVLELFGQQNPSQD  363

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
              IA+LKIM+M++ E+LRLY P   + R+VE++ + +G IT+P N+ + IS LAL  +PEI
Sbjct  364   SIAKLKIMSMVINESLRLYSPAAVVTRRVERE-IKMGKITVPANMEVLISTLALHQNPEI  422

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG DVH FKPERFAEG+ KATNN+  AF PFG GPRTC+G+NFA+ E K+ LSMILQRY 
Sbjct  423   WGGDVHLFKPERFAEGLAKATNNNIAAFFPFGLGPRTCVGVNFALTETKVALSMILQRYR  482

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
               LS +Y H PV++  + P+ GVQVIL 
Sbjct  483   FTLSPTYAHCPVEVLTMCPQHGVQVILQ  510



>ref|XP_004298348.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=507

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/506 (56%), Positives = 377/506 (75%), Gaps = 7/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LL+LA      KLWW PV +Q +M+ QGI+GPSYRF +GN  EI+  R+   S+P+
Sbjct  5     FVCVLLLLALIKAFHKLWWTPVRLQNMMALQGIRGPSYRFFYGNATEITNLRKEAMSRPI  64

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PHI++W + YG NFL W G +P LVVTE EL KEIL++++G Y K E
Sbjct  65    --SLSHDIFSHVQPHIHAWTKSYGKNFLQWHGVKPVLVVTEPELCKEILNNKEGVYQKPE  122

Query  517   LQG-FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                   ++LLGDG+  ++G+KWA++RKL+N+ FHGE L+ M P MI SAE MVE W+ +E
Sbjct  123   PSNVIVKKLLGDGVTMTEGDKWAKLRKLSNHAFHGERLKNMFPDMITSAEAMVERWKNNE  182

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRLLTSEVISRTAFGS+Y+EGKNIFEML+KL ++ S+N L++RFPGMS++ 
Sbjct  183   GKEIEVFEEFRLLTSEVISRTAFGSSYIEGKNIFEMLMKLTSIVSRNLLSIRFPGMSKLF  242

Query  874   KNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             + +D++ESEK+E+G+R+ I++I+KKRE + K GEE    +  DFL  LL+A+H  +   +
Sbjct  243   RTSDDIESEKVEKGIRDSIMEIVKKREKEAKAGEEDCFGK--DFLGLLLKAHHATDDKQR  300

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +++ECKTFY AG  TT +LL W TLLLA H +WQE ARKEV+++FG++ PT  G+
Sbjct  301   ISVDELLEECKTFYLAGQGTTNTLLAWTTLLLALHPEWQEEARKEVLQLFGKQPPTYDGM  360

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             A+LK MNMI+ ETLRLYPP   + RKV  + V LGNI +P N+ L +  LAL H+P+ WG
Sbjct  361   AKLKTMNMIINETLRLYPPAILLSRKVSGE-VRLGNILVPANVELLVPTLALHHEPQFWG  419

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             ++V  FKPERF+EG+ KATN +  AF+PFG GPR C+G NFA  EAKI +SMILQRYS  
Sbjct  420   EEVELFKPERFSEGIAKATNENMAAFMPFGLGPRKCVGFNFAALEAKIAMSMILQRYSFT  479

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVHSP Q  ++RP++GVQVILH
Sbjct  480   LSPGYVHSPFQYVIVRPQNGVQVILH  505



>ref|XP_011102246.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=506

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/506 (55%), Positives = 368/506 (73%), Gaps = 4/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F  SL+ L    +  K+ W P  IQ ++ SQGI GP Y+ +HG+TKE    ++     PM
Sbjct  5     FFLSLITLILIRVIHKVLWLPFRIQHMLRSQGITGPPYKIIHGSTKESLRLKQQARDGPM  64

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  LSHD+FPR+ P  YSW +LYG NFL W GPQP LV+TE ELVKEIL++++G + KI+
Sbjct  65    E--LSHDIFPRVQPSFYSWMKLYGKNFLTWTGPQPHLVITEPELVKEILTNKEGIFQKIK  122

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             +QG +++L+GDG+  ++G KW+++RKLAN+ F+ ESL+GM+PAMI S E M+E WR +EG
Sbjct  123   VQGPAKKLVGDGLVMTEGAKWSKLRKLANHAFYAESLKGMIPAMIASVENMLENWRMYEG  182

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE  +EF + +SEVISRTAFGS+YLEGKNIF+ML+KL  L  KN   VR  G+ +I K
Sbjct  183   KEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFDMLMKLGFLIFKNADKVRPFGIEKIWK  242

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
               D++ES+K+E+ +R+ ++ I++KRE+ K    Q  +  SDFL  LL  +H  +  N+I 
Sbjct  243   TQDDIESDKIEQSLRDSLMVILRKREE-KVLTGQADNFGSDFLGSLLRVHHDADKKNRIS  301

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++DECK F+ AGHETT+SLL W  LLLA H DWQ++ARKEV+E+FGQENPT  G+ R
Sbjct  302   LDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTDWQDKARKEVLELFGQENPTAEGLPR  361

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK  +MI+ E LRLY PV  + R+V +K  V G   LP N+ L ISPLAL  +PEIWG+D
Sbjct  362   LKTASMIINEALRLYGPVASLVRRVARKVRV-GKYVLPANMELQISPLALHRNPEIWGED  420

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H FKPERFAEG+  AT N+P+AFLPFGYGPRTC+GLNFA  E KI LSMILQRY   LS
Sbjct  421   AHLFKPERFAEGIATATRNNPMAFLPFGYGPRTCVGLNFANNEVKIALSMILQRYKFTLS  480

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              SY+HSP+ L  +RP+ GVQ++L ++
Sbjct  481   PSYIHSPLSLVTIRPQHGVQIMLQKL  506



>ref|XP_006484252.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=520

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/492 (55%), Positives = 353/492 (72%), Gaps = 4/492 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  KLWW P   Q +M SQG++GP+YR ++GNTKEI   R  I   PM   LSHD+ PRI
Sbjct  25    LFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEILSLRNQIWISPM--GLSHDILPRI  82

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW + YG NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG
Sbjct  83    LPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDG  142

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + ++ GE W R RKLA   F+ ESLR M+PAM+ S E M++ WR +EGKEIE  ++F LL
Sbjct  143   LVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLL  202

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSE+ISRTAFGS+YLEG++IF  L  +  +AS+N   ++ P +   +K +D++E++KLE+
Sbjct  203   TSEIISRTAFGSSYLEGESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQ  262

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G+R+ II+++K RE+ K  + +     +D+   LL+A H  +   +I ++ ++DECKTFY
Sbjct  263   GIRDSIIKMMKTREE-KAMKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFY  321

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AGHETTT LL W  LLLATH DWQE+ R+EV+E+FGQ+NPTP GI +LK M+M++ E+L
Sbjct  322   IAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFGQQNPTPDGIGKLKTMSMVINESL  381

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   I R VE++ V LG   LP N+ L I  LA+ HDP+IWG+DV  FKPERFAEG
Sbjct  382   RLYPPAVNISRNVERE-VRLGKYILPANMELVIPILAIHHDPQIWGEDVDLFKPERFAEG  440

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KA+NN P AFLPF  GPR C+GLNFA  EAKI LSMILQRY   LS SYVHSPV +  
Sbjct  441   VAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVT  500

Query  1633  LRPKDGVQVILH  1668
             LRP+ G+QVI  
Sbjct  501   LRPQHGLQVIFQ  512



>ref|XP_008243895.1| PREDICTED: cytochrome P450 CYP749A22-like [Prunus mume]
Length=1009

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/490 (57%), Positives = 361/490 (74%), Gaps = 6/490 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             +LWWAP  +QKLM+SQGIKGP YR +HGNTK+IS   +   SKP     SHDV   + PH
Sbjct  29    RLWWAPARLQKLMASQGIKGPPYRLIHGNTKDISNMIKEAMSKPKSLSSSHDVLSVVQPH  88

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             ++SW ++YG N+L W G + +LV+TE EL KEIL+++   YPK E + F ++LLGDG+ +
Sbjct  89    VHSWAKIYGKNYLQWHGSKAQLVITEPELCKEILNNKDKAYPKTERESFVKKLLGDGLAT  148

Query  562   S--KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLT  735
             +  +GEKWA+MRKLA + FHGESL+ M+PAM+ SAETM+E W+ +EGKEIE FEEFR  T
Sbjct  149   TTAEGEKWAKMRKLATHAFHGESLKSMIPAMVASAETMLERWKNYEGKEIEMFEEFRFFT  208

Query  736   SEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEG  915
             SEVISRTAFGS+Y+EG++IFEML+KL  L SKN L +R PG+S++ K  DE+ESEKLE+ 
Sbjct  209   SEVISRTAFGSSYIEGQHIFEMLMKLGFLLSKNALTIRVPGISKLFKTGDEIESEKLEKD  268

Query  916   VRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             VR  I++I++KRE+   TG E   S  SDFL  L++A+H  N   +I ++ ++D+CKTFY
Sbjct  269   VRASILEIVRKREEKVMTGGE--DSFGSDFLGLLVKAHHDANDSQRISVDDLIDDCKTFY  326

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AG E+T SLL W  LLLA H DWQE ARKEV+++FG++ P P GIA+LK M+M++ E L
Sbjct  327   VAGQESTNSLLAWTVLLLAHHTDWQEEARKEVIQMFGKQTPNPDGIAKLKTMSMVINECL  386

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLY PV  + RK E++ V LG + +P N+ L +S L+L HDP IWG+D   FKPERFAEG
Sbjct  387   RLYSPVGTLLRKAERE-VKLGKLIVPANVDLVMSCLSLHHDPLIWGQDAQLFKPERFAEG  445

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KA+NN+  AFLPFG GPR C+GLNFA  EAKI LSM+LQRY   LS  YVH P QL  
Sbjct  446   VAKASNNNAGAFLPFGVGPRACVGLNFATIEAKIALSMVLQRYFFTLSPGYVHLPFQLVT  505

Query  1633  LRPKDGVQVI  1662
              RP  GVQV+
Sbjct  506   NRPLRGVQVM  515


 Score =   549 bits (1414),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 279/546 (51%), Positives = 376/546 (69%), Gaps = 28/546 (5%)
 Frame = +1

Query  40    TRNSQFRHLVFSLKFCR*SFGNYYCRLIKmmmmmiiiiiFISSLLVLAAAWLCEKLWWAP  219
             T +  + HL F L   R   G    ++  +  +++I+  F+  LLVLA   +  KLWW P
Sbjct  491   TLSPGYVHLPFQLVTNRPLRGVQVMQMTSLGGLIVILSSFLCLLLVLAFIKILHKLWWTP  550

Query  220   VHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKR  399
             + IQKLM+ QGIKGPSYRF+HGNTKEIS  ++ +  +P    LSHD+   + PHI+SW +
Sbjct  551   IRIQKLMALQGIKGPSYRFIHGNTKEISNMKKEVMGRP--QLLSHDILSVVQPHIHSWTK  608

Query  400   LYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IGSSKGEK  576
             +YG N+L W G + +LV+TE EL KEIL+++   Y K E    +++LLGDG + +++ EK
Sbjct  609   IYGKNYLQWHGCRAQLVITEPELCKEILNNKDRAYQKREPTNIAKKLLGDGLVVTTEAEK  668

Query  577   WARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRT  756
             WA++RKLA + FHGESL+ M+P M+ SAE+M+E W  +EGKEIE +EEFRL TSEVISRT
Sbjct  669   WAKLRKLATHAFHGESLKSMIPEMVASAESMLERWTVYEGKEIEVYEEFRLFTSEVISRT  728

Query  757   AFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQ  936
             AFGS+Y+EG++IFE+L+KL  L  KNFL VR PG+S+  K +DE+ESEKLE+G+   II+
Sbjct  729   AFGSSYVEGQDIFEILMKLGFLIFKNFLKVRVPGISKFFKTSDEIESEKLEKGIHASIIE  788

Query  937   IIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTT  1116
             ++KKRE+ KT   +K S  SDFL  LL+AN                       AG ETT 
Sbjct  789   MVKKREK-KTMAGEKDSFGSDFLGLLLKAN-----------------------AGQETTN  824

Query  1117  SLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPY  1296
             +LL W   LLA H DWQE ARKEV+++FG++ P   GI +LK M+MI+ E LRLYPP   
Sbjct  825   TLLAWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIGKLKTMSMIINEALRLYPPAVS  884

Query  1297  IKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNH  1476
             + R VE++ V LG + +P N+ + +S +A+ HDP+IWG+DV  FKP+RF+EGV KATNN+
Sbjct  885   VVRNVERE-VRLGKLIVPSNLDVVVSIVAVHHDPQIWGQDVQLFKPQRFSEGVAKATNNN  943

Query  1477  PIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQ  1656
               AFLPF  GPRTC+GLNFA+ EAKI LSMILQRY+  LS  YVH P+    +RP+ GVQ
Sbjct  944   IGAFLPFSMGPRTCVGLNFAITEAKIALSMILQRYAFTLSPGYVHLPLHYLTVRPQHGVQ  1003

Query  1657  VILHRI  1674
             V+LH +
Sbjct  1004  VMLHSL  1009



>ref|XP_008351041.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=1032

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/515 (56%), Positives = 364/515 (71%), Gaps = 16/515 (3%)
 Frame = +1

Query  160   ISSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISE  306
             +SSL+ ++A++LC            KLWW P  IQK M+ QGIKGP YR +HGNTKEIS+
Sbjct  520   LSSLMTISASFLCVFXVLVLIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEISD  579

Query  307   ARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILS  486
               +   SKP    LSHD+FP + P++++W ++YG N+L W G QP+LV+TE EL +EIL+
Sbjct  580   MIKEAMSKP--KTLSHDIFPTVQPNMHTWTQIYGKNYLQWQGSQPQLVITELELCREILN  637

Query  487   DRKGDYPKIELQGFSRRLLGDGI-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAE  663
             ++   YPK E   F R+LLGDGI  +++GEKW ++RKL  + FHGESL+ M   M+ SAE
Sbjct  638   NKDRAYPKSEPTDFLRKLLGDGIVTTAEGEKWKKVRKLGTHAFHGESLKSMFTEMVASAE  697

Query  664   TMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLN  843
             TM+E W+ +EGKEIE FEEFRL TSEVISRTAFGS+Y+EG+NIF ML KL  L  K+F  
Sbjct  698   TMLEXWKSYEGKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFGMLTKLTPLVFKSFYT  757

Query  844   VRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEA  1023
             +R PG+S+  K++DE+E+EKLE+G+   I +IIKKRE+   G E +     DFL  LL A
Sbjct  758   IRLPGISQFFKSSDEIEAEKLEKGIHASITZIIKKREKKSMG-EGRDXFGCDFLGLLLNA  816

Query  1024  NHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFG  1203
             +H  N + +I ++ +VDECKTFYFAG ETT + L W   LLA H DWQE ARKEVME+FG
Sbjct  817   HHDANDNQRISVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTDWQEEARKEVMELFG  876

Query  1204  QENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLA  1383
             ++ P P GIA+LK +NMI  E+LRLY PV    RKV K+ V LG + +P N  L++  LA
Sbjct  877   KQTPNPDGIAKLKKINMIFNESLRLYSPVVGFVRKV-KREVKLGKLIVPANFELFVPNLA  935

Query  1384  LQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLS  1563
             L  DP+IWG+D H FKPERFAEGV KATNN+  AF+PFG GPR+CLGLNFA  E KIVLS
Sbjct  936   LHRDPQIWGEDAHLFKPERFAEGVAKATNNNVGAFIPFGIGPRSCLGLNFANTEVKIVLS  995

Query  1564  MILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             MILQRYS  LS  YVH P     + P  GVQ +LH
Sbjct  996   MILQRYSFTLSPGYVHLPYPYVTIHPXLGVQXMLH  1030


 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/503 (55%), Positives = 358/503 (71%), Gaps = 9/503 (2%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +S LL L  A+   KLWW P  IQK M+ QGIKGPSYRF HGNTKEI   +     +P  
Sbjct  16    LSILLALIKAF--HKLWWTPTRIQKRMAFQGIKGPSYRFFHGNTKEIMSMKMETMXRP--  71

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
              DLS +VF  + PHI++W ++YG  +L W G Q +LVV E +L KEIL++  G YPK +L
Sbjct  72    GDLSVNVFSAVQPHIHTWTKIYGKIYLQWHGSQAQLVVMEPQLCKEILNNXDGAYPKRKL  131

Query  520   QGFSRRLLGDGIGSS--KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             QGF ++L+GD +G+S  +G KW +++KLAN+ FHGESL+ M+PAMI SAE ++E W+ HE
Sbjct  132   QGFVKKLVGDSMGTSTTEGGKWGKLKKLANHAFHGESLKSMIPAMIASAEMILEEWKNHE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE +E+FRL TSEVISRTAFGS+Y+EGKN F+ L+KL +L  KN L VRFPG+S+I 
Sbjct  192   GKEIEVYEQFRLFTSEVISRTAFGSSYIEGKNFFDNLMKLSSLLVKNSLTVRFPGISKIF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K  DE+ESEKL++ +R+ I +IIKKRE+     E+     SD+L  L++A+   N   +I
Sbjct  252   KTGDEIESEKLDKAMRDSITEIIKKREKKAMAGEKNFG--SDYLGLLVKAHLDTNDSQKI  309

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +V+ECKTFYFAG ETT  +L W   LLA H DWQ +ARKEV+++FG++NPT   IA
Sbjct  310   SVDDLVNECKTFYFAGQETTNGVLAWIVFLLALHTDWQVKARKEVLQLFGKQNPTXDDIA  369

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ E LRLYPPV  I R+V K+ V LG   +P N+ L I  LAL H+ E WG+
Sbjct  370   KLKTMSMIINEALRLYPPVLNIDRRV-KREVKLGKYMVPANVELIIPCLALHHETEFWGQ  428

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D   FKP RF+ GV KAT ++  AFLPFG GPR+C+GLNFA  EAKIVLSMILQRY   L
Sbjct  429   DAQLFKPNRFSAGVAKATTDNIAAFLPFGMGPRSCVGLNFAANEAKIVLSMILQRYRFTL  488

Query  1594  SSSYVHSPVQLFMLRPKDGVQVI  1662
             S  YVHSP     +RP+ G+QVI
Sbjct  489   SPGYVHSPCDYLSIRPQHGIQVI  511



>ref|XP_010049897.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW82724.1| hypothetical protein EUGRSUZ_C04101 [Eucalyptus grandis]
Length=514

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/496 (53%), Positives = 361/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  I + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMKIRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE +L+KE+L +R+  YPK   + F+++LLG
Sbjct  78    KIQPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLG  137

Query  547   DG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG + ++ G+KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVSTNDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+R PG+ ++ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRLPGIRKLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  ++ +VDEC
Sbjct  258   LEKGIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDTDKSKKFTVDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ET  S++ W   LLAT+ +WQE AR+EV+ VFG  +P   G+ +LK ++MI+
Sbjct  316   KTFYIAGQETANSMMTWMLFLLATNLEWQEEARREVLNVFGNRDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG + LP    ++I  L L HDP+IWG+D H+FKPER
Sbjct  376   NETLRLYPPVVGLTRKVGKK-LRLGRLVLPAKSQIFIPTLKLHHDPKIWGEDAHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F  AEAKI+LSMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFELSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  495   QLLTTRPQHGLQIRFH  510



>ref|XP_006437870.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51110.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=520

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/492 (55%), Positives = 353/492 (72%), Gaps = 4/492 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  KLWW P   Q +M SQG++GP+YR ++GNTKEI   R  I   PM   LSHD+ PRI
Sbjct  25    LFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEILSLRNQIWISPM--GLSHDILPRI  82

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW + YG NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG
Sbjct  83    LPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDG  142

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + ++ GE W R RKLA   F+ ESLR M+PAM+ S E M++ WR +EGKEIE  ++F LL
Sbjct  143   LVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVEIMLKRWRHNEGKEIEVSQDFTLL  202

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSE+ISRTAFGS+YLEG++IF  L  +  +AS+N   ++ P +   +K +D++E++KLE+
Sbjct  203   TSEIISRTAFGSSYLEGESIFNKLTNMSFIASRNAYKIKIPLIGDFVKTSDDVEADKLEQ  262

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G+R+ II+++K RE+ K  + +     +D+   LL+A H  +   +I ++ ++DECKTFY
Sbjct  263   GIRDSIIKMMKTREE-KAMKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFY  321

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AGHETTT LL W  LLLATH DWQE+ R+EV+E+FGQ+NPTP GI +LK M+M++ E+L
Sbjct  322   IAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFGQQNPTPDGIGKLKTMSMVINESL  381

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   I R VE++ V LG   LP N+ L I  LA+ HDP+IWG+DV  FKPERFAEG
Sbjct  382   RLYPPAVNISRNVERE-VRLGKYILPANMELVIPILAIHHDPQIWGEDVDIFKPERFAEG  440

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KA+NN P AFLPF  GPR C+GLNFA  EAKI LSMILQRY   LS SYVHSPV +  
Sbjct  441   VAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVT  500

Query  1633  LRPKDGVQVILH  1668
             LRP+ G+QVI  
Sbjct  501   LRPQHGLQVIFQ  512



>ref|XP_009356542.1| PREDICTED: uncharacterized protein LOC103947363 [Pyrus x bretschneideri]
Length=1066

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/532 (54%), Positives = 371/532 (70%), Gaps = 11/532 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+    VL    +  +LWW P  IQK M+ QGIKGP YR +HGNTKEIS+  +   SKP 
Sbjct  14    FLCVFFVLVIIKILHRLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEISDMIKEAMSKP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+FP + P++++W ++YG N+L W G QP+LV+TE EL +EIL+++   YPK E
Sbjct  73    -KTLSHDIFPIVQPNMHTWTQIYGRNYLQWQGSQPQLVITELELCREILNNKDRAYPKSE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                F R+LLGDG + +++GEKW ++RKL  + FHGESL+ M   M+ SAETM+E W+ +E
Sbjct  132   PTDFLRKLLGDGLVTTAEGEKWKKVRKLGTHAFHGESLKSMFTEMVASAETMLERWKSYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y+EG+NIFEML KL  L  K+F  +R PG+S+  
Sbjct  192   GKEIEVFEEFRLFTSEVISRTAFGSSYVEGQNIFEMLTKLTLLIFKSFYTIRLPGISQFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K++DE+E+EKLE+G+   I +IIKKRE+ K+  E + S   DFL  LL+A+H  N + +I
Sbjct  252   KSSDEIEAEKLEKGIHASITEIIKKREK-KSMSEGQDSFGCDFLGLLLKAHHDANDNQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +VDECKTFYFAG ETT + L W   LLA H DWQE ARKEVME+FG++ P P GIA
Sbjct  311   SVDDLVDECKTFYFAGQETTNTSLAWTIFLLAHHTDWQEEARKEVMELFGKQTPNPDGIA  370

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK +NMI  E+LRLY PV    RKV K+ V LG + +P N  L++  LAL  DP+IWG+
Sbjct  371   KLKKINMIFNESLRLYSPVVGFVRKV-KREVKLGKLIVPANFELFVPNLALHRDPQIWGE  429

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H FKPERF+EGV KATNN+  AF+PFG GPR+CLGLNFA  E KIVLSMILQRYS  L
Sbjct  430   DAHLFKPERFSEGVAKATNNNVGAFIPFGIGPRSCLGLNFANTEVKIVLSMILQRYSFTL  489

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI***SLLACINSWFLDNILLVSTHNQ  1749
             S  YVH P     + P+ GVQV+LH       L     W    IL +  +N+
Sbjct  490   SQGYVHLPYPYVTIHPQLGVQVMLHP------LQVFGPWDKTGILFICVNNE  535


 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/505 (56%), Positives = 363/505 (72%), Gaps = 5/505 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+    VL    +  KLWW P  IQK M+ QGIKG  YR +HGNTKEI +  +   SKP 
Sbjct  564   FLCVFFVLVLIKILHKLWWTPHRIQKQMALQGIKGTPYRLIHGNTKEIFDMIKEAMSKP-  622

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LSHD+F  + PH++SW R YG N+L W G QP+LV+TE EL +EIL+++   YPK E
Sbjct  623   -KNLSHDIFSIVQPHMHSWTRTYGKNYLQWQGSQPQLVITELELCREILNNKDRAYPKSE  681

Query  517   LQGFSRRLLGDGI-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                F R+LLGDG+  +++GEKW +MRKL  + FHGESL+ M   M+ SA+TM+E W+ +E
Sbjct  682   PTDFLRKLLGDGLLTTAEGEKWKKMRKLGTHAFHGESLKSMFTEMVVSAQTMLERWKSYE  741

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y+EG+NIFEML KL  L  K++  +R PG+S+  
Sbjct  742   GKEIEVFEEFRLFTSEVISRTAFGSSYIEGQNIFEMLTKLTLLFFKSYYTIRLPGISKFF  801

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K++DE+E+EKLE+G+   I +I+KKRE+ K+  + + S  SDFL  LL+A+H  N + +I
Sbjct  802   KSSDEIEAEKLEKGIHASITEILKKREK-KSMTKGRDSFGSDFLGLLLKAHHDANDNQRI  860

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ MV ECK+FYFAG ETT +LL W   LLA H +WQE ARKEVM++FG++ P P GIA
Sbjct  861   SVDDMVYECKSFYFAGQETTNTLLAWTIFLLAHHTNWQEEARKEVMDLFGKQTPNPDGIA  920

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
              LK+M+MIL E+LRLY PV    R V K+ V LG + +P N  L++  LAL  DP+IWG+
Sbjct  921   NLKMMSMILSESLRLYSPVVGFVRDV-KREVKLGKLIIPANCELFVPNLALHRDPQIWGE  979

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D   FKPERF+EGV KATNN+  AF+PFG GPR+C+GLNFA  EAKIVLSMILQRYS  L
Sbjct  980   DALLFKPERFSEGVAKATNNNVGAFIPFGIGPRSCVGLNFANTEAKIVLSMILQRYSFTL  1039

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S  YVH PVQ   + PK GVQV+LH
Sbjct  1040  SPGYVHLPVQYVTIHPKLGVQVMLH  1064



>ref|XP_008374265.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=527

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/510 (56%), Positives = 366/510 (72%), Gaps = 9/510 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +   LV     +  KLWW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    LLCVFLVFVLIKILHKLWWXPTRIQKMMKAQGIKGPPYRLIHGNTKEISDMKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTE-AELVKEILSDRKGDYPKI  513
               +LSHD+   ++PHI+SW ++YG N+L W G   +LV+TE  EL KEI+S++   YPK 
Sbjct  73    -KNLSHDIVSVVVPHIHSWSQIYGKNYLQWHGSLAQLVITEEPELXKEIMSNKDKAYPKR  131

Query  514   ELQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
             E   F ++LLGDG + +++GEKW ++RKLA + FHGE L+ + P M+ SAETM+E WR +
Sbjct  132   EPTTFVKKLLGDGLVTTTEGEKWGKLRKLATHAFHGECLKSLFPDMVASAETMLERWRNY  191

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             E KEIE FEEFRLLTSEVISRTAFGS+YLEG+NIFEML+KL  L SKN L VR PG+S+ 
Sbjct  192   EEKEIEVFEEFRLLTSEVISRTAFGSSYLEGQNIFEMLMKLAFLVSKNALKVRIPGISKF  251

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K +DE+E+EKLE+GV   I+ I KKRE+T T  ++  S  SDFL  LL+A H  N D +
Sbjct  252   FKTSDEIEAEKLEKGVYASIMXIXKKREKTATSGDE-DSFGSDFLGLLLKARHDANDDQR  310

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +VDECKTFYFAG ETT +LL W   LLA H +WQE ARKEV+E+FG++ P   GI
Sbjct  311   ISVDDLVDECKTFYFAGQETTNTLLXWTVFLLALHTNWQEEARKEVIELFGKQTPNLDGI  370

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +LK M+MI  E+LRLYPPV    RKVE++ V LGN+ +P N+ L IS  +  H+  IWG
Sbjct  371   TKLKTMSMIFNESLRLYPPVAGFXRKVERE-VRLGNVIVPANVXLXISXJSFHHBXRIWG  429

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D   FKPERFAEGV KATNN+  AF+PFG GPR+C+GLNFA+ EAKI LSMILQRYS  
Sbjct  430   QDAQLFKPERFAEGVAKATNNNIGAFVPFGIGPRSCVGLNFAINEAKIALSMILQRYSFT  489

Query  1591  LSSSYVHSPVQLFMLRPKDGVQ---VILHR  1671
             LS  YVH P+Q   +RP+ GVQ   +I H+
Sbjct  490   LSPGYVHLPIQYVTVRPQHGVQHFWIICHK  519



>ref|XP_002316006.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
 gb|EEF02177.2| hypothetical protein POPTR_0010s14900g [Populus trichocarpa]
Length=517

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/504 (53%), Positives = 361/504 (72%), Gaps = 6/504 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+S +++L   +   K+WW P+ IQ  M SQGIKGPSYRFLHGNTKEI      I S P 
Sbjct  13    FLSIVIILVKFF--HKVWWTPIRIQSSMKSQGIKGPSYRFLHGNTKEIINMISKIRSSPK  70

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  + H  FP I PHIYSW +LYG NFL W GPQP+L++TE EL+KEIL+++   YPK +
Sbjct  71    E--VLHHTFPIIQPHIYSWIKLYGMNFLQWYGPQPQLIITEPELIKEILNNKDRAYPKAK  128

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                + ++LLGDG+ +S+GEKW +MRKLAN+ FHG SL+ M+PAMI S+E +++ WR +E 
Sbjct  129   APNYVKQLLGDGLVTSEGEKWLKMRKLANHAFHGGSLKNMIPAMIASSEIILQRWRHYES  188

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEI+ F EF++LTSE+ISRTAFGS+YLEG++IF+ML ++  + S N   +R PG+ +  K
Sbjct  189   KEIDVFREFKVLTSEIISRTAFGSSYLEGQHIFDMLTRMAHIISGNNYRIRIPGIGKFFK  248

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
              +D++ESE LE  +R+  + ++KKREQ +           DF   LLEA H  +   +I 
Sbjct  249   TSDDIESENLEATIRSSFMNMMKKREQ-EAMLGNIDGYGHDFFGLLLEAYHDSDKTKKIS  307

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++DECKTFY  G ETT+SLL W+ LLLA H DWQ++AR EV+E+FGQ+NP    IA+
Sbjct  308   VDDLIDECKTFYVGGQETTSSLLTWSVLLLAIHTDWQDKARNEVLELFGQQNPGQDSIAK  367

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIM+M++ E+LRLY P   + R+VE++ + +G IT+P N+ + IS LAL  +PEIWG+D
Sbjct  368   LKIMSMVINESLRLYSPAAVVIRRVERE-IKMGKITVPANMEVLISTLALHQNPEIWGED  426

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERFAEG+ KAT N+  AF PFG GPRTC+G+NFA+ E K+ LSMILQRY   LS
Sbjct  427   VHLFKPERFAEGLAKATKNNIAAFFPFGLGPRTCVGVNFALTETKVALSMILQRYRFTLS  486

Query  1597  SSYVHSPVQLFMLRPKDGVQVILH  1668
              +Y H PV++  + P+ GVQVIL 
Sbjct  487   PTYAHCPVEVLTMCPQHGVQVILQ  510



>ref|XP_007045775.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01607.1| Cytochrome P450 [Theobroma cacao]
Length=519

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/489 (55%), Positives = 357/489 (73%), Gaps = 4/489 (1%)
 Frame = +1

Query  208   WWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIY  387
             WW P  IQ ++ SQGIKGP Y F+HGN K + E+ R  +SKPM   L+HD+FPR+LPHIY
Sbjct  31    WWIPHRIQNILRSQGIKGPPYEFIHGNNKAVVESIREASSKPMA--LTHDIFPRVLPHIY  88

Query  388   SWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSK  567
             S    YG  +L W G +  LV+TE +L+KE+L + +  +PK ++  F  ++LGDG+ ++ 
Sbjct  89    SCINTYGKIYLSWNGVRALLVITEPDLIKEVLKNSEKAFPKRKVTYFLSKILGDGLATTV  148

Query  568   GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVI  747
              EKWAR RKLAN  FHGESL+ M PA+I S ETM++ W+  EGKEIE F+EFRLLTSEVI
Sbjct  149   REKWARQRKLANYAFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFQEFRLLTSEVI  208

Query  748   SRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNG  927
             SRTAFGS+YLEG+ IFE L+KL  +AS+N    R PG+S + K+ DE+ESEKL + + + 
Sbjct  209   SRTAFGSSYLEGEKIFETLMKLSVIASRNLYKARIPGISYVWKHADEIESEKLAKEIHDS  268

Query  928   IIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHE  1107
             +++I+K+RE+     E +S   SDFL  LL A H  +  N++ +E +VDECKTFYFAG E
Sbjct  269   VMKIVKQREEKVVAGEAESF-GSDFLGLLLNAYHDLDEKNRLSVEDLVDECKTFYFAGQE  327

Query  1108  TTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPP  1287
             TT SLL W  LLLA H DWQE+AR+EV+EVFG ++P P GIA+LK M MI+ ETLRLYPP
Sbjct  328   TTNSLLAWTVLLLAIHTDWQEKARREVIEVFGNQDPHPEGIAKLKTMTMIINETLRLYPP  387

Query  1288  VPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKAT  1467
             V  I R+V ++ V LG + LP NI   I  +AL HDPE+WG DVH FKPERFAEG+ KAT
Sbjct  388   VNGIARRVGRE-VQLGKLMLPTNIEFSIPNMALHHDPELWGDDVHLFKPERFAEGIAKAT  446

Query  1468  NNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKD  1647
              ++  AF+PFG GPR+C+G++FA+ E K+ + MILQRY++ALS +YVH+P+ L  LRP+ 
Sbjct  447   KHNAGAFIPFGMGPRSCVGMSFAITETKMAIFMILQRYNIALSPAYVHAPLALLTLRPQH  506

Query  1648  GVQVILHRI  1674
             G+Q++ H +
Sbjct  507   GIQLLFHSL  515



>ref|XP_007222124.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
 gb|EMJ23323.1| hypothetical protein PRUPE_ppa004646mg [Prunus persica]
Length=498

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/505 (54%), Positives = 358/505 (71%), Gaps = 23/505 (5%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LLVLA   +  KLWW P+ IQKLM+ QGIKGPSYRF++GNTKEIS  ++ +  +P 
Sbjct  14    FLCLLLVLAFIKILHKLWWTPIRIQKLMALQGIKGPSYRFIYGNTKEISNMKKEVMGRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+F  + PH++SW  +YG N+L W G + +LV+TE EL KEIL+++   YPK E
Sbjct  73    -HILSHDIFSVVQPHVHSWTNIYGKNYLQWHGSRAQLVITEPELCKEILNNKGRAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                 S++L GDG + ++K EKWA++RKLA + FHGESL+ M+P M+ SA+ MVE W+ +E
Sbjct  132   PPNISKKLFGDGLVATNKAEKWAKLRKLATHAFHGESLKSMIPDMVASAQKMVERWKVYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEFRL TSEVISRTAFGS+Y EG++IFEML KL  L  KN L VR P +S++ 
Sbjct  192   GKEIEVFEEFRLFTSEVISRTAFGSSYSEGQDIFEMLRKLGFLIFKNILKVRVPVISKLF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +DE+ESEKLE+G+   II+++KKRE+ K   E  S  +                    
Sbjct  252   KTSDEIESEKLEKGIHASIIEMVKKREKKKMTGENDSFGKD-------------------  292

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFYFAG ETT +LL W   LLA H DWQE ARKEV+++FG++ P   GI 
Sbjct  293   LVQEIIDECKTFYFAGQETTNTLLCWTVFLLALHTDWQEEARKEVLQLFGKQTPNLDGIG  352

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +L  M+MI+ ETLRLYPP  ++ R+VE++ + LG + +P N+ L +S +AL HDP+IWG+
Sbjct  353   KLTTMSMIINETLRLYPPAVHVVRRVERE-IRLGKLIVPSNLELDVSIVALHHDPQIWGE  411

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERF+EGV KATNNH  AF+PF  GPRTC+GLNFA+ E KI LSMILQRY+  L
Sbjct  412   DVQLFKPERFSEGVAKATNNHVGAFIPFSMGPRTCVGLNFAITEVKIALSMILQRYTFTL  471

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S  YVHSP+ L  +RP+ GVQV L 
Sbjct  472   SPGYVHSPLHLLTVRPQHGVQVRLQ  496



>ref|XP_010044376.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86462.1| hypothetical protein EUGRSUZ_B03130 [Eucalyptus grandis]
Length=514

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/496 (53%), Positives = 359/496 (72%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  + + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEVRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE EL+KE+L +R+  YPK   + F+++LLG
Sbjct  78    KIHPQVNTWIDTYGRNYLNWHGPQAQLVITEPELIKEVLLNREKTYPKTGTKDFAKKLLG  137

Query  547   DGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+   +KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVSTVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+R PG+ ++ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLATLTSKNAFNIRLPGIRKLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  ++ +VDEC
Sbjct  258   LEKGIRNSILQMIKRREKKVMAGEEDGIG--DDFLGQLVKALHDTDKSKKFTVDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY  G ET  S++ W   LLA + +WQE AR+EV+ VFG ++P   G+ +LK ++MI+
Sbjct  316   KTFYIGGQETANSMMAWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG   LP N  ++I  L L HDPEIWG+DVH+FKPER
Sbjct  376   NETLRLYPPVVNLIRKVGKK-LRLGKFVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F  AEAKI LSMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKITLSMILQRYTFELSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  495   QLLTTRPQHGLQIRFH  510



>gb|KDO70288.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=520

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/492 (55%), Positives = 351/492 (71%), Gaps = 4/492 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  KLWW P   Q +M SQGI+GP+YR ++GNTKEI   R  I   PM   LSHD+ PRI
Sbjct  25    LFNKLWWIPNRTQAVMGSQGIRGPAYRLVYGNTKEILSLRNQIWISPM--GLSHDILPRI  82

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW + YG NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG
Sbjct  83    LPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDG  142

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + ++ GE W R RKLA   F+ ESLR M+PAM+ S E M++ WR  EGKEIE  +EF+LL
Sbjct  143   LVTAGGENWHRQRKLATLAFYAESLRDMIPAMVASVEIMLKRWRHSEGKEIEVSQEFKLL  202

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSE+ISRTAFGS+YLEG++IF  L  +  LAS+N   ++ P +   +K +D++E +KLE+
Sbjct  203   TSEIISRTAFGSSYLEGESIFNKLTNMSFLASRNAYKIKIPLIGDFVKTSDDVEGDKLEQ  262

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G+R+ II+++K RE+ K  + +     +D+   LL+A H  +   +I ++ ++DECKTFY
Sbjct  263   GIRDSIIKMMKTREE-KALKGESEGYGNDYFGLLLKAYHDPDMTKRISLDVLIDECKTFY  321

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AGHETTT LL W  LLLATH DWQE+ R+EV+E+FGQ+NP P GI +LK M+M++ E+L
Sbjct  322   IAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFGQKNPAPDGIGKLKTMSMVINESL  381

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   I R VE++ V LG   LP N+ L I  LA+ HDP+IWG+DV  FKPERFA+G
Sbjct  382   RLYPPAVNISRNVERE-VRLGKYILPANMELVIPILAIHHDPQIWGEDVDLFKPERFADG  440

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KA+NN P AFLPF  GPR C+GLNFA  EAKI LSMILQRY   LS SYVHSPV +  
Sbjct  441   VAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSMILQRYRFNLSPSYVHSPVLVVT  500

Query  1633  LRPKDGVQVILH  1668
             LRP+ G+QVI  
Sbjct  501   LRPQHGLQVIFQ  512



>ref|XP_009346501.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=517

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/507 (56%), Positives = 366/507 (72%), Gaps = 8/507 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +   LV     +  KLWW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    LLCVFLVFVLIKILHKLWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDLKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTE-AELVKEILSDRKGDYPKI  513
               +LSHD+   ++PHI+SW ++YG  +L W G   +LV+TE  EL KEI+S++   YPK 
Sbjct  73    -KNLSHDIVSGVVPHIHSWSQIYGKKYLQWHGSLAQLVITEEPELCKEIMSNKDKAYPKR  131

Query  514   ELQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
             E   F ++LLGDG + +++GEKW +MRKLA + F+GE L+ M P M+ SAETM+E WR +
Sbjct  132   EPDTFVKKLLGDGLVTTTEGEKWGKMRKLATHAFNGECLKSMFPDMVASAETMLERWRNY  191

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             E KEIE FEEFRL TSEVISRTAFGS+YLEG+NIFEML+KL  L SKN L VR PG+S+I
Sbjct  192   EEKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFEMLMKLAFLLSKNALTVRIPGISKI  251

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDN  1047
              K +DE+E+EKL++GV   I+ I KKRE+T  +G+E      SDF   LL+A H  N   
Sbjct  252   FKTSDEIEAEKLKKGVYASIMDIAKKREKTAMSGDEDGFG--SDFFGLLLKARHAANDGQ  309

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ +VDECKTFYFAG ETT +LL W   LLA H +WQE ARKEV+E+FG++ P   G
Sbjct  310   RISVDDLVDECKTFYFAGQETTNTLLAWTVFLLALHTNWQEEARKEVIELFGKQTPNLDG  369

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I +LK M+MI  E+LRLYPPV    RKVE++ V LG++ +P N+ L IS L+  HDP IW
Sbjct  370   ITKLKTMSMIFNESLRLYPPVAGFGRKVERE-VRLGDVIVPANVALVISNLSFHHDPRIW  428

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G+D   FKPERFAEGV KAT+N+  AF+PFG GPR+C+GLNFA+ EAKI +SMILQRYS 
Sbjct  429   GQDAQLFKPERFAEGVAKATDNNIGAFVPFGIGPRSCVGLNFAINEAKIAVSMILQRYSF  488

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LS  YVHSP+Q   +RP+ GVQV+LH
Sbjct  489   TLSPGYVHSPIQYVTVRPQHGVQVMLH  515



>ref|XP_010091618.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44884.1| Cytochrome P450 734A1 [Morus notabilis]
Length=554

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/477 (57%), Positives = 358/477 (75%), Gaps = 2/477 (0%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW+P  +Q LM  +GIKGPSYRF+HG+TKEI   ++   ++PM   LSHD+FP++
Sbjct  19    ISNKLWWSPTRLQHLMRLRGIKGPSYRFIHGSTKEILTMQKEAMARPM-PCLSHDIFPKL  77

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+ W  LYG NFL W GPQ +LV+TEAEL+KE+L+DR G Y K + + F ++LLGDG
Sbjct  78    QPHIHYWTNLYGKNFLQWDGPQAQLVITEAELIKEVLNDRDGVYSKGKGKAFFKKLLGDG  137

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             +  S+GEKWA++RKLAN+ FH ESL+ M+PAMIE  E+M+E W+  EGKEIE +EEFR L
Sbjct  138   LVISQGEKWAKVRKLANHAFHAESLKRMIPAMIEGVESMLERWKHLEGKEIEVYEEFRFL  197

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
              SEVISRTAFGS+YLEGKNIFEML+KL  LAS+NF    FP +S + K  D++ESE+LE+
Sbjct  198   MSEVISRTAFGSSYLEGKNIFEMLMKLALLASRNFYEQTFPVISTVFKTEDQIESERLEK  257

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              +R  I+ +IKKRE+      ++ +  SDFL  L++A H  N + +  ++ +VDECKTFY
Sbjct  258   RLRESIVGLIKKREEKVVISGEEDNFGSDFLGLLVKARHDVNENQRFSVDDVVDECKTFY  317

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             F G ETT SLL W  LLLA H +WQE ARKEV  + G++NP P  + +LK +++I+ E+L
Sbjct  318   FTGQETTNSLLAWTVLLLAIHTEWQEEARKEVNNLLGKQNPKPDDLIQLKTVSLIINESL  377

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV  + RKVE++ V LG + LP N+ L+IS LA+ HDP+IWG+DVH FKPERF+ G
Sbjct  378   RLYPPVVSMSRKVERE-VRLGELNLPANMSLFISNLAVHHDPQIWGEDVHLFKPERFSPG  436

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             V KAT N+  AF+PFG+GPR C+G NFA+ +AKI L+MILQRY++ LS +YVHSPVQ
Sbjct  437   VFKATKNNIAAFVPFGFGPRNCVGSNFAIMQAKIALAMILQRYTVTLSPAYVHSPVQ  493



>ref|XP_008361867.1| PREDICTED: uncharacterized protein LOC103425555 [Malus domestica]
Length=1316

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/493 (56%), Positives = 366/493 (74%), Gaps = 6/493 (1%)
 Frame = +1

Query  199   EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILP  378
             +KLWW P HIQ  M++QG+ GPSY+F+HG+TKEI   +R    +P    L+HD+F  + P
Sbjct  829   QKLWWTPNHIQNQMAAQGVHGPSYKFIHGSTKEILSMKRETMGRPR--SLTHDIFSAVQP  886

Query  379   HIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIG  558
             HI++W +++G NFL W G QP++++ E EL KE+L+++  +Y K   QG+ ++LLGD I 
Sbjct  887   HIHAWSKIFGKNFLQWYGVQPQMIIAEPELCKEVLNNKDRNYRKQRSQGYIKKLLGDSIS  946

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
              ++GEKW ++RKLA++ FHGE L+ M+P MI+S+ETMV+ W+ +EGKEIE  EEFR  TS
Sbjct  947   MAEGEKWVKLRKLAHHAFHGEXLKNMIPEMIKSSETMVQRWKTYEGKEIEVNEEFRFFTS  1006

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS++LEGKNIF ML +L +L  +N   +RFPG+S   K +DE++SEKLE+G+
Sbjct  1007  EVISRTAFGSSFLEGKNIFXMLRELTSLIFRNTFKLRFPGISMFYKTSDEIKSEKLEKGI  1066

Query  919   RNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             R+ I +I++KRE+T +TGE     R  D+L  LL+A+H  N   +I ++ +VDECKTFYF
Sbjct  1067  RDIITEIVRKREKTARTGEAGGFGR--DYLGILLKAHHDANEKQRISVDDLVDECKTFYF  1124

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETT SLL W   LLA H DWQE ARKEV+E+FG+ENP   G+ +LK M MI+ E LR
Sbjct  1125  AGQETTNSLLAWTVFLLALHTDWQEEARKEVLELFGKENPNTDGLNKLKTMGMIINEALR  1184

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LYPPV  + R+   K V LG I +P N+ L+++ LAL HDP+ WGKDV  FKPERF+EGV
Sbjct  1185  LYPPVVSLTRE-SLKEVRLGQIVVPANVELHVANLALHHDPKYWGKDVQLFKPERFSEGV  1243

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KATNN+ +AF+PFG GPRTC+G+NFA+ EAKI LSMILQRYS  LS  YVHSP+Q   +
Sbjct  1244  AKATNNNAVAFMPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFTLSPGYVHSPIQFLTV  1303

Query  1636  RPKDGVQVILHRI  1674
             RP+ GVQVILH +
Sbjct  1304  RPQHGVQVILHPV  1316



>ref|XP_009356448.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/495 (54%), Positives = 355/495 (72%), Gaps = 6/495 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P  +QKLM+ QGI GP YR +HGNTKEI++  +   S+P   +LSHDVF  +
Sbjct  27    IFHKLWWTPTRLQKLMALQGITGPPYRLIHGNTKEITDMIKEAMSRP--KNLSHDVFSVV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+SW ++YG N+L W G + +L+VT+ EL KEIL+++   YPKIE   F ++L GDG
Sbjct  85    QPHIHSWTQIYGKNYLQWHGSKAQLIVTDPELCKEILNNKDRAYPKIETPYFEKKLFGDG  144

Query  553   I-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRL  729
             +  ++K EKWA++RKLA + FHGESL+ M PAM+ S ETM+E W+ +EGKEIE F+EFRL
Sbjct  145   LLTTTKAEKWAKLRKLATHAFHGESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFRL  204

Query  730   LTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLE  909
              +SEVISRTAFGSNY+EGKNIFEML KL  L  KN L +R P +S+  K +DE+E++KLE
Sbjct  205   FSSEVISRTAFGSNYIEGKNIFEMLAKLGVLVFKNSLTIRVPVISKFFKTSDEIEADKLE  264

Query  910   EGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             +G+R  I++I+K+RE+  TG E   S  SDFL  LL+A H  N D +I  + + + CK F
Sbjct  265   KGLRVSIMEIVKRREEKATGGE--GSFGSDFLGLLLKAYHDTNDDQRISADELFELCKEF  322

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             Y    ETT +LL W   LLA H DWQE  RKEV+++FG++ P   GIA+LK M+M++ E+
Sbjct  323   YLVAQETTNALLAWTVFLLALHTDWQEEVRKEVVDLFGKQTPNADGIAKLKTMSMVINES  382

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLY PV  I RK E++ V LG + +PPN+ L +  LAL HDP+IWG+D+  FKPERF+E
Sbjct  383   LRLYSPVATIIRKTERE-VELGKVIVPPNLELIVPNLALHHDPQIWGEDLQLFKPERFSE  441

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV KAT+N+  AF+PFG G R+C+G+NF   EAKI LSMIL+RYS  LS  YVH P    
Sbjct  442   GVAKATDNNVGAFIPFGMGLRSCVGMNFTNIEAKIALSMILRRYSFTLSPGYVHLPFHYL  501

Query  1630  MLRPKDGVQVILHRI  1674
              +RPK G+QV+LH +
Sbjct  502   TVRPKHGIQVMLHSL  516



>ref|XP_004298351.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=517

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/513 (52%), Positives = 371/513 (72%), Gaps = 17/513 (3%)
 Frame = +1

Query  169   LLVLAAAWLC------------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEAR  312
             L+++ +++LC             KLWW P  IQKLM+SQGIKGPSY+ +HGNTKEIS   
Sbjct  7     LVIIISSFLCLFYFVALLFKIFHKLWWTPNRIQKLMASQGIKGPSYKLVHGNTKEISNMY  66

Query  313   RGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDR  492
             +   S+P+   LSH++F  + PH +SW  +YG N+L WLG + +LV+ E EL ++IL+++
Sbjct  67    KEAMSRPL--SLSHNIFAYVQPHFHSWSNIYGKNYLQWLGSRAQLVIREPELCRQILNNK  124

Query  493   KGDYPKIELQGFSRRLLGDGIGS-SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETM  669
              G Y KI  + F ++LLG G+ + ++G+KW+ +RK++N+ FHGESL+ M+P +I  AE M
Sbjct  125   DGAYLKIPPENFVKKLLGYGLVTIAEGQKWSNLRKISNHAFHGESLKTMIPDIIACAEIM  184

Query  670   VEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVR  849
             ++ W  HEGKEI+  EEFRL TSEVISRTAFGS+YLEG++IFEML KL  +  +N L ++
Sbjct  185   LKRWESHEGKEIDVVEEFRLFTSEVISRTAFGSSYLEGQHIFEMLKKLALILFRNSLQIK  244

Query  850   FPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANH  1029
              PG+S++ K NDE+ESEKLE+G+++ II+++KKRE   T  EQ  +  SDFL  LL+A+H
Sbjct  245   VPGVSKLFKTNDEIESEKLEKGIQDSIIELVKKREHKVTSGEQ-DNFGSDFLGLLLKAHH  303

Query  1030  QENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQE  1209
              +N + +I ++ +VD+CKTFY AG +TT++LL W   LLA + DWQE ARKEV+++FG++
Sbjct  304   NDNLNQRISVDDIVDDCKTFYLAGQDTTSTLLTWTVFLLALNTDWQEEARKEVLQLFGKQ  363

Query  1210  NPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQ  1389
             NP P  I++LK M+MIL E+LRLYPP   I R +  + V LG + +P ++ L +S L L 
Sbjct  364   NPNPDDISKLKTMSMILNESLRLYPPALAIPR-ITGREVRLGKLIVPADVELLVSVLTLH  422

Query  1390  HDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMI  1569
             H+P+ WG DVH FKPERF EGV KATNN+   F+PFG G RTC+GLNFA  EAKI LSMI
Sbjct  423   HEPQFWGPDVHLFKPERFLEGVAKATNNNIGTFMPFGLGSRTCVGLNFATTEAKIALSMI  482

Query  1570  LQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LQRYS  LS +Y+HSP Q  +LRP+ G+QV+L 
Sbjct  483   LQRYSFTLSPAYIHSPCQSLLLRPQHGLQVLLQ  515



>ref|XP_009346500.1| PREDICTED: cytochrome P450 CYP749A22-like [Pyrus x bretschneideri]
Length=516

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/506 (56%), Positives = 365/506 (72%), Gaps = 7/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +   LV     +  K+WW P  IQK+M +QGIKGP YR +HGNTKEIS+ ++ +  +P 
Sbjct  14    LLCVFLVFVLINILHKVWWTPTRIQKMMKAQGIKGPPYRLIHGNTKEISDLKKEVMRRP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LSHD+   ++PHI+SW ++YG  +L W G   +LV+TE EL KEI+S++   YPK E
Sbjct  73    -KNLSHDIVSGVVPHIHSWSQIYGKKYLQWHGSLAQLVITEPELCKEIMSNKDKAYPKRE  131

Query  517   LQGFSRRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
                F+++LLGDG + +++GEKW +MRKLA + F+GE L+ M P M+ SAETM+E WR +E
Sbjct  132   PDTFAKKLLGDGLVTTTEGEKWGKMRKLATHAFNGECLKSMFPDMVASAETMLERWRNYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
              KEIE FEEFRL TSEVISRTAFGS+YLEG+NIFEM++KL  L SKN L VR PG+S+I 
Sbjct  192   EKEIEVFEEFRLFTSEVISRTAFGSSYLEGQNIFEMMMKLAFLLSKNALTVRIPGISKIF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K +DE+E+EKLE+GV   I+ I KKRE+T  +G+E   S  SDF   LL+A H      +
Sbjct  252   KTSDEIEAEKLEKGVYASIMDIAKKREKTAMSGDED--SFGSDFFGLLLKARHDAIDGQR  309

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I ++ +VDECKTFY AG ETT +LL W   LLA H +WQE ARKEVME+FG++ P   GI
Sbjct  310   ISVDDLVDECKTFYIAGQETTNTLLAWTVFLLALHTNWQEEARKEVMELFGKQTPNLDGI  369

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +LK M+MI  E+L LYPPV    RKVE++ V LG++ +P N+ L IS L+  HDP IWG
Sbjct  370   TKLKTMSMIFNESLWLYPPVAGFVRKVERE-VRLGDVIVPANVALVISNLSFHHDPRIWG  428

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D   FKPERFAEGV KAT+N+  AF+PFG GPR+C+GLNFA+ EAKI +SMILQRYS  
Sbjct  429   QDAQLFKPERFAEGVAKATDNNIGAFVPFGIGPRSCVGLNFAINEAKIAVSMILQRYSFT  488

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  YVHSP+Q   +RP+ GVQV+LH
Sbjct  489   LSPGYVHSPIQYVTVRPQHGVQVMLH  514



>gb|KDP41351.1| hypothetical protein JCGZ_15758 [Jatropha curcas]
Length=477

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/479 (58%), Positives = 353/479 (74%), Gaps = 8/479 (2%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M SQGIKGPSYRFLHGNTK+I++ R+     PME  LSH + PRI PHIYSW +LYG NF
Sbjct  1     MRSQGIKGPSYRFLHGNTKQIAKMRKEAIYNPME--LSHHILPRIQPHIYSWMKLYGMNF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L W G + +L VTE ELVKEIL++++  Y KI  Q + + +LGDG+  S GEKW +MRKL
Sbjct  59    LLWYGARAQLTVTEPELVKEILNNKEETYCKIGFQDYIKMVLGDGLVLSTGEKWLKMRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN  FHGE+L+GM+PAM+ S E MVE WR H+GKEIE F+EF++LTSE+ISRTAFGS+YL
Sbjct  119   ANYAFHGENLKGMVPAMLASVEMMVERWRHHDGKEIEVFQEFKVLTSEIISRTAFGSSYL  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRF--PGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             EG+ +F+ML K+  + ++N   VR   PG+ R +K  DELE +K+++ +R+ II +IKKR
Sbjct  179   EGEEVFDMLKKMIFIVARNHYKVRIPCPGIKRFLKTGDELELDKIQKEIRDTIINMIKKR  238

Query  952   EQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLG  1128
             E+ T  GE       SDFL  L++A +  + + +I I+ M+DECKTFY AG ETT S L 
Sbjct  239   EKATMMGELDGYG--SDFLGLLIKAYNDPDKNKRISIDDMIDECKTFYVAGQETTASSLT  296

Query  1129  WATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRK  1308
             W  LLLA H DWQ+ ARKEV+E+FGQ+NPT  G+ARLK MN+I+ E+LRLYPPV ++ R+
Sbjct  297   WTVLLLAIHTDWQDEARKEVLELFGQQNPTADGVARLKTMNIIINESLRLYPPVFHVTRE  356

Query  1309  VEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAF  1488
             V+++ V LG + +P  I  YI  LAL  D +IWG+D + FKPERFA GV KATNN   +F
Sbjct  357   VQRE-VRLGQLNIPNKIETYIPTLALHTDYKIWGEDAYLFKPERFAGGVAKATNNSVSSF  415

Query  1489  LPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             LPFG GPRTC+GLNFA+ E KI LSMILQRY   LS SYVHSPVQ+  + P+ GVQVIL
Sbjct  416   LPFGLGPRTCVGLNFAITEKKIALSMILQRYKFTLSPSYVHSPVQILTMCPQHGVQVIL  474



>ref|XP_008340298.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103403255 
[Malus domestica]
Length=1026

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/491 (56%), Positives = 359/491 (73%), Gaps = 4/491 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  +LWW P  IQK M+ QGI+GP YR +HGNTK++S   +   ++P   +LSHD+F R+
Sbjct  35    ILRRLWWTPTRIQKQMALQGIRGPPYRLIHGNTKQVSHMMKEXMNRP--KNLSHDIFSRV  92

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+SW ++YG N+L W G + +LV+TE EL KEIL++++  Y K E   F ++LLGDG
Sbjct  93    QPHIHSWTQIYGKNYLQWHGSRAQLVITEPELCKEILNNKERAYGKRETPKFLKKLLGDG  152

Query  553   -IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRL  729
              + +++ EKWA++RKLA + FHGE+L+ M+P M+ SAETM+  W ++ GKEIE FEEFRL
Sbjct  153   LVTTTEAEKWAKLRKLATHAFHGENLKSMIPEMVASAETMLXRWEDYVGKEIEVFEEFRL  212

Query  730   LTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLE  909
              TSEVISRTAFGS+Y+EGKNIFEMLIKL  L  KN L VR PG+S++ K NDE+ES+KLE
Sbjct  213   FTSEVISRTAFGSSYIEGKNIFEMLIKLAFLVFKNSLTVRVPGISKLFKTNDEVESDKLE  272

Query  910   EGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             + V   I +I+KKRE+      QK S  SDFL  LL+A+H  N + ++ ++ +VDECKTF
Sbjct  273   KEVHGSITEIVKKREKKAMMTGQKESFGSDFLGLLLKAHHDANENQRVSVDELVDECKTF  332

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
              FAG ETT +LL W   LLA H DWQE ARKEVM+VFG++ P P   ++LK M+MI  E+
Sbjct  333   XFAGQETTNTLLAWTVFLLALHTDWQEEARKEVMDVFGKQTPNPDDFSKLKTMSMIFYES  392

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
              RLYPP+  + RKV+++ V LGN+ +PPN+ L +S LA QHDP IWG+D   FKPERFAE
Sbjct  393   QRLYPPLDSLVRKVDRE-VRLGNVIVPPNVELILSNLAFQHDPRIWGEDSQLFKPERFAE  451

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             G+ KATNN   AF+PFG GPR+C+GLNFA  EAKI LSMILQRYS  LS  Y+H PV   
Sbjct  452   GIAKATNNTISAFIPFGVGPRSCVGLNFATIEAKIALSMILQRYSFTLSPGYIHLPVHYL  511

Query  1630  MLRPKDGVQVI  1662
              +RP+ G+QV+
Sbjct  512   TMRPQHGIQVM  522


 Score =   501 bits (1291),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 330/472 (70%), Gaps = 12/472 (3%)
 Frame = +1

Query  253   IKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLG  432
             I+ P YR +HG TKEI + R+ +  +     LSHD F  + PH+++W ++YG N+L W G
Sbjct  555   IRDPPYRLIHGTTKEIFDMRKEVMGR--SHILSHDTFSVVQPHMHAWIKIYGKNYLQWHG  612

Query  433   PQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IGSSKGEKWARMRKLANNV  609
              Q +LV TE +L KEI +++    PK E+  F  +LLGDG + +++  KW ++RKLA + 
Sbjct  613   SQAQLVXTEPDLCKEIPNNKDRAXPKREIANFVNKLLGDGLVATTEAXKWGKLRKLATHX  672

Query  610   FHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKN  789
             FHGE+L  M+P M  SAETM+E W++ EG+EIE +EEFRL TSEVISRTAFGS+Y+EGKN
Sbjct  673   FHGETLXSMIPKMXASAETMLEXWKDFEGQEIEVYEEFRLFTSEVISRTAFGSSYIEGKN  732

Query  790   IFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTG  969
             IF MLIK+ +L  KN L VR PG+S+  K +DE+ES+KLE       I+ +KKRE+ K  
Sbjct  733   IFXMLIKIGSLIXKNSLKVRVPGISKFFKTSDEIESDKLE-------IESVKKREK-KAR  784

Query  970   EEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLA  1149
              E+K S  SDFL  LL+A H  N +++I ++ ++DECKTFYFAG ETT + L W  LLLA
Sbjct  785   PEEKDSFGSDFLGLLLKARHNANDNHRISVDELIDECKTFYFAGQETTNTSLAWTVLLLA  844

Query  1150  THEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVV  1329
              H DWQE ARKEV+ +FG++ P   GI++++ + MI+ E+LRLY P     RK E++ V 
Sbjct  845   LHTDWQEEARKEVIXLFGKQTPNHDGISKMRTVTMIINESLRLYTPXVSXXRKAERE-VK  903

Query  1330  LGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGP  1509
             LG + +P N+ L +S  A   DP+IWG+DVH FK +RF+EGV+KATNN+  AF+PFG GP
Sbjct  904   LGKLIIPANLELVVSTXAPHQDPKIWGQDVHLFKQDRFSEGVLKATNNNVGAFIPFGLGP  963

Query  1510  RTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             RT +GLNFA  EAKI LSMILQRYS  LS  YVH P+    +RP  GVQVIL
Sbjct  964   RTXVGLNFATTEAKIALSMILQRYSFTLSPGYVHXPLHYIXVRPHHGVQVIL  1015



>ref|XP_009356543.1| PREDICTED: uncharacterized protein LOC103947364 [Pyrus x bretschneideri]
Length=1045

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/508 (55%), Positives = 370/508 (73%), Gaps = 13/508 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FI S+L+     +  KLWW P  +QKLM+SQGIKGPSY+ ++GNTKEIS  ++   S P 
Sbjct  541   FILSVLIS----ILHKLWWKPARMQKLMASQGIKGPSYKLVYGNTKEISSMKKETMSSP-  595

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+   +LPH + W  +YG  FL W G QP+LV+ + EL KEIL ++   YPK++
Sbjct  596   -KSLSHDILSHVLPHFHWWTNVYGKYFLQWHGSQPQLVIRDPELCKEILQNKDRAYPKLK  654

Query  517   LQGFSRRLLGDGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             ++ + ++L+GD + ++ + EKW ++RKLAN+ FHGE+L+GMLPAM+ SAE+M+E W+ +E
Sbjct  655   IKDYPKKLVGDSVLTTPEYEKWTKLRKLANHAFHGENLKGMLPAMVASAESMLERWKNYE  714

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEF+L+TSEVIS+TAFGS+YLEGK IFE+L+KL   A KNF  VRFPGMS+  
Sbjct  715   GKEIEVFEEFKLMTSEVISKTAFGSSYLEGKLIFELLMKLCFFAFKNFYTVRFPGMSKFY  774

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQT---KTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             K +DE E+EK+E+ + N +++IIKKRE+    + GEE +    SD+L  LL+A+H  +  
Sbjct  775   KTSDEREAEKIEKALHNSVMEIIKKREEKAILRNGEEDRFG--SDYLGLLLKAHHDADDK  832

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I +E +++ECK FYFAG ETTT LL W  LLLA H DWQE+ARKEV+++FG+  P   
Sbjct  833   QRISVEDLINECKAFYFAGQETTTVLLAWTVLLLAIHADWQEKARKEVLQIFGERTPNAD  892

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GI++LK M+MIL E+LRLYPPV  I R V KK   LG   +P N+ L I  LAL H+PE 
Sbjct  893   GISKLKTMSMILNESLRLYPPVVSISRTV-KKEARLGKFMVPVNLELVIPILALHHEPEF  951

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG D   FKP+RF++GV KATNN+  AF+PFG GPRTC G+NF   EAK+ LSMILQRYS
Sbjct  952   WGPDAQLFKPDRFSDGVAKATNNNMGAFMPFGIGPRTCAGINFVANEAKVALSMILQRYS  1011

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              +LS +Y+HSP QL  LRP+ GVQVILH
Sbjct  1012  FSLSPAYIHSPFQLLTLRPRHGVQVILH  1039


 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/536 (53%), Positives = 373/536 (70%), Gaps = 22/536 (4%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  I KLM+SQGI+GP YRF+HGNTK+I+  R+   SKP   DLSHD+   + PH
Sbjct  31    KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKP--KDLSHDILSVVQPH  88

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK----------IELQGFS  531
             ++SW  +YG N+L W G + + V+TE EL KEIL+++   YPK            +QGF 
Sbjct  89    MHSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKRAXXXXXXXXXAVQGFV  148

Query  532   RRLLGDG-IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
             R+LLGDG + ++ GEKW ++RK+AN+ FHGESL+ ML  M+ SAETM+E W++++GKEIE
Sbjct  149   RKLLGDGLVSATDGEKWGKLRKIANHAFHGESLKSMLSEMVASAETMLERWKDYDGKEIE  208

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              F EF+L +SEVISRTAFGS+Y+EGKNIFEML  +  L  KN L +R PG+S+ +K  DE
Sbjct  209   VFGEFKLFSSEVISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDE  268

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             +E+EKLE+ V   I++I+KKRE+ K     + S  SDFL  L++A H  N D +I ++ +
Sbjct  269   IEAEKLEKAVHASIVEIVKKREE-KAMTRGEDSFGSDFLGLLVKAYHDSNDDQRISVDDL  327

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             VDECKTFYFAG ET  + L W   LLA H DWQE ARKEV+++FG++NP   GIA++K M
Sbjct  328   VDECKTFYFAGQETVNTSLTWTVFLLALHTDWQEEARKEVIQLFGKQNPNHDGIAKMKTM  387

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             +MI+ E+LRLY P   I RKVE++ V LG   +P N+ L IS +A+ HDP+IWGKDV  F
Sbjct  388   SMIINESLRLYTPPVSITRKVERE-VRLGQFIVPANVDLVISTIAIHHDPQIWGKDVQLF  446

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KP+RF+EGV KATNN+  AF+PFG GPRTC+GLNFA  EAKI LSMILQRYS  LS  Y+
Sbjct  447   KPDRFSEGVAKATNNNVGAFIPFGLGPRTCVGLNFATTEAKIALSMILQRYSFTLSPGYI  506

Query  1609  HSPVQLFMLRPKDGVQVILHRI***SLLACINSWFLDNILLVSTHNQI*QR*CEWW  1776
             HSP+     RP+ GVQV+LH +   S L     +F+ ++L+   H         WW
Sbjct  507   HSPLHYLTCRPQHGVQVMLHSLKIMSSLEGFLCFFILSVLISILHKL-------WW  555



>ref|XP_002512038.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50707.1| cytochrome P450, putative [Ricinus communis]
Length=516

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/503 (54%), Positives = 359/503 (71%), Gaps = 5/503 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+ S  +L  +    K WW PV IQ LM SQGIKGPSYRF+HGNTK+I+  R+     PM
Sbjct  16    FLCSYFLLILSKFLYKEWWTPVRIQSLMRSQGIKGPSYRFIHGNTKDITNMRKETMENPM  75

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  LSH + PRI PHIYSW +LYG NFL W G + +LVVTE EL +EIL+ ++  + K+ 
Sbjct  76    E--LSHLILPRIQPHIYSWIKLYGTNFLLWYGGRAQLVVTEPELAQEILNSKEVTFYKVG  133

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
              Q +  +LLGDG+  + GEKW +MRKLA+  FH E+L+GM+PAMI S+E M+E WR H G
Sbjct  134   FQEYITKLLGDGLVLASGEKWIKMRKLASRAFHSENLKGMVPAMIASSEVMLEGWRSHPG  193

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEI+AF+EF++LTSE+ISRTAFGS+YLEG+ IFEML K  ++ + N   VR PG+ +  K
Sbjct  194   KEIDAFQEFKVLTSEIISRTAFGSSYLEGEKIFEMLKKTISIIAGNHYKVRIPGI-KFFK  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
                ++E +KL++ +R+ I++++KKRE+     EQ S    DFL  L++A   E+ + +I 
Sbjct  253   TTYDVELDKLQQDIRDTIMEMVKKREEAAKISEQDSFGH-DFLGSLIKAYKDEDKNKKIS  311

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             IE M+DECK FY AG ETT S L W  LLLA H DWQE+ARKEV+E+FGQ+NPT  GI R
Sbjct  312   IEDMIDECKNFYVAGQETTASSLSWTILLLAIHRDWQEKARKEVLELFGQQNPTADGITR  371

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M+MI+ E+LRLYPPV ++ R+V K+ V LG + +P  +   +  LAL  D +IWG+D
Sbjct  372   LKTMSMIINESLRLYPPVLHVNREV-KREVKLGKLLIPAKMETNVPVLALHTDNKIWGED  430

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H ++PERFAEGV KATNN+  +++PFG GPRTC+GLNFA+ E KI LSMILQRY   LS
Sbjct  431   AHLYRPERFAEGVAKATNNNISSYIPFGLGPRTCVGLNFAITEKKIALSMILQRYRFTLS  490

Query  1597  SSYVHSPVQLFMLRPKDGVQVIL  1665
              +YVHSPV +  + P+ GV +IL
Sbjct  491   PTYVHSPVHILTMCPQYGVPIIL  513



>ref|XP_008390037.1| PREDICTED: uncharacterized protein LOC103452311 [Malus domestica]
Length=1032

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/493 (56%), Positives = 359/493 (73%), Gaps = 7/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  I KLM+SQGI+GP YRF+HGNTK+I+  R+   SKP   DLSHD+   + PH
Sbjct  545   KLWWTPTRISKLMASQGIRGPPYRFIHGNTKQIATMRKEAMSKP--KDLSHDILSVVQPH  602

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IG  558
             ++SW  +YG N+L W G + + V+TE EL KEIL+++   YPK E+QGF R+LLGDG + 
Sbjct  603   MHSWIMIYGKNYLQWHGTRAQFVITEPELCKEILNNKDRAYPKREVQGFVRKLLGDGLVS  662

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +++GEKW ++RK+AN+ FHGESL+ M   M+ SAETM+E W++++GKEIE F E +L +S
Sbjct  663   TTEGEKWGKLRKIANHAFHGESLKSMFSEMVASAETMLERWKDYDGKEIEVFGELKLFSS  722

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EGKNIFEML  +  L  KN L +R PG+S+ +K  DE+E+EKLE+ V
Sbjct  723   EVISRTAFGSSYIEGKNIFEMLNNIGFLIFKNALTIRIPGISKFLKTRDEIEAEKLEKAV  782

Query  919   RNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
                I++I+ KRE+   TG E   S  SDFL  LL+A H  N D +I ++ +VDECKTFYF
Sbjct  783   HASIVEIVXKREEKAMTGGE--DSFGSDFLGLLLKAYHDSNDDQRISVDDLVDECKTFYF  840

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ET  +LL W   LLA H DWQE ARKEV+ +FG + P   GIA++K M+MI+ E+LR
Sbjct  841   AGQETANTLLAWTVFLLALHTDWQEEARKEVIXLFGXQTPNHDGIAKMKRMSMIINESLR  900

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LY P   I RKVE++ V LG + +P N+ L IS +A+ HDP+IWGKDV  FKP+RF+EGV
Sbjct  901   LYTPPVSITRKVERE-VRLGQLIVPANVDLVISTIAIHHDPQIWGKDVQLFKPDRFSEGV  959

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KATNN+   F+PFG GPRTC+GLNFA  EAKI LSMILQR+S  LS  Y+HSP+     
Sbjct  960   AKATNNNVGVFIPFGLGPRTCVGLNFATTEAKIALSMILQRFSFTLSPGYIHSPLHYLTC  1019

Query  1636  RPKDGVQVILHRI  1674
             RP+ GVQV+LH +
Sbjct  1020  RPQHGVQVMLHSL  1032


 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/488 (56%), Positives = 361/488 (74%), Gaps = 5/488 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW P  I+KLM+SQGI+GP YR +HGNTKEIS+ R+ +  +P    LSHD+   + PH
Sbjct  29    KIWWTPTRIRKLMASQGIRGPPYRLIHGNTKEISDMRKEVMGRP--QILSHDILSVVQPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG-IG  558
              +SW ++YG N+L W G + +LV+TE EL KEIL+++   YPK +   F  +LLGDG + 
Sbjct  87    THSWIKIYGKNYLQWHGSKAQLVITEPELCKEILNNKNRAYPKTDTPNFVNKLLGDGLVT  146

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +++ EKW ++RKLA + FHGE+L+ M+P M+ SAE M+E W+  EGKEIE +EEFRL TS
Sbjct  147   TTEAEKWGKLRKLATHAFHGETLKSMIPEMVASAEAMLERWKFFEGKEIEVYEEFRLFTS  206

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EGKNIFEML+KL ++  KN   VR PG+S+  K +DE+ES+KLE+ V
Sbjct  207   EVISRTAFGSSYIEGKNIFEMLMKLGSILFKNAFKVRVPGISKFFKTSDEIESDKLEKEV  266

Query  919   RNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
                II+I+KKRE  K G ++K +  SDFL  LL+A    + + +I ++ ++DECKTFYFA
Sbjct  267   HATIIEIVKKREN-KAGTKEKDNFGSDFLGLLLKAXQSADDNQRISVDELIDECKTFYFA  325

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G ETT +LLGW   LLA + DWQE ARKEV+++FG++ P   GIA+++ MNMI+ E LRL
Sbjct  326   GQETTNTLLGWTVFLLALNTDWQEEARKEVIQLFGKQTPNHDGIAKMRTMNMIINECLRL  385

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             Y P  Y+ RKVEK+ V LG + +P N+ L IS +AL HDP+IWGKDVH FKP+RF+EGV+
Sbjct  386   YTPPVYLTRKVEKE-VKLGKLIVPANLELVISTIALHHDPQIWGKDVHLFKPDRFSEGVL  444

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KATNN+  AF+PFG GPRTC+GLNF+  EAKI LSMILQRYS  LS SYVH P+    +R
Sbjct  445   KATNNNVGAFIPFGLGPRTCVGLNFSTTEAKIALSMILQRYSFTLSPSYVHLPLHYVTVR  504

Query  1639  PKDGVQVI  1662
             P  GVQ +
Sbjct  505   PYHGVQPV  512



>ref|XP_006437867.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
 gb|ESR51107.1| hypothetical protein CICLE_v10033321mg [Citrus clementina]
Length=509

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 366/506 (72%), Gaps = 6/506 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +    +L   W   K+WW PV IQ  M SQGIKGPS++F+HG+TK+I   +      PME
Sbjct  9     VCLFFLLVLIWFINKVWWTPVRIQSRMRSQGIKGPSHKFIHGSTKDILNMKNETMRSPME  68

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               LSH ++PR+ PH+YSW +LYG NFL W G + +LVVTE +L+KEILSD+   YPK E 
Sbjct  69    --LSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSDKHRAYPKREP  126

Query  520   QGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK  699
             + ++++LLG+G+ +++GEKW + RKLAN+ FH E+L+ M+P MI SAE M++ WR++EG+
Sbjct  127   REYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMMLDRWRDNEGQ  186

Query  700   EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKN  879
             EI+ ++EF++LT E ISRTAFGS+YLEG+NIF ML KL    SKN   VR P + +++K 
Sbjct  187   EIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVRIPVIGKLVKT  246

Query  880   NDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             +D++ES K E+ +R+ II+IIKKRE    TGE +  S  SD L  L++A H  +   +I 
Sbjct  247   HDDIESHKTEQDIRDSIIKIIKKRESNVMTGEVE--SYGSDLLGVLMQAYHNVDETLKIS  304

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++DECKTFY AGHETT SLL W  LLLA H DWQ++AR EV+++FGQ++P    I+R
Sbjct  305   LDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQSPNADNISR  364

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIM+MI+ E+LRLYPPV  I RKV KK V LG   +P ++ + I  LA+ HDP+IWG++
Sbjct  365   LKIMSMIINESLRLYPPVVLILRKV-KKEVKLGKFVIPADVDITIPTLAVHHDPQIWGEE  423

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H FKPERFA GV  ATNN+  AF+PFG GPRTC+G N+A+ EAKI LSMILQ+Y   LS
Sbjct  424   FHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYKFTLS  483

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP  +  LRP+ G+QV+LH +
Sbjct  484   PTYVHSPASIITLRPQHGLQVLLHAL  509



>ref|XP_006484250.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=509

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 366/506 (72%), Gaps = 6/506 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             +    +L   W   K+WW PV IQ  M SQGIKGPS++F+HG+TK+I   +      PME
Sbjct  9     VCLFFLLVLIWFINKVWWTPVRIQSRMRSQGIKGPSHKFIHGSTKDILTMKNETMRSPME  68

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               LSH ++PR+ PH+YSW +LYG NFL W G + +LVVTE +L+KEILSD+   YPK E 
Sbjct  69    --LSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSDKHRAYPKREP  126

Query  520   QGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK  699
             + ++++LLG+G+ +++GEKW + RKLAN+ FH E+L+ M+P MI SAE M++ WR++EG+
Sbjct  127   REYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMMLDRWRDNEGQ  186

Query  700   EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKN  879
             EI+ ++EF++LT E ISRTAFGS+YLEG+NIF ML KL    SKN   VR P + +++K 
Sbjct  187   EIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVRIPVIGKLVKT  246

Query  880   NDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             +D++ES K E+ +R+ II+IIKKRE    TGE +  S  SD L  L++A H  +   +I 
Sbjct  247   HDDIESHKTEQDIRDSIIKIIKKRESNVMTGEVE--SYGSDLLGVLMQAYHNVDETLKIS  304

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++DECKTFY AGHETT SLL W  LLLA H DWQ++AR EV+++FGQ++P    I+R
Sbjct  305   LDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQSPNADNISR  364

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIM+MI+ E+LRLYPPV  I RKV KK V LG   +P ++ + I  LA+ HDP+IWG++
Sbjct  365   LKIMSMIINESLRLYPPVVLILRKV-KKEVKLGKFVIPADVDITIPTLAVHHDPQIWGEE  423

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H FKPERFA GV  ATNN+  AF+PFG GPRTC+G N+A+ EAKI LSMILQ+Y   LS
Sbjct  424   FHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYKFTLS  483

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP  +  LRP+ G+QV+LH +
Sbjct  484   PTYVHSPASIITLRPQHGLQVLLHAL  509



>ref|XP_004297208.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/506 (52%), Positives = 358/506 (71%), Gaps = 7/506 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKL----WWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              LVL A  L  K+    WW P   QKLM+ QGIKGP YR +HGNTKEI   +    S+P 
Sbjct  10    FLVLFALILMIKIFLTQWWTPTRFQKLMARQGIKGPCYRLVHGNTKEILNMKTEAISRP-  68

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                L+HD+FP + PH  SW + YG  FL W G +P+LV+ E EL KEIL+++   Y + +
Sbjct  69    -KPLTHDLFPLVQPHYQSWFKRYGKVFLQWYGTEPQLVILEPELCKEILNNKDRVYMQKD  127

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
              QGF ++LLG+G+G+++GE WA++RK+AN+ FHGESL+ M+P +I SAE M+  W+ HEG
Sbjct  128   PQGFVKKLLGNGLGTAEGEHWAKLRKIANHAFHGESLKNMIPDIIASAENMLHRWKNHEG  187

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE ++EFRLLTSEVISRTAFGS+YLEGK IF+ML KL +L  +N   +R PG+S++ K
Sbjct  188   KEIEVYQEFRLLTSEVISRTAFGSSYLEGKTIFDMLTKLSSLLFRNSYKIRLPGISKLFK  247

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + DE+E++K+E+ +R+ I++I+KKRE+      +     SDFL  LL+A+H  +  ++I 
Sbjct  248   SRDEIEADKVEKDIRSSILKIVKKREKEAAVSGKGDWFGSDFLGLLLKAHHDADERSKIS  307

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++D+C+ FYFAG ETT  LL W   LLA H DWQE+ARKEV ++FG++NP P GIA+
Sbjct  308   VDDIIDQCRAFYFAGQETTNGLLAWTVFLLALHPDWQEKARKEVTQIFGKQNPNPDGIAK  367

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
              K M+MI+ E+LRLYPPV  + RK  ++ V LG   LP NI + I  +A  HDP+IWG +
Sbjct  368   QKTMSMIINESLRLYPPVIQLVRKTGRE-VRLGKFILPANIQVLIPNVAFHHDPQIWGPE  426

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
                FKPERF+EGV KAT ++  AFLPFG GPR C+G NFA  E KI LSMILQRY+  LS
Sbjct  427   AQLFKPERFSEGVAKATRDNMAAFLPFGMGPRICVGFNFATTETKIALSMILQRYTFTLS  486

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
               YVHSP+Q   +RP+ GVQV+LH +
Sbjct  487   PGYVHSPLQFLTVRPQHGVQVMLHSL  512



>ref|XP_002316008.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
 gb|EEF02179.1| hypothetical protein POPTR_0010s14920g [Populus trichocarpa]
Length=513

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/507 (51%), Positives = 362/507 (71%), Gaps = 7/507 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEK----LWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
             +IS  + LA   +  K    +WW P+ IQ +M SQGI+GPSY+F+HGNTKEI   R+ + 
Sbjct  7     YISCCMCLAFLSILVKFLKEVWWKPIRIQSMMRSQGIRGPSYKFIHGNTKEIINMRKSVQ  66

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
             S PME    H++ P + PHI++W +LYG  F+YW G Q +LVVTE +L+KEI +++ G +
Sbjct  67    STPMELS-HHELLPIVQPHIHAWIKLYGMTFMYWHGSQAQLVVTEPDLIKEIFNNKNGAF  125

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
             PK  L  + ++LLGDGI ++ GEKW ++RKL+N+ FH E L+ M+PAMI S E M++ WR
Sbjct  126   PKRNLPVYMKKLLGDGIVAANGEKWFKLRKLSNHAFHAECLKSMIPAMIASVEVMLKRWR  185

Query  685   EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMS  864
             +H+GKEI+ F+EF+LLTSE+ISRTAFGS+YLEG+++F+ML ++  +  +N   +  PG+ 
Sbjct  186   QHDGKEIDVFQEFKLLTSEIISRTAFGSSYLEGQHVFDMLTRMGDIIVRNHYKITIPGIR  245

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             + +K  D++ES+KLE+ +RN  I +IK RE+    E +     SDFL  LL A+H+ +  
Sbjct  246   KFVKMRDDIESDKLEQEIRNCFINMIKNREKAAM-EGKWGDFGSDFLGILLLAHHETDKA  304

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
              +I +E ++DECKTFYFAGHETT + L W  LLLA H DWQ++AR+EV+E+FG +NP P 
Sbjct  305   KRISVEDIIDECKTFYFAGHETTRTSLTWIVLLLAFHTDWQDKARREVLELFGMQNPNPE  364

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             GI +LK ++MI+ ETLRLY P  +I R V +K V LG + +P N  +YI  + + H+PEI
Sbjct  365   GITKLKTVSMIINETLRLYSPAIHIPRMV-RKEVRLGKLIIPANTEIYIPLVVVHHNPEI  423

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+D H FKPERFA+GV KATNN+  AFLPFG GPR+C+GLNF+  E KI L+MILQ Y 
Sbjct  424   WGEDAHLFKPERFADGVAKATNNNMNAFLPFGLGPRSCVGLNFSFTETKIALAMILQHYR  483

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVIL  1665
               LS +Y+HSP  L  + P+ GVQ++L
Sbjct  484   FTLSPTYIHSPAHLLTMSPQHGVQIML  510



>ref|XP_002512037.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50706.1| cytochrome P450, putative [Ricinus communis]
Length=513

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/514 (52%), Positives = 374/514 (73%), Gaps = 16/514 (3%)
 Frame = +1

Query  160   ISSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISE  306
             + +L+V  A+  C            K+WW P+ +Q  M SQGIKGPSYRFL GNTKEI+ 
Sbjct  1     MKNLIVCLASCFCLYFLLNLIKFLSKVWWNPICVQSSMRSQGIKGPSYRFLLGNTKEITN  60

Query  307   ARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILS  486
              R  I + PME  LSH++ PRI PHIY W +LYG  FL W GP+ +L++TE ELV+E+L+
Sbjct  61    MRSRIMNGPME--LSHEMLPRIQPHIYYWIKLYGTYFLNWYGPKAQLIITEPELVQEVLN  118

Query  487   DRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAET  666
             +++G + K  +Q ++ +LLG+G+ +S+GEKW +MRKLAN  FHGESL+GM+PAM+ S ET
Sbjct  119   NKEGAFGKKHIQNYADKLLGNGLFASQGEKWLKMRKLANQAFHGESLKGMVPAMVASVET  178

Query  667   MVEAWREH-EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLN  843
             M++ WR++ EGKEIE ++EF++LT+E+IS+TAFGSNYLEGKN F+ML ++  + ++N   
Sbjct  179   MLQRWRQNQEGKEIEVYQEFKVLTAEIISKTAFGSNYLEGKNTFDMLARMANIVARNNYR  238

Query  844   VRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEA  1023
             V  PG+ + +K  D+  SEKLE+G+R+ I++IIKKRE+ +    +  +  +DFL  LL+A
Sbjct  239   VGIPGIKKFLKTRDDTASEKLEQGMRDSIMKIIKKREE-EMLMGKNDAYGNDFLGLLLKA  297

Query  1024  NHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFG  1203
             +H  +   +I +  ++DECK+FY AGHETT+S L W  LLLA H  WQE+AR+EV+E+FG
Sbjct  298   HHDNDKAKKISVNDLIDECKSFYVAGHETTSSSLTWTVLLLAIHPIWQEKAREEVLELFG  357

Query  1204  QENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLA  1383
             ++NP+P GI RLKIM+MI+ E+LRLY P   I R+V+K+ V LG + +P  + + +  LA
Sbjct  358   KQNPSPDGIRRLKIMSMIVNESLRLYTPAFSITREVQKE-VKLGKLVVPEKMSVCLPVLA  416

Query  1384  LQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLS  1563
             + H+P++WG+DVH FKPERF +GV KAT N   AFLPFG GPR+C+G+NFA  E KIVLS
Sbjct  417   VHHNPQVWGEDVHLFKPERFIDGVAKATENSIGAFLPFGGGPRSCVGMNFATTEMKIVLS  476

Query  1564  MILQRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             MILQ     LS +YVHSPV +  +RP+ G+Q++L
Sbjct  477   MILQHCRFTLSPTYVHSPVDILTIRPQYGLQIML  510



>ref|XP_010044348.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW86439.1| hypothetical protein EUGRSUZ_B03107 [Eucalyptus grandis]
Length=514

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/496 (53%), Positives = 357/496 (72%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  + + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKEAIKMQMKVRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ  LV+TE EL+KE+L DR+  YPK   + F+++LLG
Sbjct  78    KIHPQVNTWIDTYGRNYLSWHGPQARLVITEPELIKEVLLDREKTYPKTGTKDFAKKLLG  137

Query  547   DGIGS-SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S    +KWA  RKLAN+ FHGESL+ M PAM+ES  TM+E W+  EGKEIE F EF
Sbjct  138   DGLVSIVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLEKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L +L SKN  N+R PG+S++ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLASLTSKNAFNIRLPGISKLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+ +RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  ++ +VDEC
Sbjct  258   LEKDIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDMDKSKKFTVDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ETT S++ W   LLA + +WQE AR+EV+ V+G ++P   G+ +LK ++MI+
Sbjct  316   KTFYLAGQETTNSMMAWMLFLLAINPEWQEEARREVLNVYGNKDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLY     + RKV KK + LG + LP N   +I  L L HDPEIWG+DVH+FKPER
Sbjct  376   NETLRLYSAGGGLTRKVGKK-LRLGKLVLPANSQTFIPTLKLHHDPEIWGEDVHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++FA AEAKI  SMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFAAAEAKITFSMILQRYTFELSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
              L  +RP+ G+Q+  H
Sbjct  495   HLLTIRPQHGLQIRFH  510



>gb|EYU22576.1| hypothetical protein MIMGU_mgv1a004757mg [Erythranthe guttata]
Length=511

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/491 (53%), Positives = 360/491 (73%), Gaps = 8/491 (2%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+W  P+ +Q  MSSQG+KGP Y+F HGNTKEIS  R    SKP+ D+ SHD+FPRI PH
Sbjct  29    KIWRNPIRLQTTMSSQGVKGPPYKFPHGNTKEISNMRIQSMSKPI-DNFSHDIFPRIQPH  87

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +Y+W + YG  F+ W G Q +L +TE E++KE+L +R+G +PK+E++G++++LLG+ + +
Sbjct  88    VYAWTKAYGTKFVTWHGSQCQLFITEPEIIKEVLMNREGAFPKMEMEGYAKKLLGEALIT  147

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKWA++RKLAN+ FH ESL+ M+P M  S   M+E W+ +EG EI+ F+EF LLT+E
Sbjct  148   NEGEKWAKIRKLANHTFHAESLKSMVPEMSYSVSKMLEKWKNYEGIEIDVFKEFGLLTTE  207

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAFGS+YLEGK+IFEM+  L  +  +N   V+ PG+S I+K++DE+E+++LE+ ++
Sbjct  208   VISRTAFGSSYLEGKHIFEMVANLTAITVRNVYKVKVPGISMILKSDDEIEADRLEKKIK  267

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
             + I++I +KR       E   +  SD+L +L++ +++ +   +I +E M+DE K  Y AG
Sbjct  268   SSILEIARKR------GELVENIGSDYLGQLVKISNESDLKKRITVEQMIDEIKAVYGAG  321

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
             H TTTSLLGW   LLA + +WQE+AR EV   FG   P   GIARLKIMNMI+ E +RLY
Sbjct  322   HLTTTSLLGWCVFLLALNTEWQEKARDEVKRTFGDNKPDSDGIARLKIMNMIINECMRLY  381

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
             PPV  + RKV K+   +G + +PPNI++++S LAL H+P+IWGKDVH F+PERF+EGV K
Sbjct  382   PPVLTVTRKVAKE-AKIGELIIPPNINIFVSILALHHNPKIWGKDVHLFRPERFSEGVAK  440

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             ATNN+  AFLPFG GPRTC+GLNF   EAKI L+MILQ+Y   LS +YVH P   F+L P
Sbjct  441   ATNNNGAAFLPFGLGPRTCVGLNFTTNEAKIALTMILQKYEFVLSPNYVHHPTDAFILTP  500

Query  1642  KDGVQVILHRI  1674
             K+GVQVIL  I
Sbjct  501   KNGVQVILKGI  511



>gb|KCW73229.1| hypothetical protein EUGRSUZ_E01694 [Eucalyptus grandis]
Length=514

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 357/495 (72%), Gaps = 4/495 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +LSHD+FP
Sbjct  20    AKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPM-SNLSHDIFP  78

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I +W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   +GF ++LLG
Sbjct  79    KIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKLLG  138

Query  547   DGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+ G EKWA+ RKLAN  FHGESL+ M PAM++S  TM+E W+  EGKEIE F +F
Sbjct  139   DGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDF  198

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             ++LTSEVISRTAFGS+Y+EG+NIF+ML  L  L S+N   +R PG+S++ K  DE+E+EK
Sbjct  199   KVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEK  258

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+ + I+Q+IK+RE+ K    +     +DFL +L++A H  +   +I I+ +VDECK
Sbjct  259   LEKGICDSIVQMIKRREK-KVMAGEVDGFGNDFLGQLVKALHDADKSKKITIDNLVDECK  317

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AGHET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK ++MI+ 
Sbjct  318   TFYVAGHETANSLMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLKKISMIIN  377

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             ETLRLYPPV  + RKV KK   LG + LP +  +++    L  DPEIWG+DVH+FKPERF
Sbjct  378   ETLRLYPPVNGLTRKVGKKQ-RLGRLALPADTQIFVPIPKLHSDPEIWGEDVHQFKPERF  436

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             +EGV KATNN+ + F+PFG+GPR+C+G++F M EAK+ LSMILQRY+  LS +Y+H PV 
Sbjct  437   SEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYTFELSPAYIHCPVH  496

Query  1624  LFMLRPKDGVQVILH  1668
             + + +P+ G+Q+  H
Sbjct  497   IIINQPQHGLQIRFH  511



>gb|AJD25262.1| cytochrome P450 CYP749A40 [Salvia miltiorrhiza]
Length=509

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/507 (52%), Positives = 374/507 (74%), Gaps = 8/507 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FI S+LV+ A  L  KLWW P+ IQK++ SQGIKGPSY+ +HGNTK+I + R+   S   
Sbjct  6     FIISILVVLAR-LIHKLWWKPLQIQKILRSQGIKGPSYKLIHGNTKDILKMRKEAISS-C  63

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             +D  SHDVFPRILPH+ +W +LYG+NFL W+G QP+++VTE EL +EIL+++ G Y K +
Sbjct  64    DDLCSHDVFPRILPHLNTWIKLYGSNFLIWMGDQPQIIVTEPELAREILTNKDGIYKKCK  123

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                + +RLLGDG+  ++GEKW+++RKL+N  FHG+SL+ M+PAM+ES +TM+E +  + G
Sbjct  124   PLNYVKRLLGDGLVVAEGEKWSKLRKLSNYAFHGDSLKDMVPAMVESVDTMLERFEGNVG  183

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE  +EF+LLTS++IS+TAFGS Y+EG++IF+ML+KL  L ++N   +R  G+ RI +
Sbjct  184   KEIEISKEFKLLTSDIISKTAFGSTYVEGQDIFDMLMKLVVLITRNAFKIRPFGLKRIWR  243

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             ++DE+E++++E+ +R+ I+ +++KRE   +TG+ +     +DFL  L++ NH+ +   +I
Sbjct  244   SSDEIEADRVEKSLRDSIVSLVRKREDMVRTGQLEDFG--NDFLGALMKVNHEVDPKIRI  301

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ +VDECK F+ AGHETT+SLL W  LLL+ HE+WQERAR EV+ +FG + PT  G++
Sbjct  302   SLDDIVDECKVFFIAGHETTSSLLSWTALLLSIHEEWQERARDEVLHLFGMDKPTAQGLS  361

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLKI+ MIL E LRLY PV  + RKV ++   LG   +P ++ +YI PLAL  + EIWG+
Sbjct  362   RLKILTMILNEALRLYSPVLALTRKVGQET-RLGRYKIPADVEVYIPPLALHRNHEIWGR  420

Query  1414  DVHKFKPERFAEGVVKATNNHP--IAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             D H FKPERF +GV KA N +P  +AFLPFG GPR C+GLNFA  EAK+ L MILQRY L
Sbjct  421   DAHLFKPERFGDGVAKAANGNPTALAFLPFGAGPRACVGLNFAGDEAKVALIMILQRYKL  480

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LS +YVH+P QL  + P+ G+Q+IL 
Sbjct  481   TLSPNYVHAPFQLLTVNPQHGIQIILQ  507



>gb|KCW86463.1| hypothetical protein EUGRSUZ_B03131 [Eucalyptus grandis]
Length=512

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/496 (52%), Positives = 360/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P  IQ++++ QGI+GP Y+F+HG++KE  +    +   PM ++LSHD+FP
Sbjct  19    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I++W   YG N+L W G Q +LV+TE EL+KE+L +R   YPK     F ++LLG
Sbjct  78    KIQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLG  137

Query  547   DGIGSSKGE-KWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ ++  E KWA+ RKLAN+ FHGESL+ M+P M+++   M+  W+  EGKEI+ FE+F
Sbjct  138   DGLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLT EVIS+TAFGS+Y+EG+NIF+ML +L  L +KN  +VRFPG+S+  K  DE+E+EK
Sbjct  198   KLLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEK  257

Query  904   LEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             L++G+ + I+ I+KKRE+  KTGE   +   +DFL +L++A+   +   +I I+ +VDEC
Sbjct  258   LQKGIYDAILGIVKKREEKVKTGEA--ADVGNDFLGQLVKASRGMDNSKKITIDDLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ETT +L+ W   LLA H +WQE+ARKEV+ VFG  +P   GIA+LK M+MI+
Sbjct  316   KTFYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKLKTMSMII  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + R+VE++ + LG + LP NIH+ I  L L HDP+IWG+DV  FKPER
Sbjct  376   NETLRLYPPVIGMSRQVEQQ-LRLGKLLLPTNIHIIIGNLKLHHDPKIWGEDVLLFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             FAEG+ +ATNN+P+ F+PF +GPR C G+NFA  E KI+LSMILQRY+  LS +YVH PV
Sbjct  435   FAEGIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKLSPAYVHCPV  494

Query  1621  QLFMLRPKDGVQVILH  1668
             Q+  + PK G+QVI  
Sbjct  495   QVLTIGPKHGLQVIFQ  510



>ref|XP_008229697.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Prunus mume]
Length=491

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/482 (57%), Positives = 349/482 (72%), Gaps = 7/482 (1%)
 Frame = +1

Query  157   FISSLLVLAAAW-LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKP  333
             F+   +VLAA +    KLWW P  IQKLM+ QGIKGPSYR +HGN KEIS  ++   ++P
Sbjct  14    FVCLFIVLAAFFKTVHKLWWTPTQIQKLMALQGIKGPSYRLIHGNNKEISNMQKEAMARP  73

Query  334   MEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKI  513
                +LSHDVF  + PH++SW ++YG  FL W GPQP LV+T+ EL KEIL+++   YPK 
Sbjct  74    --RNLSHDVFALVQPHLHSWTKIYGKTFLQWDGPQPVLVITDPELCKEILNNKHRAYPKS  131

Query  514   ELQGFSRRLLGDGIGSSK-GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
                 F  +L  +G+ + K GEKWA++RKLAN+ FHGESL+  + AMI S ETM+E W  H
Sbjct  132   NPVAFVMKLSRNGLVTRKEGEKWAKLRKLANHAFHGESLKSQIHAMIASVETMLERWENH  191

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIE F EFRL+TSEVISRTAFGS+YLEGKNIFEML+K+ +L  K  L  +FPG+SR 
Sbjct  192   EGKEIEVFGEFRLVTSEVISRTAFGSSYLEGKNIFEMLLKISSLTFKTALKPKFPGLSRF  251

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             +K NDE+E EKLE+ +R  II+I+KKRE +   GEE+  S  SDFL  LL+A H  N + 
Sbjct  252   VKTNDEIEMEKLEKRIRETIIEIVKKRERKVMPGEEE--SLGSDFLGLLLKAYHDTNDNQ  309

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ +VDECKTFY AGHETT + L W   LLA H DWQE ARKEV++VFG++ P P G
Sbjct  310   RISLDDLVDECKTFYLAGHETTATFLAWTVFLLALHTDWQEEARKEVLQVFGKQTPNPKG  369

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I +LK M+MI+ E+LRLYPPV  + R+  ++ V LG + LP N+ L I  +A  +D E+W
Sbjct  370   IEKLKTMSMIMYESLRLYPPVVSVIRRRVEREVKLGRLILPANLELAIPIVAFHYDSELW  429

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G+DV  FKPERFAEGVVKAT+ +  AFLPFG GPR C+GLNFA+ EAKI LSMILQR++ 
Sbjct  430   GQDVQLFKPERFAEGVVKATDENIAAFLPFGMGPRICVGLNFAITEAKIALSMILQRHAF  489

Query  1588  AL  1593
              L
Sbjct  490   TL  491



>ref|XP_010044378.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X2 [Eucalyptus 
grandis]
Length=556

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/496 (52%), Positives = 360/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P  IQ++++ QGI+GP Y+F+HG++KE  +    +   PM ++LSHD+FP
Sbjct  63    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPM-NNLSHDIFP  121

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I++W   YG N+L W G Q +LV+TE EL+KE+L +R   YPK     F ++LLG
Sbjct  122   KIQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLG  181

Query  547   DGIGSSKGE-KWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ ++  E KWA+ RKLAN+ FHGESL+ M+P M+++   M+  W+  EGKEI+ FE+F
Sbjct  182   DGLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDF  241

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLT EVIS+TAFGS+Y+EG+NIF+ML +L  L +KN  +VRFPG+S+  K  DE+E+EK
Sbjct  242   KLLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLSKFWKTADEIEAEK  301

Query  904   LEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             L++G+ + I+ I+KKRE+  KTGE   +   +DFL +L++A+   +   +I I+ +VDEC
Sbjct  302   LQKGIYDAILGIVKKREEKVKTGEA--ADVGNDFLGQLVKASRGMDNSKKITIDDLVDEC  359

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ETT +L+ W   LLA H +WQE+ARKEV+ VFG  +P   GIA+LK M+MI+
Sbjct  360   KTFYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIAKLKTMSMII  419

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + R+VE++ + LG + LP NIH+ I  L L HDP+IWG+DV  FKPER
Sbjct  420   NETLRLYPPVIGMSRQVEQQ-LRLGKLLLPTNIHIIIGNLKLHHDPKIWGEDVLLFKPER  478

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             FAEG+ +ATNN+P+ F+PF +GPR C G+NFA  E KI+LSMILQRY+  LS +YVH PV
Sbjct  479   FAEGIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKLSPAYVHCPV  538

Query  1621  QLFMLRPKDGVQVILH  1668
             Q+  + PK G+QVI  
Sbjct  539   QVLTIGPKHGLQVIFQ  554



>sp|H2DH17.1|C7A22_PANGI RecName: Full=Cytochrome P450 CYP749A22; AltName: Full=Cytochrome 
P450 CYP749A20 [Panax ginseng]
 gb|AEY75214.1| cytochrome P450 CYP749A20 [Panax ginseng]
Length=524

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/488 (53%), Positives = 363/488 (74%), Gaps = 3/488 (1%)
 Frame = +1

Query  205   LWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHI  384
             +WW P+ +Q++   QGI+GPSY FL+GNTKEI   R+   S+PM D LSH++FPR+ PH+
Sbjct  38    IWWTPIRLQRVFRQQGIRGPSYGFLYGNTKEILNMRKESMSRPM-DYLSHNIFPRLQPHL  96

Query  385   YSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSS  564
             YSW  +YG NFL W GP+ + VVT+ + VKE +   +  YPK++ + F+++LLGDGI +S
Sbjct  97    YSWLNIYGKNFLNWYGPRAQFVVTQVDFVKETMIKDQA-YPKMDPEWFAKKLLGDGIVTS  155

Query  565   KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEV  744
             KG+KWA+ R+LAN+ FH ESL+ M PAMI S E M++ W++HEG+EI+ F+EF++LTSEV
Sbjct  156   KGKKWAKHRRLANHAFHAESLKSMTPAMIASVEMMLKRWKQHEGREIDVFQEFKILTSEV  215

Query  745   ISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRN  924
             ISRTAFGS+YL+GK+IF+ L +L  + ++N   V+ PG+S   K+NDE+E+EKL++G+ +
Sbjct  216   ISRTAFGSSYLDGKDIFDRLTQLGIIITRNSYKVKLPGISLFYKSNDEIEAEKLDQGLYD  275

Query  925   GIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGH  1104
              I++I++KRE+  T   +  S  +DFL  L++A +  +  N+I  + +VDECKTFY AG 
Sbjct  276   SILRIMEKREKESTMSGEVGSFGTDFLGLLMKAMNDADEKNRITAQDVVDECKTFYVAGQ  335

Query  1105  ETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYP  1284
             ETTT+LL W   LL  H DWQE+AR+EV+ +FGQE P   G+A+LK +NMI+ ETLRLYP
Sbjct  336   ETTTTLLAWVIFLLGIHTDWQEKARQEVLNLFGQEIPNSDGLAKLKTVNMIINETLRLYP  395

Query  1285  PVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKA  1464
             PV ++ RKV K+    G +TLP N+H+ +  LAL HD +IWG D   FKPERF++GV KA
Sbjct  396   PVIFLTRKV-KEETKFGKLTLPANVHIVVPTLALHHDEQIWGDDALLFKPERFSQGVAKA  454

Query  1465  TNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPK  1644
             TNN+  AF PFG GPR+C+GLNFA  EAKI L+MILQ YS ALS +Y+HSPVQ+  +RP+
Sbjct  455   TNNNAAAFFPFGLGPRSCVGLNFATNEAKIALAMILQCYSFALSPTYIHSPVQILTVRPQ  514

Query  1645  DGVQVILH  1668
              G+QV+L 
Sbjct  515   HGLQVMLQ  522



>ref|XP_010041584.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Eucalyptus 
grandis]
Length=919

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/496 (54%), Positives = 363/496 (73%), Gaps = 6/496 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L   LWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  I + PM ++LSHD+FP
Sbjct  19    AKLLHNLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEIRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE +L+KE+L +R+  YPK   + F+++LLG
Sbjct  78    KIHPQVNTWIDTYGRNYLNWHGPQAQLVITEPDLIKEVLLNREKTYPKTGTKDFAKKLLG  137

Query  547   DGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+  G+KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVSTVDGKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML  L TL SKN  N+RFPG+ ++ K  DE+E+EK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTGLVTLTSKNAFNIRFPGIRKLWKTADEVEAEK  257

Query  904   LEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDEC  1080
             LE+G+RN I+Q+IK+RE +   GEE       DFL +L++A H  +   +  ++ +VDEC
Sbjct  258   LEKGIRNSILQMIKRREKKVMAGEEDGFG--DDFLGQLVKALHDTDKSKKFTVDNLVDEC  315

Query  1081  KTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMIL  1260
             KTFY AG ET  S++ W   LLA + +WQE AR+EV+ VFG ++P   G+ +LK ++MI+
Sbjct  316   KTFYIAGQETVNSMMTWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKISMIM  375

Query  1261  EETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPER  1440
              ETLRLYPPV  + RKV KK + LG + LP N  ++I  L L HDPEIWG+DVH+FKPER
Sbjct  376   NETLRLYPPVVGLTRKVGKK-LRLGRLVLPANSQIFIPTLKLHHDPEIWGEDVHEFKPER  434

Query  1441  FAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPV  1620
             F+EG+ KATNN+ + F+PFG+GPR+C+G++F  AEAKI+LSMILQRY+  LS +Y+H P 
Sbjct  435   FSEGIAKATNNNAVVFIPFGFGPRSCVGMSFVAAEAKILLSMILQRYTFKLSPTYIHCPG  494

Query  1621  QLFMLRPKDGVQVILH  1668
             QL   RP+ G+Q+  H
Sbjct  495   QLATTRPQHGLQIRFH  510


 Score =   416 bits (1070),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/382 (52%), Positives = 279/382 (73%), Gaps = 6/382 (2%)
 Frame = +1

Query  217   PVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWK  396
             PV   + M+SQGI+GP Y+  +GNT+EI + +   +S+P+  +LSHD+FPR+ PHI +W 
Sbjct  543   PVSHPETMASQGIRGPPYKLFYGNTREILQFKNETSSRPL--NLSHDIFPRVQPHISTWT  600

Query  397   RLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEK  576
               YGAN+L W G  P L+VTE EL+KE+L+++   +PK E+  F ++LLGDG+ +++GEK
Sbjct  601   GTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTAEGEK  660

Query  577   WARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRT  756
             W + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE+ISRT
Sbjct  661   WVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRT  720

Query  757   AFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQ  936
             AFGS+Y+EG+NIFEML KL  +AS+N   +RFPG+S++ K NDELESEKLE G+R+ +++
Sbjct  721   AFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLE  780

Query  937   IIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETT  1113
             II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY AG++T+
Sbjct  781   IIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTS  838

Query  1114  TSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVP  1293
              ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK M MI+ E+LRLYPPV 
Sbjct  839   NTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPYPDGIAKLKTMGMIINESLRLYPPVV  898

Query  1294  YIKRKVEKKNVVLGNITLPPNI  1359
              + RKV  K   LG + LP N+
Sbjct  899   GLIRKVATK-TRLGKLVLPANM  919



>ref|XP_007045776.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01608.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/516 (52%), Positives = 362/516 (70%), Gaps = 15/516 (3%)
 Frame = +1

Query  160   ISSLLVLAAAWLC-----------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISE  306
             +  LL+L A   C            K  W P  IQ ++ SQGIKGP Y F+HGN K + E
Sbjct  4     MGKLLILVAGSFCLYFLRALLKVFYKYLWIPHRIQNILRSQGIKGPPYEFIHGNNKAVVE  63

Query  307   ARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILS  486
               R  +SKPM   L+HD+FPR+LPH YSW   YG   L W G Q  LV+TE +L+KE+L 
Sbjct  64    IGREASSKPMA--LTHDIFPRVLPHTYSWINAYGKIHLSWNGVQALLVITEPDLIKEVLK  121

Query  487   DRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAET  666
             + +  + K ++  F  ++LGDG+ +++ EKWAR RKLAN  FHGESL+ M PA+I S ET
Sbjct  122   NSEKAFLKGKVTYFVSKILGDGLATTEREKWARHRKLANYAFHGESLKNMTPAVIASVET  181

Query  667   MVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNV  846
             M++ W+  EGKEIE F+EFRLLTSEVISRTAFGS+YLEG+ IFE L+KL  +A +N    
Sbjct  182   MLQKWKGREGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFETLMKLSVIAIRNLYKA  241

Query  847   RFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEAN  1026
             R PG+S + K+ DE+ESEKL + + + +++I+KKRE+     E +S   SDFL  LL A+
Sbjct  242   RIPGISYVWKHADEIESEKLAKEIHDSVLKIVKKREEKVVAGEAESF-GSDFLGLLLNAH  300

Query  1027  HQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ  1206
             H  +  N++ +E +VDECKTFYF G ETT SLL W  LLLA H DWQE+AR+E++E FG 
Sbjct  301   HDLDEKNRLSVEDLVDECKTFYFTGQETTNSLLAWTVLLLAIHTDWQEKARREMIEEFGN  360

Query  1207  ENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLAL  1386
             ++P P GIA+LK M MI+ ETLRLYPP+  I R+V ++ V LG + LP ++HL +  +AL
Sbjct  361   QDPHPEGIAKLKTMTMIINETLRLYPPLNRIVRRVGRE-VQLGKLILPADLHLVVPIMAL  419

Query  1387  QHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSM  1566
              HDP++WG DV+ FKPERFAEG+  AT ++  A++PFG GPR+C+G++FA+ E KI LSM
Sbjct  420   HHDPQLWGDDVNLFKPERFAEGIANATKHNAAAYVPFGLGPRSCVGMSFAITETKIALSM  479

Query  1567  ILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             ILQRY+++LS +Y HSP  L +L+P+ G+QVILH +
Sbjct  480   ILQRYTISLSPAYSHSPYYLPLLQPQHGIQVILHSL  515



>ref|XP_010056464.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=581

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/495 (53%), Positives = 357/495 (72%), Gaps = 4/495 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +LSHD+FP
Sbjct  87    AKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPM-SNLSHDIFP  145

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I +W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   +GF ++LLG
Sbjct  146   KIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKLLG  205

Query  547   DGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+ G EKWA+ RKLAN  FHGESL+ M PAM++S  TM+E W+  EGKEIE F +F
Sbjct  206   DGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDF  265

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             ++LTSEVISRTAFGS+Y+EG+NIF+ML  L  L S+N   +R PG+S++ K  DE+E+EK
Sbjct  266   KVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEK  325

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+ + I+Q+IK+RE+ K    +     +DFL +L++A H  +   +I I+ +VDECK
Sbjct  326   LEKGICDSIVQMIKRREK-KVMAGEVDGFGNDFLGQLVKALHDADKSKKITIDNLVDECK  384

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AGHET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK ++MI+ 
Sbjct  385   TFYVAGHETANSLMTWMLFLLAIYPEWQEEARMEVLNVFGNKDPIFDGLGKLKKISMIIN  444

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             ETLRLYPPV  + RKV KK   LG + LP +  +++    L  DPEIWG+DVH+FKPERF
Sbjct  445   ETLRLYPPVNGLTRKVGKKQ-RLGRLALPADTQIFVPIPKLHSDPEIWGEDVHQFKPERF  503

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             +EGV KATNN+ + F+PFG+GPR+C+G++F M EAK+ LSMILQRY+  LS +Y+H PV 
Sbjct  504   SEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYTFELSPAYIHCPVH  563

Query  1624  LFMLRPKDGVQVILH  1668
             + + +P+ G+Q+  H
Sbjct  564   IIINQPQHGLQIRFH  578



>ref|XP_010056458.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW73208.1| hypothetical protein EUGRSUZ_E01670 [Eucalyptus grandis]
Length=514

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/495 (53%), Positives = 353/495 (71%), Gaps = 4/495 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +LSHD+FP
Sbjct  20    AKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPM-SNLSHDIFP  78

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I  W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   + F+++++G
Sbjct  79    KIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGSKDFAKKIVG  138

Query  547   DGIGS-SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S   GEKWA  RKLAN+ FHGESL+ M PAM++S  TM+  W+  EGKEIE F EF
Sbjct  139   DGLASVPGGEKWATKRKLANHAFHGESLKNMAPAMVDSVHTMLGKWKNQEGKEIEVFGEF  198

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             ++L +EVISRTAFGS+Y+EG+NIF+ML +L  L S+N   +R PG+S++ K  DE+E+EK
Sbjct  199   KVLAAEVISRTAFGSSYIEGRNIFQMLTRLALLTSRNTFTIRLPGLSKLWKTVDEVEAEK  258

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+ + I+Q+IK+RE+ K    +      DFL +L++A H  +   +I ++ +VDECK
Sbjct  259   LEKGICDSIVQMIKRREK-KVMAGEVDCFGDDFLGQLVKALHDADKSKKITVDNLVDECK  317

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AGHET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK ++MIL 
Sbjct  318   TFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLKKISMILN  377

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             ETLRLYPPV  + RKV KK   LG + LP +I +++    L  DPEIWG+DVH+FKPERF
Sbjct  378   ETLRLYPPVVGLTRKVGKKQ-RLGRLLLPADIQIFVPIPKLHSDPEIWGEDVHQFKPERF  436

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             +EGV KATNN  + F+PFG+GPR+C+G++F M EAK+ LSMILQRYS  LS +Y+HSP  
Sbjct  437   SEGVAKATNNKAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRYSFELSPAYIHSPAH  496

Query  1624  LFMLRPKDGVQVILH  1668
             + M RP+ G+Q+  H
Sbjct  497   IVMNRPQHGLQIRFH  511



>ref|XP_008389384.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/495 (53%), Positives = 349/495 (71%), Gaps = 6/495 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P  +QKLM+ QGI GP YR +HGNTKEI++  +   S+P   +LSHDVF  +
Sbjct  27    IFHKLWWTPTRLQKLMALQGITGPPYRLIHGNTKEITDMIKEAMSRP--KNLSHDVFSVV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+SW ++YG N+L W G + +L+VT+ EL KEIL+++   YPKIE   F ++L GDG
Sbjct  85    QPHIHSWTQIYGKNYLQWHGSKAQLIVTDPELCKEILNNKDRAYPKIETPYFDKKLFGDG  144

Query  553   I-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRL  729
             +  ++K E WA++RKLA + FHGESL+ M PAM+ S ETM+E W+ +EGKEIE F+EFRL
Sbjct  145   LLTTTKPEXWAKLRKLATHAFHGESLKSMTPAMVASTETMLEKWKSYEGKEIEVFQEFRL  204

Query  730   LTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLE  909
              +SEVISRTAFGSNY+EGK IFE L KL  L  KN L +R P  S+  K +DE+E++KLE
Sbjct  205   FSSEVISRTAFGSNYIEGKXIFETLAKLGVLVFKNSLTIRVPVFSKFFKTSDEIEADKLE  264

Query  910   EGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
             +G+R  I++I+K+RE+  TG E   S  SDFL  LL+A H  N D +I  + + + CK F
Sbjct  265   KGLRVSIMEIVKRREEKATGGE--GSFGSDFLGLLLKAYHDTNDDQRISADELFELCKEF  322

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             Y    ETT +LL W   LLA H DWQE  RKEV+++FG+  P   GIA+LK M+M++ E+
Sbjct  323   YLVAQETTNALLAWTVFLLALHTDWQEEVRKEVVDLFGKHTPNADGIAKLKTMSMVINES  382

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLY PV  I RK E++ V LG + +P N+ L +  LAL HDP+IWG+D+  FKPERF+E
Sbjct  383   LRLYSPVATIIRKTERE-VELGKVIVPANLELIVPNLALHHDPQIWGEDLQLFKPERFSE  441

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV KAT+N+  AF+PFG G R+C+G+NF   EAKI LSMILQRYS  LS  YVH P    
Sbjct  442   GVAKATDNNVGAFIPFGLGLRSCVGMNFTNIEAKIALSMILQRYSFTLSPGYVHLPFHYL  501

Query  1630  MLRPKDGVQVILHRI  1674
              +RPK G+QV+LH +
Sbjct  502   TVRPKRGIQVMLHSL  516



>ref|XP_006437871.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
 gb|ESR51111.1| hypothetical protein CICLE_v10031156mg [Citrus clementina]
Length=546

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/518 (52%), Positives = 353/518 (68%), Gaps = 30/518 (6%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  KLWW P   Q +M SQG++GP+YR ++GNTKEI   R  I   PM   LSHD+ PRI
Sbjct  25    LFNKLWWIPNRTQAVMGSQGVRGPAYRLVYGNTKEILSLRNQIWISPM--GLSHDILPRI  82

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW + YG NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG
Sbjct  83    LPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDG  142

Query  553   IGSSKGEKWARMRKLANNVFHGESLR--------------------------GMLPAMIE  654
             + ++ GE W R RKLA   F+ ESLR                           M+PAM+ 
Sbjct  143   LVTAGGENWHRQRKLATLAFYAESLRVTKSNCLMFKLKSIIVMLFNVFVPMQDMIPAMVA  202

Query  655   SAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKN  834
             S E M++ WR +EGKEIE  ++F LLTSE+ISRTAFGS+YLEG++IF  L  +  +AS+N
Sbjct  203   SVEIMLKRWRHNEGKEIEVSQDFTLLTSEIISRTAFGSSYLEGESIFNKLTNMSFIASRN  262

Query  835   FLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKL  1014
                ++ P +   +K +D++E++KLE+G+R+ II+++K RE+ K  + +     +D+   L
Sbjct  263   AYKIKIPLIGDFVKTSDDVEADKLEQGIRDSIIKMMKTREE-KAMKGESEGYGNDYFGLL  321

Query  1015  LEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVME  1194
             L+A H  +   +I ++ ++DECKTFY AGHETTT LL W  LLLATH DWQE+ R+EV+E
Sbjct  322   LKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLE  381

Query  1195  VFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYIS  1374
             +FGQ+NPTP GI +LK M+M++ E+LRLYPP   I R VE++ V LG   LP N+ L I 
Sbjct  382   LFGQQNPTPDGIGKLKTMSMVINESLRLYPPAVNISRNVERE-VRLGKYILPANMELVIP  440

Query  1375  PLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKI  1554
              LA+ HDP+IWG+DV  FKPERFAEGV KA+NN P AFLPF  GPR C+GLNFA  EAKI
Sbjct  441   ILAIHHDPQIWGEDVDIFKPERFAEGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKI  500

Query  1555  VLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LSMILQRY   LS SYVHSPV +  LRP+ G+QVI  
Sbjct  501   ALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  538



>gb|KDO70289.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=546

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/518 (52%), Positives = 351/518 (68%), Gaps = 30/518 (6%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  KLWW P   Q +M SQGI+GP+YR ++GNTKEI   R  I   PM   LSHD+ PRI
Sbjct  25    LFNKLWWIPNRTQAVMGSQGIRGPAYRLVYGNTKEILSLRNQIWISPM--GLSHDILPRI  82

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW + YG NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG
Sbjct  83    LPHICSWTKQYGMNFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDG  142

Query  553   IGSSKGEKWARMRKLANNVFHGESLR--------------------------GMLPAMIE  654
             + ++ GE W R RKLA   F+ ESLR                           M+PAM+ 
Sbjct  143   LVTAGGENWHRQRKLATLAFYAESLRVTKSNCLMFKLKSVIVMLFNVFAPMQDMIPAMVA  202

Query  655   SAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKN  834
             S E M++ WR  EGKEIE  +EF+LLTSE+ISRTAFGS+YLEG++IF  L  +  LAS+N
Sbjct  203   SVEIMLKRWRHSEGKEIEVSQEFKLLTSEIISRTAFGSSYLEGESIFNKLTNMSFLASRN  262

Query  835   FLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKL  1014
                ++ P +   +K +D++E +KLE+G+R+ II+++K RE+ K  + +     +D+   L
Sbjct  263   AYKIKIPLIGDFVKTSDDVEGDKLEQGIRDSIIKMMKTREE-KALKGESEGYGNDYFGLL  321

Query  1015  LEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVME  1194
             L+A H  +   +I ++ ++DECKTFY AGHETTT LL W  LLLATH DWQE+ R+EV+E
Sbjct  322   LKAYHDPDMTKRISLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLE  381

Query  1195  VFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYIS  1374
             +FGQ+NP P GI +LK M+M++ E+LRLYPP   I R VE++ V LG   LP N+ L I 
Sbjct  382   LFGQKNPAPDGIGKLKTMSMVINESLRLYPPAVNISRNVERE-VRLGKYILPANMELVIP  440

Query  1375  PLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKI  1554
              LA+ HDP+IWG+DV  FKPERFA+GV KA+NN P AFLPF  GPR C+GLNFA  EAKI
Sbjct  441   ILAIHHDPQIWGEDVDLFKPERFADGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKI  500

Query  1555  VLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LSMILQRY   LS SYVHSPV +  LRP+ G+QVI  
Sbjct  501   ALSMILQRYRFNLSPSYVHSPVLVVTLRPQHGLQVIFQ  538



>gb|KDP41353.1| hypothetical protein JCGZ_15760 [Jatropha curcas]
Length=475

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/476 (54%), Positives = 360/476 (76%), Gaps = 4/476 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M S+GI+GPSY FLHGNTKEI+  R  I + PME  LSH++ PRI PHIYSW +LYG NF
Sbjct  1     MRSKGIRGPSYVFLHGNTKEITHMRNTIMNGPME--LSHEMLPRIQPHIYSWIKLYGPNF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L W G Q +LVVTE ELV+E+L++++G Y K  +Q ++ +L GDG+ +SKGEKW +MRKL
Sbjct  59    LNWYGLQAQLVVTEPELVQEVLNNKEGAYQKKIIQNYAEKLFGDGLVASKGEKWLKMRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             A+  FHGESL+GM+PAM+ S ETM++ WR++E KEIE F+EF++LTSE+IS+TAFGS+YL
Sbjct  119   AHQAFHGESLKGMVPAMVASVETMLDRWRQNEVKEIEMFQEFKILTSEIISKTAFGSSYL  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGKN+F+ML K+ T+ ++N   VR PG+ +I+K  D++ESE+LE G+R  I+ ++K RE+
Sbjct  179   EGKNLFDMLTKMATIIARNNFQVRIPGIKKILKTPDDIESEELERGMRESILMMMKTREE  238

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWAT  1137
                 + +  +  SDFL  LL+  H  +  N+I ++ ++DECKTFY AGHETT S L W  
Sbjct  239   GVV-KGKLENYGSDFLGLLLKVYHANDLSNKISVQDLIDECKTFYLAGHETTVSSLTWTI  297

Query  1138  LLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEK  1317
             LLLA H  WQ++AR+EV+++FG++NP   GIARLKIM+MI+ E+LRLYPPV  I R+V++
Sbjct  298   LLLAIHPIWQDKAREEVIKLFGKQNPGSDGIARLKIMSMIVNESLRLYPPVFNITREVQR  357

Query  1318  KNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPF  1497
             + V LGN+ +P  + + +  LA+QH+ ++WG+DV+ FKPERFA+GV KAT N+  AFLPF
Sbjct  358   E-VRLGNVIIPEKMAVCLPILAVQHNSKVWGEDVNLFKPERFADGVAKATKNNIAAFLPF  416

Query  1498  GYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             G G R+C+G NFA AE KI LSMILQ Y   LS +YVH+P+ +  + P+ G+Q++L
Sbjct  417   GSGARSCVGSNFATAEIKIALSMILQNYRFTLSPTYVHAPIHVLTICPQYGLQILL  472



>ref|XP_004297207.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 372/512 (73%), Gaps = 14/512 (3%)
 Frame = +1

Query  169   LLVLAAAW-LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDD  345
             +L+LA  + +  +LWW P   QKLM+SQGI+GPSY+ +HGNTKEI+  +    S+P   +
Sbjct  19    VLLLALIFKVLHRLWWTPTRFQKLMASQGIRGPSYKLIHGNTKEINNMKIQAMSRPR--N  76

Query  346   LSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG  525
             LSHD+   + PHI+SW  +YG N+L W G Q +LV+TE EL +EIL+D++  YPK+E   
Sbjct  77    LSHDIVSAVHPHIHSWTNIYGKNYLQWHGTQAQLVITEPELCREILNDKEKAYPKMEPIP  136

Query  526   FSRRLLGDGIGS--SKGEKWARMRKLANNVFHGES-LRGMLPAMIESAETMVEAWREHEG  696
             F ++L G+G+G+     EKWA++R+++N+ F GES L+  +PA I+SA TM++ W+ HEG
Sbjct  137   FIKKLFGEGLGTRTKSDEKWAQLRRISNHSFLGESSLKNKIPATIDSAGTMLQRWKNHEG  196

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPG-MSRIM  873
             KEIE +EEFRLLT+EVISRTAFGS+YLEG++IF+ML+K   L SKN   +R P  +S++ 
Sbjct  197   KEIEVYEEFRLLTAEVISRTAFGSSYLEGQHIFDMLMKFYFLISKNLFTIRLPTFISKVY  256

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQ--TKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             K  DE E+EKL++G+R+ I++IIK+RE    KTGEE    +  DFL  LL+A+H  + + 
Sbjct  257   KTKDETEAEKLDQGIRDSILKIIKEREAKAMKTGEEGNFGQ--DFLGMLLKAHHDADVNQ  314

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQEN-PTPY  1224
             +I +E ++DECKT YFAG ++T SLL W  LLLA H DWQ+ A+KEV++VFG++N P   
Sbjct  315   RITVEELIDECKTLYFAGQDSTASLLAWTILLLALHTDWQDEAQKEVLQVFGKQNQPNHD  374

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPP--NIHLYISPLALQHDP  1398
             GIA+LK ++MI+ E+LRLYPP+  +  +   + V +G +T+ P  N+ L I PL+L HDP
Sbjct  375   GIAKLKTLSMIINESLRLYPPLVTVSGRTADREVRVGKLTIDPAANLELLIKPLSLHHDP  434

Query  1399  EIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQR  1578
             + WG+DVH FKPERFA+GV KATNN+   FLPFG G R C+G +FA+ EAK+VLSMILQR
Sbjct  435   DFWGQDVHLFKPERFADGVAKATNNNLAGFLPFGTGRRMCVGSDFAVTEAKVVLSMILQR  494

Query  1579  YSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             YS  LS +YVHSP +   L P+ GVQV+LH +
Sbjct  495   YSFTLSPTYVHSPYEALTLCPQHGVQVMLHSL  526



>ref|XP_004298350.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/511 (53%), Positives = 363/511 (71%), Gaps = 13/511 (3%)
 Frame = +1

Query  160   ISSLLVLAAAWLC----EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             I++LL+ +   L      K+WW P  +Q  M+SQGIKGPSY  +HGNTK+++   R   S
Sbjct  13    ITNLLLFSLVILIFNIFRKIWWIPTRLQNFMASQGIKGPSYTLIHGNTKQVANMYREAMS  72

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
             KPM D  SHD+ P +LPH+++W  +YG NFL W G Q +LVVTE EL KEI +++ G YP
Sbjct  73    KPMLD-FSHDIVPVVLPHVHAWSNIYGKNFLLWQGTQAQLVVTEPELCKEIFNNKDGAYP  131

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             K       + LLG+G+   +GEKWA+ RKLAN+ FHGESL+ M+P MI SAETMVE W+ 
Sbjct  132   K-PTSEIPKLLLGNGLPLLEGEKWAKSRKLANHTFHGESLKNMIPQMIVSAETMVERWK-  189

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
             + G+EIE F+EFRLLT+EVISRTAFGS+YL+G+ IF+ML+KL +L S   L ++ P +S+
Sbjct  190   NLGQEIEVFQEFRLLTAEVISRTAFGSSYLQGQQIFDMLMKLTSLISTFDLRLKLPIISK  249

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKT--GEEQKSSRRSDFLEKLLEANHQENG  1041
               K +DE+E+EKL++G+RN +++I+K+RE+     GEE   S  SDFL  LL+A H  N 
Sbjct  250   FFKTSDEIEAEKLQKGIRNSVMEIVKEREEKAMSGGEE---SFGSDFLGSLLKAYHDTND  306

Query  1042  DNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTP  1221
               +  I+ +VDECK+FYFAG ET  +LL W   LLA H +WQE ARKEV+E+FG+E P P
Sbjct  307   KQRFSIDDIVDECKSFYFAGQETVNTLLAWTVFLLAHHTEWQEEARKEVLEIFGKETPNP  366

Query  1222  YGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPE  1401
               +++LK M+MI+ E LRLY P+ Y+ R +E+K V LGN+ +P ++ L I  LA+ HD +
Sbjct  367   NDLSKLKTMSMIINEALRLYSPILYVTRNIERK-VKLGNLVVPADVELLIPFLAIHHDLQ  425

Query  1402  IWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRY  1581
              WG+D H FKPERF+EGV KATNN+   FLPFG GPR C+GL+F   EAKI LSMILQRY
Sbjct  426   FWGEDAHLFKPERFSEGVAKATNNNMATFLPFGMGPRNCVGLHFGTTEAKIALSMILQRY  485

Query  1582  SLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  LS  YVH+P +   LRP+ GVQV+LH +
Sbjct  486   SFTLSPGYVHAPSRQLALRPRHGVQVMLHSL  516



>ref|XP_002316007.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
 gb|EEF02178.2| hypothetical protein POPTR_0010s14910g [Populus trichocarpa]
Length=512

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/505 (53%), Positives = 360/505 (71%), Gaps = 7/505 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCE---KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK  330
             +S L VL    L +   K+WW P+ IQ  M SQG+KGP YRFLHGNTKEI   R  I S 
Sbjct  9     LSCLCVLFILHLIKFFIKVWWDPIRIQSAMRSQGMKGPPYRFLHGNTKEIYNMRNEIMSS  68

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             PME  LSH +  RI PH+YSW +LYG NFL W GPQ +LV+TE +L+KE+LS++ G YPK
Sbjct  69    PME--LSHQMLARIQPHVYSWIKLYGMNFLNWYGPQAQLVITEPKLIKEVLSNKDGAYPK  126

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
             + +Q ++ +LLGDG+  S+G+KW +MRKLA + FH ESL+G +PAMI S ETM++ WR  
Sbjct  127   LVIQNYAEKLLGDGLVLSQGKKWLKMRKLAIHAFHAESLKGTIPAMIVSVETMLDRWRRE  186

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
               KEIE F+EF++LTSE+ISR AF S+YLEGKNIF+ML ++  +  +N   V   G+ R 
Sbjct  187   GIKEIEVFQEFKVLTSEIISRAAFRSSYLEGKNIFDMLTRMALIVGRNNYKVGISGIKRF  246

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  D++ESEKL+ G+R+ ++++IK+RE+   G E      SDFL  LL+A H+ +   +
Sbjct  247   FKTRDDIESEKLDRGIRDSMLKVIKRREEVMMGTE-PDGYGSDFLGLLLKAYHENDKTKK  305

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I I+ ++DECKTFY AGHETTTS L W  L LA H DWQ RAR+EV+++FGQ+NP P  I
Sbjct  306   ISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTDWQNRAREEVLQIFGQQNPCPDSI  365

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              RLK M MI+ E+LRLYPPV  + R+V+++ V LG + +P  + L +S LAL ++P+IWG
Sbjct  366   GRLKTMTMIVNESLRLYPPVFNLTREVQRE-VKLGKLIVPAKMTLSLSVLALHNNPQIWG  424

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D H FKPERFA GV +AT N+  AFLPFG GPR+C+GLNFA++E KI LSMILQ Y   
Sbjct  425   EDAHLFKPERFAGGVAEATKNNATAFLPFGLGPRSCVGLNFALSEIKIALSMILQHYRFT  484

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVIL  1665
             LS +YVHSP  +  + P+ G+Q++ 
Sbjct  485   LSPTYVHSPEHILTISPRYGLQILF  509



>ref|XP_010046611.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104435586 
[Eucalyptus grandis]
Length=1036

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/508 (54%), Positives = 362/508 (71%), Gaps = 15/508 (3%)
 Frame = +1

Query  163   SSLLVL---AAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKP  333
             +SL +L   A A    KLWW P  IQ+ M+SQGI+GP Y+  +GNT+EI + +   +S+P
Sbjct  6     TSLFLLPFSALAIALHKLWWTPCRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRP  65

Query  334   MEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKI  513
             M  +LSHD+FPR+ PHI +W   YGAN+L W G  P        L+KE+++++   +PK 
Sbjct  66    M--NLSHDIFPRVQPHISTWTGTYGANYLRWYGLLP------LXLIKEVVNNKDKAFPKP  117

Query  514   ELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             E++GF ++LLGDG  +++GEKWA+ RKLAN  FHG+SL+ MLPAM++S   M++ W+   
Sbjct  118   EIEGFVKKLLGDGPVTTEGEKWAKQRKLANYAFHGDSLKSMLPAMVDSVHMMLDRWKNLH  177

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             G EIE ++EF +LTSE+ISRTAFGS+Y+EG+NIFEML KL ++AS+N   +RFPG+S++ 
Sbjct  178   GDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFEMLRKLASIASRNAFKIRFPGISKLW  237

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K NDELESEKLE G+R+ +++II+KRE+  K GE       +DFL  L++A+H ++   +
Sbjct  238   KTNDELESEKLENGIRDAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRR  295

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I I  +VDECKTFY AG +T+ ++L W   LLA H DWQ+ ARKEV+ VFG ++P P GI
Sbjct  296   ITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPDWQDEARKEVLNVFGNQDPDPDGI  355

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             A+LK M MI+ E+LRLYPPV  + RKV  K   LG + LP NI LYI  L L HDP+IWG
Sbjct  356   AKLKTMGMIINESLRLYPPVVGLIRKVGTK-TRLGKLVLPANIGLYIPNLKLHHDPQIWG  414

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              D   FKPERF+EGV KATNN+  AF PFG GPRTC+G NFA AEAKI LSMILQRY+ +
Sbjct  415   DDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFS  474

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             L  +YVHS  QL    P+ GVQVI H +
Sbjct  475   LFPAYVHSHTQLLTTSPQHGVQVIFHAL  502


 Score =   545 bits (1405),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 264/513 (51%), Positives = 359/513 (70%), Gaps = 16/513 (3%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             +++ + A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM + L
Sbjct  524   IVLCSLAKLLHKLWWNPLRIQRVMAQQGITGPPYRFLHGSTKETIKMNMEARNTPMSN-L  582

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+FP+I P I +W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   + F
Sbjct  583   SHDIFPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNKDF  642

Query  529   SRRLLGDGIGSSKG-EKWARMRKLANNVFHGESLR------------GMLPAMIESAETM  669
             S++LLGDG+ S+ G EKWA+ RKLAN  FHG+SL+             M PAM+ S  TM
Sbjct  643   SKKLLGDGLASTPGGEKWAKKRKLANRAFHGKSLKVVGLDGKRELCENMAPAMVASVHTM  702

Query  670   VEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVR  849
             +  W+  EGKEIE F EF++LTSEVISRTAFGS+++EG+NIF+ML  L  L S+N   +R
Sbjct  703   LGKWKNREGKEIEVFGEFKVLTSEVISRTAFGSSFVEGRNIFQMLTGLSLLTSRNAFTIR  762

Query  850   FPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANH  1029
              PG+S++ K  DE+E+EKLE+G+RN I Q+IK+RE+ K    + +    DFL +L++A H
Sbjct  763   LPGLSKLWKTVDEVEAEKLEKGIRNSIEQMIKRREK-KVMAGEVNGFGDDFLGQLVKALH  821

Query  1030  QENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQE  1209
               +   +I +  +VDECKTFY AG ET  SL+ W   LLA + +WQE AR EV+ VFG +
Sbjct  822   DVDKSKKITVNNLVDECKTFYVAGQETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNK  881

Query  1210  NPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQ  1389
             +P   G+ +LK +NMI+ ETLRLYPP+  + RKV KK   LG + LP +I +++    L 
Sbjct  882   DPDFDGLGKLKKINMIINETLRLYPPLVGLNRKVGKKQR-LGRLVLPADIQIFVPIPKLH  940

Query  1390  HDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMI  1569
              DPEIWG+DVH+FKPERF+EGV KATNN+ + F+PFG+GPR+C+G++F M EAK+ LSMI
Sbjct  941   SDPEIWGEDVHQFKPERFSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMI  1000

Query  1570  LQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LQR++  LS +Y+H PV  FM RP+ G+Q+I H
Sbjct  1001  LQRFTFELSPAYIHCPVYNFMNRPQHGLQIIFH  1033



>ref|XP_004297193.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=519

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 359/504 (71%), Gaps = 9/504 (2%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             LL++A   +  K WW P  I+K ++ QG+ GP YR +HGNTKEI+   +   S+P    L
Sbjct  19    LLLVALIKIFYKQWWIPTRIKKKLNLQGVTGPPYRLIHGNTKEIAGMIKEAMSRP--KRL  76

Query  349   SHDVFPRILPHIYSWKRLYGAN-FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG  525
             SHD+   I PHI+SW + YG   +L W G Q +L+V + EL KEIL+++   Y K + +G
Sbjct  77    SHDIRTLIYPHIHSWSKKYGGKAYLQWYGSQAQLIVMDTELCKEILNEKDRVYRKPKKEG  136

Query  526   FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE-HEGKE  702
             F+ RL G+G+   +GEKWA++RK++ + FHGESL+ M+P+MI S ETM++ W    EGKE
Sbjct  137   FALRLQGNGLPGIEGEKWAKVRKISMHAFHGESLKTMIPSMIASTETMLKRWITFEEGKE  196

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE FEEFRLLTSEVISRTAFGS+YLEG++IFEML+KL +   KN   +R PG+SR +KN 
Sbjct  197   IEVFEEFRLLTSEVISRTAFGSSYLEGQDIFEMLMKLASFLVKNTYRLRIPGISRFIKNK  256

Query  883   DELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICI  1059
             DE+ESEKL E + + I++I+KKRE Q  T  +++     DF+  LL+A H  N +  I +
Sbjct  257   DEIESEKLVERIHDSILEIVKKREEQAMTMSDEEDRFGGDFIGLLLKARHDPNVN--ITV  314

Query  1060  EAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFG-QENPTPYGIAR  1236
             + ++DECKTFYFAG ETT +LL W  LLLA H +WQE AR+EV+++FG Q  P   GIA+
Sbjct  315   DDVIDECKTFYFAGQETTNTLLAWTILLLALHPEWQEEARREVLQLFGKQTTPNSDGIAK  374

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M+MIL ETLRLYPPV  I R+V KK+V LG I +P N+ L +  LA  HDP++WG D
Sbjct  375   LKTMSMILNETLRLYPPVVSIIRRV-KKDVRLGKIIVPANVELQVPNLAFHHDPQLWGDD  433

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERF+EGV KATNN+ +A+LPFG GPR C+G NFA  EAKI LSMILQRYS  LS
Sbjct  434   VHLFKPERFSEGVAKATNNNMVAYLPFGMGPRNCIGFNFATTEAKIALSMILQRYSFTLS  493

Query  1597  SSYVHSPVQLFMLRPKDGVQVILH  1668
               YVHSP +   +RP+ GVQV+LH
Sbjct  494   PGYVHSPFRYITVRPQHGVQVMLH  517



>ref|XP_010044377.1| PREDICTED: cytochrome P450 CYP749A22-like isoform X1 [Eucalyptus 
grandis]
Length=565

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/505 (51%), Positives = 360/505 (71%), Gaps = 15/505 (3%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P  IQ++++ QGI+GP Y+F+HG++KE  +    +   PM ++LSHD+FP
Sbjct  63    AKLWYKLWWKPHRIQRILNEQGIRGPPYKFVHGSSKESFKMITQVRDIPM-NNLSHDIFP  121

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I++W   YG N+L W G Q +LV+TE EL+KE+L +R   YPK     F ++LLG
Sbjct  122   KIQPEIHTWTNTYGRNYLSWHGTQAQLVITEPELIKEVLVNRDKTYPKTPATDFVKKLLG  181

Query  547   DGIGSSKGE-KWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ ++  E KWA+ RKLAN+ FHGESL+ M+P M+++   M+  W+  EGKEI+ FE+F
Sbjct  182   DGLATTNNEEKWAKQRKLANHAFHGESLKNMVPMMVDTIHVMLARWKHQEGKEIDVFEDF  241

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGM---------SRIMK  876
             +LLT EVIS+TAFGS+Y+EG+NIF+ML +L  L +KN  +VRFPG+         S+  K
Sbjct  242   KLLTCEVISKTAFGSSYIEGRNIFQMLTRLGVLLTKNLHHVRFPGLRGISLGILLSKFWK  301

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
               DE+E+EKL++G+ + I+ I+KKRE+  KTGE   +   +DFL +L++A+   +   +I
Sbjct  302   TADEIEAEKLQKGIYDAILGIVKKREEKVKTGEA--ADVGNDFLGQLVKASRGMDNSKKI  359

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              I+ +VDECKTFY AG ETT +L+ W   LLA H +WQE+ARKEV+ VFG  +P   GIA
Sbjct  360   TIDDLVDECKTFYLAGQETTNALMTWVVFLLAAHPNWQEKARKEVLHVFGNNDPDSDGIA  419

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+MI+ ETLRLYPPV  + R+VE++ + LG + LP NIH+ I  L L HDP+IWG+
Sbjct  420   KLKTMSMIINETLRLYPPVIGMSRQVEQQ-LRLGKLLLPTNIHIIIGNLKLHHDPKIWGE  478

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERFAEG+ +ATNN+P+ F+PF +GPR C G+NFA  E KI+LSMILQRY+  L
Sbjct  479   DVLLFKPERFAEGIARATNNNPVVFIPFSFGPRICAGMNFATHEVKIILSMILQRYAFKL  538

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S +YVH PVQ+  + PK G+QVI  
Sbjct  539   SPAYVHCPVQVLTIGPKHGLQVIFQ  563



>ref|XP_004297210.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/494 (54%), Positives = 349/494 (71%), Gaps = 7/494 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P+ IQKLMS +GIKGP YR L+GN KEI   ++   +  M  +LSHD+FPR+ PH
Sbjct  23    KLWWTPIRIQKLMSLRGIKGPPYRLLYGNGKEIINMQK--EAALMPRNLSHDIFPRLHPH  80

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I+SW + YG NFL W G QP LVVTE E  KEI +++ G +PK +     ++L GD +  
Sbjct  81    IHSWSKRYGKNFLMWYGVQPVLVVTEPESCKEIFNNKDGAFPKPKPSDIVKKLFGDSLAM  140

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++ EKWA +RKLAN+ FHGESL+ M P M  SAE M+E W+ HEGKE + FEEFRLLTSE
Sbjct  141   TEDEKWANLRKLANHAFHGESLKAMFPDMTASAEAMIERWKNHEGKETDVFEEFRLLTSE  200

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNF--LNVRFPGM-SRIMKNNDELESEKLEE  912
             VI+RTAFGS+YLEG+NIFEML  L  +  KN      RFPG+ S++ + + E+E++KLE+
Sbjct  201   VIARTAFGSSYLEGQNIFEMLKNLSIIVFKNLYKYKTRFPGISSKVYRTSGEIEADKLEK  260

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              +++ +++I+KKREQ K    +  S  SDFL  LL+++H  N D +  I+ +V+ECK  Y
Sbjct  261   EIQDSVMEIVKKREQ-KASSGEGESFGSDFLGLLLKSHHDINDDQKFSIDNVVEECKALY  319

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             F G ETT++LL W   LLA H +WQE ARKEV+++FG+E P   GI++LK M+MI+ ETL
Sbjct  320   FVGQETTSTLLSWTVFLLAQHPEWQEEARKEVLQLFGKETPNSDGISKLKTMSMIINETL  379

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV  I R V ++ V LG + +P N+ L I  +AL HD +IWG++   FKPERF+EG
Sbjct  380   RLYPPVNLIGRIVPRE-VKLGAVQVPANVELLIPTVALHHDSQIWGQEAALFKPERFSEG  438

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KATN++  +F PFG GPR C G+NFA  EAKI LSMILQ YS  LS +YVHSP Q   
Sbjct  439   VAKATNDNMGSFSPFGMGPRMCAGINFASNEAKIALSMILQHYSFTLSPAYVHSPFQFLT  498

Query  1633  LRPKDGVQVILHRI  1674
             +RP+ GVQVILH +
Sbjct  499   VRPQHGVQVILHSL  512



>gb|KCW82722.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=491

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/492 (52%), Positives = 350/492 (71%), Gaps = 23/492 (5%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQ+ M+SQGI+GP Y+  +GNT+EI + +   +S+P+  +LSHD+FPR+ PH
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL--NLSHDIFPRVQPH  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I +W   Y                 E EL+KE+L+++   +PK E+  F ++LLGDG+ +
Sbjct  80    ISTWTGTY-----------------EPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVT  122

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE
Sbjct  123   TEGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSE  182

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             +ISRTAFGS+Y+EG+NIFEML KL  +AS+N   +RFPG+S++ K NDELESEKLE G+R
Sbjct  183   IISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIR  242

Query  922   NGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + +++II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY A
Sbjct  243   DAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIA  300

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             G++T+ ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK M MI+ E+LRL
Sbjct  301   GYDTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLKTMGMIINESLRL  360

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             YPPV  + RK+  K   LG + LP N+ LYI  L L H+P+IWG D   FKPERF+EGV 
Sbjct  361   YPPVVGLIRKIATK-TRLGKLVLPANMGLYIPNLKLHHNPQIWGDDAQLFKPERFSEGVA  419

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KA+NN+  AF PFG GPRTC+G NFA AEAKI LSMILQRY+ +LS +YVHSP QL    
Sbjct  420   KASNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFSLSPAYVHSPTQLLTTS  479

Query  1639  PKDGVQVILHRI  1674
             P+ G+QVI H +
Sbjct  480   PQHGLQVIFHAL  491



>ref|XP_007045772.1| Secologanin synthase, putative [Theobroma cacao]
 gb|EOY01604.1| Secologanin synthase, putative [Theobroma cacao]
Length=1045

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/504 (53%), Positives = 362/504 (72%), Gaps = 10/504 (2%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLS  351
             LV+A   +  K WW P+ IQ  M+ QGIKGP Y+F+HGN KE  + ++   SKPM   LS
Sbjct  20    LVIALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFIHGNNKETVKMKQEALSKPMAS-LS  78

Query  352   HDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG--  525
             HD+FPR+ P +YSW   YG N+L W G + +L++TE ELVKE+L   +  +PK   +   
Sbjct  79    HDIFPRVNPPVYSWINSYGKNYLSWAGTKAQLIITEPELVKEVLKSSERAFPKRTSRERK  138

Query  526   -----FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
                  F+ ++LGDG+ +S+G+KWAR RKLAN  FHGESL+ M PA+I S ETM+E W++ 
Sbjct  139   RNEDEFAIKILGDGLVTSEGQKWARQRKLANYAFHGESLKSMTPALIASVETMLEKWKQL  198

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIE FEEFRLLTSEVISRTAFGS+YL+GK IF+ML+KL  L ++N    +FP +S  
Sbjct  199   EGKEIEVFEEFRLLTSEVISRTAFGSSYLDGKKIFDMLLKLSVLTNRNMFKTKFPVISNF  258

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  DE+ES+KL +G+ N +++I+KKRE+ K    + +S  +DFL  L+ A H  +  N+
Sbjct  259   RKTADEIESDKLVKGIHNSVMEIVKKREE-KVVNGEANSFGTDFLGLLVSAYHDADKKNR  317

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
               ++ +VDECKTFYFAG ETT S L W  LLLA + DWQE+AR+EV+EVFG +NP   GI
Sbjct  318   PSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPDWQEKARREVIEVFGNQNPHSEGI  377

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              RLK M MI+ ETLRLYPPV  + RKVE + V LG + LP ++HL +  +AL HDP++WG
Sbjct  378   GRLKTMTMIINETLRLYPPVSGMARKVENE-VQLGKLILPADLHLGVPIMALHHDPQLWG  436

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              DV+ FKPERFAEG+  AT ++  A++PFG GPR+C+G++FAM E KIV+SMILQRY+++
Sbjct  437   DDVNLFKPERFAEGIANATKHNAAAYVPFGLGPRSCVGMSFAMTETKIVVSMILQRYTIS  496

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVI  1662
             LS +Y HSP  L +L+P+ G+QV+
Sbjct  497   LSPTYSHSPFTLLLLQPQHGIQVL  520


 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/508 (53%), Positives = 359/508 (71%), Gaps = 10/508 (2%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLS  351
             LV+A   +  K WW P+ IQ  M+ QGIKGP Y+F+HGN KE     R   SKPM + LS
Sbjct  541   LVMALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFIHGNNKETERMTRDALSKPMAN-LS  599

Query  352   HDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG--  525
             HD+ PR+ P +YS    YG  +L W+G + +L +TE ELVKE+L   +  +PK   +   
Sbjct  600   HDILPRVNPPVYSRINSYGKIYLSWVGTRAQLFITEPELVKEVLKSSERAFPKRTSRERK  659

Query  526   -----FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
                  F+ ++LGDG+ +S+GEKWAR RKLAN  FHG+SL+ M PA+I S ETM+E W++ 
Sbjct  660   WNDDEFALKILGDGLVTSEGEKWARQRKLANYAFHGDSLKSMTPAVIASVETMLERWKQF  719

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEIEAFEEFRLLTSEVISRTAFGS+YL+GK IF+ML+KL  L ++N    +FP +S  
Sbjct  720   EGKEIEAFEEFRLLTSEVISRTAFGSSYLDGKKIFDMLLKLSVLTNRNLFKTKFPVISNF  779

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  DE+ES+KL +G+ N +++++KKRE+ K    + +S  +DFL  L+ A H  +  N+
Sbjct  780   CKTADEIESDKLVKGIHNSVMEVVKKREE-KVVNGEANSFGTDFLGLLVNAYHDADKKNR  838

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             + ++ +VDECKTFYFAG ETT S L W  LLLA + DWQE+AR+EV+EVFG +NP   GI
Sbjct  839   LSVQDLVDECKTFYFAGQETTNSALAWTVLLLAINPDWQEKARREVIEVFGNQNPHSEGI  898

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              RLK M MI+ ETLRLYPPV  + RKVE + V LG + LP ++ L +  +AL HDP++WG
Sbjct  899   GRLKTMTMIINETLRLYPPVSGMARKVENE-VQLGKLILPADLQLVVPTVALHHDPQLWG  957

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              DV+ FKPERFAEG   AT ++  A+ PFG GPR+C+G++FAM E KI LSMILQRY+++
Sbjct  958   DDVNLFKPERFAEGTANATKHNAAAYAPFGLGPRSCVGMSFAMTETKIALSMILQRYNIS  1017

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             LS +Y HSP  L +L+P+ G+QVILH +
Sbjct  1018  LSPTYSHSPYTLLLLQPQHGIQVILHSL  1045



>gb|AJD25261.1| cytochrome P450 CYP749A39 [Salvia miltiorrhiza]
Length=511

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/502 (53%), Positives = 361/502 (72%), Gaps = 6/502 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
              L++  + +  KL W P+ +Q+LM SQGI+GP YRFLHGNT+EI + ++  T      D+
Sbjct  12    FLLIIPSIIFYKLCWIPLRLQRLMESQGIRGPPYRFLHGNTREIIKMKQQ-TKDAAAMDI  70

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ-G  525
             SHD+FP ILPH YSW +LYG NFLYW+G +PE+VVTE ELVKEILS+++G + KI  +  
Sbjct  71    SHDIFPIILPHWYSWIKLYGNNFLYWIGTEPEIVVTEPELVKEILSNKQGTFRKIVAKRA  130

Query  526   FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEI  705
             + ++LLGDG+ +++GEKW ++RKLAN+ FHGESL+ M+P +    ETM+E WR + GKEI
Sbjct  131   YWKKLLGDGLIAAEGEKWLKLRKLANHAFHGESLKDMVPEITACVETMLEKWRNYHGKEI  190

Query  706   EAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNND  885
             E   EF+ L+SEVISRTAFGSN LEG+ IF+ML KL  L S+N L +R  G+ + ++  D
Sbjct  191   EVCSEFKHLSSEVISRTAFGSNCLEGRKIFDMLSKLIVLISRNMLKIRPFGLGKFIRTQD  250

Query  886   ELESEKLEEGVRNGIIQIIKKR-EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             + E++K+E+ + + I++I+ KR ++ +TG  +  S  +DFL  LL+++H  +  + I   
Sbjct  251   DKEADKIEQLLHDSIMEIVNKRQDEVQTG--KADSFGNDFLGSLLKSHHDTDPKSHISAA  308

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              ++DECKTFYF G ETT SLL W T LLA H +WQ+RAR+EV+++FGQ+NP   G++RLK
Sbjct  309   EIIDECKTFYFGGQETTFSLLSWTTFLLAIHTEWQDRAREEVLQLFGQQNPNSDGLSRLK  368

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
              +NMIL ETLRLY  V  I R+   + + LG   LP NI + I PLAL  +PEIWG+D H
Sbjct  369   TVNMILYETLRLYGAVTNIVRRTGSR-MKLGKYELPANIRVSIPPLALHRNPEIWGQDAH  427

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFA+G+ KATN  P AFL FG+GPRTC+GLNFA++EAKI  SMILQRY   LSS 
Sbjct  428   LFKPERFAQGMAKATNGIPTAFLGFGFGPRTCVGLNFAISEAKITFSMILQRYKFTLSSD  487

Query  1603  YVHSPVQLFMLRPKDGVQVILH  1668
             YVHSP  L   +P+ GV ++L 
Sbjct  488   YVHSPFILLTAQPQRGVGILLQ  509



>emb|CDP00472.1| unnamed protein product [Coffea canephora]
Length=1133

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/490 (56%), Positives = 357/490 (73%), Gaps = 5/490 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+ WAP+H+Q +M +Q IKGP Y+FL+GNTKEI   +    S PM D +SHD+FPRI PH
Sbjct  646   KICWAPIHMQYVMRAQRIKGPPYKFLYGNTKEILSMKSKSMSCPMVD-ISHDIFPRIQPH  704

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +Y+W+ LYG NFL W+G +P+LVVTE EL+++ILS+++G YPKI+     ++LLGDG+  
Sbjct  705   MYAWRNLYGKNFLVWIGNKPQLVVTEPELIRQILSNKEGAYPKIKADSLVKKLLGDGLVM  764

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW ++RKLAN+ FH ESL+ M+PAMIES E ++E WR H+GKEIE +EEFR LTSE
Sbjct  765   TEGEKWLKLRKLANHAFHAESLKDMVPAMIESVEAVLEKWRCHDGKEIEVYEEFRHLTSE  824

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAFGS+YLEGKNIFEML++L     KN   +RF    +I ++ D++ SEK+EE +R
Sbjct  825   VISRTAFGSSYLEGKNIFEMLMQLGFFIFKNDAKIRFLKDWKIFRSADDIASEKIEESLR  884

Query  922   NGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             N I+ I+ KRE+  K G  +  S  +DFL  LL+A+H  +   +I I+ +VDECKTFY A
Sbjct  885   NSIMSIVNKREEGVKIG--KADSYGNDFLGSLLQAHHAADVKYRITIDDIVDECKTFYLA  942

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             GHET +S L W   LLA H DWQE+AR EV E FG E P P  IARL+ M MI+ ET+RL
Sbjct  943   GHETISSALTWTIFLLAIHTDWQEKARNEVFEFFGHEKPKPDFIARLRNMTMIINETMRL  1002

Query  1279  YPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVV  1458
             Y P   I R+V ++ V LG +TLP ++ + I P A+  DPEIWG D   FKPERFAEGV 
Sbjct  1003  YSPATNIVRRVGRE-VKLGKLTLPADMDINILPCAIHCDPEIWGADALLFKPERFAEGVA  1061

Query  1459  KATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLR  1638
             KATN + +A+LPFG+GPRTC+GLNFA  E KI LSM+LQR+   LS +YVHSP  +  LR
Sbjct  1062  KATNYNTMAYLPFGFGPRTCVGLNFAANEVKIALSMMLQRFKFTLSPNYVHSPFTVLTLR  1121

Query  1639  PKDGVQVILH  1668
             P+ GV ++L+
Sbjct  1122  PERGVPIVLN  1131


 Score =   522 bits (1344),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 255/509 (50%), Positives = 358/509 (70%), Gaps = 13/509 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLC---EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             F++S+L      L     K+WW P  IQ +  SQ IKGP  RFLHGNT EISE R+   +
Sbjct  8     FVASILFCLLVPLINFLHKVWWMPRRIQHVFFSQSIKGPPPRFLHGNTIEISEMRQNFMN  67

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
             + ++  LSHD+F  + PHIY W ++YG NFL+W G + ELVV+E EL+KE+L D +  + 
Sbjct  68    RKLQ--LSHDIFRTLQPHIYLWTKIYGKNFLHWPGARAELVVSEPELIKELLYDNEQSFC  125

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             + +   + +++LG GI +S GEKW ++R+L++  FH ESLR M+PAMIES E M+  W+ 
Sbjct  126   RSDADRYLKKILGKGILTSDGEKWLKLRQLSSQAFHAESLRHMIPAMIESVELMLGRWKN  185

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
             +EG EI+A EEFRLLT+E+ISRTAFGS+YLEG++IF+ML KL  L+ KN    + P +S 
Sbjct  186   YEGMEIDASEEFRLLTAEIISRTAFGSSYLEGQDIFQMLRKLVVLSCKNSHKTKLPIISS  245

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             + K+  +LE++KLE+ VR+ +++++KKR+   +  E       DFL   L+A++  +G++
Sbjct  246   VFKDRYDLEADKLEKRVRDSVLEMVKKRQTEISFGE-------DFLGLHLKAHYASDGNS  298

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ ++D+CKTFY AG  TT+ LL W  LLLA H DWQE+AR+EV E+FGQ+ P P G
Sbjct  299   RITVQEIIDQCKTFYSAGQTTTSVLLSWTILLLAIHTDWQEKAREEVFELFGQQPPNPEG  358

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I+R+K M+MI+ E+LRLYPP  YI+RK +K   +   I LP N ++++  LA+ HDP++W
Sbjct  359   ISRMKTMSMIINESLRLYPPSVYIQRKAKKGAKLGKLI-LPTNTNVHVPILAIHHDPKLW  417

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             GKD H F PERF+ GV  AT N+P AFLPF  GPR C+G NFA  EAKI LSMILQRY+ 
Sbjct  418   GKDAHIFNPERFSSGVAAATKNNPAAFLPFSLGPRACVGANFATLEAKISLSMILQRYTF  477

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              LS +YVHSPVQ+  LRP+ GVQV++  +
Sbjct  478   TLSPNYVHSPVQILSLRPQHGVQVMITNV  506



>ref|XP_011009686.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=512

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/505 (53%), Positives = 358/505 (71%), Gaps = 7/505 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCE---KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK  330
             +SSL V     L +   K+WW P+ IQ  M SQG+KGP YRFLHGNTKEI   R  I S 
Sbjct  9     LSSLCVFFILHLIKFFIKVWWDPIRIQSAMRSQGMKGPPYRFLHGNTKEIYNMRNEIMSS  68

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             PME  LSH +  RI PH+YSW +LYG NFL W GPQ +LV+TE EL+KE+LS++ G YPK
Sbjct  69    PME--LSHQMLARIQPHVYSWIKLYGMNFLNWYGPQAQLVITEPELIKEVLSNKDGAYPK  126

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
               +Q ++ +LLGDG+  S+G+KW +MRKLA + FH ESL+G +PAMI S ETM++ WR  
Sbjct  127   FVIQNYAEKLLGDGLVLSQGKKWLKMRKLAIHAFHAESLKGTIPAMIVSVETMLDRWRRE  186

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
               KEIE ++EF++LTSE+ISR AF S+YLEGKNIF+ML ++  +  +N   V   G+   
Sbjct  187   GIKEIEVYQEFKVLTSEIISRAAFRSSYLEGKNIFDMLTRMALIVGRNNYKVGISGIKNF  246

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  D++ESEKL+ G+R+ ++++IK+RE+   G E      SDFL  LL+A H+ +   +
Sbjct  247   FKTRDDIESEKLDRGIRDSMLKVIKRREEVLMGTE-PDGYGSDFLGLLLKAYHENDKTKK  305

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I I+ ++DECKTFY AGHETTTS L W  L LA H DWQ RAR+EV+++FGQ+NP P  I
Sbjct  306   ISIDDLIDECKTFYVAGHETTTSSLTWTLLFLAIHTDWQNRAREEVLQIFGQQNPCPDSI  365

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              RLK M MI+ E+LRLYPPV  + R+V+++ V LG + +P  + L +S LAL ++P+IWG
Sbjct  366   GRLKTMTMIINESLRLYPPVFNLTREVQRE-VKLGKLIVPAKMTLSLSILALHNNPQIWG  424

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
             +D H FKPERFA GV +AT N+  +FLPFG GPR+C+GLNFA++E KI LSMILQ Y   
Sbjct  425   EDAHLFKPERFAGGVAEATRNNATSFLPFGLGPRSCVGLNFALSEIKIALSMILQHYRFT  484

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVIL  1665
             LS +YVHSP  +  + P+ G+Q++ 
Sbjct  485   LSPTYVHSPEHILTISPRYGLQILF  509



>ref|XP_011009712.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=529

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/502 (50%), Positives = 354/502 (71%), Gaps = 15/502 (3%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW  + IQ  + SQG+KGPSYRFLHGN KEI   R+   S P E  L H  F RI PH
Sbjct  32    KVWWTQIRIQSALHSQGVKGPSYRFLHGNLKEIINLRKEAMSGPTE--LCHQSFSRIQPH  89

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +Y W +L+G NF +W G Q +LVV E E +K +L+++ G+Y K E+Q + ++L GDG+ +
Sbjct  90    VYLWSKLHGKNFFWWKGSQAQLVVYETEQIKVVLNNKDGNYLKPEVQPYLKKLFGDGLVT  149

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW ++RK+AN+ FHGESL+ M+P M+ S E M+  W++H GKEIE F++F++LTSE
Sbjct  150   TRGEKWFKLRKVANHAFHGESLKDMIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSE  209

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             +ISRTAFGS+YLEG+ IFE+L ++  + SKN   +R PG+ +++K  D+++SEKL + +R
Sbjct  210   IISRTAFGSSYLEGQQIFEILTRMVLIFSKNLFRMRIPGIGKLVKTQDDIQSEKLGQIIR  269

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
             N +I++IKKRE+     E      SDFL +L++     +  ++I I+ ++DECK FY AG
Sbjct  270   NSVIKMIKKREEAAMAGE-IDGYGSDFLGQLVKVYRSADMTSRITIDDLIDECKNFYIAG  328

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
             HETTTS L W  L+LATH DWQE+ R E++E+FGQ+NP   GI+RLK M+M++ E+LRLY
Sbjct  329   HETTTSALTWIVLMLATHADWQEKVRNEILELFGQQNPGLEGISRLKTMSMVINESLRLY  388

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
             PPV  + R+V KK   LGN+ +P  + +++  LAL HDP+IWG DVH FKP+RFAEGV K
Sbjct  389   PPVVGLLREV-KKGTKLGNLIIPEKMEVHVPSLALHHDPQIWGDDVHLFKPDRFAEGVAK  447

Query  1462  ATNNHPIA-----------FLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             AT N+  A           FLPFG GPR C+G+NFA  E KI LSMILQRY + LS +YV
Sbjct  448   ATKNNIAAFLXXXXXXXXXFLPFGMGPRNCVGMNFAYNEIKITLSMILQRYRITLSPNYV  507

Query  1609  HSPVQLFMLRPKDGVQVILHRI  1674
             HSPV +  + P+ G+QV++  +
Sbjct  508   HSPVLVLAICPQHGLQVMIKAV  529



>gb|KCW86460.1| hypothetical protein EUGRSUZ_B03128 [Eucalyptus grandis]
Length=485

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/508 (52%), Positives = 351/508 (69%), Gaps = 32/508 (6%)
 Frame = +1

Query  163   SSLLVL---AAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKP  333
             +SL +L   A A    KLWW P  IQ+ M+SQGI+GP Y+  +GNT+EI + +   +S+P
Sbjct  6     TSLFLLPFSALAIALHKLWWTPCRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRP  65

Query  334   MEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKI  513
             M  +LSHD+FPR+ PHI +W   Y                       E+++++   +PK 
Sbjct  66    M--NLSHDIFPRVQPHISTWTGTY-----------------------EVVNNKDKAFPKP  100

Query  514   ELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             E++GF ++LLGDG  +++GEKWA+ RKLAN  FHG+SL+ MLPAM++S   M++ W+   
Sbjct  101   EIEGFVKKLLGDGPVTTEGEKWAKQRKLANYAFHGDSLKSMLPAMVDSVHMMLDRWKNLH  160

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             G EIE ++EF +LTSE+ISRTAFGS+Y+EG+NIFEML KL ++AS+N   +RFPG+S++ 
Sbjct  161   GDEIEVYQEFTMLTSEIISRTAFGSSYVEGRNIFEMLRKLASIASRNAFKIRFPGISKLW  220

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
             K NDELESEKLE G+R+ +++II+KRE+  K GE       +DFL  L++A+H ++   +
Sbjct  221   KTNDELESEKLENGIRDAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRR  278

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             I I  +VDECKTFY AG +T+ ++L W   LLA H DWQ+ ARKEV+ VFG ++P P GI
Sbjct  279   ITITDLVDECKTFYIAGQDTSNTMLTWTVFLLAIHPDWQDEARKEVLNVFGNQDPDPDGI  338

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
             A+LK M MI+ E+LRLYPPV  + RKV  K   LG + LP NI LYI  L L HDP+IWG
Sbjct  339   AKLKTMGMIINESLRLYPPVVGLIRKVGTK-TRLGKLVLPANIGLYIPNLKLHHDPQIWG  397

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              D   FKPERF+EGV KATNN+  AF PFG GPRTC+G NFA AEAKI LSMILQRY+ +
Sbjct  398   DDAQLFKPERFSEGVAKATNNNLAAFFPFGLGPRTCVGFNFATAEAKIALSMILQRYTFS  457

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             L  +YVHS  QL    P+ GVQVI H +
Sbjct  458   LFPAYVHSHTQLLTTSPQHGVQVIFHAL  485



>gb|KCW85140.1| hypothetical protein EUGRSUZ_B01983 [Eucalyptus grandis]
Length=514

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/507 (50%), Positives = 359/507 (71%), Gaps = 11/507 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK--  330
             F+SS+L      L +KLWW P+ +Q+ M+SQGIKGP Y+F+HG TKEIS+ ++ +  K  
Sbjct  14    FLSSILTK----LLQKLWWRPIRVQRAMASQGIKGPPYKFIHGCTKEISKLKQDVMMKMN  69

Query  331   -PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM + +SH++ P + PHI+ W +LYG  +L+W GPQ  L +++ ELVKE+L++R   Y 
Sbjct  70    EPMTN-VSHEILPIVEPHIHKWNKLYGGIYLHWYGPQAFLFISDTELVKEVLNNRDKTYV  128

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             K+E  G  +++ GDG+ +++G+KWAR R+LA+  FHGESL+GM+PAM++S   +++ W++
Sbjct  129   KLEFPGDIKKIFGDGLVATEGKKWARQRRLAHLAFHGESLKGMIPAMVDSVHALLDRWQK  188

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
              E KE+E FEEF  +TS+VISRTAFGS+Y+EG+ IF+ML +L  + S+NF  +R PG+ +
Sbjct  189   LEAKEVEIFEEFATITSDVISRTAFGSSYMEGREIFQMLSELTIIVSRNFFKLRLPGIRK  248

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             I K +DE++SE+LE+ + + ++ IIKKRE+   GE       +D+L  LL+A H  +   
Sbjct  249   IWKTSDEIKSERLEKAICDALLGIIKKREEKAKGEMDDYG--NDYLGSLLKAYHDPDKSK  306

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ + DECKTF+FAG ETTTS+L W   LLA H+DWQE ARKEV +VF  E+P   G
Sbjct  307   RITMDDLRDECKTFHFAGQETTTSILTWTLFLLAIHKDWQEEARKEVTDVFDNEDPNHEG  366

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I +LK ++MI+ E+LRLYPPV    RKV ++ V LGN+ LP  I L+I  L + H P IW
Sbjct  367   IIKLKTVDMIINESLRLYPPVVSAIRKVVRQ-VTLGNLVLPQGIALHIPILTIHHSPRIW  425

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G DVH FKPERF EG+  A +N   AFLPFG GPR C+G NFA  EAKI L+MIL+ YS 
Sbjct  426   GDDVHLFKPERFREGIAGAVSNDAAAFLPFGLGPRNCVGSNFATTEAKITLAMILRHYSF  485

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              +S  YVH P Q FM+RP+ G++VILH
Sbjct  486   TVSPDYVHLPTQTFMIRPQHGLKVILH  512



>ref|XP_006388777.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
 gb|ERP47691.1| hypothetical protein POPTR_0102s00210g [Populus trichocarpa]
Length=517

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/490 (52%), Positives = 343/490 (70%), Gaps = 4/490 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW P+ IQ LM SQGI+GPSYRFLHGNTKEIS   R I S P E  L H   P + PH
Sbjct  26    KVWWTPIRIQSLMKSQGIRGPSYRFLHGNTKEISTMIRKIRSSPQE--LLHHTLPMVHPH  83

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
              YSW +LYG NFL W GPQ +L++TE ELVK+ILS++   YPK ++    ++LLGDGI  
Sbjct  84    FYSWIKLYGMNFLQWYGPQAQLIITEPELVKQILSNKDRAYPKTKVSSEIKKLLGDGIVL  143

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             S+GEKW ++RKLAN+ FHGES++GM+P MI S E M+E WR H  KEI+ F EF++LTSE
Sbjct  144   SEGEKWVKLRKLANHAFHGESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKILTSE  203

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRT+FGS+YLEG+++F+ML ++  + S+N   VR PG+ + +K + ++E E LE  +R
Sbjct  204   VISRTSFGSSYLEGQHVFDMLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEAKIR  263

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
                + ++K+RE+     E       D    LL+A H  +   +I ++ ++D+CK FY AG
Sbjct  264   KSFMNMMKRREKDAMSGELDGYGH-DLFGLLLKAYHDSDETRKISLDDLIDQCKNFYLAG  322

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
              ET+ S L W   LLA H DWQ++ARKEV+E+FG + P+   IA+LKIM M++ E+LRLY
Sbjct  323   QETSASALTWIVFLLAVHSDWQDKARKEVLELFGLQIPSQDRIAKLKIMGMVINESLRLY  382

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
              P   + R+VE++   LG IT+P N  +YIS LA+  +PEIWG+D   FKPERFA+GVVK
Sbjct  383   TPNAILMRRVERET-KLGKITVPANTEVYISTLAVHQNPEIWGEDALLFKPERFADGVVK  441

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             ATNN+  AF+PFG GPR C G+NFA+ E K+ LSMILQR+S  LS +Y H P ++  + P
Sbjct  442   ATNNNTAAFMPFGLGPRNCAGMNFAITETKLALSMILQRHSFTLSPTYAHCPTEVLTMCP  501

Query  1642  KDGVQVILHR  1671
             + GVQVIL R
Sbjct  502   QHGVQVILQR  511



>gb|KHG09815.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/488 (53%), Positives = 347/488 (71%), Gaps = 4/488 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ +++SQGIKGP YRF+HGN KE+++ ++   SK +   L+ D+FP++ PHIY+
Sbjct  29    WIPLRIQHMLNSQGIKGPPYRFIHGNNKEVTKMKQKALSKSV--GLTDDLFPKVQPHIYT  86

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
             W   YG NF+YW G + ELV++E ELVKE+L + +  + K +L    R+ LG+G+   +G
Sbjct  87    WTNRYGKNFVYWNGARAELVISEPELVKEVLRNSEQIFQKKKLTDIGRKFLGNGLIFIEG  146

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKWA+ RKLAN+ FHGESL+ M PA+I S ETM+E W   EGKEIE ++EFRLLTSEVIS
Sbjct  147   EKWAKHRKLANHTFHGESLKNMTPAIIASVETMLEKWNAQEGKEIEVYQEFRLLTSEVIS  206

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAFGSNY+EG+ IF ML KL  + S+NF   R P +S++ K+ D LESEKL + +++ +
Sbjct  207   RTAFGSNYMEGEKIFAMLSKLAVIMSRNFSKTRIPLISKLWKSADLLESEKLSKEIKDRV  266

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             ++I+KKRE  K    + +S RSDFL  LL A H  +  N++ +E +V ECKTFYFAG ET
Sbjct  267   LKIVKKRED-KVVNGEVNSFRSDFLGLLLNAYHDSDEKNRLSLEDLVAECKTFYFAGQET  325

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               SLL W  L LA H DWQE+AR+EV+++FG +NP   GIA+LKIM MI+ ETLRLY P 
Sbjct  326   VNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEGIAKLKIMTMIINETLRLYGPT  385

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               ++R V ++ + LG + LP NI +    + L  DP IWG DVH FKPERFA+G+ KATN
Sbjct  386   TVLQRTVIRE-IQLGKLLLPANIDILPLNIGLHRDPHIWGDDVHHFKPERFAKGIAKATN  444

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
                 AF PFG GPR+C+G+ FA  E K+ LSMILQRY++ALS +YVHSP+ +  LRP+ G
Sbjct  445   YTTAAFFPFGLGPRSCVGMTFATIETKVALSMILQRYTIALSPAYVHSPIPILTLRPQHG  504

Query  1651  VQVILHRI  1674
             +QV L  I
Sbjct  505   IQVTLKPI  512



>gb|KDO70287.1| hypothetical protein CISIN_1g039293mg [Citrus sinensis]
Length=512

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/494 (53%), Positives = 354/494 (72%), Gaps = 10/494 (2%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGI--TSKPMEDDLSHDVFP  366
             L  K+WW P+ IQ  M SQGIKGPSY+F HGN KEI   +  +  +S PME  LSH +FP
Sbjct  23    LLNKIWWTPIRIQSQMRSQGIKGPSYKFFHGNNKEIINMKNEMIMSSSPME--LSHQIFP  80

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
                PHIYSW +LYG NFL W G Q ELVV E +L+KEI+++ +  +PK E + +  +LLG
Sbjct  81    ITEPHIYSWIKLYGTNFLMWHGSQAELVVAEPKLIKEIMNNNRS-FPKREPREY-LKLLG  138

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFR  726
             +G+ +++GEKW + RKLA N FH E+L+ M+P MI S + M+E WR++EGKEI+A+ E +
Sbjct  139   NGLVTTRGEKWLKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIK  198

Query  727   LLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKL  906
             +LTSE+ISRTAFGS YLEG+NIF ML K+  + +K    +  PG+ +++K ND++ES+KL
Sbjct  199   VLTSEIISRTAFGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKL  258

Query  907   EEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             E+ +R+ II+++KKRE    TGE +  S  +D L  L+ A H  +   +I ++ ++DECK
Sbjct  259   EQDIRDSIIKVVKKRESNVLTGEAE--SYGNDLLGILMRAYHSADETQKISLDDLIDECK  316

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AG +TT SLL W   LLA H DWQ++ARKEV+E+ GQ+NP+   I+RLKI+ MI+ 
Sbjct  317   TFYVAGTDTTASLLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIIN  376

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             ETLRLYPP     R+V KK V LG++ +P N+ + I  +A+ HDP+IWG+D H +KPERF
Sbjct  377   ETLRLYPPFVVFVREV-KKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERF  435

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             A+GV KAT+N+  AFLPFG GPRTC+G NF + EAKI LSMIL+RY   LS +YVHSPV 
Sbjct  436   AQGVPKATSNNMAAFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVP  495

Query  1624  LFMLRPKDGVQVIL  1665
                L P+ G+QV+L
Sbjct  496   RITLCPQHGIQVML  509



>gb|KHG18356.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   535 bits (1378),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 253/501 (50%), Positives = 354/501 (71%), Gaps = 6/501 (1%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPME  339
             I SL+VL    +    WW P+ IQ  ++SQG++GP Y+F+HG  K+I++ R    SKPM 
Sbjct  17    IYSLIVLLK--VLYDYWWVPLRIQHFLNSQGLRGPPYKFIHGCNKQINKMRSEALSKPM-  73

Query  340   DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL  519
               L+HD+ PR+ PH YSW  LYG N+L W G Q ++V T+ EL+KE+L + +  +PK E 
Sbjct  74    -GLTHDILPRVFPHYYSWINLYGKNYLSWDGAQAQVVTTDPELIKEVLKNSEQTFPKREP  132

Query  520   QGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK  699
               +  RL+GDG+ +++GEKWA+ RKLAN VFHGESL+ M PA+I S ETM++ W++ EG+
Sbjct  133   PIYISRLVGDGLVTTEGEKWAKQRKLANYVFHGESLKNMTPAVIASVETMLDKWKDKEGE  192

Query  700   EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKN  879
             E E F+EFR+LTSEVISRTAFGS+YLEG+ IF ML KL  + S+N    R P +S+  K 
Sbjct  193   ETEVFQEFRMLTSEVISRTAFGSSYLEGEKIFYMLKKLADIVSRNSNKSRIPILSKFWKT  252

Query  880   NDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICI  1059
             +D++ SEKL   +++ +I+I+KKRE  K    +  S  SDFL  L++A +  +  N+I +
Sbjct  253   DDDVGSEKLAREIKDLVIEIVKKRE-NKVASGEAESFGSDFLGLLVKAFNNPDEKNKISM  311

Query  1060  EAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARL  1239
             E +VDECKTFYFAG ET  +LL WA L+LA H DWQ++AR+EVME+FG +NP   G+A+L
Sbjct  312   EDLVDECKTFYFAGQETVNALLAWAVLVLAIHSDWQDKARREVMEIFGSQNPHSEGLAKL  371

Query  1240  KIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDV  1419
             KIM+MI+ ETLRLY P+  + R+  ++ V +G + LP  + ++I  +AL HDP++WG D 
Sbjct  372   KIMSMIINETLRLYAPINGLVRRA-RRQVQVGKLVLPAKVDVWIPNMALHHDPQLWGDDA  430

Query  1420  HKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSS  1599
             H FKPERF EG+ KAT  +  AF+PFG GPR C+G+ FA+ E K  LSMILQRY+++LS 
Sbjct  431   HVFKPERFKEGIAKATKYNAAAFIPFGMGPRACVGMTFAINETKTALSMILQRYTISLSP  490

Query  1600  SYVHSPVQLFMLRPKDGVQVI  1662
             +YVHSP     ++P+ G+QVI
Sbjct  491   AYVHSPTPRITVQPQHGIQVI  511



>gb|AJD25260.1| cytochrome P450 CYP749A38 [Salvia miltiorrhiza]
Length=508

 Score =   534 bits (1375),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 254/489 (52%), Positives = 349/489 (71%), Gaps = 6/489 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K  W P H+Q++M +QGI GPSYR +HG TKE +  R      PME  LSHD+FP+I P 
Sbjct  22    KAIWIPFHVQRMMKAQGITGPSYRIVHGTTKESTILREEALKGPME--LSHDIFPKIQPQ  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
              Y W +LYG NFL W GPQP +V+TE E+ KEIL++++G + K + +G  ++LLGDG+  
Sbjct  80    FYQWMKLYGKNFLTWAGPQPHVVITEPEIAKEILTNKEGIFLKPKSRGNVKKLLGDGLVM  139

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++G KW ++RKLAN+ F+ ESL+ M+P+MI S ETM++ WR+++G+E++  EE ++++SE
Sbjct  140   AEGAKWFKLRKLANHAFYAESLKEMIPSMIASVETMLQKWRQYQGREMDVCEELKVMSSE  199

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VI+RTAFGS+YLEGKNIF+ML KL  L  KN   +R  GM  I K  D++ES+++E+ +R
Sbjct  200   VIARTAFGSSYLEGKNIFDMLTKLGFLLFKNIDKIRPFGM--IWKTRDDVESDEIEQSLR  257

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
             +  + I++KRE+     E +    +DFL  LL+A+H  +  ++I I+ ++DECK F+ AG
Sbjct  258   DTAMSIVRKREERVVAGEAEDY-GTDFLGALLKAHHDSDKKSRISIDDVIDECKVFFLAG  316

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
             HETT+SLL W   LLA H DWQE+AR+EV+E+FG +NPT  G+ RLK  +MI+ ETLRLY
Sbjct  317   HETTSSLLSWTIFLLAIHTDWQEKARQEVLELFGDQNPTAEGLPRLKTASMIMNETLRLY  376

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
              PV  + R+  ++ V +G    P  +  +I  LAL  + EIWGKDVH FKPERFAEGV  
Sbjct  377   SPVASLVRRGTRR-VRIGRYEFPAKMEFHIPTLALHRNQEIWGKDVHLFKPERFAEGVAT  435

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             AT N+P+AFLPFGYGPRTC+GLNFA  EAKI LSMILQRYS  LS +Y H P+ +   RP
Sbjct  436   ATRNNPMAFLPFGYGPRTCVGLNFATNEAKIALSMILQRYSFTLSKNYAHFPINIITTRP  495

Query  1642  KDGVQVILH  1668
             + GVQ+IL 
Sbjct  496   QCGVQIILQ  504



>gb|KHG11625.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 256/501 (51%), Positives = 349/501 (70%), Gaps = 4/501 (1%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL  +A         W P+ IQ++++SQGI+GP YRF+HGN KE+++ R+   SKPM  
Sbjct  13    CSLFFVALVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGNNKEVAKMRQEALSKPMA-  71

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L HD+FPR+ PHIY+W   YG N+L W G + ELV++E EL+KE+L++ +  +PK +  
Sbjct  72    -LRHDIFPRVQPHIYTWINKYGKNYLSWDGVRAELVISEPELIKEVLNNSEKAFPKRKPT  130

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              F  +L+ +G+ S +GEKW + RKL N+ FHGESL+ M PA+I S ETM+E W+ + GKE
Sbjct  131   VFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVIASVETMLEKWKGYVGKE  190

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE FEEFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  +  +N    R P +S++ K  
Sbjct  191   IELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHRNLFKTRIPWISKLWKPA  250

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L   ++  ++++IKKRE      E   S  +DFL  L+ A H  +  N + + 
Sbjct  251   DILESEELSNEIQGCVMKMIKKREDRVVNGE-ADSFGNDFLGLLVNAYHDLDDKNMLSLG  309

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFY AG +T  SLL W   LLA H DWQE+AR+EV+++FG +NP P GI +LK
Sbjct  310   DLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGDWQEKARREVIDIFGNQNPNPEGIVKLK  369

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IM MI+ ET RLY P   + RK  ++ V +G + LP NI LYI+ +  QHDP++WG DVH
Sbjct  370   IMTMIINETSRLYGPANGLMRKTGRE-VQIGKLVLPANIDLYIANVVPQHDPQLWGDDVH  428

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEG+ KATN +  AF PFG GPR+C+G++FA  E KI LSMILQRY+++LS +
Sbjct  429   LFKPERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFATTEIKIALSMILQRYTISLSPA  488

Query  1603  YVHSPVQLFMLRPKDGVQVIL  1665
             YVHSP+ +  ++P+ G+QVIL
Sbjct  489   YVHSPISVITIQPQHGIQVIL  509



>gb|KHG26170.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   533 bits (1373),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 257/504 (51%), Positives = 352/504 (70%), Gaps = 4/504 (1%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              S  +LA         W P+ IQ +++SQGIKGP Y+F+HGN  E ++  +   SKPM  
Sbjct  13    CSFFLLALIKFLYDYLWIPLRIQHMLNSQGIKGPRYKFIHGNNDEATQMTKEALSKPMA-  71

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L+HD+FPR+ PHIYS    YG NFLYW G +PELV++E EL+KE+L + +  +PK +  
Sbjct  72    -LTHDIFPRVQPHIYSCINRYGRNFLYWDGVRPELVISEPELIKEVLKNSEKTFPKRKPT  130

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              F  +LLGDG+ + +GEKW + RKLANNVFHGESL+ M PA+I S ETM++ W+   GKE
Sbjct  131   IFINKLLGDGLVTVEGEKWVKQRKLANNVFHGESLKDMRPAIIASVETMLKKWKGQVGKE  190

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE F EF+LLTSEVISRTAFGS+YLEG+ IFEML KL  + S+N  N R P   ++ K  
Sbjct  191   IEVFHEFKLLTSEVISRTAFGSSYLEGEKIFEMLNKLSIVLSRNLSNTRIPLFVKLQKPA  250

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LE+E+L +G+++ + +I+K RE  K  + +  +   DFL  L+ A H  + +N++ +E
Sbjct  251   DMLEAEELAKGIQDCVSKIVKTRED-KVVKGEADNFGIDFLGLLINAYHDTDENNKLSLE  309

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +V+ECKTFYFAG +T  SLL W  LLLA+  DWQE+AR+EV+E+FG + P   G+++LK
Sbjct  310   DLVNECKTFYFAGQDTVNSLLAWMVLLLASQGDWQEKARREVIEIFGNQYPNSEGLSKLK  369

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IM MI+ E+LRLY P   + RK     V LGN+ LP +I + I+  AL HDP++WG +VH
Sbjct  370   IMTMIINESLRLYGPAVGLLRK-GGTEVRLGNLVLPADIDILIANAALHHDPQLWGDNVH  428

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEG+ KATN +  AF PFG GPRTC+G  FA+ E KI +SMILQRY+++LS +
Sbjct  429   LFKPERFAEGIAKATNYNTTAFCPFGLGPRTCVGTTFAIMEVKIAVSMILQRYTISLSPA  488

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVH+PV +  ++P+ G+QVIL  +
Sbjct  489   YVHAPVSIITVKPQHGIQVILESL  512



>ref|XP_007045774.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY01606.1| Cytochrome P450 [Theobroma cacao]
Length=524

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 358/508 (70%), Gaps = 10/508 (2%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLS  351
             LV+A   +  K WW P+ IQ  M+ QGIKGP Y+F+HGN KE  + +    SKPM   LS
Sbjct  20    LVIALIKILHKYWWTPLRIQYAMNLQGIKGPPYKFIHGNNKETVKMKHEALSKPMAS-LS  78

Query  352   HDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQG--  525
             HD+FPR+ P +YS    YG N+L W G   +L +TE ELVKE+L   +  +PK   +   
Sbjct  79    HDIFPRVNPPVYSRINSYGKNYLSWGGTTAQLFITEPELVKEVLKSSERAFPKRTSRERK  138

Query  526   -----FSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
                  F+  +LGDG+ +S+GEKWAR RKLAN  FHG+SL+ M PA+I S ETM+E W++ 
Sbjct  139   RNEDEFALMILGDGLVTSEGEKWARQRKLANYAFHGDSLKSMTPAVIASVETMLERWKQF  198

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EGKEI+ FE+FRLLTSEVISRTAFGS+YL+GK IF+ML+KL  L ++N    +FP +S  
Sbjct  199   EGKEIDVFEDFRLLTSEVISRTAFGSSYLDGKKIFDMLLKLSVLTNRNLFKAKFPVISNF  258

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  DE+ESEKL +G+ N +++I+KKRE+ K    + +S  +DFL  L+ A H  +  N+
Sbjct  259   CKTADEIESEKLVKGIHNSVMEIVKKREE-KVLNGEANSFGTDFLGLLVSAYHDADKKNR  317

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
             +  + +VDECKTFYF G ETT S L WA LLLA + DWQE+AR+EV+EVFG +NP   GI
Sbjct  318   LSGQDLVDECKTFYFTGQETTNSALAWAVLLLAINPDWQEKARREVIEVFGNQNPHSEGI  377

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              RLK M MI+ ETLRLYPP+  + RKVE + V LG + LP ++H+ +  +AL HDP++WG
Sbjct  378   GRLKTMTMIINETLRLYPPINSMVRKVENE-VQLGKLILPADLHVVVPIVALHHDPQLWG  436

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              D + FKPERF+EG+  AT ++  A++PFG GPR+C+G++FAM EAK  LSMILQRY+++
Sbjct  437   DDANLFKPERFSEGISNATKHNAAAYIPFGLGPRSCVGMSFAMTEAKTALSMILQRYTIS  496

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             LS +Y HSP  L +L+P+ G+QVILH +
Sbjct  497   LSPTYSHSPCTLLLLQPQHGIQVILHSL  524



>ref|XP_002325324.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
 gb|EEE99705.2| hypothetical protein POPTR_0019s03160g [Populus trichocarpa]
Length=519

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 253/488 (52%), Positives = 342/488 (70%), Gaps = 4/488 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW P+ IQ LM SQGI+GPSYRFLHGNTKEIS   R   S P E  L H   P + PH
Sbjct  26    KVWWTPIRIQSLMKSQGIRGPSYRFLHGNTKEISTMIRKTRSSPQE--LLHHTLPMVHPH  83

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
              YSW +LYG NFL W GPQ +L++TE ELVK+ILS++   YPK ++    ++LLGDGI  
Sbjct  84    FYSWIKLYGMNFLQWYGPQAQLIITEPELVKQILSNKDRAYPKTKVSSEIKKLLGDGIVL  143

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             S+GEKW ++RKLAN+ FHGES++GM+P MI S E M+E WR H  KEI+ F EF++LTSE
Sbjct  144   SEGEKWVKLRKLANHAFHGESIKGMVPEMIASLEIMLERWRHHHSKEIDIFVEFKILTSE  203

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRT+FGS+YLEG+++F+ML ++  + S+N   VR PG+ + +K + ++E E LE  +R
Sbjct  204   VISRTSFGSSYLEGQHVFDMLTRMTHIISENNYRVRIPGIGKFVKASYDIEFENLEAKIR  263

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
                + ++K+RE+  T  E       D    LL+A H  +   +I ++ ++D+CK FY AG
Sbjct  264   KSFMNMMKRREKDATLGELDGYGH-DLFGLLLKAYHDSDETKKISLDDLIDQCKNFYLAG  322

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
              ET+ S L W   LLA H DWQ++ARKEV+E+FG + P+   IA+LKIM +++ E+LRLY
Sbjct  323   QETSASALTWIVFLLAVHSDWQDKARKEVLELFGLQIPSQDRIAKLKIMGIVINESLRLY  382

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
              P   + R+VE++   LG IT+P N  +YIS LA+  +P+IWG+D   FKPERFA+GVVK
Sbjct  383   TPNAILMRRVERET-KLGKITVPANTEVYISTLAVHQNPKIWGEDALLFKPERFADGVVK  441

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             ATNN+  AF+PFG GPR C G+NFA+ E K+ LSMILQRYS  LS +Y H P ++  + P
Sbjct  442   ATNNNIAAFMPFGLGPRNCAGMNFAITETKLALSMILQRYSFTLSPTYAHCPTEVLTMCP  501

Query  1642  KDGVQVIL  1665
             + GVQVIL
Sbjct  502   QHGVQVIL  509



>gb|KHG06141.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG27970.1| Cytochrome P450 protein [Gossypium arboreum]
Length=522

 Score =   533 bits (1372),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 254/500 (51%), Positives = 350/500 (70%), Gaps = 9/500 (2%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  K WW P+ IQ+LMS QGI GP YRF+HGN KE  + ++     PM   LSHD  PR+
Sbjct  26    VLHKYWWKPLRIQRLMSRQGINGPPYRFIHGNNKETIKMKQEALRNPMPS-LSHDTLPRV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK------IELQGFSR  534
              P I+S  +LYG N+L W G +  LV+TE EL+KE+L + +  +PK       +   F  
Sbjct  85    HPQIWSRIKLYGKNYLSWTGSRAMLVITEPELIKELLKNSERAFPKRTSRERKKEDDFVL  144

Query  535   RLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAF  714
             ++LGDG+ +S+GEKWA+ RKLAN+ FHGE+L+ M PA+I S ETM+E W+  EGKEIE F
Sbjct  145   KILGDGLVTSEGEKWAKKRKLANHAFHGETLKSMSPAVIASVETMLERWKLFEGKEIEVF  204

Query  715   EEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELE  894
              EFRLLTSEVISR AFGS+YL+G+ IF+ML+KL  + ++N    + P +S+  K+ D++E
Sbjct  205   GEFRLLTSEVISRIAFGSSYLDGEKIFDMLMKLSVITNRNMFKAKLPVISKFWKSADQIE  264

Query  895   SEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVD  1074
             ++KLE+ + N +++I+KKRE+ K      +S  +DFL  LL A H  +  N I  + +VD
Sbjct  265   ADKLEKEIHNCVMKIVKKREE-KVANGGANSSGTDFLGLLLNAYHDTDKKNSISQQDLVD  323

Query  1075  ECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNM  1254
             ECKTFYFAG ETT S L W  LLLA H +WQE+AR+EV+++FG +NP P GI +LKIM M
Sbjct  324   ECKTFYFAGQETTNSSLAWTVLLLAVHPEWQEKARQEVIKIFGNQNPNPEGIGKLKIMTM  383

Query  1255  ILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKP  1434
             I+ ETLRLYPPV    RKV   +V LG + LP ++ L +  L L HDP +WG D++ FKP
Sbjct  384   IINETLRLYPPVSSRVRKVA-SDVQLGKLILPADLELLVPNLVLHHDPHLWGDDINVFKP  442

Query  1435  ERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHS  1614
             ERFAEG+  AT ++  AF+PFG GPR+C+G++FA+ E K+ LSMILQR+++ LS +Y HS
Sbjct  443   ERFAEGIANATKHNSAAFIPFGLGPRSCVGMSFALMEMKMALSMILQRFTILLSPTYSHS  502

Query  1615  PVQLFMLRPKDGVQVILHRI  1674
             P  L +L+P+ G+QV+LH +
Sbjct  503   PFTLLLLQPQQGIQVMLHSL  522



>gb|KCW76384.1| hypothetical protein EUGRSUZ_D00766 [Eucalyptus grandis]
Length=490

 Score =   530 bits (1365),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 251/492 (51%), Positives = 348/492 (71%), Gaps = 4/492 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  K WW P+ IQ+ M+SQGIKGP+YRF +G+TKE+ + +R  TS+PM   LSHD+FP +
Sbjct  1     MLHKFWWRPIQIQRKMASQGIKGPAYRFFYGSTKEMLQMKREATSRPMS--LSHDIFPYV  58

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PH + W + YG NFL W GPQ  LV+++ ++VK++L+D    + KI LQ   ++++G+G
Sbjct  59    QPHFHKWTQTYGKNFLVWHGPQAFLVISDLDMVKKVLNDNDHTFSKIFLQDQVKKIVGEG  118

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +S+GE+WA+ RKLAN  FHGESL+ M+PAM++ A  M++ W + E  EI  +EEF+L 
Sbjct  119   LVTSEGEQWAKHRKLANFAFHGESLKSMVPAMVDCAHMMIQRWSDRECLEINVYEEFKLC  178

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TS+ IS+TAFGS+ +EGK +FE  +KL    +K    +R PG+S++ K   E+E+EKLE+
Sbjct  179   TSDAISKTAFGSSQVEGKTVFENGVKLGLTMAKASSQIRLPGISKLWKPTYEIEAEKLEK  238

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G+R  +++IIK+R Q K    +  S  +DFL  LL+A H  + + +I  + ++ ECKTFY
Sbjct  239   GLREAVLKIIKRR-QRKINSGEMESYGNDFLGLLLKAMHDVDENKKITFDNVIAECKTFY  297

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             FAG+ET +SLL W   LLA H DWQ+ ARKEV+ V G  +P   GI +LK M MI+ E+L
Sbjct  298   FAGYETLSSLLAWTVFLLAVHTDWQQEARKEVLNVLGDRDPDFNGITKLKKMGMIMNESL  357

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   + RKV ++   LG++ LP +I ++I  L + HDP+IWG D H FKPERF+EG
Sbjct  358   RLYPPGVGVPRKVTRQ-AKLGDLILPADIMVHIPILKIHHDPQIWGDDAHLFKPERFSEG  416

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KATNN+P  FLPFG GPR C+GLNFA  EAKIVL+MILQRYS  LS +YVHSPV+L  
Sbjct  417   VAKATNNNPAMFLPFGLGPRNCVGLNFATVEAKIVLAMILQRYSFTLSPAYVHSPVELHN  476

Query  1633  LRPKDGVQVILH  1668
              RP+ GVQVI +
Sbjct  477   SRPQYGVQVIFN  488



>ref|XP_006484251.1| PREDICTED: cytochrome P450 734A1-like [Citrus sinensis]
Length=512

 Score =   531 bits (1367),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/494 (52%), Positives = 352/494 (71%), Gaps = 10/494 (2%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGI--TSKPMEDDLSHDVFP  366
             L  K+WW P+ IQ  M SQ IKGPSY+F  GN KEI   +  +  +S PM+  LSH +FP
Sbjct  23    LLNKIWWTPIRIQSQMRSQDIKGPSYKFFQGNNKEIMNMKNEMIMSSSPMQ--LSHQIFP  80

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
                PHIYSW +LYG NFL W G Q ELVV E +L+KEI+++ +  +PK E + +  +LLG
Sbjct  81    ITEPHIYSWIKLYGTNFLMWHGSQAELVVAEPKLIKEIMNNNRS-FPKREPREY-LKLLG  138

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFR  726
             +G+ +++GEKW + RKLA N FH E+L+ M+P MI S + M+E WR++EGKEI+A+ E +
Sbjct  139   NGLVTTRGEKWLKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIK  198

Query  727   LLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKL  906
             +LTSE+ISRTAFGS YLEG+NIF ML K+  + +K    +  PG+ +++K ND++ES+KL
Sbjct  199   VLTSEIISRTAFGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKL  258

Query  907   EEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             E+ +R+ II+++KKRE    TGE +  S  +D L  L+ A H  +   +I ++ ++DECK
Sbjct  259   EQDIRDSIIKVVKKRESNVLTGEAE--SYGNDLLGILMRAYHSADETQKISLDDLIDECK  316

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AG +TT SLL W   LLA H DWQ++ARKEV+E+ GQ+NP+   I+RLKI+ MI+ 
Sbjct  317   TFYVAGTDTTASLLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIIN  376

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             ETLRLYPP     R+V KK V LG++ +P N+ + I  +A+ HDP+IWG+D H +KPERF
Sbjct  377   ETLRLYPPFVVFVREV-KKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERF  435

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             A+GV KAT+N+  AFLPFG GPRTC+G NF + EAKI LSMIL+RY   LS +YVHSPV 
Sbjct  436   AQGVPKATSNNMAAFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVP  495

Query  1624  LFMLRPKDGVQVIL  1665
                L P+ G+QV+L
Sbjct  496   RITLCPQHGIQVML  509



>gb|KHG27490.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   531 bits (1367),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 255/501 (51%), Positives = 348/501 (69%), Gaps = 4/501 (1%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL  +A         W P+ IQ++++SQGI+GP YRF+HGN KE+++ R+   SKPM  
Sbjct  13    CSLFFVALVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGNNKEVAKMRQEALSKPMA-  71

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L HD+FPR+ PHIY+W   YG N+L W G + ELV++E EL+KE+L++ +  +PK +  
Sbjct  72    -LGHDIFPRMQPHIYTWINKYGKNYLSWDGVRAELVISEPELIKEVLNNSEKAFPKRKPT  130

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              F  +L+ +G+ S +GEKW + RKL N+ FHGESL+ M PA+I S ETM+E W+ + GKE
Sbjct  131   VFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVIASVETMLEKWKGYVGKE  190

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE FEEFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  +  +N    R P +S++ K  
Sbjct  191   IELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHRNLFKTRIPWISKLWKPA  250

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L   ++  ++++IKKRE      E   S  +DFL  L+ A H  +  N + + 
Sbjct  251   DILESEELSNEIQGCVMKMIKKREDRVVNGE-ADSFDNDFLGLLVNAYHDLDDKNMLSLG  309

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFY AG +T  SLL W   LLA H DWQE+AR+EV+++FG +NP P  I +LK
Sbjct  310   DLVDECKTFYLAGQDTVNSLLTWTVFLLAIHGDWQEKARREVIDIFGNQNPHPESIVKLK  369

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IM MI+ ET RLY P   + RK  ++ V +G + LP NI LYI+ +  QHDP++WG DVH
Sbjct  370   IMTMIINETSRLYGPANGLMRKTGRE-VQIGKLVLPANIDLYIANVVPQHDPQLWGDDVH  428

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEG+ KATN +  AF PFG GPR+C+G++FA  E KI LSMILQRY+++LS +
Sbjct  429   LFKPERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFATTEIKIALSMILQRYTISLSPA  488

Query  1603  YVHSPVQLFMLRPKDGVQVIL  1665
             YVHSP+ +  ++P+ G+QVIL
Sbjct  489   YVHSPISVITIQPQHGIQVIL  509



>ref|XP_008446466.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=515

 Score =   530 bits (1366),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 245/506 (48%), Positives = 354/506 (70%), Gaps = 4/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+S  L+     L  KLWW P+ IQ+ M SQGI+GPSY+F+ GNT+++   R    + PM
Sbjct  12    FLSGCLLFVVFKLFVKLWWTPMRIQRFMRSQGIQGPSYKFIQGNTRDVYMKRMQAMATPM  71

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               DLSH++ PR++P ++SW  LYG N+L W G   +L++T+ E++KE+L DR+  +PK +
Sbjct  72    --DLSHNILPRVMPSVHSWLNLYGRNYLQWAGVDAQLMITDPEMIKEVLHDRQKSFPKAK  129

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             L+G   R+ G+G+ +++G++W   R++AN  FHG+SL+ M+P MIE  E M+E W+ +EG
Sbjct  130   LKGHIDRIFGNGLATAEGQRWVNSRRIANFAFHGDSLKNMIPTMIECGEKMIEGWKNYEG  189

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KE++AF+EF++ T +VIS TAFGS+Y +GK IF ML +L  L+ +N   ++ P +S+I+K
Sbjct  190   KELDAFKEFKVFTLDVISHTAFGSSYQQGKKIFHMLQELCDLSIRNGYKIKLPIISKILK  249

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + D+ E E+LE+ +++  ++IIK+RE+ K   ++ S   +DFL  L++A +       I 
Sbjct  250   SKDDYEGERLEKRLKDCFMEIIKEREE-KLRNDEASDYGNDFLGLLIKAKNDPETSQSIS  308

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             +E +VDECKTFYFAGHETT  LL W  LLLA H++WQE+AR EV +VFG  +PT  G+ +
Sbjct  309   MEDIVDECKTFYFAGHETTNVLLAWTMLLLALHKEWQEKARNEVFDVFGHNHPTLEGLPK  368

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M MI+ E LRLYPP   I R+VEK+ V LGN+ +P    L I  +A+ HD + WG D
Sbjct  369   LKAMAMIINECLRLYPPAMTIARRVEKE-VRLGNLVVPTTTLLAIPTVAVHHDTKFWGDD  427

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H+FKPERF+EG+ KAT  +  A+LPFG GPR C+G+NFA  EAKI +SMILQRYS +LS
Sbjct  428   AHEFKPERFSEGIGKATEKNSAAYLPFGLGPRNCVGMNFATNEAKIAMSMILQRYSFSLS  487

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +Y H P QL  + P++GVQVIL+ I
Sbjct  488   PAYAHMPAQLLTICPQNGVQVILNSI  513



>ref|XP_004295655.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=478

 Score =   527 bits (1357),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 250/481 (52%), Positives = 342/481 (71%), Gaps = 5/481 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M  QGIKGPSYR +HGN KEI   ++   S+     LSHD+FP + P  +SW + YG  F
Sbjct  1     MGLQGIKGPSYRLVHGNAKEILNMKKEAMSR--SKGLSHDIFPVLQPQYHSWLKKYGKIF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L WLG + +LVV E EL KEIL ++   Y ++++ GF ++LLG+GIG+S+GE+W ++RKL
Sbjct  59    LQWLGTEAQLVVMEPELCKEILINKDEVYLQLKMNGFGKKLLGNGIGNSEGERWLKLRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN+  HGE+L+ M+P +I SAE M++ W+  EGKEIE ++EFRL T+EVISRTAFGS+YL
Sbjct  119   ANHALHGETLKNMVPEIIASAEKMLQRWQNSEGKEIELYQEFRLFTAEVISRTAFGSSYL  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGKNIF+ L K+  L  KN   +R P +  + K +DE+E+EKLE+ +R  I++I+KKRE 
Sbjct  179   EGKNIFDRLTKISLLLFKNSYKIRLPVIRELFKTSDEVEAEKLEKEIRETILEIVKKREN  238

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDN--QICIEAMVDECKTFYFAGHETTTSLLGW  1131
                 ++ + +   DFL  LL+A+H  + ++  +I I+ ++D+CK  YFAG ETT   L W
Sbjct  239   KAVAQQDEHNFGGDFLGLLLKAHHHVDSNDRYRITIDDIIDQCKALYFAGQETTNGSLAW  298

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
                LLA H+DWQE ARKEV+++FG++NP   GI+RLK MNMI+ E+LRLYPPV  + ++ 
Sbjct  299   TVFLLALHQDWQEEARKEVLQLFGKQNPNIDGISRLKTMNMIINESLRLYPPVIQLVKRT  358

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
             E++ V LG   +P NI L I  +AL HDPEIWG+D   F+PERF+EG+ KAT  +  AF+
Sbjct  359   ERE-VRLGKFIVPANIDLVIPIVALHHDPEIWGQDAKLFRPERFSEGIAKATKKNMAAFI  417

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHR  1671
             PFG GPR C+G NFA  E KI LSMILQRY+  LS+ YVHSP+Q+  LRP +GVQVILH 
Sbjct  418   PFGMGPRICVGFNFATIETKIALSMILQRYAFTLSTGYVHSPLQVLTLRPHNGVQVILHS  477

Query  1672  I  1674
             +
Sbjct  478   L  478



>gb|KHG07569.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   527 bits (1357),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 254/501 (51%), Positives = 347/501 (69%), Gaps = 4/501 (1%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL  +A         W P+ IQ++++SQGI+GP YRF+HGN KE+++ R+   SKPM  
Sbjct  13    CSLFFVALVKFLYDYLWRPLRIQQMLNSQGIRGPPYRFIHGNNKEVAKMRQEALSKPMA-  71

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L HD+FPR+ PHIY+W   YG N+L W G + ELV++E EL+KE+L++ +  +PK +  
Sbjct  72    -LGHDIFPRMQPHIYTWINKYGKNYLSWDGVRAELVISEPELIKEVLNNSEKAFPKRKPT  130

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              F  +L+ +G+ S +GEKW + RKL N+ FHGESL+ M PA+I S ETM+E W+ + GKE
Sbjct  131   VFISKLVANGLFSVEGEKWVKQRKLGNHAFHGESLKNMTPAVIASVETMLEKWKGYVGKE  190

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE FEEFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  +  +N    R P +S++ K  
Sbjct  191   IELFEEFRLLTSEVISRTAFGSSYLEGQKIFDMLSKLAIIMHRNLFKTRIPWISKLWKPA  250

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L   ++  ++++IKKRE      E   S  +DFL  L+ A H  +  N + + 
Sbjct  251   DILESEELSNEIQGCVMKMIKKREDRVVNGE-ADSFGNDFLGLLVNAYHDLDDKNMLSLG  309

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFY AG +T  SLL W   LLA H DWQE+AR+EV+++FG +NP P GI +LK
Sbjct  310   DLVDECKTFYLAGQDTANSLLAWTVFLLAIHGDWQEKARREVIDIFGNQNPNPEGIVKLK  369

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IM MI+ ETLRLY P   + RKV ++ V +G + L  NI L+I+ +  QHDP++WG DVH
Sbjct  370   IMTMIINETLRLYSPANGLMRKVGRE-VQIGKLVLHANIDLFIASVVPQHDPQLWGDDVH  428

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FK ERFAEG+ KATN +  AF PFG GPR+C+G++FA  E KI LSM LQRY ++LS +
Sbjct  429   LFKSERFAEGIAKATNYNAAAFCPFGIGPRSCVGMSFAAIEIKIALSMTLQRYMISLSPA  488

Query  1603  YVHSPVQLFMLRPKDGVQVIL  1665
             YVHSP+ +  ++P+ G+QVIL
Sbjct  489   YVHSPISVITVQPQHGIQVIL  509



>ref|XP_011070904.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=511

 Score =   526 bits (1355),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 263/489 (54%), Positives = 343/489 (70%), Gaps = 2/489 (0%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWWAP+H Q +M SQGIKGP Y F H NTKEI + +   +     D   HD+FPR  P+
Sbjct  23    KLWWAPLHFQSIMESQGIKGPCYNFFHNNTKEIIKIKNQTSYNSPIDLPDHDIFPRFQPY  82

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
              YS  +LYG NFL W G QP++VVTE EL+KEIL +R G YPK + +G+ ++LLGDGI  
Sbjct  83    WYSCMKLYGNNFLVWNGTQPQVVVTEPELIKEILVNRNGAYPKTKREGYLKKLLGDGITV  142

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW ++RKLAN+ FHGE L+ M+PAM+ S +TM+E WR +EGKEIE   +FR+L+SE
Sbjct  143   AEGEKWLKLRKLANHAFHGECLKDMVPAMVASVQTMLEKWRHYEGKEIEVCGDFRILSSE  202

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAFGS+Y+EG  IF ML KL  L S+N   + F G+ + ++   + E++K+E+ + 
Sbjct  203   VISRTAFGSSYVEGIKIFNMLGKLSALISENANKMNFLGLVKFVRTKADSEADKIEQLLH  262

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
               I++I++KR Q +    +  S  SDFL  LL+A H+ +   QI    ++DECKTFYFAG
Sbjct  263   ESIMEIVRKR-QDEVITVRADSFGSDFLGSLLKARHEGSEKKQISAAEIIDECKTFYFAG  321

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
               TT SLL W+ LLLA H DWQE+AR EV ++FG+ENP   GIARLK +N+I+ ETLRLY
Sbjct  322   QLTTHSLLSWSVLLLAIHPDWQEKARNEVFQLFGRENPNSEGIARLKTVNLIIHETLRLY  381

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
              PV  I R+ + + V LG    P N+ L I PLAL  DP+IWG+D H FKPERFAEG+ K
Sbjct  382   SPVTLITRRTQGQ-VKLGKFKFPANVELAIPPLALHRDPDIWGQDAHLFKPERFAEGLAK  440

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             AT  +P+AFL FG+GPR C GLNFA  EAKI LSMILQRY   LS +YVHSP     ++P
Sbjct  441   ATKGNPMAFLAFGFGPRICPGLNFASHEAKIALSMILQRYKFTLSPNYVHSPFIALTVQP  500

Query  1642  KDGVQVILH  1668
             + GVQ++L 
Sbjct  501   QHGVQILLQ  509



>ref|XP_010091620.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44886.1| Cytochrome P450 734A1 [Morus notabilis]
Length=475

 Score =   524 bits (1350),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 248/477 (52%), Positives = 342/477 (72%), Gaps = 4/477 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M+SQGI+GPSYRF+ GN KE+   ++   SKPM     H++F ++ P+   W ++YG N+
Sbjct  1     MASQGIRGPSYRFIQGNAKEMWNMKKEAMSKPMSLSQGHNIFHKLQPNQEYWAKIYGKNY  60

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L WLG QP+LV+TE EL+KE+L+++   Y K   Q F ++L GDG+  ++GEKW ++RKL
Sbjct  61    LQWLGTQPQLVITELELIKEVLNNKDRVYLKSGAQRFVKKLFGDGLAVTEGEKWDKLRKL  120

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN+ FH E+L+GM+PAM+ S E M+E W+ +EGKEIE FEEFR+LTS+VIS+TAFGS+YL
Sbjct  121   ANHFFHAENLKGMVPAMMSSVEMMLERWKNYEGKEIEVFEEFRVLTSDVISKTAFGSSYL  180

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGK IF+ML +L  + +  FL ++ P +S+  K  DE+ES+ L+  + N I++++KKRE 
Sbjct  181   EGKKIFDMLRRLTFIVTMGFLKIKLPIISKFTK--DEIESDMLDREISNSIMEMVKKRED  238

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWAT  1137
               T  ++  +  SD L  L++A+H  +   QI +E ++ E ++FYFAG ETT SLL W  
Sbjct  239   KVTSGDE-DNYGSDLLGGLIKAHHDADEMKQISMEDLITEVRSFYFAGQETTNSLLAWTV  297

Query  1138  LLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEK  1317
             LLLA H DWQE ARKE + +FGQ NP   GIARLK+++ I+ E+ RLYPPV    R   K
Sbjct  298   LLLAIHTDWQEEARKEAVNLFGQHNPIADGIARLKVISQIINESTRLYPPVVAFSRHAAK  357

Query  1318  KNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPF  1497
             + V LGN+ LP  + L IS L L  DP+IWG+DV++FKPERF+EGVVKATNN+  A+ PF
Sbjct  358   E-VRLGNLNLPAKMELVISNLPLHLDPQIWGEDVYEFKPERFSEGVVKATNNNSAAYFPF  416

Query  1498  GYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             G GPRTC+G+NFA+ EAKI LSMIL+RYS  LS +YVHSP     L+P+ G+QV+L 
Sbjct  417   GMGPRTCVGMNFALTEAKIALSMILRRYSFTLSPAYVHSPYAFITLQPQHGIQVVLQ  473



>gb|KHG21314.1| Secologanin synthase [Gossypium arboreum]
Length=518

 Score =   525 bits (1353),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 258/499 (52%), Positives = 349/499 (70%), Gaps = 5/499 (1%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
              LV    +L + LW  P+ IQ +M+SQGIKGP YRF+HGN KE+++ R+   +K +   L
Sbjct  19    FLVALTKFLYDYLW-VPLRIQHMMNSQGIKGPPYRFIHGNNKEVTKMRKEALNKAV--GL  75

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             + D+FPR+ PHIYSW   YG NF+YW G Q E+V++E EL+KEI+++ +  + K +L   
Sbjct  76    TDDLFPRLQPHIYSWINTYGKNFVYWNGVQAEVVISEPELIKEIMTNSEKIFQKRKLTDV  135

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
               +LLG+G+   +GEKWA+ RKLAN+ FHGESL+ M PAMI S ETM+E W+  EGKEIE
Sbjct  136   GAKLLGNGLVFIEGEKWAKHRKLANHAFHGESLKNMTPAMIVSVETMLERWKGQEGKEIE  195

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              + EFRLLTSEVISRTAFGSNYLEG+ IF ML KL  L S+N    + P ++++ K+ + 
Sbjct  196   VYNEFRLLTSEVISRTAFGSNYLEGERIFAMLNKLTILVSQNISKTKIPFINKLWKSAEM  255

Query  889   LESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAM  1068
             LESEKLE+G+++ ++++IKKRE  K    +  S  +DFL  L+ A H  +  N++ ++ +
Sbjct  256   LESEKLEKGIQDCVMEMIKKRED-KVVSGEADSFGNDFLGLLVNAYHDLDDKNRVALKDL  314

Query  1069  VDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
             V ECKT YFAG ET  SLL W  L LA H DWQE+AR+EV+++FG +NP   GIA+LKIM
Sbjct  315   VGECKTIYFAGQETVNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEGIAKLKIM  374

Query  1249  NMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
              MI+ ETLRLY P   + R V ++ V LG + LP NI +    + L  DP +WG DVH F
Sbjct  375   TMIINETLRLYGPSNGLPRTVARE-VQLGKLVLPANIDILSLNIGLHRDPHLWGDDVHHF  433

Query  1429  KPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYV  1608
             KPERFAEG+ KATN    AF PFG GPR+C+G+  A  E KI LSMILQRY++ +S +YV
Sbjct  434   KPERFAEGIAKATNYTAAAFFPFGLGPRSCVGMTLATIETKIALSMILQRYTITISPTYV  493

Query  1609  HSPVQLFMLRPKDGVQVIL  1665
             HSP+ +  +RP+ G+Q+IL
Sbjct  494   HSPMPILTIRPRHGIQIIL  512



>ref|XP_008352941.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 264/495 (53%), Positives = 352/495 (71%), Gaps = 7/495 (1%)
 Frame = +1

Query  199   EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILP  378
             +KLWW P  IQK M+SQGIKGPSY+ ++GN KEI+   +   S+PM    SHD+   +LP
Sbjct  26    DKLWWTPTRIQKRMASQGIKGPSYKLIYGNGKEITSMTKETMSRPMSTS-SHDISSYVLP  84

Query  379   HIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIG  558
             H + W  +YG +FL W GPQP L + E E  K ILS++     K +   F ++L GDG+ 
Sbjct  85    HDHLWTNIYGKSFLQWYGPQPHLTIGEPESCKAILSNKDRICRKPKPPYFVKKLFGDGLL  144

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
              ++GEKW ++RKLA + F+GESL+ M+P MI S E M+E W+ HEG+EIE  EEF+LLTS
Sbjct  145   MAEGEKWVKLRKLATHAFNGESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKLLTS  204

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+YLEGKNIFEML +L +L  KN    R PG+S+  K +DE++S+KLE+G+
Sbjct  205   EVISRTAFGSSYLEGKNIFEMLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLEKGI  264

Query  919   RNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             R+ I  +  KRE +  TGE       SD+L  LL+A+H   G+ +I ++ +VDECKTFY 
Sbjct  265   RDSIAGMASKREKKAMTGEGDGFG--SDYLGLLLKAHHNAIGNERISMDELVDECKTFYL  322

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI--MNMILEET  1269
             AG ET TS+L W   LLA H DWQE ARKEV+++FG++ P P GIA+LK+  M+MI+ E+
Sbjct  323   AGQETATSMLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGIAKLKLKTMSMIVNES  382

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPPV ++ R+ EK+ V L  + +P N+ L +S LA  H+PE WG+D   FKPERF++
Sbjct  383   LRLYPPVIHLIRETEKE-VRLEELNVPANVQLRVSNLAFHHEPEFWGQDAQLFKPERFSK  441

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV KATNN+ +AF+PFG GPRTC+G+NFA+ EAKI LSMILQRYS  LS  Y+HSP+   
Sbjct  442   GVSKATNNNMVAFIPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPINGL  501

Query  1630  MLRPKDGVQVILHRI  1674
              + P+ GVQVILH +
Sbjct  502   AVSPQHGVQVILHSL  516



>ref|XP_008339765.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=516

 Score =   525 bits (1351),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 264/495 (53%), Positives = 352/495 (71%), Gaps = 7/495 (1%)
 Frame = +1

Query  199   EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILP  378
             +KLWW P  IQK M+SQGIKGPSY+ ++GN KEI+   +   S+PM    SHD+   +LP
Sbjct  26    DKLWWTPTRIQKRMASQGIKGPSYKLIYGNGKEITSMTKETMSRPMSTS-SHDISSYVLP  84

Query  379   HIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIG  558
             H + W  +YG +FL W GPQP L + E E  K ILS++     K +   F ++L GDG+ 
Sbjct  85    HDHLWTNIYGKSFLQWYGPQPHLTIGEPESCKAILSNKDRICRKPKPPYFVKKLFGDGLL  144

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
              ++GEKW ++RKLA + F+GESL+ M+P MI S E M+E W+ HEG+EIE  EEF+LLTS
Sbjct  145   MAEGEKWVKLRKLATHAFNGESLKSMIPEMITSTEVMLERWKNHEGEEIEVNEEFKLLTS  204

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+YLEGKNIFEML +L +L  KN    R PG+S+  K +DE++S+KLE+G+
Sbjct  205   EVISRTAFGSSYLEGKNIFEMLTELASLLFKNTYTFRLPGISKFYKPSDEIKSDKLEKGI  264

Query  919   RNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             R+ I  +  KRE +  TGE       SD+L  LL+A+H   G+ +I ++ +VDECKTFY 
Sbjct  265   RDSIAGMASKREKKAMTGEGDGFG--SDYLGLLLKAHHNAIGNERISMDELVDECKTFYL  322

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI--MNMILEET  1269
             AG ET TS+L W   LLA H DWQE ARKEV+++FG++ P P GIA+LK+  M+MI+ E+
Sbjct  323   AGQETATSMLSWTVFLLALHTDWQEEARKEVLQLFGKQTPNPDGIAKLKLKTMSMIVNES  382

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPPV ++ R+ EK+ V L  + +P N+ L +S LA  H+PE WG+D   FKPERF++
Sbjct  383   LRLYPPVIHLIRETEKE-VRLEELNVPANVQLRVSNLAFHHEPEFWGQDAQLFKPERFSK  441

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV KATNN+ +AF+PFG GPRTC+G+NFA+ EAKI LSMILQRYS  LS  Y+HSP+   
Sbjct  442   GVSKATNNNMVAFIPFGMGPRTCVGMNFAIIEAKIALSMILQRYSFXLSPXYMHSPINGL  501

Query  1630  MLRPKDGVQVILHRI  1674
              + P+ GVQVILH +
Sbjct  502   AVSPQHGVQVILHSL  516



>ref|XP_002512040.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50709.1| cytochrome P450, putative [Ricinus communis]
Length=514

 Score =   524 bits (1350),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 256/493 (52%), Positives = 351/493 (71%), Gaps = 5/493 (1%)
 Frame = +1

Query  199   EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHD-VFPRIL  375
             +K+WW P+  Q ++ SQGI+GP Y+  HGNTKEI       +S P E  LSH  + P +L
Sbjct  26    DKVWWTPIRTQSMLRSQGIRGPCYKIFHGNTKEIISMVNNASSNPAE--LSHQQLLPTVL  83

Query  376   PHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGI  555
             PHIYSW ++YG NFL W G +   VVTE +L+KEIL+ + G +PK E + + +++ GDG 
Sbjct  84    PHIYSWIKIYGNNFLTWHGRRAYFVVTEPDLIKEILNGKDGVFPKAEPEHYEQKIFGDGT  143

Query  556   GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLT  735
              +SKGEKW +MRKL+N+ FH ESL+G++P MI S E M+E W+ H+GKE+E F+EF  LT
Sbjct  144   ITSKGEKWVKMRKLSNHAFHAESLKGLIPVMIASVEIMLERWKYHDGKEVEVFQEFEHLT  203

Query  736   SEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEG  915
             SEVISRTAFGS+Y EGK+IF+ML +L  + SKN  N+R PG+  ++K  D++ES+KLE+ 
Sbjct  204   SEVISRTAFGSSYWEGKHIFDMLTRLIIILSKNKYNIRIPGIRNLVKTGDDIESDKLEKN  263

Query  916   VRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             + +  I +IK+RE+  T   Q     S FL  LL+A+H  N   +I ++ ++DECKTFY 
Sbjct  264   IHDSFINMIKRREEEAT-MGQADGFGSGFLGLLLKAHHDNNMAKKISVDDLIDECKTFYV  322

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETTTSL+ W   L A H DWQ +AR+EV+E+FG ++P   G+ RLKI++MI+ ETLR
Sbjct  323   AGRETTTSLITWILFLPAIHPDWQHKAREEVIEIFGSQHPRLDGLTRLKIVSMIINETLR  382

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LYPP    KR V+++ V LG + LP NI + I  LA+ H+P+IWG+DV+ FKPERFAEGV
Sbjct  383   LYPPAVIFKRYVQRQ-VRLGKLILPANIVMEIPILAVHHNPQIWGEDVNLFKPERFAEGV  441

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KAT N+  A+LPF  GPR C+G NFA+ E KI LS+ILQRY  +LS +YVHSP+ L  L
Sbjct  442   AKATKNNAAAYLPFSLGPRNCVGYNFAITETKIALSIILQRYRFSLSPNYVHSPIPLIGL  501

Query  1636  RPKDGVQVILHRI  1674
              P+ G+Q++LH++
Sbjct  502   CPQHGLQIMLHKL  514



>gb|KHG16899.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score =   524 bits (1349),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 257/488 (53%), Positives = 340/488 (70%), Gaps = 4/488 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ +M+SQGIKGP YRF+HGN+KE++   +   SK +   L+ D+FP++LPH Y+
Sbjct  25    WVPLRIQHMMNSQGIKGPPYRFIHGNSKEVARLEQEALSKRVA--LTDDIFPKVLPHFYT  82

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
                 YG NF+YW G +PELV++E EL+KE+L   +    + +L    R  LG+G+    G
Sbjct  83    SINRYGRNFVYWNGARPELVISEPELIKEVLQTSEKKIQEKKLSDIGREFLGNGLLFIAG  142

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKWA+ RKLAN+ FHGESL+ M PA+I S ETM+E W+  EG+EIE  +EFRLLTSEVIS
Sbjct  143   EKWAKHRKLANHAFHGESLKNMTPAIIASVETMLEKWKGQEGREIEVLQEFRLLTSEVIS  202

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAFGS+YLEG+ IF ML KL  + S+N    R P +S++ K+ D LESEKL + +++ +
Sbjct  203   RTAFGSSYLEGEKIFAMLQKLTIIMSRNLFKSRIPLISKLWKSADLLESEKLSKEIKDRV  262

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             ++I+KKRE  K    + +S RSDFL  LL A H  +  N++ +E +V ECKTFYFAG ET
Sbjct  263   LKIVKKRED-KVVNGEVNSFRSDFLGLLLNAYHDSDEKNRLSLEDLVAECKTFYFAGQET  321

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               SLL W  L LA H DWQE+AR+EV+++FG +NP   GIA+LKIM MI+ ETLRLY P 
Sbjct  322   VNSLLAWIVLHLAIHGDWQEKARREVIDIFGNQNPHLEGIAKLKIMTMIINETLRLYGPS  381

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               + R V ++ V LG + LP NI +    + L  DP IWG DVH FKPERFA+G+ KATN
Sbjct  382   NGLPRAVTRE-VQLGKLLLPANIDILPLNIGLHRDPHIWGDDVHHFKPERFAKGIAKATN  440

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
                 AF PFG GPR+C+G+ FA  E K+ LSMILQRY++ALS +YVHSP+ +  LRP+ G
Sbjct  441   YTTAAFFPFGLGPRSCVGMTFATIETKVALSMILQRYTIALSPAYVHSPIPILTLRPQHG  500

Query  1651  VQVILHRI  1674
             +QV L  I
Sbjct  501   IQVTLKPI  508



>gb|KHG14937.1| Cytochrome P450 protein [Gossypium arboreum]
Length=501

 Score =   523 bits (1348),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 254/485 (52%), Positives = 346/485 (71%), Gaps = 19/485 (4%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ++++SQGIKGP YRF+HGN +EI++ R+  +SKPM   L+HD+FP++ PHIYS
Sbjct  29    WIPLRIQRMLNSQGIKGPPYRFIHGNNREIAKMRQEASSKPMA--LTHDIFPKVQPHIYS  86

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
             W   YG N+LYW G + ELV++E ELVKEIL + +  +PK +   +  +LLG+G+ + +G
Sbjct  87    WINKYGRNYLYWNGVRAELVISEPELVKEILKNSEKTFPKRKPTIYLSKLLGNGLVTVEG  146

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKWA+ RKLAN VFHGESL+ M PA+I S ETM++ W+  EGKEIE F EFRLLTSEVIS
Sbjct  147   EKWAKQRKLANYVFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVIS  206

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAFGS+YLEG+ I+  L+                  S++ K  D LESE+L + +++ +
Sbjct  207   RTAFGSSYLEGEKIWLTLVF---------------SSSKLWKPADMLESEELAKEIQDCV  251

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             ++I+KKRE  K    +  S  +DFL  L+ A H  + +N++ +E +VDECKTFYFAG +T
Sbjct  252   MKIVKKRED-KVVNGEADSFGNDFLGLLVNAYHDSDKNNKLSMEDLVDECKTFYFAGQDT  310

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               +LL W  LLLA H DWQ++AR+EV+ +FG +NP P GIA+LK M MI+ ETLRLY   
Sbjct  311   VNALLAWTVLLLAIHGDWQDKARREVIGIFGNQNPQPEGIAKLKTMTMIINETLRLYSSS  370

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               + R+V  ++V +  + LP NI L I+   L HDP++WG+DVH FKP+RFAEG+ KATN
Sbjct  371   NGMLRRV-GRDVQMEKVVLPANIDLLIANAVLHHDPQLWGEDVHLFKPDRFAEGIAKATN  429

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
              +  AFLPFG GPRTC+G+ FA  E KIVLSMILQRY++ LS +YVHSP+ +  L+P+ G
Sbjct  430   YNAAAFLPFGLGPRTCVGMTFAATETKIVLSMILQRYAITLSPAYVHSPIPIISLKPQHG  489

Query  1651  VQVIL  1665
             +QVIL
Sbjct  490   IQVIL  494



>gb|KCW86459.1| hypothetical protein EUGRSUZ_B03127 [Eucalyptus grandis]
Length=495

 Score =   523 bits (1346),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 254/501 (51%), Positives = 347/501 (69%), Gaps = 25/501 (5%)
 Frame = +1

Query  169   LLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDL  348
             +++ + A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +L
Sbjct  16    IVLCSLAKLLHKLWWNPLRIQRVMAQQGITGPPYRFLHGSTKETIKMNMEARNTPM-SNL  74

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+FP+I P I +W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   + F
Sbjct  75    SHDIFPKIQPQINTWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNKDF  134

Query  529   SRRLLGDGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEI  705
             S++LLGDG+ S+ G EKWA+ RKLAN  FHG+SL+ M PAM+ S  TM+  W+  EGKEI
Sbjct  135   SKKLLGDGLASTPGGEKWAKKRKLANRAFHGKSLKNMAPAMVASVHTMLGKWKNREGKEI  194

Query  706   EAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNND  885
             E F EF++LTSEVISRTAFGS+++EG+NIF++                     ++ K  D
Sbjct  195   EVFGEFKVLTSEVISRTAFGSSFVEGRNIFQI---------------------KLWKTVD  233

Query  886   ELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEA  1065
             E+E+EKLE+G+RN I Q+IK+RE+ K    + +    DFL +L++A H  +   +I +  
Sbjct  234   EVEAEKLEKGIRNSIEQMIKRREK-KVMAGEVNGFGDDFLGQLVKALHDVDKSKKITVNN  292

Query  1066  MVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI  1245
             +VDECKTFY AG ET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK 
Sbjct  293   LVDECKTFYVAGQETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPDFDGLGKLKK  352

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             +NMI+ ETLRLYPP+  + RKV KK   LG + LP +I +++    L  DPEIWG+DVH+
Sbjct  353   INMIINETLRLYPPLVGLNRKVGKKQR-LGRLVLPADIQIFVPIPKLHSDPEIWGEDVHQ  411

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             FKPERF+EGV KATNN+ + F+PFG+GPR+C+G++F M EAK+ LSMILQR++  LS +Y
Sbjct  412   FKPERFSEGVAKATNNNAVVFIPFGFGPRSCVGMSFVMTEAKVALSMILQRFTFELSPAY  471

Query  1606  VHSPVQLFMLRPKDGVQVILH  1668
             +H PV  FM RP+ G+Q+I H
Sbjct  472   IHCPVYNFMNRPQHGLQIIFH  492



>ref|XP_010040838.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=584

 Score =   525 bits (1352),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 357/506 (71%), Gaps = 4/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              +S +L  A   + +K WW P+ +Q+ M+SQG++GP Y F HG+T+EI + R  +  +  
Sbjct  11    LLSIILFSALEKVLQKFWWNPIRVQRAMASQGVRGPPYGFAHGSTREIFKLREEVARQMN  70

Query  337   ED--DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             +   D+SHD+ P + PHIY W +++G  FLYW GP   L++++ ELVKE+L++R   Y K
Sbjct  71    KHTVDVSHDILPIVEPHIYKWSQMFGGIFLYWYGPAALLLISDTELVKEVLNNRDKTYVK  130

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
              +  G  ++LLGDG+ S+KGEKWAR R+LA+  FHGESL+ M+PAM++S   +++ W+  
Sbjct  131   PDFPGDIKKLLGDGLFSTKGEKWARQRRLAHLAFHGESLKCMIPAMVDSVHMLLKRWQNL  190

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             E + +E FEEF  +TS+VISRTAFGS+Y+EG+N+F+ML +L T+AS+N   +R PG+  I
Sbjct  191   EARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQMLGELTTIASRNIFKLRLPGVRNI  250

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ  1050
              K  DE++SE+LE+ +R+ +++II+KRE+ K    + +   +D L  LL+A H  +   +
Sbjct  251   WKTIDEIDSERLEKAIRDVVLEIIRKREE-KVNTGEMNDYGNDLLGSLLKAYHDPDESKR  309

Query  1051  ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGI  1230
               I+ ++DECKTFYFAG ETT S+L W   LLA H+DWQ+ ARKEV +VFG E+P   GI
Sbjct  310   TTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEARKEVTDVFGNEDPNHDGI  369

Query  1231  ARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWG  1410
              +LK + MI+ E+LRLYPPV  + RKV KK V LGN+ LP +I L I  LA+ HD  IWG
Sbjct  370   MKLKTVGMIINESLRLYPPVISLLRKV-KKQVTLGNLVLPADIVLDIPTLAIHHDRRIWG  428

Query  1411  KDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLA  1590
              DVH FKPERF+EG+ KATNN+  AFLPFG GPRTC+G+NFA  EAKI ++MILQRYS  
Sbjct  429   NDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRTCVGINFATNEAKIAIAMILQRYSFT  488

Query  1591  LSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LS  Y+H P  +  + P+ GV+VILH
Sbjct  489   LSPGYIHLPAHILTIHPQHGVKVILH  514



>gb|KHG03731.1| Secologanin synthase [Gossypium arboreum]
Length=513

 Score =   520 bits (1339),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 343/493 (70%), Gaps = 6/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K WW P+ IQK +S QGIKGP Y F+HGN K  S  R    SKPM   L+H++ PR++PH
Sbjct  25    KYWWTPLKIQKALSLQGIKGPPYEFIHGNNKASSRFRFEALSKPMAS-LTHNIVPRVIPH  83

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK-IELQGFSRRLLGDGIG  558
             I+SW   YG  +L W G Q +LV++E E++KEIL    G +PK  +   F  ++LGDG+ 
Sbjct  84    IHSWINTYGNIYLTWEGNQAQLVISEPEIIKEILKSNDGSFPKRKDDSSFIYKILGDGLV  143

Query  559   SSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +++G KW R RKLAN+ FHGESL+ M PA+I S ETM+E W+  EG+E+E FEEFRLLT+
Sbjct  144   ATEGAKWVRQRKLANHAFHGESLKNMNPAVIASVETMLEKWKGREGEEMEVFEEFRLLTA  203

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGSNYLEGK IFEML +L  L   N+   + PG+S I K  DE+ESEKL +G+
Sbjct  204   EVISRTAFGSNYLEGKKIFEMLTRLSILVINNYYKTKIPGISMIWKTADEIESEKLAKGI  263

Query  919   RNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
              + +++++K+RE+    GE       +DFL  L+ A+   +  N+  +E +VDECKTFYF
Sbjct  264   HDRVMEMVKRREKNVSVGESDNFG--NDFLGLLINAHRDSDEKNRFSVEDLVDECKTFYF  321

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETT SLL W  L+LA H +WQE+ R+EV E FG  NP   GI++LKIMNM++ ETLR
Sbjct  322   AGQETTNSLLAWTVLVLAIHTEWQEKTRREVFEAFGDRNPNSEGISKLKIMNMVINETLR  381

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LY PV  + RKV K+   LG + LP N+ + I  +AL HDP++WG DVH FKPERF EG+
Sbjct  382   LYSPVSAVIRKVGKE-AQLGRLVLPANMEVMIPIMALHHDPQLWGDDVHLFKPERFTEGI  440

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
               AT  +  AF+PF  GPR+C+G++FA  E KI LSMILQRY+  LS +YVH+P  +  L
Sbjct  441   ASATKYNSAAFIPFSMGPRSCVGMSFATTETKIALSMILQRYAFTLSPAYVHAPFPIITL  500

Query  1636  RPKDGVQVILHRI  1674
             +P+ G+QV+L+R+
Sbjct  501   QPQHGIQVMLNRL  513



>ref|XP_009356544.1| PREDICTED: uncharacterized protein LOC103947365 [Pyrus x bretschneideri]
Length=1141

 Score =   540 bits (1392),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 268/493 (54%), Positives = 357/493 (72%), Gaps = 6/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P+ +Q  M+SQGIKGPSYRF+HGN KE++  R+   S+P    LSHDVF  +LP 
Sbjct  653   KLWWIPIRVQNRMTSQGIKGPSYRFIHGNNKEVASMRKEAMSRP--KSLSHDVFSIVLPL  710

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             ++SW ++YG NFLYW G QP LVVTE EL KEIL ++ G Y K +L G  ++LLGDG+ +
Sbjct  711   MHSWTKIYGKNFLYWYGHQPRLVVTETELCKEILMNKNGAYQKSKLLGGVKKLLGDGLAT  770

Query  562   SK-GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +  GEKW+++RKLAN+ F+GESL+ M   MI S ETM+E W+ HEG+E+E FEEFRLLTS
Sbjct  771   TNDGEKWSKLRKLANHAFNGESLKSMHSEMIASTETMLERWKIHEGEEVEVFEEFRLLTS  830

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             EVISRTAFGS+Y+EGKNIF+ML+K   L   +     FPG+S+ +K++ E+E +KLE+G+
Sbjct  831   EVISRTAFGSSYVEGKNIFDMLLKSSALTFSSSFKPGFPGISKFVKSSSEIEFQKLEKGI  890

Query  919   RNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             R+ +++I+++RE+     E  +   SDFL +LL A+H  N + +I +E +VDECKTFY A
Sbjct  891   RDSLMEIVRRRERNPINREA-NKFGSDFLGQLLRAHHDTNDNQRISMEDLVDECKTFYLA  949

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRL  1278
             GHE+T ++L W   LLA H +WQE+ARKEV + FG+  P P GI+ LK M MI+ E+LRL
Sbjct  950   GHESTGTMLAWTVFLLALHPEWQEKARKEVQQFFGKRTPDPNGISNLKTMTMIVNESLRL  1009

Query  1279  YPPV-PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             YPPV   + RKV+K+   LG + LP  +HL I    L +DP++WG+DV  FKPERF+EGV
Sbjct  1010  YPPVLSVVNRKVDKE-TRLGRLVLPAKLHLVIPISPLHYDPQLWGQDVQLFKPERFSEGV  1068

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFML  1635
              KATN++  AFLPFG GPR C G NFA  EAKI LSMILQRY+  LS +Y HSP     +
Sbjct  1069  AKATNDNIAAFLPFGMGPRVCAGSNFATTEAKIALSMILQRYTFXLSPTYTHSPSAFLTV  1128

Query  1636  RPKDGVQVILHRI  1674
             RP+ GVQ++LH +
Sbjct  1129  RPQHGVQIMLHAL  1141


 Score =   534 bits (1375),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 259/500 (52%), Positives = 348/500 (70%), Gaps = 16/500 (3%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQK M+ QGIKGP YR +HGNTKEI   ++     P    LSHD+   + PH
Sbjct  25    KLWWTPTRIQKFMALQGIKGPPYRLVHGNTKEILRMQKQNLGSP--KKLSHDILCAVQPH  82

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +++W  +YG  +L W   Q +LV+ E EL KEIL+++   YPK E   F ++++GDG+ +
Sbjct  83    VHTWSNIYGKIYLQWHNSQAQLVIMEPELCKEILNNKDRAYPKKEFGNFEKKIVGDGMAT  142

Query  562   SKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             +    KW ++RK+AN+ FHGESL+ M+P M+   ETM+E W+ HEGKEIE FEE RL TS
Sbjct  143   ALNVAKWMKLRKIANHAFHGESLKSMIPTMVACTETMLERWKNHEGKEIEVFEELRLFTS  202

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGM-SRIMKNNDELESEKLEEG  915
             EVI++TAFGSN+ EG+NIFEML+KL  +A KN   +R PGM S++ K +DE E+E++E+ 
Sbjct  203   EVIAKTAFGSNHGEGQNIFEMLMKLFFIALKNIFTIRPPGMMSKLYKTSDEAEAERIEKR  262

Query  916   VRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYF  1095
             +   + +IIK+RE+  T         SD+L  LL+A+H  N   +I ++ M+DECKTFYF
Sbjct  263   MHKSLFEIIKRREEKATSGNN-DGFGSDYLGLLLKAHHDANEKERISVDDMIDECKTFYF  321

Query  1096  AGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLR  1275
             AG ETT   L W   LLA H DWQE ARKEV+E+FG++NP+P G+A+LK M+MI+ E+LR
Sbjct  322   AGQETTNIELAWIVFLLAVHTDWQEEARKEVLELFGKQNPSPEGVAKLKTMSMIINESLR  381

Query  1276  LYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGV  1455
             LYPP   I+RKV+++ V LGN  +P N+ L I  LA+ H+PE WG+D   FKPERFA GV
Sbjct  382   LYPPAVSIERKVDRE-VRLGNFIIPANVELVIPILAIHHEPEFWGQDAQLFKPERFARGV  440

Query  1456  VKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSS---------SYV  1608
              KATNN+   ++PFG GPRTC+G++FA+ E KI LSMILQRYS  LS          +YV
Sbjct  441   AKATNNNIATYIPFGMGPRTCVGMDFAIIEVKIALSMILQRYSFTLSXXXXXXXLSPAYV  500

Query  1609  HSPVQLFMLRPKDGVQVILH  1668
             HS V+ F+LRP+ GVQ+ILH
Sbjct  501   HSHVR-FILRPQHGVQIILH  519



>gb|KHG08051.1| Cytochrome P450 protein [Gossypium arboreum]
 gb|KHG14695.1| Cytochrome P450 protein [Gossypium arboreum]
Length=494

 Score =   519 bits (1337),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/491 (51%), Positives = 346/491 (70%), Gaps = 29/491 (6%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             + WW P  IQ +M+SQGI+GP Y+F+HGN KE +  RR   SKPM   L+H +FPR++PH
Sbjct  29    RYWWIPYRIQLIMNSQGIRGPPYKFIHGNNKETAAMRREAFSKPMA--LTHAIFPRVMPH  86

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             +YSW   YG ++L W G +P+LV+T+ E+VKE+L + +  +PK +   F  ++LG+G+ +
Sbjct  87    VYSWINKYGKSYLSWNGFRPQLVITDPEIVKEVLRNSEKAFPKGKPTNFFEKILGEGLVT  146

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++ EKWAR RKLAN  FHGESL+ M+PA++ S ETM+E W+  EGKE+E F+EF+LLTSE
Sbjct  147   TESEKWARQRKLANYAFHGESLKNMIPAVVVSVETMLEKWKGREGKEMEVFQEFKLLTSE  206

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             VISRTAF S+YLEG+ IFEML KL  +AS+N    R P +SR  K++DE+ES+KL + + 
Sbjct  207   VISRTAFSSSYLEGEKIFEMLTKLSLIASRNVFKTRLPIISRFWKSSDEIESDKLAKMIH  266

Query  922   NGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAG  1101
             + +++I++KRE                          E  +N++ I+ +VDECKTFYFAG
Sbjct  267   DSVMKIVEKRE--------------------------EKVNNKLSIQDLVDECKTFYFAG  300

Query  1102  HETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLY  1281
              ETT SLL    LLLA H DWQE+AR+EV+E+ G+ NP   GIA+LK + MI+ ETLRLY
Sbjct  301   QETTNSLLARRILLLAVHTDWQEKARREVIEIIGKGNPNSEGIAKLKTIPMIINETLRLY  360

Query  1282  PPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVK  1461
             PP     RKVE++ V LG + LP ++ L I  +AL HDP++WG DVH FKPERFAEG+ K
Sbjct  361   PPATGTMRKVERE-VRLGKLVLPTDLELNIRIMALHHDPDLWGDDVHLFKPERFAEGISK  419

Query  1462  ATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRP  1641
             ATN +  AF PFG GPR+C+G++FA+ E KI LSMILQRY+  LS +YVHSP+ L  L+P
Sbjct  420   ATNYNAAAFFPFGLGPRSCVGMSFAITETKIALSMILQRYTFTLSPAYVHSPLPLITLKP  479

Query  1642  KDGVQVILHRI  1674
             + G+Q++ H +
Sbjct  480   QHGIQLLFHSL  490



>ref|XP_010052417.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
 gb|KCW76383.1| hypothetical protein EUGRSUZ_D00765 [Eucalyptus grandis]
Length=516

 Score =   518 bits (1335),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 348/504 (69%), Gaps = 4/504 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
              + SL +     +  K WW P+ IQ+ M+SQGIKGP+YRF +G+TKE+ + +R  TS+PM
Sbjct  15    LVLSLFLALIVKMLHKFWWRPIQIQRKMASQGIKGPAYRFFYGSTKEMLQMKREATSRPM  74

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                LSHD+FP + PH + W + YG NFL W GPQ  LV+++ ++VK++L+D    + KI 
Sbjct  75    S--LSHDIFPYVQPHFHKWTQTYGKNFLVWHGPQAFLVISDLDMVKKVLNDNGNTFSKIF  132

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             LQ   ++++GDG+ +S+GE+ A+ RKLAN  FHG+SL+ M+PAM++ A  M++ W + E 
Sbjct  133   LQDQVKKIVGDGLVTSEGEQLAKHRKLANLAFHGQSLKSMVPAMVDCAHMMIQRWSDREC  192

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
              EI  +EEF+L TS+ IS+TAFGS+Y+EGK +FE  +KL    ++    +R PG+S++ K
Sbjct  193   LEINVYEEFKLCTSDAISKTAFGSSYVEGKTVFENGVKLGLTMARASSQIRLPGISKLWK  252

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
                E+E+ KLE+G+R  +++IIK+R+Q K    +     +DFL  LL+A H  + + +I 
Sbjct  253   PTYEIEAAKLEKGLREALLKIIKRRQQ-KINSGEMEGYGNDFLGLLLKAMHDVDENKKIT  311

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
              + ++ +CKTFY AG+ET +SLL W   LLA H DWQ+ ARKEV+ V G  +P   GI +
Sbjct  312   FDNVIADCKTFYSAGYETLSSLLAWTAFLLAIHTDWQQEARKEVLNVLGDRDPDFNGIMK  371

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M MI+ E+LRLYPP   + RKV ++   LG++ LP  I ++I  L + HDP+IW  D
Sbjct  372   LKKMGMIINESLRLYPPAGGVTRKVTRQ-AKLGDLILPAGIMVHIPILKIHHDPQIWEDD  430

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
              H FKPERF+EGV KATNN+P  FLPFG G R C+GLNFA  EAKIVL+MILQRYS  LS
Sbjct  431   AHLFKPERFSEGVAKATNNNPAMFLPFGLGTRNCVGLNFATVEAKIVLAMILQRYSFTLS  490

Query  1597  SSYVHSPVQLFMLRPKDGVQVILH  1668
              +YVHSPV+L   RP+ GVQVIL+
Sbjct  491   PAYVHSPVELHNSRPQYGVQVILN  514



>gb|AJD25259.1| cytochrome P450 CYP749A37 [Salvia miltiorrhiza]
Length=508

 Score =   517 bits (1332),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 252/507 (50%), Positives = 352/507 (69%), Gaps = 9/507 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F S+LL         K+W AP  +Q    SQGI+GPSY+F HGNTKEIS  R     KPM
Sbjct  10    FCSTLLCFCFLRFLHKIWVAPTRLQAKWRSQGIRGPSYKFPHGNTKEISYMRSQFFDKPM  69

Query  337   E-DDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKI  513
             +     HD+FPR+ PH+Y+W ++YG NF+ W G + +L VTE EL KEIL +R   + K+
Sbjct  70    DISHYVHDLFPRLHPHVYAWTKVYGRNFICWHGSKCQLFVTEVELSKEILMNRDDAFRKM  129

Query  514   ELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             +++G+ R+LLG+ + +++G+KWA++RKLA+  FH ESL  M+P M  S   M++ W  ++
Sbjct  130   DMEGYLRKLLGEALTTNEGQKWAKVRKLADRSFHSESLNSMVPEMRSSVAKMLDKWGSYQ  189

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             G+EI+ F+EF +LT EVISRTAFGS+ ++GK+IFEM  KL  LA+KN   VR PG+S ++
Sbjct  190   GREIDVFKEFGMLTIEVISRTAFGSSCMDGKHIFEMKEKLAALAAKNLHKVRVPGISLVV  249

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             +++DE+E+E+LE+ +   I++ +++RE  + GE       SD+L +L+  +H+ +   +I
Sbjct  250   RSDDEVEAERLEQRINGSIMEKVRERE--REGELG-----SDYLGQLIRISHESDVKKRI  302

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
                 ++DE K  Y AG+ TTTSLLGW  +LLATH +WQ+RAR+EV E FG   P   GIA
Sbjct  303   TRHQLIDEVKAIYGAGNYTTTSLLGWCVVLLATHTEWQDRAREEVKETFGGNIPDFEGIA  362

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLKIMNMI+ E LRLYPP   + R V K+  + G + L PN +++IS LAL H+P IWG 
Sbjct  363   RLKIMNMIINECLRLYPPALSLTRTVAKETKI-GQLCLFPNTNIFISVLALHHNPRIWGD  421

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DVH FKPERFA GVV+AT+N+  AF+PFG GPRTC+GLNF+  EAKI LSMIL  Y   L
Sbjct  422   DVHLFKPERFAHGVVEATHNNAAAFIPFGIGPRTCVGLNFSTNEAKIALSMILHNYKFVL  481

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S +YVH P++  +L P++G+QVIL +I
Sbjct  482   SPNYVHCPIENIILVPRNGIQVILEKI  508



>ref|XP_002512039.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50708.1| cytochrome P450, putative [Ricinus communis]
Length=475

 Score =   516 bits (1328),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 356/481 (74%), Gaps = 7/481 (1%)
 Frame = +1

Query  235   LMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHD-VFPRILPHIYSWKRLYGA  411
             ++ SQGIKGPSYRF HGN+KEI       +S PM+  LS+D +F  +LPHIYSW +LYG 
Sbjct  1     MLRSQGIKGPSYRFYHGNSKEIINMEYNASSNPMK--LSNDQLFSTVLPHIYSWSKLYGK  58

Query  412   NFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMR  591
             NFLYW GP+  +VV E  ++K+I  +R   + K E + + ++LLGDGI +++GEKW ++R
Sbjct  59    NFLYWHGPRAHIVVQEPSMLKDIF-NRDEIFTKGEPEDYVKKLLGDGIVTARGEKWLKLR  117

Query  592   KLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSN  771
             K++N+ FH ESL+GM+P MI S E M+E W  H+GKEIEA++EF++LTSE+ISRTAFGS+
Sbjct  118   KISNHTFHAESLKGMIPGMIASVEMMLERWNNHDGKEIEAYKEFKILTSEIISRTAFGSS  177

Query  772   YLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             YLEG++IF+MLI+L  +  +N   VR PG+  ++K  D+ +S+KLE+G+ N  I +IKKR
Sbjct  178   YLEGQHIFDMLIRLAVIVIRNKYKVRIPGIRNLVKTRDDTDSDKLEQGIHNSFIYMIKKR  237

Query  952   EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGW  1131
             E   T  +Q  S R+DFL  LL+A H+ N   +I +  ++DECKTFY AGHETTTSLL W
Sbjct  238   EVAMT--DQSGSFRNDFLGSLLKAYHENNMAKKITVANLIDECKTFYVAGHETTTSLLTW  295

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
               LLLA H +WQE+AR+EV+E+FG +  +  G+  LKI++MI+ ETLRLYPPV  + RKV
Sbjct  296   ILLLLAIHPEWQEKAREEVLEIFGSQRLSSDGLTGLKIVSMIINETLRLYPPVVNVIRKV  355

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
             + + V LG + +P N  + I  +A+ H+P+IWG+DV+KFKPERFAEGV KATNN+  A+L
Sbjct  356   DGE-VKLGELIIPENTEIDIPVIAIHHNPQIWGEDVYKFKPERFAEGVAKATNNNITAYL  414

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHR  1671
             PFG GPR C+G +FA+ E KI LSMILQRY  +LS +YVHSP+ +  + P+ G+Q++LH+
Sbjct  415   PFGLGPRNCVGSSFAITETKIALSMILQRYRFSLSPTYVHSPIPILTMCPQYGLQMVLHK  474

Query  1672  I  1674
             +
Sbjct  475   L  475



>ref|XP_004295657.1| PREDICTED: cytochrome P450 734A1-like [Fragaria vesca subsp. 
vesca]
Length=477

 Score =   516 bits (1328),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 345/480 (72%), Gaps = 4/480 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M  QGI+GPSYR ++GN KEI   ++   SKP    LSHD+FP + P  +SW ++YG  F
Sbjct  1     MCLQGIRGPSYRLVNGNAKEILNMKKEAMSKP--KGLSHDIFPVVQPQYHSWLKIYGKIF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L WLG + +LVV E EL KEIL ++   Y + + +G  ++L+G+ +G+S+GE+W + RKL
Sbjct  59    LQWLGTEAQLVVMEPELCKEILINKDRVYMQKKQEGLGKKLIGNSLGTSEGEQWLKHRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN+  HG+SL+ M+P MI +AE M++ W+  EGKEIE ++EFRL T+EVISRTAFGS+YL
Sbjct  119   ANHALHGQSLKNMIPEMIATAEKMLQRWKNSEGKEIELYQEFRLFTAEVISRTAFGSSYL  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGKNIF+ML K+  L  KN   +R PG+ +  K +DE+E+EKLE+ +R  I++I+KKRE 
Sbjct  179   EGKNIFDMLTKICLLVFKNSYKIRLPGIRKFFKTSDEIEAEKLEKDLRYTILEIVKKREN  238

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDN-QICIEAMVDECKTFYFAGHETTTSLLGWA  1134
                 ++ +++   D L  LL+A+H+++ D  ++ I+ ++D+CK  YFAG ETT  LL W 
Sbjct  239   KVVVKQDENNFGDDLLGLLLKAHHEDSNDRYRVTIDDIIDQCKALYFAGQETTNGLLAWT  298

Query  1135  TLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVE  1314
              LLLA H+DWQE ARKEV+++FG++NP+  GI+RLK MNMI+ E+LRLYPPV  + +K E
Sbjct  299   VLLLALHQDWQEEARKEVLQLFGKQNPSSDGISRLKTMNMIINESLRLYPPVIELVKKAE  358

Query  1315  KKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLP  1494
             ++ V LG + +P NI L I  +AL HD +IWG+D   FKP+RF+EGV KAT ++  AF+P
Sbjct  359   RE-VRLGKLIVPANIDLVIPIVALYHDTQIWGQDAGLFKPDRFSEGVAKATKDNMAAFIP  417

Query  1495  FGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             FG GPRTC+GLNFA  E KI LSMILQRY+  LS  YVH P+    LRP++GVQV LH +
Sbjct  418   FGMGPRTCVGLNFATTETKIALSMILQRYAFTLSPGYVHLPLHFITLRPQNGVQVTLHSL  477



>gb|KHG20728.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=988

 Score =   533 bits (1373),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 253/475 (53%), Positives = 347/475 (73%), Gaps = 4/475 (1%)
 Frame = +1

Query  235   LMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGAN  414
             +++SQGIKGP YRF+HGN +EI++ R+  +SKPM   L+HD+FP++ PHIYSW   YG N
Sbjct  1     MLNSQGIKGPPYRFIHGNNREIAKMRQEASSKPMA--LTHDIFPKVQPHIYSWINKYGRN  58

Query  415   FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRK  594
             +LYW G + ELV++E ELVKEIL + +  +PK +   +  +LLG+G+ + +GEKWA+ RK
Sbjct  59    YLYWNGVRAELVISEPELVKEILKNSEKTFPKRKPTIYLSKLLGNGLVTVEGEKWAKQRK  118

Query  595   LANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNY  774
             LAN VFHGESL+ M PA+I S ETM++ W+  EGKEIE F EFRLLTSEVISRTAFGS+Y
Sbjct  119   LANYVFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSY  178

Query  775   LEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKRE  954
             LEG+ +F ML KL  + S+N  N R P ++++ K  D LESE+L + +++ +++I+KKRE
Sbjct  179   LEGEKVFAMLNKLSIIMSRNLYNTRIPLINKLWKPADMLESEELAKEIQDCVMKIVKKRE  238

Query  955   QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWA  1134
               K    +  S  +DFL  L+ A H  + +N++ +E +VDECKTFYFAG +T  +LL W 
Sbjct  239   D-KVVNGEADSFGNDFLGLLVNAYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWT  297

Query  1135  TLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVE  1314
              LLLA H DWQ++AR+EV+ +FG +NP P GIA+LK M MI+ ETLRLY     + R+V 
Sbjct  298   VLLLAIHGDWQDKARREVIGIFGNQNPQPEGIAKLKTMTMIINETLRLYSSSNGMLRRV-  356

Query  1315  KKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLP  1494
              ++V +  + LP NI L I+   L HDP++WG+DVH FKP+RFAEG+ KATN +  AFLP
Sbjct  357   GRDVQMEKVVLPANIDLLIANAVLHHDPQLWGEDVHLFKPDRFAEGIAKATNYNAAAFLP  416

Query  1495  FGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQV  1659
             FG GPRTC+G+ FA  E KI LSMILQRY++ LS +YVHSP+ +  L+P+ G+Q+
Sbjct  417   FGLGPRTCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQI  471


 Score =   516 bits (1328),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 253/504 (50%), Positives = 341/504 (68%), Gaps = 4/504 (1%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL ++A         W P+ +Q +M+SQGIKGP Y F++GN KE ++      SKPM  
Sbjct  485   CSLFLVALIKFLYDYLWIPLRLQHMMNSQGIKGPPYAFIYGNNKEATKTTNEALSKPMA-  543

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L HD+FPR+ PH+YS    YG N+L W G +PELV+TE ELV E+L      +PK +  
Sbjct  544   -LRHDIFPRVQPHVYSCINRYGRNYLAWDGKRPELVITEPELVNEVLKHSVTTFPKRKPT  602

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              F   + G+G+ ++ GEKW + RKLAN  FHGESL+ M PA+I S ETM+E W+ + GKE
Sbjct  603   FFLTGIFGNGLVTALGEKWVKQRKLANYAFHGESLKNMTPAVIASVETMLEKWKGYVGKE  662

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE + EFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  + S+NF   R P +++  K+ 
Sbjct  663   IEVYHEFRLLTSEVISRTAFGSSYLEGEKIFDMLNKLSIIRSRNFFETRIPLINKFWKSG  722

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L +G+++ +++I+KKRE  K    +  S  +DFL  L+ A H  + +N++  E
Sbjct  723   DVLESEELSKGIQDCVMKIVKKRED-KVVNGEVDSFGNDFLGLLVNAYHDSDENNRLSTE  781

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFYFAG +T  SL+ W   LLA H DWQE+AR+EV+E+FG + P    +++LK
Sbjct  782   DLVDECKTFYFAGQDTVNSLIAWIVFLLAIHGDWQEKARREVIEIFGNQIPNSEEMSKLK  841

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IM MI+ ETLRLY P   + R+ E  +V LG + LP N+ L +   A  HDP++WG DVH
Sbjct  842   IMTMIIYETLRLYGPSNGMMRRTE-SDVQLGKLILPANLDLLVIHSAPHHDPQLWGDDVH  900

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEG+ KATN +   F PFG GPR C+G NFA  E KIVLSMILQRY++ LS +
Sbjct  901   LFKPERFAEGIAKATNYNAGVFCPFGLGPRNCVGTNFATMETKIVLSMILQRYTIYLSPT  960

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVHSP+    ++P+ G+QVIL  +
Sbjct  961   YVHSPIPYITVQPQHGIQVILESL  984



>gb|KHG14401.1| Cytochrome P450 protein [Gossypium arboreum]
Length=682

 Score =   523 bits (1346),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 349/506 (69%), Gaps = 3/506 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F    +++A   L     W P+ +Q++MSSQGIKGP Y F+HGN KE ++      SKPM
Sbjct  176   FPCCFILIALVKLLYDYLWRPLRLQRMMSSQGIKGPPYTFIHGNNKEATKMTMEALSKPM  235

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                L HD+FPR+ PH+YS    YG  +L W G +PELV+TEAELV E+L      +PK +
Sbjct  236   -GALRHDIFPRVQPHVYSCVNRYGRIYLAWDGNRPELVITEAELVNEVLKHSATTFPKRK  294

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                F   L G+G+ ++ GEKW + RKLAN  FHGESL+ M PA+I S ETM+E W+ + G
Sbjct  295   PTFFLTGLFGNGLVTALGEKWVKQRKLANYAFHGESLKNMTPAVIASVETMLEKWKSYVG  354

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KE+E + EFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  + S+N    R P ++++ K
Sbjct  355   KEMEVYHEFRLLTSEVISRTAFGSSYLEGEKIFDMLSKLSIIRSRNLFETRIPLINKLWK  414

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + D L+SE+L +G+++ +++I+KKRE  K    +  S   DFL  L++A H  + +N++ 
Sbjct  415   SADMLKSEELSKGIQDCVMKIVKKRED-KVENREADSFGYDFLGLLVKAYHDPDKNNRLS  473

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             +E +VDECKTFYFAG +T  SLL W   L+A H DWQE+AR+EV+E+FG + P   GI++
Sbjct  474   MEDLVDECKTFYFAGQDTVNSLLAWMVFLIAIHGDWQEKARREVIEIFGNQIPDSEGISK  533

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LKIM MI+ ETLRLY P   + R+ E++ V LG + LP N+ L +   A  HDP++WG +
Sbjct  534   LKIMTMIIYETLRLYGPSIAMMRRAERE-VQLGKLVLPANLDLLVVHSASHHDPQLWGDE  592

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERFAEG+ KATN +  AF PFG GPR C+G+NFA+ E KI LSMILQRY+++LS
Sbjct  593   VHLFKPERFAEGIAKATNYNAGAFCPFGLGPRNCVGMNFAIIETKIALSMILQRYTISLS  652

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP+    ++P+ G+QVIL  +
Sbjct  653   PAYVHSPIPYITIQPQHGIQVILESL  678


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 5/118 (4%)
 Frame = +1

Query  217  PVHIQKLMSSQ---GIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIY  387
            P  + KL S+    GIKGP YRF+HGN KE+++ R+   SK +   L+ D+FPR+ PHIY
Sbjct  14   PHRVDKLASADQLAGIKGPPYRFIHGNNKEVTKMRKEALSKAV--GLTDDLFPRLQPHIY  71

Query  388  SWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
            SW   YG NF+YW G + E+V++E EL+KE++ + +  + + +L     +LLG+G+ S
Sbjct  72   SWINTYGKNFVYWNGVRAEVVISEPELIKEVMKNSEKIFQRRKLTDVGGKLLGNGLCS  129



>ref|XP_004135429.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=521

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/494 (49%), Positives = 346/494 (70%), Gaps = 6/494 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  +LWW P+ IQ+LM +QG++GPSY F+HGNTKE+   R    +KPM+  LSH + PR+
Sbjct  26    LLGRLWWNPMKIQRLMRAQGVQGPSYNFIHGNTKEMYSKRIKAMAKPMQ--LSHRILPRV  83

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW   YG N++ W G +  LV+TE EL+KE+L+++   +PK +LQG   ++ G+G
Sbjct  84    LPHILSWLNQYGRNYVQWFGAEAHLVITEPELIKEVLNNQHKSFPKAKLQGHIHKIFGNG  143

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +++G+KW   RKLA+  FHG++L+ M+P+M++ AETMVE W  HE KEI+ F+ F++ 
Sbjct  144   LATAEGQKWVNSRKLAHFAFHGDNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFKVY  203

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VIS TAFGS+Y +G+N+F+ML +L  L+  N   VR P +S+I+K+ D++E + LE+
Sbjct  204   TLDVISHTAFGSSYEQGRNVFQMLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSLEK  263

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              +++  ++IIK RE+ K   ++ +   +DFL  L++A +      +I +E +VDECKTFY
Sbjct  264   KMKDCFVEIIKAREE-KLNNDEANDYGNDFLGLLVKAKNDPQDSQRISLEDVVDECKTFY  322

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             FAGHETT  LL W  LLLA H++WQE+AR EV +VFG  NPT   + +LK M MI+ E+L
Sbjct  323   FAGHETTNVLLAWTMLLLALHKEWQEKARNEVFDVFGHSNPTFEALPKLKTMGMIIHESL  382

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   + RKVEK+   LG + LP  + + I   A+ HD E+WG+ V  FKPERF+EG
Sbjct  383   RLYPPAMTLLRKVEKE-TRLGRLVLPRGVQVVIPTAAIHHDEELWGRSVDDFKPERFSEG  441

Query  1453  VVKATNNHPIA--FLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             + KAT  +P    +LPFG GPR+C+G+NFA+ EAKI +SMILQR+S  LS +Y HSP  L
Sbjct  442   IAKATERNPGGGTYLPFGLGPRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAML  501

Query  1627  FMLRPKDGVQVILH  1668
               + P+ G+Q+ILH
Sbjct  502   LTIAPQHGLQLILH  515



>gb|EYU22581.1| hypothetical protein MIMGU_mgv1a004745mg [Erythranthe guttata]
Length=512

 Score =   516 bits (1329),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 241/497 (48%), Positives = 346/497 (70%), Gaps = 5/497 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A    ++WWAP+  Q  M  QGIKGPSY+F+ GNT EIS  +       ME  L+HD+F 
Sbjct  20    AKFLHRVWWAPLRTQYAMELQGIKGPSYKFVRGNTVEISSMKSNSMRGNME--LNHDIFS  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             R +PH Y+W  +YG  F +W G + ELV+TE ELVKE+L ++   Y + +   + R+++G
Sbjct  78    RTMPHFYTWINIYGKVFYFWNGEKAELVITEPELVKEVL-NKSESYSRTDPDKYMRKIIG  136

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFR  726
             DGI +S+GEKW ++RKLAN  FH E+L+ M+PAM+ES E M++ WRE + +E++  +EF 
Sbjct  137   DGIVASEGEKWVKLRKLANQAFHAENLKNMVPAMVESVEMMMKKWREEKTREVDISKEFT  196

Query  727   LLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKL  906
              +TSE+IS+TAFGS+Y +G+ +F ML +L  +  +N    + P +S + KN+D+ ES+K+
Sbjct  197   FMTSEMISKTAFGSSYSQGEKVFNMLRQLSIITGRNAYKTKIPVISDLFKNSDDRESDKM  256

Query  907   EEGVRNGIIQIIKKREQTKTGE-EQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             E+ +++  ++I+ +R++  T E  +K     D+L  LL ANH      +I ++ ++DECK
Sbjct  257   EKEIQDFFLRILDQRKKETTREAHEKHGFGDDYLGSLLRANHDPVEKKRISVQEIIDECK  316

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AGH TT++LL W  LLLA   +WQE+AR+EV+EVFG  NP   G+++LK M+MI+ 
Sbjct  317   TFYSAGHATTSTLLSWTALLLAIDSEWQEKARQEVLEVFGPHNPNSEGLSKLKTMSMIIN  376

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
             E+LRLYPPVP  +RK  K +  LGN+ +PPN  + +  LAL HDP IWG D H FKPERF
Sbjct  377   ESLRLYPPVPINERKTTKTSK-LGNLIIPPNTKINMPILALHHDPAIWGDDAHLFKPERF  435

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             ++G+ +AT N P AF PFG GPRTC+G++FA  EAKI L MILQRY++ LS +YVHSPVQ
Sbjct  436   SKGIAEATKNIPAAFSPFGLGPRTCVGMSFATNEAKIALCMILQRYTITLSPNYVHSPVQ  495

Query  1624  LFMLRPKDGVQVILHRI  1674
             +  LRP+ GV+V+LH +
Sbjct  496   IMSLRPQHGVKVVLHAL  512



>gb|KHG27367.1| Cytochrome P450 protein [Gossypium arboreum]
Length=516

 Score =   516 bits (1329),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 252/506 (50%), Positives = 347/506 (69%), Gaps = 9/506 (2%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FI +L+     +L     W P+ +Q +MSSQGIKGP Y F+HGN KE ++  +   SKPM
Sbjct  16    FIVALIRFLYDYL-----WRPLRLQHMMSSQGIKGPPYSFIHGNNKEATKMTKEAFSKPM  70

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                L HD+FPR+ P+IYS    YG N+L W G +PELV+TE EL  E+L      +PK +
Sbjct  71    A--LRHDIFPRVQPYIYSCVNKYGRNYLSWDGNRPELVITEPELANEVLKHSVTTFPKRK  128

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                F  R+ G+G+ ++ GEKW + RKLAN  FHGESL+ M PA+I S +TM+E W+ + G
Sbjct  129   PTVFVSRIFGNGLVTALGEKWVKQRKLANYAFHGESLQNMTPAVIASVKTMLEKWKGYVG  188

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KE+E + EFRLLTSEVISRTAF S+YLEG+ IF+ML KL  + S+N    R P ++++ K
Sbjct  189   KEMEVYHEFRLLTSEVISRTAFSSSYLEGEKIFDMLNKLSIIRSRNLFETRIPLINKLWK  248

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
             + D LESE+L +G+++ +++I+KKRE      E  +S  +DFL  L+ A H  + +N++ 
Sbjct  249   SGDVLESEELSKGIQDCVMKIVKKREDEVVNGE-ANSFGNDFLGLLVNAYHDSDENNRLS  307

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
              E +VDECKTFYFAG +T  SLL W   LLA H DWQE+AR+EV+E+FG + P   G+++
Sbjct  308   TEDLVDECKTFYFAGQDTVNSLLAWIVFLLAIHGDWQEKARREVIEIFGNQIPDSEGMSK  367

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK M MI+ ETLRLY P   + R+  ++ V LG + LP NI + +  +AL H+P +WG D
Sbjct  368   LKTMTMIIYETLRLYGPPNGLPRRAARE-VQLGKLVLPANIDILVQNIALHHNPHLWGDD  426

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALS  1596
             VH FKPERFAEG+ KATN +  AF PFG GPR C+G+NFA  E KIV+SMILQRY+++LS
Sbjct  427   VHLFKPERFAEGIAKATNYNAGAFCPFGLGPRNCVGMNFATTEMKIVVSMILQRYTISLS  486

Query  1597  SSYVHSPVQLFMLRPKDGVQVILHRI  1674
              +YVHSP+    ++P+ G+QVIL  +
Sbjct  487   PTYVHSPIPYITVQPQHGIQVILESL  512



>gb|KHG09429.1| Cytochrome P450 protein [Gossypium arboreum]
Length=513

 Score =   516 bits (1328),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 248/486 (51%), Positives = 343/486 (71%), Gaps = 6/486 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ +++SQGIKGP +RF+HGN KEI++ ++    KP+    + D+FPR+ PHIYS
Sbjct  29    WIPLRIQHILNSQGIKGPPFRFIHGNNKEIAKMKQEALGKPVA--WTDDLFPRLQPHIYS  86

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
             W   YG NF+YW G + ELV++E ELVKE+L + +  + K++L   SR+L+G+G+  ++G
Sbjct  87    WINRYGKNFVYWDGARAELVISEPELVKEVLKNSENIFQKVKLPEISRKLMGNGLAFTEG  146

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKWA+ RKLAN+ FHGESL+ M PAMI S ETM+E W+  EG+EIE F+EFRLLTSEVIS
Sbjct  147   EKWAKYRKLANHTFHGESLKNMTPAMIASVETMLEKWKGQEGQEIEVFQEFRLLTSEVIS  206

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             +TAFGS+YLEG+ IF +L KLK L S+N      P ++++ K+ D LESEKL +G+++ +
Sbjct  207   KTAFGSSYLEGEKIFALLYKLKILVSRNMSKTTIPFINKLWKSADLLESEKLAKGIQDCV  266

Query  931   IQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHE  1107
             ++I+KKRE Q   GE    S  +DF   L+ A H  +  N++ +E +VDECKTFY AG E
Sbjct  267   MKIVKKREDQVVNGE--ADSFGNDFFGLLVNAYHDLDEKNRLSLEDLVDECKTFYIAGQE  324

Query  1108  TTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPP  1287
             T  SLL W  L LA H DWQE+ R+EV+++FG +NP   GI +LK M M++ ETLRLY P
Sbjct  325   TVNSLLAWIVLHLAIHGDWQEKTRREVIDIFGNQNPHLEGITKLKTMAMVINETLRLYGP  384

Query  1288  VPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKAT  1467
                + R V ++ V LG + L   + +    + +  DP +WG DVH FKPERFA+G+ KAT
Sbjct  385   SNGLARTVARE-VQLGKLFLLAKLDILPLNIGVHRDPHLWGDDVHLFKPERFADGIAKAT  443

Query  1468  NNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKD  1647
             N    AFLPFG GPR+C+G+ FA  E KIVLSMILQRY++ LS +YVHSP+ +  +RP+ 
Sbjct  444   NYTAAAFLPFGLGPRSCVGMTFATIETKIVLSMILQRYTITLSPAYVHSPILILTVRPQH  503

Query  1648  GVQVIL  1665
             G+Q+ +
Sbjct  504   GIQLTI  509



>ref|XP_004170856.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=521

 Score =   515 bits (1326),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/494 (48%), Positives = 345/494 (70%), Gaps = 6/494 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  +LWW P+ IQ+LM +QG++GPSY F+HGNTKE+   R    +KPM+  LSH + PR+
Sbjct  26    LLGRLWWNPMKIQRLMRAQGVQGPSYNFIHGNTKEMYSKRIKAMAKPMQ--LSHRILPRV  83

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI SW   YG N++ W G +  LV+TE EL+KE+L+++   +PK +LQG   ++ G+G
Sbjct  84    LPHILSWLNQYGRNYVQWFGAEAHLVITEPELIKEVLNNQHKSFPKAKLQGHIHKIFGNG  143

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +++G+KW   RKLA+  FHG++L+ M+P+M++ AETMVE W  HE KEI+ F+ F++ 
Sbjct  144   LATAEGQKWVNSRKLAHFAFHGDNLKNMIPSMVQCAETMVEEWAHHEDKEIDVFKHFKVY  203

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VIS TAFGS+Y +G+N+F+ML +L  L+  N   VR P +S+I+K+ D++E + LE+
Sbjct  204   TLDVISHTAFGSSYEQGRNVFQMLQRLCELSITNRYKVRLPVISKILKSKDDIEGQSLEK  263

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              +++  ++IIK RE+ K   ++ +   +DFL  L++A +      +I +E +VDECKTFY
Sbjct  264   KMKDCFVEIIKAREE-KLNNDEANDYGNDFLGLLVKAKNDPQDSQRISLEDVVDECKTFY  322

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             FAGHETT  LL W   LLA H++WQE+AR EV +VFG  NPT   + +LK M MI+ E+L
Sbjct  323   FAGHETTNVLLAWTMFLLALHKEWQEKARNEVFDVFGHSNPTFEALPKLKTMGMIIHESL  382

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPP   + RKVEK+   LG + LP  + + I   A+ HD E+WG+ V  FKPERF+EG
Sbjct  383   RLYPPAMTLLRKVEKE-TRLGRLVLPRGVQVVIPTAAIHHDEELWGRSVDDFKPERFSEG  441

Query  1453  VVKATNNHPIA--FLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             + KAT  +P    +LPFG GPR+C+G+NFA+ EAKI +SMILQR+S  LS +Y HSP  L
Sbjct  442   IAKATERNPGGGTYLPFGLGPRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAML  501

Query  1627  FMLRPKDGVQVILH  1668
               + P+ G+Q+ILH
Sbjct  502   LTIAPQHGLQLILH  515



>ref|XP_011101783.1| PREDICTED: cytochrome P450 CYP749A22-like [Sesamum indicum]
Length=489

 Score =   512 bits (1318),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/463 (54%), Positives = 336/463 (73%), Gaps = 4/463 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F  SL+ L    +  K+ W P  IQ ++ SQGI GP Y+ +HG+TKE    ++     PM
Sbjct  5     FFLSLITLILIRVIHKVLWLPFRIQHMLRSQGITGPPYKIIHGSTKESLRLKQQARDGPM  64

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  LSHD+FPR+ P  YSW +LYG NFL W GPQP LV+TE ELVKEIL++++G + KI+
Sbjct  65    E--LSHDIFPRVQPSFYSWMKLYGKNFLTWTGPQPHLVITEPELVKEILTNKEGIFQKIK  122

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
             +QG +++L+GDG+  ++G KW+++RKLAN+ F+ ESL+GM+PAMI S E M+E WR +EG
Sbjct  123   VQGPAKKLVGDGLVMTEGAKWSKLRKLANHAFYAESLKGMIPAMIASVENMLENWRMYEG  182

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE  +EF + +SEVISRTAFGS+YLEGKNIF+ML+KL  L  KN   VR  G+ +I K
Sbjct  183   KEIEVSKEFMVFSSEVISRTAFGSSYLEGKNIFDMLMKLGFLIFKNADKVRPFGIEKIWK  242

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQIC  1056
               D++ES+K+E+ +R+ ++ I++KRE+ K    Q  +  SDFL  LL  +H  +  N+I 
Sbjct  243   TQDDIESDKIEQSLRDSLMVILRKREE-KVLTGQADNFGSDFLGSLLRVHHDADKKNRIS  301

Query  1057  IEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIAR  1236
             ++ ++DECK F+ AGHETT+SLL W  LLLA H DWQ++ARKEV+E+FGQENPT  G+ R
Sbjct  302   LDDVIDECKVFFLAGHETTSSLLSWTFLLLAIHTDWQDKARKEVLELFGQENPTAEGLPR  361

Query  1237  LKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKD  1416
             LK  +MI+ E LRLY PV  + R+V +K  V G   LP N+ L ISPLAL  +PEIWG+D
Sbjct  362   LKTASMIINEALRLYGPVASLVRRVARKVRV-GKYVLPANMELQISPLALHRNPEIWGED  420

Query  1417  VHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAE  1545
              H FKPERFAEG+  AT N+P+AFLPFGYGPRTC+GLNFA  E
Sbjct  421   AHLFKPERFAEGIATATRNNPMAFLPFGYGPRTCVGLNFANNE  463



>ref|XP_006437868.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
 gb|ESR51108.1| hypothetical protein CICLE_v10033709mg [Citrus clementina]
Length=477

 Score =   511 bits (1316),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/507 (50%), Positives = 341/507 (67%), Gaps = 41/507 (8%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             +   L +L       KLWW P+  Q  M SQGIKGPSY+F+HGNTKEI      I S PM
Sbjct  11    YFCLLFLLVLIRFINKLWWNPIWTQSQMRSQGIKGPSYKFIHGNTKEIINMTNEIMSSPM  70

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  L+H +FPR+ PH+YSW +LYG NFL W G QP+LVV E +L+KEIL+D+   +PK E
Sbjct  71    E--LTHQIFPRVYPHVYSWIKLYGTNFLMWNGLQPQLVVAEPDLIKEILNDKDRAHPKRE  128

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                F ++ LGDG+ +++GEKW + RKLAN+ FH E+L+ M+P MI S E M+E WR++EG
Sbjct  129   PTNFIKKFLGDGLVTTQGEKWFKQRKLANHAFHVETLKSMIPDMIASVEMMLERWRDYEG  188

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEI+A++EF++LTSE+ISRTAFGS+YLEG+NIF ML KL    SKN   VR P + +++K
Sbjct  189   KEIDAYKEFKVLTSEIISRTAFGSSYLEGENIFNMLTKLAFFISKNEYKVRIPLIGKLVK  248

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
               D+ ES+K+E+ +R+ +I+I++ RE+   TGE   +S   D L  L+ A H        
Sbjct  249   TRDDTESDKVEQDIRDSVIKIVENREKNVITGE--VASYGDDLLGALMMAYHD-------  299

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
                  VD          ETT S+L W  LLLATH DWQ++ARKEV E+FGQ++P    I+
Sbjct  300   -----VD----------ETTASVLSWTVLLLATHNDWQDKARKEVQELFGQQSPNADNIS  344

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
                          RLYPP  +I RKV+K+ V LG   +P N+ + I  +A+ HDP+IWG+
Sbjct  345   -------------RLYPPAFHILRKVQKE-VKLGKFIVPGNLDITIPVIAVHHDPQIWGE  390

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H FKPERFAEGV KATNN+  AF+PFG GPRTC+GLN+A+ EAKI LSMILQRY    
Sbjct  391   DAHLFKPERFAEGVAKATNNNVAAFIPFGLGPRTCVGLNYAITEAKIALSMILQRYKFTP  450

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S +YVHSPV +  + P+ G+QV++HR+
Sbjct  451   SPTYVHSPVAIITINPQHGLQVLVHRL  477



>gb|KHG17439.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   511 bits (1315),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 249/485 (51%), Positives = 347/485 (72%), Gaps = 4/485 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ L++SQGIKGP Y+F+HGN  E+++ ++   SKP+   L+ D+ PR+ PHIYS
Sbjct  29    WVPLRIQHLLNSQGIKGPPYKFIHGNNHEVTKMKKEALSKPL--GLTDDILPRVQPHIYS  86

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
             W   YG N+LYW G +PELV++E ELVKE+L + +  +PK +   F  +LLG+G+   +G
Sbjct  87    WINRYGRNYLYWNGIRPELVISEPELVKEVLKNSENTFPKKKPSIFFSKLLGNGLLLLEG  146

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKW + RKLAN+VFHGE L+ M P +I S ETM+E W+  EGKEIE F+EFRLLTSEVIS
Sbjct  147   EKWVKRRKLANHVFHGERLKNMTPTVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVIS  206

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAF S+YLEG+ IF ML +L  + S+N    R P ++++ K  D L+SE+L +G+++ +
Sbjct  207   RTAFDSSYLEGEKIFAMLKELSIIMSRNNFKTRIPLINKLWKPVDMLKSEELAKGIQDCV  266

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             ++I+KKRE  K    +  S  +DFL  L+ A H  N +N++ +E +VDECKTFYFAG +T
Sbjct  267   MKIVKKRED-KVVNGEADSFGNDFLGLLVNAYHDSNENNRLSVEDLVDECKTFYFAGQDT  325

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               S+L W  L LATH DWQ++AR+EV+++FG  NP   GI++LK + +I+ ETLRLY P 
Sbjct  326   VNSILAWVVLHLATHGDWQDKARREVIDIFGNRNPDSEGISKLKTITVIIYETLRLYGPS  385

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               ++R V ++ V LG + LP NI + +  +AL HDP  WG DVH FKPERF EG+ KATN
Sbjct  386   NGLQRSVTRE-VQLGKLVLPANIDILVQNIALHHDPHQWGDDVHLFKPERFEEGIAKATN  444

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
              +  AF PFG GPR+C+G++FA+ E K+ LSMILQRY++ LS +YVHSP+ +  +RP+ G
Sbjct  445   YNAAAFFPFGLGPRSCVGMSFAITETKVALSMILQRYTINLSPAYVHSPMPILAIRPQHG  504

Query  1651  VQVIL  1665
             +QVIL
Sbjct  505   IQVIL  509



>gb|AEM42984.1| cytochrome P450 [Siraitia grosvenorii]
Length=519

 Score =   511 bits (1315),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 240/493 (49%), Positives = 343/493 (70%), Gaps = 5/493 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  +LW +P+ IQK M SQGI+GP Y+F+ GNTKE+   R   T+ PM  DLSH++ PR+
Sbjct  24    LVVRLWMSPIRIQKTMRSQGIRGPPYQFIQGNTKEMYTKRMQATATPM--DLSHNILPRV  81

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPH++SW   YG NFL WLG + + VVT+ E++KE+L  R+ ++PK +L G+ +++ GDG
Sbjct  82    LPHVHSWLNHYGKNFLQWLGTEAQFVVTDPEMIKEMLHVRQRNFPKAKLHGYIQKIFGDG  141

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
               +++GE+WA++RK+AN  F+G+SL+ M+PAM   AE M+E W+ +EGKEI+ FE+ ++ 
Sbjct  142   TVTAEGERWAKLRKIANFSFNGDSLKSMIPAMTGCAEAMIERWKHYEGKEIDVFEQMKIY  201

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TS+VIS TAFGS+Y +GK+IF  L ++  L  +N   V FP +SRI K+ D +E E+L++
Sbjct  202   TSDVISHTAFGSSYEQGKHIFYTLQQISELYIRNAYKVSFPVISRIFKHKDHIEGERLQK  261

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              ++   +++IK RE  K    +     +DFL  L++A +      +I ++ +VDECKTFY
Sbjct  262   RMKECFMKVIKTRE-AKFLSGEADGYGNDFLGLLVKAKNDPEISQRISVDEIVDECKTFY  320

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPYGIARLKIMNMILEET  1269
             FAGHETT+ LL W   LLA H++WQE ARKE   +FG  +NPT  G+A+LK M MI+ E 
Sbjct  321   FAGHETTSMLLTWTMFLLALHQEWQEEARKEAFRIFGDSDNPTAEGLAKLKTMTMIINEC  380

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPP   + R VEK+ V LG + LP  I + +  +A+  D E WG+D H FKPERF+E
Sbjct  381   LRLYPPAMTVSRTVEKE-VRLGRLVLPKTITVAVPTIAVHQDTEYWGEDAHVFKPERFSE  439

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             G+ K   ++   +LPFG GPR C+G+NFA+ EAKIV+SMIL+RYS  LS +Y HSP+QL 
Sbjct  440   GIAKVIESNSAGYLPFGLGPRICVGMNFALNEAKIVISMILRRYSFTLSPAYSHSPIQLV  499

Query  1630  MLRPKDGVQVILH  1668
              + P+ G+QVILH
Sbjct  500   TVCPQHGLQVILH  512



>gb|KHG20842.1| Secologanin synthase [Gossypium arboreum]
Length=512

 Score =   510 bits (1313),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 250/485 (52%), Positives = 334/485 (69%), Gaps = 4/485 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ +M+SQGIKGP YRF+HGN+KE++   +   SK +   L+ D+FP++LPH Y+
Sbjct  25    WVPLRIQHMMNSQGIKGPPYRFIHGNSKEVARLEQEALSKRVA--LTDDIFPKVLPHFYT  82

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
                 YG NF+YW G +PELV++E EL+KE+L   +    + +L    R  LG+G+    G
Sbjct  83    SINRYGRNFVYWNGARPELVISEPELIKEVLQTSEKKIQEKKLSDIGREFLGNGLLFIAG  142

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKWA+ RKLAN+ FHGESL+ M PA+I S ETM+E W+  EG+EIE  +EFRLLTSEVIS
Sbjct  143   EKWAKHRKLANHAFHGESLKNMTPAIIASVETMLEKWKGQEGREIEVLQEFRLLTSEVIS  202

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAFGS+YLEG+ IF ML KL  + S+N    R P +S++ K+ D LESEKL + +++ +
Sbjct  203   RTAFGSSYLEGEKIFAMLQKLTIIMSRNLFKSRIPLISKLWKSADLLESEKLSKEIKDRV  262

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             + I+KKRE      E  +S  +DFL  L+ A H  +  N+  +E ++ ECKTFYF+G ET
Sbjct  263   MNIVKKREDEAVNGEV-NSFGNDFLGLLVNAYHDSDEKNRFSLEDLLAECKTFYFSGQET  321

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               SLL W  L LA H +WQE+AR+EV+++FG +NP   G+A+LKIM MI+ ETLRLY P 
Sbjct  322   VNSLLSWIVLHLAIHGNWQEKARREVIDIFGNQNPHLEGVAKLKIMTMIINETLRLYGPS  381

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               + R V ++ V LG + LP NI +      +  DP  WG DVH FKPERFAEG+ KATN
Sbjct  382   NGLARAVTRE-VQLGKLLLPANIDILPLYTGVHRDPHFWGDDVHHFKPERFAEGIAKATN  440

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
                 AFLPFG GPR+C+G+ FAM E KIVLSMILQRY+  LS +YVHSP+ +  +RP+  
Sbjct  441   YTAAAFLPFGLGPRSCVGMTFAMIETKIVLSMILQRYTFTLSPAYVHSPISVLSIRPQHE  500

Query  1651  VQVIL  1665
             +QVIL
Sbjct  501   IQVIL  505



>ref|XP_004135431.1| PREDICTED: cytochrome P450 734A1-like [Cucumis sativus]
Length=520

 Score =   509 bits (1312),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 234/496 (47%), Positives = 345/496 (70%), Gaps = 6/496 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  K WW P+ IQ++M SQGI GPSY+F+ GN +++   R    + PME  LSH++ PR+
Sbjct  27    LVSKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPME--LSHNILPRV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             +PH++SW   YG +FL W G + +L++T+ E++KE+L+D++ +YPK +L     R+ GDG
Sbjct  85    IPHVHSWLNDYGRSFLQWYGIEAQLIITDPEMIKEVLNDKQKNYPKAKLGRDLLRIFGDG  144

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +S+G++WA+ RK+AN  FHG+SL+ M+P MIE  E M+E W+ HEGKE++ ++E ++ 
Sbjct  145   LVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNHEGKELDVYKELKVY  204

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VISRTAFGS+Y +G NIF ML +L  L+ +N   ++ P +S+I+++ D++E E+LE+
Sbjct  205   TLDVISRTAFGSSYQQGLNIFHMLQQLTDLSIRNGYKIKLPIISKILRSKDDVEGERLEK  264

Query  913   GVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
              ++    +II+ RE ++K G  +     +DFL  L++A ++     +I ++ +V ECKTF
Sbjct  265   RMKECFTEIIRGREDRSKNGGGEGYG--NDFLGMLVKAKNEGEKSERITMDVIVAECKTF  322

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPYGIARLKIMNMILEE  1266
             YFAGHETT  L+ W   LLA H+ WQE+AR EV  +FG   NPT   +++LKIM MI+ E
Sbjct  323   YFAGHETTNVLIAWIMFLLALHKQWQEQARDEVFRIFGHSSNPTYEALSKLKIMTMIINE  382

Query  1267  TLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFA  1446
             TLRLYPP   + R+V +K V LG++ LP ++ L I  +A+ HD E WG+DVH+FKPERFA
Sbjct  383   TLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLMIPTIAVHHDKEFWGEDVHEFKPERFA  442

Query  1447  EGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             EGV K    +   +LPFG GPR C+G+NFA+ EAKI +SMILQ+YS  LS +Y H+PVQ 
Sbjct  443   EGVSKTIEGNSAGYLPFGLGPRNCVGMNFAINEAKIAMSMILQKYSFTLSPAYAHTPVQF  502

Query  1627  FMLRPKDGVQVILHRI  1674
                 P+ G+QVIL  I
Sbjct  503   LTTCPQQGLQVILRSI  518



>ref|XP_002512042.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF50711.1| cytochrome P450, putative [Ricinus communis]
Length=452

 Score =   506 bits (1304),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 244/445 (55%), Positives = 324/445 (73%), Gaps = 4/445 (1%)
 Frame = +1

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
             +LSH + PR+ PHIY W  L+G N++ WLGP+P+LV+TE  LVKE+LS+R   YPK E +
Sbjct  11    ELSHQLLPRVQPHIYFWINLHGKNYVSWLGPRPQLVLTEPNLVKEVLSNRDETYPKPEFE  70

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              + ++L G+G+ +  GEKW R RKLAN+ FHGE+L+GM+PAMI S E M+E WR++E KE
Sbjct  71    SYVKQLFGNGLVAITGEKWNRQRKLANHAFHGENLKGMVPAMIASVEMMLERWRQNEEKE  130

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE ++EF+LLTSE+ISRTAFGS+YLEG++IF+ML KL  + +KN   VR   + ++ K  
Sbjct  131   IEVYQEFKLLTSEIISRTAFGSSYLEGQHIFDMLGKLARILNKNSYQVRIRAIEKLWKRK  190

Query  883   DELESEKLEEGVRNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEANHQENGDNQICI  1059
             D+ ESEKLE+G+R+ ++++I KRE+  KTGE    S  SDFL  LL+A  + +   +I +
Sbjct  191   DDTESEKLEQGIRDSVLKMINKREEDEKTGE--VDSCGSDFLGVLLKAYQETDESKKISV  248

Query  1060  EAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARL  1239
             + ++DECKTFY AGHETT+S L W   LLA H DWQE+AR+EV+E FGQ  PT   I RL
Sbjct  249   DDLIDECKTFYIAGHETTSSALTWCIFLLAIHTDWQEKARQEVLESFGQRIPTSDEITRL  308

Query  1240  KIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDV  1419
             KIMNMI+ ETLRLY P+  + R+V+K +  LG +  P  I + + PLAL  DPEIWG+D 
Sbjct  309   KIMNMIVNETLRLYAPITNLIREVQKGS-RLGKLVAPSRIDIIVPPLALHQDPEIWGEDA  367

Query  1420  HKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSS  1599
             + FKPERFAEG+ KAT N+  AFLPFG GPR C+G+NFAMAE KI LSMILQRY   LS 
Sbjct  368   YLFKPERFAEGIAKATKNNIAAFLPFGLGPRNCVGMNFAMAETKISLSMILQRYRFTLSP  427

Query  1600  SYVHSPVQLFMLRPKDGVQVILHRI  1674
             +YVHSP  L  + P+ G+Q+ L  +
Sbjct  428   TYVHSPTFLIAVCPQKGLQINLQAL  452



>gb|KHG08441.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score =   508 bits (1308),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 248/505 (49%), Positives = 333/505 (66%), Gaps = 27/505 (5%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F++  L L       K WW P  IQ+ +S QGIKGP Y F+HGN K  +  R    SKPM
Sbjct  10    FLAGSLTLFLLKFLHKYWWIPFKIQRALSLQGIKGPPYEFIHGNNKASTRFRYEALSKPM  69

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                L+H++ PR++P I+SW   YG N+L W                      +G+  +++
Sbjct  70    AS-LTHNIVPRVIPQIHSWINTYGQNYLTW----------------------EGNRAQLD  106

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                   +++G+G+ +S+G KWA+ RKLAN+ FHGESL+ M PA+I S ETM+E W+  EG
Sbjct  107   DSSIIHKIVGEGLVTSEGAKWAKQRKLANHAFHGESLKNMNPAVIASVETMLEKWKGREG  166

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             +EIE F EFRLLTSEVISRTAFGSNYLEGK IF+ML KL  L S+N+     PG+S+I K
Sbjct  167   EEIEVFNEFRLLTSEVISRTAFGSNYLEGKKIFDMLTKLAILVSRNYFKTPIPGISKIWK  226

Query  877   NNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
                E+ESEKL  G+ + +++++K+RE + +TGE       +DFL  L+ A    +  N+ 
Sbjct  227   TAVEIESEKLANGIHDCVMEMVKRREKKVETGEADGFG--NDFLGLLINAYRDSDEKNRF  284

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              IE +VDECKTFYFAG ETT SLL W  L+LA H  WQE+ R+EV EVFG +NP   GIA
Sbjct  285   SIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTKWQEKTRQEVSEVFGDQNPNSEGIA  344

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LKIMNM++ ETLRLY PV  + R++ KK V LG + LP N+ + I  +AL HDP++WG 
Sbjct  345   KLKIMNMVVNETLRLYSPVAAVIRQI-KKEVRLGKLVLPANLEILIPIIALHHDPQLWGD  403

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DVH FKPERF EG+  AT  +  AF+PF  GPR+C+G++FA  E K+ LSMILQRY+  L
Sbjct  404   DVHLFKPERFVEGIASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFTL  463

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S +YVH+P  +  L+P+ G+QV+LH
Sbjct  464   SPTYVHAPFPVITLQPQHGIQVMLH  488



>gb|KHG26927.1| Cytochrome P450 protein [Gossypium arboreum]
Length=490

 Score =   507 bits (1306),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 248/505 (49%), Positives = 334/505 (66%), Gaps = 27/505 (5%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F++  L L       K WW P  IQ+ +S QGIKGP Y F+HGN K  +  R    SKPM
Sbjct  10    FLAGSLTLFLLKFLHKYWWIPFKIQRALSLQGIKGPPYEFIHGNNKASTRFRYEALSKPM  69

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
                L+H++ PR++P I+SW   YG N+L W                      +G+  +++
Sbjct  70    AS-LTHNIVPRVIPQIHSWINTYGQNYLTW----------------------EGNRAQLD  106

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                   +++G+G+ +S+G KWA+ RKLAN+ FHGESL+ M PA+I S ETM+E W+  EG
Sbjct  107   DSSIIHKIVGEGLVTSEGAKWAKQRKLANHAFHGESLKNMNPAVIASVETMLEKWKGREG  166

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             +EIE F EFRLLTSEVISRTAFGSNYLEGK+IF+ML KL  L S+N+     PG+S+I K
Sbjct  167   EEIEVFNEFRLLTSEVISRTAFGSNYLEGKHIFDMLTKLAILFSRNYFKTPIPGISKIWK  226

Query  877   NNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
                E+ESEKL  G+ + +++++K+RE + +TGE       +DFL  L+ A    +  N+ 
Sbjct  227   TAVEIESEKLANGIHDCVMEMVKRREKKVETGEADGFG--NDFLGLLINAYRDSDEKNRF  284

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              IE +VDECKTFYFAG ETT SLL W  L+LA H  WQE+ R+EV EVFG +NP   GIA
Sbjct  285   SIEDLVDECKTFYFAGQETTNSLLAWTILVLAIHTKWQEKTRQEVSEVFGDQNPNSEGIA  344

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LKIMNM++ ETLRLY PV  + R++ KK V LG + LP N+ + I  +AL HDP++WG 
Sbjct  345   KLKIMNMVVNETLRLYSPVAAVIRQI-KKEVRLGKLVLPANLEILIPIIALHHDPQLWGD  403

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DVH FKPERF EG+  AT  +  AF+PF  GPR+C+G++FA  E K+ LSMILQRY+  L
Sbjct  404   DVHLFKPERFVEGIASATKYNSAAFIPFSMGPRSCVGMSFATTETKVALSMILQRYAFTL  463

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S +YVH+P  +  L+P+ G+QV+LH
Sbjct  464   SPTYVHAPFPVITLQPQHGIQVMLH  488



>gb|KHG24669.1| Secologanin synthase [Gossypium arboreum]
Length=516

 Score =   508 bits (1308),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 248/485 (51%), Positives = 347/485 (72%), Gaps = 4/485 (1%)
 Frame = +1

Query  211   WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYS  390
             W P+ IQ L++SQGIKGP Y+F+HGN  E+++ ++   SKP+   L+ D+ PR+ PHIYS
Sbjct  29    WVPLRIQHLLNSQGIKGPPYKFIHGNNHEVTKMKKEALSKPL--GLTDDILPRVQPHIYS  86

Query  391   WKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG  570
             W   YG N+LYW G +PELV++E ELVKE+L + +  +PK +   F  +LLG+G+   +G
Sbjct  87    WINRYGRNYLYWNGIRPELVISEPELVKEVLKNSENTFPKKKPSIFFSKLLGNGLLLLEG  146

Query  571   EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVIS  750
             EKW + RKLAN+VFHGE L+ M P +I S ETM+E W+  EGKEIE F+EFRLLTSEVIS
Sbjct  147   EKWVKRRKLANHVFHGERLKNMTPTVIASVETMLEKWKGQEGKEIEVFQEFRLLTSEVIS  206

Query  751   RTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGI  930
             RTAF S+YLEG+ IF ML +L  + S+N    R P ++++ K  D L+SE+L +G+++ +
Sbjct  207   RTAFDSSYLEGEKIFAMLKELSIIMSRNNFKTRIPLINKLWKPVDMLKSEELAKGIQDCV  266

Query  931   IQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHET  1110
             ++I+KKRE  K    +  S  +DFL  L+ A H  N +N++ +E +VDECKTFYFAG +T
Sbjct  267   MKIVKKRED-KVVNGEADSFGNDFLGLLVNAYHDSNENNRLSVEDLVDECKTFYFAGQDT  325

Query  1111  TTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPV  1290
               S+L W  L LATH DWQ++AR+EV+++FG  NP   GI++LK + MI+ ETLRLY P 
Sbjct  326   VNSILAWVVLHLATHGDWQDKARREVIDIFGNRNPDSEGISKLKTITMIIYETLRLYGPS  385

Query  1291  PYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN  1470
               ++R+V ++ V LG + LP NI + +  +AL +DP  WG DVH FKPERF EG+ K TN
Sbjct  386   NGLQRRVTRE-VQLGKLVLPANIDILLQNIALHNDPCQWGDDVHLFKPERFEEGIAKTTN  444

Query  1471  NHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDG  1650
              +  AF PFG GPR+C+G++FA+ E K+ LSMILQRY++ LS +YVHSP+ +  +RP+ G
Sbjct  445   YNAAAFFPFGLGPRSCVGMSFAITETKVALSMILQRYTITLSPAYVHSPMPILAIRPQHG  504

Query  1651  VQVIL  1665
             +QVIL
Sbjct  505   IQVIL  509



>ref|XP_008446465.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=498

 Score =   507 bits (1305),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 232/496 (47%), Positives = 345/496 (70%), Gaps = 8/496 (2%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  K WW P+ IQ++M SQGI GPSY+F+ GN +++   R    + PME  LSH++ PR+
Sbjct  7     LVNKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPME--LSHNILPRV  64

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             +PH++SW   YG +FL W G + +L++T+ E++KE+L+D++ +YPK +L     R+ G+G
Sbjct  65    IPHVHSWLNDYGRSFLQWYGMEAQLIITDPEMIKEVLNDKRKNYPKAKLGSDLFRIFGNG  124

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +S+G++WA+ RK+AN  FHG+SL+ M+P MIE  E M+E W+ +EGKE++ F+E ++ 
Sbjct  125   LVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNYEGKELDVFKELKVY  184

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VIS TAFGS+Y +G NIF ML +L  L+ +N   ++ P +S+I+K+ D++E E+LE+
Sbjct  185   TLDVISHTAFGSSYQQGSNIFHMLQQLTDLSIRNGYKIKLPIISKILKSKDDIEGERLEK  244

Query  913   GVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
              +     +II+ RE+ +K GE       +DFL  L++A ++     +I ++ +V ECKTF
Sbjct  245   RMNECFAEIIRGREEKSKKGE----GYGNDFLGMLVKAKNEGEKSERITMDVIVAECKTF  300

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPYGIARLKIMNMILEE  1266
             YFAGHETT  L+ W   LLA H++WQE+AR EV  +FG   NPT   +++LKIM MI+ E
Sbjct  301   YFAGHETTNVLITWIIFLLAIHKEWQEQARNEVFRIFGHNNNPTYEALSKLKIMTMIINE  360

Query  1267  TLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFA  1446
             TLRLYPP   + R+V +K V LG++ LP ++ L I  +A+ HD E WG+DVH+FKPERF+
Sbjct  361   TLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLTIPTIAVHHDKEFWGEDVHEFKPERFS  420

Query  1447  EGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             EGV K    +   +LPFG GPR C+G+NFA+ EAK+ +S+ILQ+YS  LS +Y H+PVQ 
Sbjct  421   EGVSKTIERNSAGYLPFGLGPRNCVGMNFAINEAKVAMSIILQKYSFTLSPAYAHTPVQF  480

Query  1627  FMLRPKDGVQVILHRI  1674
                 P+ G+QVILH I
Sbjct  481   LTTCPQQGLQVILHSI  496



>gb|KCW76385.1| hypothetical protein EUGRSUZ_D00767 [Eucalyptus grandis]
Length=473

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/479 (51%), Positives = 333/479 (70%), Gaps = 6/479 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M++QGI+GP Y F HG+TKE+ + ++ +T +PM  +LSHD+FP + PH+Y W + YG NF
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM--NLSHDIFPYVQPHLYEWTKTYGRNF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L W G Q  LV+++ E+VKE+L++R   Y K  +Q   ++ +GDG+ + +GEKWA+ RKL
Sbjct  59    LMWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN  FH E+L+GM+PAM++SA TM++ W   EGKEI+ ++E RL  S+VIS+TAFGS+Y 
Sbjct  119   ANFAFHRENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYT  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGK+IFE + KL  L   N  +  FP + ++ +   E+E EK+E+G R  +++IIKKR Q
Sbjct  179   EGKSIFENVNKL-ILVMVN-ASSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKR-Q  235

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWAT  1137
              K    +  S  +DFL  LL A+H+ +   +I I+ +V ECKTFY AGHET TS L W  
Sbjct  236   EKVNSGELESYGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTV  295

Query  1138  LLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEK  1317
             LLL+ H DWQE ARKE   VFG ++P   GI +LK + MI+ E+LRLYPP  +I R+V +
Sbjct  296   LLLSIHTDWQEEARKEAFNVFGNQDPDLDGITKLKTIGMIINESLRLYPPATFISREVSR  355

Query  1318  KNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPF  1497
             +   LGN  LP  I L+I  L + HDP+IWG D H FKPERF +GV KAT+N+P  FLPF
Sbjct  356   Q-AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPF  414

Query  1498  GYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             G GPR+C+G NF + EAKIVLSMILQRY+  LS +YVHSP QL +  PK GVQV  + I
Sbjct  415   GLGPRSCVGSNFVVVEAKIVLSMILQRYAFNLSPAYVHSPAQLLIAYPKYGVQVFFNSI  473



>gb|KDO36840.1| hypothetical protein CISIN_1g012962mg [Citrus sinensis]
Length=452

 Score =   505 bits (1300),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/449 (55%), Positives = 334/449 (74%), Gaps = 6/449 (1%)
 Frame = +1

Query  331   PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPK  510
             PME  LSH ++PR+ PH+YSW +LYG NFL W G + +LVVTE +L+KEILSD+   YPK
Sbjct  9     PME--LSHQIYPRVSPHVYSWIKLYGKNFLMWYGLEAQLVVTEPQLIKEILSDKHRAYPK  66

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH  690
              E + ++++LLG+G+ +++GEKW + RKLAN+ FH E+L+ M+P MI SAE M++ WR++
Sbjct  67    REPREYTKKLLGNGLVTAQGEKWFKQRKLANHAFHAETLKSMIPDMIASAEMMLDRWRDN  126

Query  691   EGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI  870
             EG+EI+ ++EF++LT E ISRTAFGS+YLEG+NIF ML KL    SKN   VR P + ++
Sbjct  127   EGQEIDVYQEFKILTLEAISRTAFGSSYLEGENIFNMLTKLTFFISKNEYRVRIPVIGKL  186

Query  871   MKNNDELESEKLEEGVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             +K +D++ES+K EE +R+ II+IIKKRE    TGE +  S  +D L  L++A H  +   
Sbjct  187   VKTHDDIESDKTEEDIRDSIIKIIKKRESNVMTGEVE--SDGNDLLGVLMQAYHNVDETL  244

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I ++ ++DECKTFY AGHETT SLL W  LLLA H DWQ++AR EV+++FGQ++P    
Sbjct  245   KISLDDLIDECKTFYIAGHETTASLLTWTVLLLAIHNDWQDKARNEVLQLFGQQSPNADN  304

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I+RLKIM+MI+ E+LRLYPPV  I RKV KK V LG   +P ++ + I  LA+ HDP+IW
Sbjct  305   ISRLKIMSMIINESLRLYPPVVLILRKV-KKEVKLGKFVIPADVDITIPTLAVHHDPQIW  363

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G++ H FKPERFA GV  ATNN+  AF+PFG GPRTC+G N+A+ EAKI LSMILQ+Y  
Sbjct  364   GEEFHLFKPERFAGGVANATNNNMAAFIPFGLGPRTCVGFNYAIMEAKIALSMILQQYKF  423

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              LS +YVHSP  +  LRP+ G+QV+LH +
Sbjct  424   TLSPTYVHSPASIITLRPQHGLQVLLHAL  452



>gb|KDP35171.1| hypothetical protein JCGZ_10705 [Jatropha curcas]
Length=478

 Score =   506 bits (1302),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 339/482 (70%), Gaps = 6/482 (1%)
 Frame = +1

Query  235   LMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGAN  414
             +M SQGIKGPSY+  +GN KEI    +  +S  ME  LSH VFP +LPH  SW  LYG N
Sbjct  1     MMRSQGIKGPSYKLFYGNIKEIIHMTKRASSNSME--LSHQVFPTVLPHFQSWMNLYGKN  58

Query  415   FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIEL-QGFSRRLLGDGIGSSK-GEKWARM  588
             FL+W GP+  LV +E EL+KEI +++ G + K +   G+ ++LLGDG+  ++  EKW ++
Sbjct  59    FLWWEGPRAHLVFSEPELIKEIFNNKDGAFYKPQPDNGYLQKLLGDGLAMTRVSEKWLKL  118

Query  589   RKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGS  768
             RKL+N+ FH ESL+ M+ AM+ S E M+E W  HEG EI+ F+EF +L SE+I R+AFGS
Sbjct  119   RKLSNHAFHAESLKSMISAMVTSVEMMLERWGHHEGNEIDVFKEFLVLGSEIICRSAFGS  178

Query  769   NYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKK  948
             +Y EG+  F+ +I+L  +  +N   ++ PG+  +MK  D++ES+ ++ G+RN I+ +IKK
Sbjct  179   SYSEGQRTFDKIIQLILIIDRNKYRIKIPGIRYLMKTRDDVESDNIQNGIRNSIMNMIKK  238

Query  949   REQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLG  1128
             RE+      Q +   SDFL  LL+A+H  +   ++ +E ++DECK+FY AG  TT +LL 
Sbjct  239   REEAAMFS-QSNDYGSDFLGLLLKAHHDSDMTKRLAVEEIIDECKSFYHAGQGTTATLLS  297

Query  1129  WATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRK  1308
             W   LLA H DWQ +ARKEV+E+FGQ+NP+P  ++R+KI++MI+ E LRLY PV  + R+
Sbjct  298   WIVFLLAVHTDWQAKARKEVIELFGQKNPSPDSLSRMKIVSMIINEALRLYSPVVTLPRE  357

Query  1309  VEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAF  1488
             V ++ V LGN+ LP NI + I  +AL HDPEIWG+DV+ FKPERFAEG+ KATNN+  A+
Sbjct  358   V-RRQVRLGNLFLPANIIIEIPVIALHHDPEIWGEDVYLFKPERFAEGLAKATNNNVNAY  416

Query  1489  LPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LPF  GPR+C+G NFA  E KI LSMILQRY   LS +YVHSPVQ+  + P+ G+Q++LH
Sbjct  417   LPFSLGPRSCVGYNFANTETKIALSMILQRYRFTLSPTYVHSPVQILAMCPQHGMQIVLH  476

Query  1669  RI  1674
              +
Sbjct  477   PV  478



>ref|XP_007210003.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
 gb|EMJ11202.1| hypothetical protein PRUPE_ppa016601mg [Prunus persica]
Length=561

 Score =   506 bits (1303),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/499 (51%), Positives = 337/499 (68%), Gaps = 37/499 (7%)
 Frame = +1

Query  178   LAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHD  357
             LA   +  KLWW P  IQKLM+ QGIKGPSYR +HGNT+EIS  ++   ++P   +LSHD
Sbjct  100   LAFFKIFHKLWWTPTQIQKLMALQGIKGPSYRLIHGNTQEISNMQKEAMARP--RNLSHD  157

Query  358   VFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRR  537
             VF  + PH++SW ++YG  FL W GPQP LV+ + EL KEIL+++   YPK     F  +
Sbjct  158   VFALVQPHLHSWTKIYGKTFLQWDGPQPVLVIVDPELCKEILNNKHRAYPKSNPVAFVMK  217

Query  538   LLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFE  717
             LLG+G+  S+                       + AMI SA+TM+E W  HE KEIE FE
Sbjct  218   LLGNGLVMSQ----------------------RIHAMIASADTMLERWENHEAKEIEVFE  255

Query  718   EFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELES  897
             EFRLLTSEVISRTAFGS+YLEGK+IFEML+K+ +L  K  L  +FPG+SR +K NDE+E 
Sbjct  256   EFRLLTSEVISRTAFGSSYLEGKDIFEMLLKISSLTFKTALKPKFPGLSRFVKTNDEIEM  315

Query  898   EKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDE  1077
             EKLE+ +R  II+I+KKRE+ K    ++ S RSDFL  LL+A    N + +I ++ +V+E
Sbjct  316   EKLEKRIRETIIEIVKKRER-KVMPGEEGSLRSDFLGLLLKAYLDTNDNQRISLDDLVEE  374

Query  1078  CKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMI  1257
             CKTFY AGHE+T + L W              ARKEV+++FG++ P P GIA+LK M+MI
Sbjct  375   CKTFYLAGHESTATFLAWT------------EARKEVLQLFGKQTPNPKGIAKLKTMSMI  422

Query  1258  LEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPE  1437
             + E+LRLYPPV  + R+  ++ V LG + LP N+ L I  +A  +D E+WG+DV  FKPE
Sbjct  423   MYESLRLYPPVVLVIRRRVEREVKLGRLILPANLELAIPIVAFHYDSELWGQDVQLFKPE  482

Query  1438  RFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSP  1617
             RFAEGVVKAT+ +  AFLPFG GPR C+GLNFA+ EAKI LSMILQR++  LS +Y HSP
Sbjct  483   RFAEGVVKATDENIAAFLPFGMGPRICVGLNFAITEAKIALSMILQRHAFTLSPAYTHSP  542

Query  1618  VQLFMLRPKDGVQVILHRI  1674
              Q   +RP+  VQV+LH +
Sbjct  543   SQFLTVRPQHEVQVMLHSL  561



>ref|XP_010054392.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=476

 Score =   502 bits (1293),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 333/478 (70%), Gaps = 8/478 (2%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M++QGI+GP Y F HG+TKE+ + ++ +T +PM  +LSHD+FP + PH+Y W + YG NF
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM--NLSHDIFPYVQPHLYEWTKTYGRNF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L W G Q  LV+++ E+VKE+L++R   Y K  +Q   ++ +GDG+ + +GEKWA+ RKL
Sbjct  59    LMWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN  FH E+L+GM+PAM++SA TM++ W   EGKEI+ ++E RL  S+VIS+TAFGS+Y 
Sbjct  119   ANFAFHRENLKGMIPAMVDSAHTMLKRWSGREGKEIDVYKELRLYASDVISKTAFGSSYT  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGK+IFE + KL  L   N  +  FP + ++ +   E+E EK+E+G R  +++IIKKR Q
Sbjct  179   EGKSIFENVNKL-ILVMVN-ASSSFPILRKLWRPAYEIEGEKIEKGFREAVLEIIKKR-Q  235

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWAT  1137
              K    +  S  +DFL  LL A+H+ +   +I I+ +V ECKTFY AGHET TS L W  
Sbjct  236   EKVNSGELESYGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWTV  295

Query  1138  LLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEK  1317
             LLL+ H DWQE ARKE   VFG ++P   GI +LK + MI+ E+LRLYPP  +I R+V +
Sbjct  296   LLLSIHTDWQEEARKEAFNVFGNQDPDLDGITKLKTIGMIINESLRLYPPATFISREVSR  355

Query  1318  KNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPF  1497
             +   LGN  LP  I L+I  L + HDP+IWG D H FKPERF +GV KAT+N+P  FLPF
Sbjct  356   Q-AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPF  414

Query  1498  GYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHR  1671
             G GPR+C+G NF + EAKIVLSMILQRY+  LS +YVHSP QL +  PK GVQ  LH+
Sbjct  415   GLGPRSCVGSNFVVVEAKIVLSMILQRYAFNLSPAYVHSPAQLLIAYPKYGVQ--LHK  470



>gb|KCW86465.1| hypothetical protein EUGRSUZ_B03133 [Eucalyptus grandis]
Length=511

 Score =   502 bits (1292),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 247/495 (50%), Positives = 338/495 (68%), Gaps = 7/495 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  + +  + + PM ++LSHD+FP
Sbjct  19    AKLLHKLWWNPLRIQRMMAQQGISGPPYRFLHGSTKETIKMKMEVRNTPM-NNLSHDIFP  77

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P + +W   YG N+L W GPQ +LV+TE EL+KE+L DR+  YPK   + F+++LLG
Sbjct  78    KIHPQVNTWIDTYGKNYLSWHGPQAQLVITEPELIKEVLLDREKTYPKTGTKDFAKKLLG  137

Query  547   DGIGSS-KGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+   +KWA  RKLAN+ FHGESL+ M PAM+ES  TM+  W+  EGKEIE F EF
Sbjct  138   DGLVSTVDDKKWANQRKLANHAFHGESLKNMAPAMVESVHTMLGKWKNQEGKEIEVFGEF  197

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             +LLTSEVISRTAFGS+Y+EG+NIF+ML +L TL SKN  N+R PG+ R         SEK
Sbjct  198   KLLTSEVISRTAFGSSYVEGRNIFQMLTELATLTSKNAFNIRLPGI-RYHAFFLRKFSEK  256

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+RN I+++IK+RE+     E+      DFL +L++A H  +   +  ++ +VDECK
Sbjct  257   LEKGIRNSILEMIKRREKKVMASEE-DGFGDDFLGQLVKALHDTDKSKKFTVDNLVDECK  315

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILE  1263
             TFY AG ET  S++ W   LLA + +WQE AR+EV+ VFG ++P   G+ +LK  +   E
Sbjct  316   TFYIAGQETANSMMAWMLFLLAINPEWQEEARREVLNVFGNKDPDSDGLGKLKKHDH--E  373

Query  1264  ETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERF  1443
                   PP   + RKV KK  +   + LP N  ++I  L L HDPEIWG+D H+FKPERF
Sbjct  374   RNSAFVPPAVDLTRKVGKKLRLG-KLLLPANSQIFIPTLKLHHDPEIWGEDAHEFKPERF  432

Query  1444  AEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQ  1623
             +EG+ KATNN+ + F+PFG+G R+C+G++F  AE KI  SMILQRY+  LS +Y+H P Q
Sbjct  433   SEGIAKATNNNAVIFIPFGFGRRSCIGMSFVAAEVKIAFSMILQRYTFELSPTYIHCPGQ  492

Query  1624  LFMLRPKDGVQVILH  1668
             L    P+ G+Q+  H
Sbjct  493   LLTTCPQHGLQIRFH  507



>emb|CDP12576.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   501 bits (1290),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 250/521 (48%), Positives = 352/521 (68%), Gaps = 25/521 (5%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+   ++ A   +   +WW P+ IQ ++ SQGIKGP    LHG+ +E+ + +   T    
Sbjct  11    FVLIYILFALIKVLHIIWWKPMRIQHILESQGIKGPPRSILHGSPRELPKKKENTT----  66

Query  337   EDDLSHDVFPRILPHIYSWKRLY-GANFLYWL-GPQPELVVTEAELVKEILSDRKGDYPK  510
               +LSHD+FP I PHIYSW  +Y G  FL W  G   ELV+T+ +L+KEIL+D++  +  
Sbjct  67    --NLSHDIFPVIQPHIYSWMNIYEGKIFLRWRRGAGAELVITDLDLIKEILNDKEQFFTI  124

Query  511   IELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGE--------------SLRGMLPAM  648
              +L  + ++++G G+G S GEKW ++RKLAN  FH                + R M PAM
Sbjct  125   AKLSKYLKKIVGGGLGQSDGEKWVKLRKLANQAFHVRKQADFILLILLLICASRDMTPAM  184

Query  649   IESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLAS  828
             +ES E M+  W +++GKEI+  EEF LLT+EVISRTAFGS+Y+EG+ IF M+ +L  L  
Sbjct  185   VESVEMMLRRWSDYDGKEIDVSEEFMLLTAEVISRTAFGSSYVEGEQIFNMMKRLGILTG  244

Query  829   KNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLE  1008
             K    ++ P + +  K+ D++ES+KLE+G+++ I++I+KKRE+ K G+  K S   DFL 
Sbjct  245   KIAYKLKPPFIRKFFKDGDDIESDKLEKGIQDSIVEIVKKREKGKKGD-NKQSFGEDFLG  303

Query  1009  KLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEV  1188
              LL+A++  + ++ I IE ++DECKTFY AGH TT+ LL W  LLLA + DWQE+AR+EV
Sbjct  304   LLLKAHYDCSDNDNISIEEIIDECKTFYGAGHGTTSILLSWTILLLAINTDWQEKAREEV  363

Query  1189  MEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLY  1368
              ++FGQ++P   GI+RLK ++MI+ ETLRLYPP  Y  R+  K+   LGN  LP ++++ 
Sbjct  364   TKLFGQDHPNSEGISRLKTISMIINETLRLYPPAIY-ARRTTKEGAKLGNYKLPADLNIS  422

Query  1369  ISPLALQHDPEIWGKDVHKFKPERFAEGVVKATN-NHPIAFLPFGYGPRTCLGLNFAMAE  1545
             I+ LA+ HDP+IWG D H F PERF++GV  AT  N+P AFLPF  GPRTC+G NFA+ E
Sbjct  423   IAILAVHHDPQIWGDDAHLFNPERFSQGVSGATKINNPAAFLPFSLGPRTCVGSNFAITE  482

Query  1546  AKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              KI LSMILQRY+  LS SYVH+PVQ+F L P+ GVQV+LH
Sbjct  483   VKIALSMILQRYAFTLSPSYVHAPVQMFALMPQHGVQVVLH  523



>ref|XP_002316009.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
 gb|EEF02180.1| hypothetical protein POPTR_0010s14940g [Populus trichocarpa]
Length=555

 Score =   500 bits (1288),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 246/533 (46%), Positives = 343/533 (64%), Gaps = 51/533 (10%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+WW P+ IQ  + SQG+KGPSYRFLHGN KEI   R+   S P E  L H  F RI PH
Sbjct  32    KVWWTPIRIQSALHSQGVKGPSYRFLHGNLKEIINLRKEAMSSPTE--LCHQSFSRIQPH  89

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGI--  555
             +Y W +L+G NF +W G Q +LVV E E +K +L+++ G+Y K E+Q + ++L GDG+  
Sbjct  90    VYLWSKLHGKNFFWWKGSQAQLVVYETEQIKVVLNNKDGNYLKPEVQPYLKKLFGDGLVT  149

Query  556   --------------------------------------GSSKGEKWARMRKLANNVFHGE  621
                                                   G S  + W    +L  ++  G 
Sbjct  150   TRVASECPSNIFTRLYIKMYIHMDEERFAPSGLMFEPCGCSYDDHW----RLTWSLTSGS  205

Query  622   S--LRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIF  795
                +  M+P M+ S E M+  W++H GKEIE F++F++LTSE+ISRTAFGS+YLEG+ IF
Sbjct  206   VGLVEDMIPEMVSSVEMMLGRWKDHRGKEIEVFQDFKVLTSEIISRTAFGSSYLEGQQIF  265

Query  796   EMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEE  975
             E+L ++  + SKN   +R PG+ +++K  D+++SEKL + +RN +I++IKKRE    GE 
Sbjct  266   EILTRMVLIFSKNLFKMRIPGIGKLVKTQDDIQSEKLGQLIRNSVIKMIKKREAAMAGE-  324

Query  976   QKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATH  1155
                   SDFL +L++     +  ++I I+ ++DECK FY AGHETTTS L W  L+LATH
Sbjct  325   -IDGYGSDFLGQLVKVYRSADMTSRITIDDLIDECKNFYIAGHETTTSALTWIVLMLATH  383

Query  1156  EDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLG  1335
              DWQE+ R E++E+FGQ+NP+  GI+RLK M+M++ E+LRLYPPV  + R+V KK   LG
Sbjct  384   ADWQEKVRNEILELFGQQNPSLEGISRLKTMSMVINESLRLYPPVVGLLREV-KKGTKLG  442

Query  1336  NITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRT  1515
             N+ +P  + +++  LAL HDP+IWG DVH FKP+RFAEGV KAT N+  AFLPFG GPR 
Sbjct  443   NLIIPEKMEVHVPSLALHHDPQIWGDDVHLFKPDRFAEGVAKATKNNISAFLPFGMGPRN  502

Query  1516  CLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             C+G+NFA  E KI LSMILQRY + LS +YVHSPV +  + P+ G+QV +  +
Sbjct  503   CVGMNFAYNEIKITLSMILQRYRITLSPNYVHSPVLVLAICPQHGLQVTIKAV  555



>ref|XP_008446467.1| PREDICTED: cytochrome P450 CYP749A22-like [Cucumis melo]
Length=525

 Score =   497 bits (1280),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 240/494 (49%), Positives = 342/494 (69%), Gaps = 9/494 (2%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  +LWW P+ IQ+LM SQGI+GPSY  + GNTKE+   R    +KPM+  LSH + PR+
Sbjct  27    LLGRLWWRPMKIQQLMRSQGIQGPSYNLIQGNTKEMYSKRIKAMAKPMQ--LSHHILPRV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             LPHI+SW   YG N++ W G    LV+TE EL+KE+L+++  D+PK +LQG   ++ G+G
Sbjct  85    LPHIHSWLNQYGRNYVQWFGADAHLVITEPELIKEVLNNQHKDFPKAKLQGHIHKIFGNG  144

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +++G++W   RKLA+  FHG+SL+ M+P+M++ AETMVE W +HE KEI+ FE F++ 
Sbjct  145   LATAEGQRWVNSRKLAHFAFHGDSLKNMIPSMVQCAETMVEEWEQHEEKEIDVFEHFKVY  204

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VIS TAFGS+Y +G+NIF+ML +L  L   N   VR P +S+I+K+ D++E E LE+
Sbjct  205   TLDVISHTAFGSSYEQGRNIFQMLQRLCELYITNRYKVRLPVISKILKSEDDIEGESLEK  264

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
              +++  ++IIK RE  K   +      +DFL  L++A +      +I +E +VDECKT Y
Sbjct  265   KMKDCFVEIIKAREDQKMNNDYG----NDFLGLLVKAKNDPQKSQRISLEDVVDECKTLY  320

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
             FAGHETT+ LL W   LLA H++WQE+AR EV ++FG  NPT   + +LK M+MI+ E+L
Sbjct  321   FAGHETTSLLLAWTMFLLALHKEWQEKARNEVFDLFGHSNPTFEALPKLKTMSMIIHESL  380

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV  + RKVEK+   LG + LP  +H+ I   A+ HD E+WG+    FKPERF+EG
Sbjct  381   RLYPPVMTLVRKVEKE-TRLGRLVLPSGVHVVIPTAAIHHDEELWGRSADDFKPERFSEG  439

Query  1453  VVKATNNHPIA--FLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQL  1626
             + KAT  +P+   +LPFG G R+C+G+NFA+ EAKI +SMILQR+S  LS +Y HSP   
Sbjct  440   IAKATERNPVGGTYLPFGLGSRSCVGMNFALNEAKIAISMILQRFSFTLSPAYAHSPAMF  499

Query  1627  FMLRPKDGVQVILH  1668
               + P+ G+Q+ILH
Sbjct  500   LTIAPQHGLQLILH  513



>gb|KCW44611.1| hypothetical protein EUGRSUZ_L01872 [Eucalyptus grandis]
Length=495

 Score =   494 bits (1273),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 242/494 (49%), Positives = 333/494 (67%), Gaps = 22/494 (4%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P+ IQ  M++QGI+GP Y F HG+TKE+ + ++ +T +PM  +LSHD+FP +
Sbjct  24    ILHKLWWNPLRIQGKMAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM--NLSHDIFPYV  81

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PH+Y W + YG NFL W G Q  LV+++ E+VKE+L++R   Y K  +Q   ++ +GDG
Sbjct  82    QPHLYEWTKTYGRNFLMWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDG  141

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + + +GEKWA+ RKLAN  FHGE+L+ M+PAM++SA TM++ W + EGKEI+ ++E RL 
Sbjct  142   LATFRGEKWAKHRKLANFAFHGENLKDMVPAMVDSAHTMLKRWSDREGKEIDVYKELRLY  201

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
              S+VIS+TAFGS+Y EGK+IFE + KL  L   N  +  FP + ++ ++  E+E EK+E+
Sbjct  202   ASDVISKTAFGSSYTEGKSIFENVNKL-ILVMVN-ASSSFPILRKLWRSAYEIEGEKIEK  259

Query  913   GVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             G R  +++IIKKR Q K    +  S  +DFL  LL A+H+ +   +I I+ +V ECKTFY
Sbjct  260   GFREAVLEIIKKR-QEKVNSGELESYGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFY  318

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETL  1272
              AGHET TS L W                 E   VFG ++P   GI +LK + MI+ E+L
Sbjct  319   IAGHETATSFLAWT----------------EAFNVFGNQDPDLDGITKLKTIGMIINESL  362

Query  1273  RLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEG  1452
             RLYPPV +I R+V ++   LGN  LP  I L+I  L + HDP+IWG D H FKPERF +G
Sbjct  363   RLYPPVTFISREVSRQ-AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDG  421

Query  1453  VVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFM  1632
             V KAT+N+P  FLPFG GPR+C+G NF + EAKIVLSMILQRY+  LS +YVHSP QL +
Sbjct  422   VAKATSNNPATFLPFGLGPRSCVGSNFVVVEAKIVLSMILQRYAFTLSPAYVHSPAQLLI  481

Query  1633  LRPKDGVQVILHRI  1674
               PK GVQV  + I
Sbjct  482   AYPKYGVQVFFNSI  495



>ref|XP_007224911.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
 gb|EMJ26110.1| hypothetical protein PRUPE_ppa021901mg [Prunus persica]
Length=451

 Score =   493 bits (1268),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 237/421 (56%), Positives = 315/421 (75%), Gaps = 5/421 (1%)
 Frame = +1

Query  415   FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRK  594
             FL W G Q +LV+ E EL KEIL+++ G + K + Q + ++LLGDG+ + +GEKW ++RK
Sbjct  35    FLQWYGSQAQLVIVEPELCKEILNNKDGAFAKRKPQSYVKKLLGDGLATIEGEKWGKLRK  94

Query  595   LANNVFHGESLRGMLPAMIESAETMV-EAWREHEGKEIEAFEEFRLLTSEVISRTAFGSN  771
             LAN+ FH ESL+ M+P M+ SAETM+ E W+ +EGKEIE FE FR+ TSEVISRTAFGS+
Sbjct  95    LANHAFHAESLKSMVPEMVASAETMLLEGWKNNEGKEIEVFEPFRMFTSEVISRTAFGSS  154

Query  772   YLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             YLEG+N+FE L+KL  L  KN L VRFPG+S+  K +DE+ESEKL++G+ N II I++KR
Sbjct  155   YLEGQNLFENLMKLSFLIFKNALTVRFPGISKFFKTSDEIESEKLQKGMHNSIIGIVEKR  214

Query  952   EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGW  1131
             E+ K  + ++ S  SDFL  LL+A+H  N   +I ++ +VDECKTFYFAG ETT S+L W
Sbjct  215   EK-KAMDGEEDSFGSDFLGLLLKAHHDTNDSQRISVDDLVDECKTFYFAGQETTNSMLAW  273

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
                LLA + DWQE ARKEV+++FG++NP P G+++LK+M  I+ E+LRLYPPV  ++RKV
Sbjct  274   TVFLLALNTDWQEEARKEVLQLFGRQNPNPDGLSKLKLM--IINESLRLYPPVVSVERKV  331

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
              ++ V LG + +P N+ L I  LA+ HDPE WG+DV  FKPERF EGV KAT+N+  AFL
Sbjct  332   -RREVRLGKLIVPANVELIIPILAIHHDPEFWGEDVQLFKPERFEEGVAKATHNNIAAFL  390

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHR  1671
             PFG GPRTC+  NFA+ EAKI LSMILQRY+  LS +YVHSP +   +RP+ GVQV LH 
Sbjct  391   PFGMGPRTCVAFNFAITEAKIALSMILQRYTFTLSPAYVHSPYEYLTVRPQHGVQVALHS  450

Query  1672  I  1674
             +
Sbjct  451   L  451



>gb|KDP35170.1| hypothetical protein JCGZ_10704 [Jatropha curcas]
Length=522

 Score =   495 bits (1274),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/493 (48%), Positives = 342/493 (69%), Gaps = 6/493 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             K+W  P+ IQ +M SQGIKGPSY+  +GNTKEI    +   +   ++  SH VFP ILPH
Sbjct  28    KVWGTPMRIQSMMRSQGIKGPSYKLFYGNTKEILRMNKKALTDTKKELSSHQVFPTILPH  87

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             ++SW +LYG NFL+W G Q  L ++E  L+K+++ +R G + K     ++R+LLGDGI  
Sbjct  88    LHSWMKLYGKNFLWWEGAQAFLEISEPNLIKDMMENRYGVFHKPIPDDYNRKLLGDGIAI  147

Query  562   SK-GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTS  738
             ++  EKW ++RK++N+ FH E L+ M PAMI S E M+E W+ HEGKE E F+EF LL+S
Sbjct  148   TRVPEKWLKLRKISNHAFHAECLKNMFPAMITSVEMMIERWKHHEGKEHEVFQEFILLSS  207

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             E+ISRTAFGS+YLEG+ IF+ML +L  +  +N   +R PG+  ++KN D++ES+K++ G+
Sbjct  208   EIISRTAFGSSYLEGQRIFDMLTQLIFIIDRNKYRIRIPGIRYLVKNRDDIESDKIDIGI  267

Query  919   RNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD---NQICIEAMVDECKTF  1089
              N I+ +IKKRE+ +    Q +   SDFL  LL+A+H  N     N+I +E ++D+CK F
Sbjct  268   HNAILNMIKKREE-EAMMSQSNGFGSDFLGILLKAHHDNNDSDETNRISVEEIIDDCKIF  326

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             Y AG  T  + L W   LL+ H DWQE+ARKEV E+FGQ+NP+P  +++LKI++MI  E 
Sbjct  327   YAAGQGTVATSLTWTLYLLSIHTDWQEKARKEVFELFGQKNPSPDSLSKLKIVSMIYNEA  386

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPP+  I ++  ++ V +GN+ +P N  + +  +A+ HDPEIWG+DV+ FKPERFAE
Sbjct  387   LRLYPPILTIAKEALRE-VKIGNLVVPANTVVEVPVVAVHHDPEIWGEDVYLFKPERFAE  445

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             G+ KATNN+   +LPF  GPR C+G  FA+ EAKI LSMILQ +   LS +YVHSP+ L 
Sbjct  446   GLAKATNNNVNGYLPFSLGPRHCVGDKFALTEAKITLSMILQHFRFNLSPNYVHSPIPLL  505

Query  1630  MLRPKDGVQVILH  1668
              + P+ G++++ H
Sbjct  506   TIYPEHGMKIMFH  518



>ref|XP_006348799.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=423

 Score =   491 bits (1264),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 323/425 (76%), Gaps = 3/425 (1%)
 Frame = +1

Query  400   LYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKW  579
             + G NFL W G +P L VTE EL+KEILS+++  YPK++++G++++LLG+ + +++GEKW
Sbjct  2     IAGRNFLTWHGSKPYLFVTEPELIKEILSNKEDTYPKMDMEGYAKKLLGEALITNEGEKW  61

Query  580   ARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTA  759
             A++RKLAN+ FH ESL+ M+P M ES + M+E W+EHEGKE + F++F LLT+EVISRTA
Sbjct  62    AKVRKLANHTFHAESLKRMVPEMSESVQKMLERWKEHEGKEFDVFKDFGLLTTEVISRTA  121

Query  760   FGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQI  939
             FGS+Y+EGK+IFEM+ KL  +  KN   VRFPG+S +++ +DE+E+EKLE G++N I+++
Sbjct  122   FGSSYMEGKHIFEMVAKLTAITVKNVYTVRFPGISWLIRTDDEIEAEKLERGIKNSILEL  181

Query  940   IKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTS  1119
             + KRE+ K G  +K    +D+L +L++  H+ + +  I I+ M+DE +T Y AGH TTTS
Sbjct  182   VSKREKGKDGMSEKFG--NDYLGQLMKLLHESDTNKSITIDQMIDEVRTLYGAGHLTTTS  239

Query  1120  LLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYI  1299
             LLGW+  LLA H +WQE+ARKEV+   G ENPT   IARL+ MNMI+ E +RLYPPV  +
Sbjct  240   LLGWSVFLLALHPEWQEKARKEVVAFCGLENPTSDAIARLRTMNMIINECMRLYPPVIIV  299

Query  1300  KRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHP  1479
              RKVE++ V LG++TLP N+ +++  LAL HDP IWG+DVH FKPERFAEGV KATNN+ 
Sbjct  300   TRKVERE-VRLGSMTLPANMTIFMPILALHHDPRIWGEDVHVFKPERFAEGVAKATNNNA  358

Query  1480  IAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQV  1659
              AF PFG GPRTC+GLNF   EAKI LSMILQRY   LS +YVH P  +F+L PKDGV+V
Sbjct  359   AAFFPFGSGPRTCVGLNFTTNEAKITLSMILQRYKFTLSPNYVHYPSDIFLLTPKDGVKV  418

Query  1660  ILHRI  1674
             +L  I
Sbjct  419   VLESI  423



>gb|KHG20729.1| hypothetical protein F383_28301 [Gossypium arboreum]
Length=936

 Score =   508 bits (1308),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 251/487 (52%), Positives = 335/487 (69%), Gaps = 5/487 (1%)
 Frame = +1

Query  217   PVH-IQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSW  393
             P H IQ +M+SQGIKGP Y F++GN KE ++      SKPM   L HD+FPR+ PH+YS 
Sbjct  450   PQHGIQHMMNSQGIKGPPYAFIYGNNKEATKTTNEALSKPMA--LRHDIFPRVQPHVYSC  507

Query  394   KRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGE  573
                YG N+L W G +PELV+TE ELV E+L      +PK +   F   + G+G+ ++ GE
Sbjct  508   INRYGRNYLAWDGKRPELVITEPELVNEVLKHSVTTFPKRKPTFFLTGIFGNGLVTALGE  567

Query  574   KWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISR  753
             KW + RKLAN  FHGESL+ M PA+I S ETM+E W+ + GKEIE + EFRLLTSEVISR
Sbjct  568   KWVKQRKLANYAFHGESLKNMTPAVIASVETMLEKWKGYVGKEIEVYHEFRLLTSEVISR  627

Query  754   TAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGII  933
             TAFGS+YLEG+ IF+ML KL  + S+NF   R P +++  K+ D LESE+L +G+++ ++
Sbjct  628   TAFGSSYLEGEKIFDMLNKLSIIRSRNFFETRIPLINKFWKSGDVLESEELSKGIQDCVM  687

Query  934   QIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETT  1113
             +I+KKRE  K    +  S  +DFL  L+ A H  + +N++  E +VDECKTFYFAG +T 
Sbjct  688   KIVKKRED-KVVNGEVDSFGNDFLGLLVNAYHDSDENNRLSTEDLVDECKTFYFAGQDTV  746

Query  1114  TSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVP  1293
              SL+ W   LLA H DWQE+AR+EV+E+FG + P    +++LKIM MI+ ETLRLY P  
Sbjct  747   NSLIAWIVFLLAIHGDWQEKARREVIEIFGNQIPNSEEMSKLKIMTMIIYETLRLYGPSN  806

Query  1294  YIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNN  1473
              + R+ E  +V LG + LP N+ L +   A  HDP++WG DVH FKPERFAEG+ KATN 
Sbjct  807   GMMRRTE-SDVQLGKLILPANLDLLVIHSAPHHDPQLWGDDVHLFKPERFAEGIAKATNY  865

Query  1474  HPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGV  1653
             +   F PFG GPR C+G NFA  E KIVLSMILQRY++ LS +YVHSP+    ++P+ G+
Sbjct  866   NAGVFCPFGLGPRNCVGTNFATMETKIVLSMILQRYTIYLSPTYVHSPIPYITVQPQHGI  925

Query  1654  QVILHRI  1674
             QVIL  +
Sbjct  926   QVILESL  932


 Score =   504 bits (1298),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 339/478 (71%), Gaps = 19/478 (4%)
 Frame = +1

Query  235   LMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGAN  414
             +++SQGIKGP YRF+HGN +EI++ R+  +SKPM   L+HD+FP++ PHIYSW   YG N
Sbjct  1     MLNSQGIKGPPYRFIHGNNREIAKMRQEASSKPMA--LTHDIFPKVQPHIYSWINKYGRN  58

Query  415   FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRK  594
             +LYW G + ELV++E ELVKEIL + +  +PK +   +  +LLG+G+ + +GEKWA+ RK
Sbjct  59    YLYWNGVRAELVISEPELVKEILKNSEKTFPKRKPTIYLSKLLGNGLVTVEGEKWAKQRK  118

Query  595   LANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNY  774
             LAN VFHGESL+ M PA+I S ETM++ W+  EGKEIE F EFRLLTSEVISRTAFGS+Y
Sbjct  119   LANYVFHGESLKNMTPAVIASVETMLQKWKGQEGKEIEVFNEFRLLTSEVISRTAFGSSY  178

Query  775   LEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKRE  954
             LEG+ I+  L+                  S++ K  D LESE+L + +++ +++I+KKRE
Sbjct  179   LEGEKIWLTLVF---------------SSSKLWKPADMLESEELAKEIQDCVMKIVKKRE  223

Query  955   QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWA  1134
               K    +  S  +DFL  L+ A H  + +N++ +E +VDECKTFYFAG +T  +LL W 
Sbjct  224   D-KVVNGEADSFGNDFLGLLVNAYHDSDKNNKLSMEDLVDECKTFYFAGQDTVNALLAWT  282

Query  1135  TLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVE  1314
              LLLA H DWQ++AR+EV+ +FG +NP P GIA+LK M MI+ ETLRLY     + R+V 
Sbjct  283   VLLLAIHGDWQDKARREVIGIFGNQNPQPEGIAKLKTMTMIINETLRLYSSSNGMLRRV-  341

Query  1315  KKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLP  1494
              ++V +  + LP NI L I+   L HDP++WG+DVH FKP+RFAEG+ KATN +  AFLP
Sbjct  342   GRDVQMEKVVLPANIDLLIANAVLHHDPQLWGEDVHLFKPDRFAEGIAKATNYNAAAFLP  401

Query  1495  FGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             FG GPRTC+G+ FA  E KI LSMILQRY++ LS +YVHSP+ +  L+P+ G+Q +++
Sbjct  402   FGLGPRTCVGMTFATTETKIALSMILQRYAITLSPAYVHSPIPVISLQPQHGIQHMMN  459



>gb|KCW85143.1| hypothetical protein EUGRSUZ_B01987 [Eucalyptus grandis]
Length=495

 Score =   493 bits (1268),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 240/508 (47%), Positives = 346/508 (68%), Gaps = 32/508 (6%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSK--  330
             F+SS+L      L +KLWW P+ +Q+ M+SQGIKGP  +F+HG TKEI + ++ IT K  
Sbjct  14    FLSSILTK----LLQKLWWRPIRVQRAMASQGIKGPPCKFIHGCTKEIYKLKKDITMKMN  69

Query  331   -PMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM + +SH++ P + PHI+ W +LYG  +L+W GPQ  L++++ ELVKE+L++R   Y 
Sbjct  70    EPMTN-VSHEILPIVEPHIHKWNKLYGGIYLHWYGPQAFLIISDTELVKEVLNNRDKTYV  128

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             K+E  G  +++LGDG+ +++G+KWAR R+LA+  FHGE L+GM+PAM++S   +++ W++
Sbjct  129   KLEFPGDIKKILGDGLVATEGKKWARQRRLAHLAFHGECLKGMIPAMVDSVHALLDRWQK  188

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
              E KE+E FEEF ++TS+VISRTAFGS+Y+EG+ IF++                      
Sbjct  189   LEAKEVELFEEFAMITSDVISRTAFGSSYIEGREIFQI---------------------N  227

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             I K +D+++SE+LE+ + + ++ II+KRE+ K    +     +D+L  LL+A H  +   
Sbjct  228   IWKTSDDIKSERLEKAICDALLGIIEKREK-KVNVGEMDDYGNDYLGSLLKAYHDPDKSK  286

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I I+ ++DEC+TF+F+G ETTTS+L W   LLA H+DWQE ARKEV +VFG E+P   G
Sbjct  287   RITIDDLMDECRTFHFSGQETTTSILTWTLFLLAIHKDWQEEARKEVTDVFGNEDPNHEG  346

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I +LK + MI+ E+LRLYPPV    RKV ++ V LG++ LP  I L I  L + H P IW
Sbjct  347   IMKLKTVGMIINESLRLYPPVVNTIRKVVRQ-VTLGDLVLPQGIALQIPILTIHHSPRIW  405

Query  1408  GKDVHKFKPERFAEGVVKA-TNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             G DVH FKPERF EGV  A +N+   AFLPFG GPR C+G NFA  E KI+L+MIL+ YS
Sbjct  406   GDDVHLFKPERFREGVAGAVSNDAAAAFLPFGLGPRNCVGSNFATTEVKIILAMILRHYS  465

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILH  1668
               +S  YVH P Q+  +RP+ G++VILH
Sbjct  466   FTVSPDYVHLPTQILTIRPQHGLKVILH  493



>gb|KHG16163.1| Cytochrome P450 protein [Gossypium arboreum]
Length=479

 Score =   492 bits (1266),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 346/481 (72%), Gaps = 8/481 (2%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M+SQGI+GP Y F+HGN KE ++     ++KPM   L+HD+FPR++P +YSW   YG  +
Sbjct  1     MNSQGIRGPPYEFIHGNNKEAAQMLMEASTKPMA--LTHDIFPRVMPQVYSWVNKYGKTY  58

Query  418   LYWLGPQPELVVTEAELVKEIL--SDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMR  591
             L W G + +L++T+ +LVKE+L  SD+    PK     F  +L+GDG+ +++ EKWAR R
Sbjct  59    LSWNGIRAQLLITDPDLVKEVLKNSDKAFRMPKASY--FFDKLVGDGLATTEREKWARQR  116

Query  592   KLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSN  771
             KLAN  FHGESL+ M PA++ S ETM+E W+ +EGKEIE F+EFRLLTSEVISRTAFGS+
Sbjct  117   KLANYAFHGESLKNMTPAVVASVETMLEKWKSNEGKEIEVFQEFRLLTSEVISRTAFGSS  176

Query  772   YLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             YLEG+ IF+ML+KL  +A +N    + P +S++ K+ DE+E+E++ + + + +++I+KKR
Sbjct  177   YLEGEKIFDMLMKLSVIAGRNIYKAKIPIISKLWKSADEIEAERIAKMIHDSVMRIVKKR  236

Query  952   EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGW  1131
             E+     E  +  R DFL  L+ A H+ +  N++ I+ +VDECKTFY AG ET  SLL W
Sbjct  237   EERVVNGEADNFGR-DFLGLLVNAYHEVDEKNRLSIQDLVDECKTFYVAGQETVNSLLAW  295

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
             ATLLLA H DWQ++AR EV+EVFG +NP   G+A+LK + MI+ ETLRLYPP+     +V
Sbjct  296   ATLLLAIHSDWQDKARAEVIEVFGNQNPDSEGMAKLKTITMIIYETLRLYPPISGSIGEV  355

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
              ++ V LG + LP ++ +Y+  +AL HDP++WG DV+ FKPERFAEG+ KAT  +  AF+
Sbjct  356   -RREVRLGKLVLPTHLEVYMRIIALHHDPDLWGDDVNLFKPERFAEGIAKATKYNAAAFM  414

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHR  1671
             PFG GPR+C+G++FA+ E K  LSMILQRY++ +S +YVH+P     L+P+ G+Q++ H 
Sbjct  415   PFGLGPRSCVGMSFAITEVKTTLSMILQRYTVTVSPTYVHAPAPRITLKPQHGIQLLFHS  474

Query  1672  I  1674
             +
Sbjct  475   L  475



>gb|KDP35176.1| hypothetical protein JCGZ_10710 [Jatropha curcas]
Length=448

 Score =   489 bits (1259),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/447 (52%), Positives = 326/447 (73%), Gaps = 7/447 (2%)
 Frame = +1

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEA-ELVKEILSDRKGDYPKIEL  519
             +LSH VFP +LPH +SW +LYG NFL W GPQ  LV +E  ELVKEI ++R G +PK E 
Sbjct  2     ELSHQVFPTVLPHFHSWMKLYGKNFLRWQGPQAYLVFSEPNELVKEIFNNRDGAFPKPEP  61

Query  520   QGFSRRLLGDGIGSSK-GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
               ++++L+G+GIG+++  EKW ++RKL+N+ FH E L+ M+PAMI S E M+E WR +EG
Sbjct  62    DNYTKKLIGEGIGTTRIPEKWLKLRKLSNHAFHAECLKSMIPAMITSVEMMLEKWRHNEG  121

Query  697   KEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMK  876
             KEIE F+EF++L SE+ISRTAFGS+YLEG+ IF+M+ +L  +  +N   +R PG+  ++K
Sbjct  122   KEIEVFQEFKVLASEIISRTAFGSSYLEGQRIFDMINQLTLIIGRNRYRIRIPGIRNLVK  181

Query  877   NNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ--  1050
               D++ESEK+++ +R+ I+ +IKKRE+      Q +   +DFL  LL+A+H  N  +Q  
Sbjct  182   TWDDIESEKIDQEIRDSIMNMIKKREEAAM-MSQSNGFGTDFLGLLLKAHHDNNDPDQTK  240

Query  1051  -ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
              + +E M+DECKTFY  GHETT +   W   LLA H DWQ++ARKEV+E+FGQ++P+  G
Sbjct  241   RLSVEEMIDECKTFYVVGHETTATSFTWTVFLLAIHTDWQDKARKEVLELFGQQSPSSDG  300

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             ++++K+++MI+ E LRLYPPV  I + V+++ V LG + LP NI + I  +AL HDPEIW
Sbjct  301   LSKMKLVSMIINEALRLYPPVLSIPKAVQRQ-VRLGKLVLPANIVIEIPVIALHHDPEIW  359

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G+DV+ FKPERFAEG+ KATNN+  A+LPF  GPR+C+G NFA+ E KI LSMILQ Y  
Sbjct  360   GEDVYLFKPERFAEGLAKATNNNLNAYLPFSLGPRSCVGYNFAITETKIALSMILQHYRF  419

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LS +YVHSPV    + P+ G+Q++LH
Sbjct  420   TLSPTYVHSPVNRLTVCPQHGMQIMLH  446



>gb|KCW85137.1| hypothetical protein EUGRSUZ_B01976 [Eucalyptus grandis]
Length=484

 Score =   490 bits (1261),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 345/507 (68%), Gaps = 41/507 (8%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGI---TS  327
             F+SS+L      L  KLWW P+ +Q+ M+SQGI GP Y+F+HG+TKEI + +  +   T+
Sbjct  14    FLSSILTK----LLHKLWWRPIRVQRAMASQGINGPPYKFIHGSTKEIFKLKEDVMMKTN  69

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              PM++ +SH++ P + PHI+ W ++YG  +LYW GPQ  L++++ ELVKE L+DR   Y 
Sbjct  70    GPMKN-VSHEILPIVEPHIHQWNKIYGGIYLYWYGPQALLLISDTELVKEALNDRDKTYV  128

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
             K E  G  +++LGDG+ S++G+KW R R+LA+  FHGESL+GM+PAM++S   +++ W+ 
Sbjct  129   KPEFPGDIKKILGDGLVSTEGKKWTRQRRLAHLAFHGESLKGMIPAMVDSVHMLLKRWQN  188

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
              E KE+E FEEF  + SEVISRTAFGS+Y+EG++IF+ML +L  +AS+N   +R PG+S+
Sbjct  189   LEAKEVELFEEFTAILSEVISRTAFGSSYIEGRDIFQMLGELTIIASRNLFKLRLPGISK  248

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDN  1047
             I K +DE++S++LE+ +R+ ++ II KRE+ K    +     +DFL K            
Sbjct  249   IWKTSDEIKSDRLEKAIRDAVLGIIDKREK-KLNAGEIDDYGNDFLGK------------  295

Query  1048  QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYG  1227
             +I I  +VDECKTFY AG ETT S+L W   LLA H++WQE ARKEV +VFG E+P   G
Sbjct  296   RITINDLVDECKTFYLAGQETTNSILTWTLFLLAIHKNWQEEARKEVADVFGDEDPNHEG  355

Query  1228  IARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIW  1407
             I +LK + MI+ ETLRLYPPV  + RKVE++ V LGN+ LPP+I L+I  L + HDP IW
Sbjct  356   IMKLKTVEMIINETLRLYPPVINVIRKVERQ-VTLGNLLLPPDIILHIPILKIHHDPRIW  414

Query  1408  GKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSL  1587
             G DVH FKPERF+EG+ KATNN+  AFLPFG GPR+C                   RYS 
Sbjct  415   GDDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRSC-------------------RYSF  455

Query  1588  ALSSSYVHSPVQLFMLRPKDGVQVILH  1668
              LS  Y+H P Q+  +RP+ GV+VILH
Sbjct  456   TLSPDYIHLPTQILAMRPQHGVKVILH  482



>gb|KHG14912.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score =   490 bits (1261),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 336/504 (67%), Gaps = 19/504 (4%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL ++A         W P+ IQ +++SQGIKGP YRF+HGN KEI +  +   SKP   
Sbjct  9     CSLFLIALIKFLYDYLWVPLSIQHMLNSQGIKGPPYRFIHGNNKEIIKMIKEAMSKP--K  66

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L+HD+F ++ PH +SW + YG NF+YW G + ELV++EAELVKE++ +    +PK +  
Sbjct  67    ALTHDMFIKLQPHTHSWIKEYGKNFVYWNGVRAELVISEAELVKEVMKNSLNVFPKAKPS  126

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              +   LLG+G+   +G            V  G   R M PA+I S ETM+E W+  EGKE
Sbjct  127   VYVSNLLGNGLVMIEG------------VLFG---RNMTPAVIASVETMLEKWKGKEGKE  171

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE ++EFRLLTSEVISRTAFGS+YLEG+ IF ML KL  + S+N  + + P +S++ K  
Sbjct  172   IEVYQEFRLLTSEVISRTAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPA  231

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L   +++ +++I+KKRE      E   S  +DFL  L+ A H  + +N++ ++
Sbjct  232   DLLESERLANEIQDCVMKIVKKREDRVVNGEA-DSFGNDFLGLLVNAYHDLDDENRLSMD  290

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +V ECKTFY AG ET   LL W  LLL+ HEDWQE+AR+EV+EVFG +NP   GI++LK
Sbjct  291   DLVAECKTFYVAGQETVNGLLAWIVLLLSIHEDWQEKARREVIEVFGNQNPDSDGISKLK  350

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             I+ MI+ ETLRLY P   + R+V +K V +G + LP NI+L I+  AL HDP++WG DVH
Sbjct  351   IITMIIYETLRLYGPTTGLPRRVARK-VQVGKLVLPANINLLIAKAALHHDPQLWGDDVH  409

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFA+G+ KATN +  AF PFG GPR C+G+ FA  E KI LSMILQRYS+ LS +
Sbjct  410   LFKPERFADGIAKATNYNAAAFFPFGLGPRFCVGMTFATTETKIALSMILQRYSVTLSPA  469

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVHSPV +  L+P+ G+QVI   +
Sbjct  470   YVHSPVPIITLKPEHGIQVIFESL  493



>gb|KHG26580.1| Cytochrome P450 protein [Gossypium arboreum]
Length=497

 Score =   488 bits (1256),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 334/504 (66%), Gaps = 19/504 (4%)
 Frame = +1

Query  163   SSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMED  342
              SL ++A         W P+ IQ +++SQGIKGP YRF+HGN KEI +  +   SKP   
Sbjct  9     CSLFLIALIKFLYDYLWVPLSIQHMLNSQGIKGPPYRFIHGNNKEIIKMIKEAMSKP--K  66

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
              L+HD+F ++ PH +SW + YG NF+YW G + ELV++EAELVKE++ +    +PK +  
Sbjct  67    ALTHDMFIKLQPHTHSWIKEYGKNFVYWNGVRAELVISEAELVKEVMKNSLNVFPKAKPS  126

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              +   LLG+G+   +G            V  G   R M PA+I S ETM+E W+  EGKE
Sbjct  127   VYVSNLLGNGLVMIEG------------VLFG---RNMTPAVIASVETMLEKWKGKEGKE  171

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             IE ++EFRLLTSEVISRTAFGS+YLEG+ IF ML KL  + S+N  + + P +S++ K  
Sbjct  172   IEVYQEFRLLTSEVISRTAFGSSYLEGEKIFAMLNKLSIIMSRNLFSTKIPLISKLWKPA  231

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D LESE+L   +++ +++I+KKRE      E   S  +DFL  L+ A H  +  N++ +E
Sbjct  232   DLLESERLANEIQDCVMKIVKKREDRVVNAEA-DSFGNDFLGLLVNAYHDLDDKNRLSME  290

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +V ECKTFY AG ET  +LL W  LLLA H+DWQE+AR+EV+EVFG +NP   GI++LK
Sbjct  291   DLVAECKTFYVAGQETVNALLAWMVLLLAIHKDWQEKARREVIEVFGNQNPDSDGISKLK  350

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             I+ MI+ ETLRLY P   + R+V +K V +G +  P NI+L I+  AL HD ++WG DVH
Sbjct  351   IITMIIYETLRLYGPTNGLPRRVARK-VQVGKLVFPANINLLIAKAALHHDHQLWGDDVH  409

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFA+G+ KATN +  AF PFG GPR C+G+ FA  E KI LSMILQRYS  LS +
Sbjct  410   IFKPERFADGIAKATNYNAAAFFPFGLGPRFCVGMTFATTETKIALSMILQRYSFTLSPA  469

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             YVHSPV +  L+P+ G+QVIL  +
Sbjct  470   YVHSPVHIITLQPEHGIQVILESL  493



>gb|AAZ39644.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=504

 Score =   484 bits (1245),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 235/501 (47%), Positives = 341/501 (68%), Gaps = 13/501 (3%)
 Frame = +1

Query  172   LVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGN-TKEISEARRGITSKPMEDDL  348
             L L  A    K WW PV +Q LM SQGIKGP Y+  + N  K + +     TS PME  +
Sbjct  13    LALVLARFLYKSWWYPVSLQLLMKSQGIKGPPYKAPNWNYAKGVLDMEVKSTSAPME--I  70

Query  349   SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGF  528
             SHD+ PR+ P +YSW  LYG NFL+W+  QP+LVVT+  L+KEILSD++G + K++L+G 
Sbjct  71    SHDIIPRLFPQVYSWINLYGKNFLHWIDTQPQLVVTDINLIKEILSDKEGSFDKVQLEGV  130

Query  529   SRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIE  708
              ++ LG GI   +G+KW+++RK+AN+ FHG++L+  +PAM+ S E +++ W+ +EGKEIE
Sbjct  131   LKKFLGGGIVFEEGKKWSKLRKVANHAFHGQNLKEKVPAMVASVEELLKTWKSYEGKEIE  190

Query  709   AFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDE  888
              F+EF+LL+ E+IS++ FGS+YL GK ++ ML ++  +  K   +       +  K++ E
Sbjct  191   VFKEFKLLSLEIISKSVFGSDYLTGKTMYHMLDEIVLICYKIIAD-------KFSKSSHE  243

Query  889   LE-SEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEA  1065
             L+ ++ + +   + ++ I+K+RE  K    Q ++  SDFL  L+E++H  + + +I +  
Sbjct  244   LKVADHILQAFVDSLVGIMKQRED-KVKAGQSNNFGSDFLGSLMESHHNTDQNKRISVVE  302

Query  1066  MVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKI  1245
             +++ECKTFYFAGHET  S+L W+ LLLA H DWQ+ ARKEV+E+ GQ NP    I+RLK 
Sbjct  303   IIEECKTFYFAGHETVRSVLSWSILLLAVHTDWQDTARKEVLEMLGQGNPNIESISRLKT  362

Query  1246  MNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHK  1425
             + MIL ETLRLYPP+ ++ RKV K+N+ LG + LP  + +YI+ LA+ H+ EIWG+D H 
Sbjct  363   VGMILNETLRLYPPLVFLHRKV-KRNIKLGELRLPAGMEVYIASLAVHHNSEIWGEDTHL  421

Query  1426  FKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSY  1605
             FKPERFAEGV KAT +  +AFL FG+G R C+G NFA  E KI L MILQRY   +S +Y
Sbjct  422   FKPERFAEGVAKATRDQLMAFLSFGFGLRKCVGFNFAQMEVKIALCMILQRYRFTVSPNY  481

Query  1606  VHSPVQLFMLRPKDGVQVILH  1668
              H P  +  L PK G+Q++LH
Sbjct  482   RHFPTLVMGLWPKHGIQIMLH  502



>gb|KDP41345.1| hypothetical protein JCGZ_15752 [Jatropha curcas]
Length=435

 Score =   477 bits (1228),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 224/424 (53%), Positives = 316/424 (75%), Gaps = 6/424 (1%)
 Frame = +1

Query  406   GANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKG-EKWA  582
             G NFLYW GP+  LV+TE E++KEIL++R G +PKIE   + ++LLGDG  +++  EKW 
Sbjct  4     GTNFLYWQGPRAHLVITEPEMIKEILNNRDGAFPKIEPDDYVKKLLGDGTVTARTPEKWF  63

Query  583   RMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAF  762
             R+RKL+N+ FH E L+GM+PAMI S E M++ W+     EI+AF+EF++LTSE+ISRTAF
Sbjct  64    RLRKLSNHAFHAECLKGMIPAMIASVEMMLQRWKICGCMEIDAFQEFKVLTSEIISRTAF  123

Query  763   GSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQII  942
             GS+YLEG+NIF+ L++L  + S+N   V+ PG+S ++K  D++ESEKLE+G++N II +I
Sbjct  124   GSSYLEGQNIFDKLMRLGVIISRNKYKVKVPGISNLVKTEDDIESEKLEQGIQNSIISMI  183

Query  943   KKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQ---ICIEAMVDECKTFYFAGHETT  1113
             KKREQ  T  E+  S  +DFL  LL+A+H +   ++   + ++ ++DECKTFY AGHETT
Sbjct  184   KKREQA-TITEKSDSFGNDFLGLLLKAHHDDRDAHKTKRLSVQDIIDECKTFYVAGHETT  242

Query  1114  TSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVP  1293
             TS L W   LLA H DWQ++AR E++++F  +NP+P G++R+KI++MI+ E LRLYPPV 
Sbjct  243   TSSLSWIVFLLAVHTDWQDKARNEILQLFDLQNPSPDGLSRMKIVSMIINEALRLYPPVA  302

Query  1294  YIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNN  1473
                R+V+++ V LG + LP NI + I  +A+ H+P+IWG+DVH FKPERFAEG+ KATNN
Sbjct  303   AFPREVQRQ-VRLGKLNLPANIEVEIPIIAIHHNPQIWGEDVHLFKPERFAEGLAKATNN  361

Query  1474  HPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGV  1653
             +  A+LPF  GPR+C+G NF++ E KI LSMILQRY   LS +Y HSPV L  + PK G+
Sbjct  362   NVNAYLPFALGPRSCVGSNFSIMETKIALSMILQRYHFTLSPTYAHSPVNLLTVCPKYGL  421

Query  1654  QVIL  1665
             Q++L
Sbjct  422   QILL  425



>ref|XP_011015642.1| PREDICTED: cytochrome P450 CYP749A22-like [Populus euphratica]
Length=420

 Score =   475 bits (1222),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 217/418 (52%), Positives = 304/418 (73%), Gaps = 2/418 (0%)
 Frame = +1

Query  412   NFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMR  591
              FLYW G Q +LVVTE +L+KEI +++ G +PK  L  + ++LLGDGI ++ GEKW ++R
Sbjct  2     TFLYWHGSQAQLVVTEPDLIKEIFNNKNGAFPKRNLPVYMKKLLGDGIVAANGEKWFKLR  61

Query  592   KLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSN  771
             KL+N+ FH E L+ M+PAMI S E M++ WR+H+GKEI+ F+EF+LLTSE+ISRTAFGS+
Sbjct  62    KLSNHAFHAECLKSMIPAMIASVEVMLKRWRQHDGKEIDVFQEFKLLTSEIISRTAFGSS  121

Query  772   YLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             YLEG+++F+ML ++  +  +N   +  PG+ + +K  D++ES+KLE+ ++N  I +IK R
Sbjct  122   YLEGQHVFDMLTRMGDIIVRNHYKITIPGIGKFVKTRDDIESDKLEQEIKNCFINMIKNR  181

Query  952   EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGW  1131
             E+    E ++    SDFL  LL A+H+ +   +I +E ++DECKTFYFAGHETT + L W
Sbjct  182   EKAAM-EGKRGDFGSDFLGILLLAHHEADKAKRISVEDIIDECKTFYFAGHETTRTSLTW  240

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
               LLLA H DWQ++AR+EV+E+FG +NP P GI +L  ++MI+ ETLRLY P  +I R V
Sbjct  241   TVLLLAFHTDWQDKARREVLELFGLQNPNPEGITKLNTVSMIMNETLRLYSPAVHIPRMV  300

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
              ++ V LG + +P N  +YI  L   H+PEIWG+D H FKPERFA+GV KATNN+  AFL
Sbjct  301   -RREVRLGKLIIPANTEIYIPVLVAHHNPEIWGEDAHLFKPERFADGVAKATNNNMSAFL  359

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVIL  1665
             PFG GPRTC+GLNF++ E KI L+MILQ Y   LS +Y+HSP  L  + P+ GVQ++L
Sbjct  360   PFGLGPRTCVGLNFSVTETKIALAMILQHYRFTLSPTYIHSPAHLLAMSPQHGVQIML  417



>ref|XP_004173451.1| PREDICTED: cytochrome P450 734A1-like, partial [Cucumis sativus]
Length=485

 Score =   474 bits (1221),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 218/463 (47%), Positives = 324/463 (70%), Gaps = 6/463 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L  K WW P+ IQ++M SQGI GPSY+F+ GN +++   R    + PME  LSH++ PR+
Sbjct  27    LVSKFWWTPMRIQRIMRSQGINGPSYKFIQGNMRDMYTKRMQAMATPME--LSHNILPRV  84

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             +PH++SW   YG +FL W G + +L++T+ E++KE+L+D++ +YPK +L     R+ GDG
Sbjct  85    IPHVHSWLNDYGRSFLQWYGIEAQLIITDPEMIKEVLNDKQKNYPKAKLGRDLLRIFGDG  144

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             + +S+G++WA+ RK+AN  FHG+SL+ M+P MIE  E M+E W+ HEGKE++ ++E ++ 
Sbjct  145   LVTSEGQRWAKSRKIANFAFHGDSLKNMIPTMIECGEKMIEGWKNHEGKELDVYKELKVY  204

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             T +VISRTAFGS+Y +G NIF ML +L  L+ +N   ++ P +S+I+++ D++E E+LE+
Sbjct  205   TLDVISRTAFGSSYQQGLNIFHMLQQLTDLSIRNGYKIKLPIISKILRSKDDVEGERLEK  264

Query  913   GVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
              ++    +II+ RE ++K G  +     +DFL  L++A ++     +I ++ +V ECKTF
Sbjct  265   RMKECFTEIIRGREDRSKNGGGEGYG--NDFLGMLVKAKNEGEKSERITMDVIVAECKTF  322

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ-ENPTPYGIARLKIMNMILEE  1266
             YFAGHETT  L+ W   LLA H+ WQE+AR EV  +FG   NPT   +++LKIM MI+ E
Sbjct  323   YFAGHETTNVLIAWIMFLLALHKQWQEQARDEVFRIFGHSSNPTYEALSKLKIMTMIINE  382

Query  1267  TLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFA  1446
             TLRLYPP   + R+V +K V LG++ LP ++ L I  +A+ HD E WG+DVH+FKPERFA
Sbjct  383   TLRLYPPAMTVSRQVVEKEVKLGSLVLPTSLQLMIPTIAVHHDKEFWGEDVHEFKPERFA  442

Query  1447  EGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQ  1575
             EGV K    +   +LPFG GPR C+G+NFA+ EAKI +SMILQ
Sbjct  443   EGVSKTIEGNSAGYLPFGLGPRNCVGMNFAINEAKIAMSMILQ  485



>gb|KHG08575.1| Cytochrome P450 protein [Gossypium arboreum]
Length=454

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/452 (52%), Positives = 325/452 (72%), Gaps = 6/452 (1%)
 Frame = +1

Query  322   TSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGD  501
             ++KPM   L+HD+FPR++PH+YSW   YG  +L W G +  L++T+ ELVKE+L + +  
Sbjct  4     STKPMA--LTHDIFPRVMPHVYSWINKYGKTYLSWNGIRARLLITDPELVKEVLKNSEKA  61

Query  502   YPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAW  681
             +PK +   F  +L+GDG+ S++ EKWAR RKLAN  FHGESL+ M PA++ S ETM+E W
Sbjct  62    FPKPKRSYFIDKLIGDGLASTESEKWARQRKLANYAFHGESLKNMTPAVVASVETMLEKW  121

Query  682   REHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGM  861
             +  EGKEIE F+EFRLLTSEVISRTAFGS+YLEG+ IF+ML+KL  +  +N    + P +
Sbjct  122   KSKEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFDMLMKLSVITGRNIFKAKIPII  181

Query  862   SRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQEN  1038
             S+  K+ DE+ESE++ + + + ++ I+KKRE+   TGE        DFL  L+ A H+ +
Sbjct  182   SKFWKSADEIESERIAKMIHDSVMSIVKKREERVVTGEADNFG--CDFLGLLVNAYHEAD  239

Query  1039  GDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPT  1218
               N + I+ +VDECKTFYF G ET  +LL WATLLLA H DWQ+RAR EV+EVFG +NP 
Sbjct  240   EKNILLIQDLVDECKTFYFGGQETVNTLLAWATLLLAIHTDWQDRARAEVIEVFGNQNPN  299

Query  1219  PYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDP  1398
               G+A+LK + MI+ ETLRLYPPV  + RKV K+ V LG + LP ++ + +  +AL HDP
Sbjct  300   FEGMAKLKTITMIINETLRLYPPVNGVIRKVGKE-VRLGKLVLPTHLEVDMRIIALHHDP  358

Query  1399  EIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQR  1578
             ++W  DV+ FKPERFAEG+ KAT  +  AF+PFG GPR+C+G++FA+ EAKI LSMILQ 
Sbjct  359   DLWEDDVNLFKPERFAEGIAKATKYNAAAFMPFGLGPRSCVGMSFAITEAKIALSMILQC  418

Query  1579  YSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             Y++ +S +YVH+P Q   L+P+ G+Q++ H +
Sbjct  419   YTVIVSPTYVHAPAQRLTLKPQHGIQLLFHSL  450



>ref|XP_008243893.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP749A22-like 
[Prunus mume]
Length=388

 Score =   465 bits (1196),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 215/385 (56%), Positives = 287/385 (75%), Gaps = 3/385 (1%)
 Frame = +1

Query  520   QGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK  699
             Q + ++LL DG+ S++GEKW ++RKLAN+ FHG+SL+ M+P M  S ETM+  W++HEGK
Sbjct  7     QAYVKKLLVDGLASTEGEKWGKLRKLANHAFHGDSLKSMIPTMTASVETMLVRWKKHEGK  66

Query  700   EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKN  879
             EIE FEEFRLLTSEV+SRTAFGS+YLEGKN+FEML++L  L  KN     FPG+S+++K 
Sbjct  67    EIEVFEEFRLLTSEVVSRTAFGSSYLEGKNVFEMLMRLYFLIFKNLFKFSFPGISKLIKT  126

Query  880   NDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICI  1059
              DE+ES+KLE+G+R GII+I+KKRE+      +  S  SDFL  LL+A+H      +I +
Sbjct  127   KDEVESKKLEKGIREGIIEIVKKREEKAIMIGETDSFGSDFLGLLLKAHHDSKEKQRISV  186

Query  1060  EAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARL  1239
             + +VD+CKTFYFAG ETT +LL W   LL  H DWQE ARKE++++FG++ P   G+A+L
Sbjct  187   DDLVDKCKTFYFAGQETTNTLLAWTVFLLVLHTDWQEEARKEILQIFGKQAPNSDGLAKL  246

Query  1240  KIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDV  1419
             K M MI+ E LRLYPP+  I RKVE++ + LG + +P N+ ++I  LA+ H+P++WG+DV
Sbjct  247   KTMGMIINEXLRLYPPIVSIARKVERE-LRLGKLIVPANVEIFIPSLAIHHEPQLWGEDV  305

Query  1420  HKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSS  1599
             H FKPE+F+EG+ KAT N   AFLPF  GPR C+G N    EAKIVLSMILQRYS  LS 
Sbjct  306   HLFKPEQFSEGIAKATKNRIAAFLPFVMGPRNCVGFN--XTEAKIVLSMILQRYSFTLSP  363

Query  1600  SYVHSPVQLFMLRPKDGVQVILHRI  1674
             +YVHSP+Q   +RP+ GVQVILH +
Sbjct  364   AYVHSPLQYITVRPQHGVQVILHSL  388



>gb|KDO70290.1| hypothetical protein CISIN_1g009043mg [Citrus sinensis]
Length=452

 Score =   466 bits (1200),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/445 (51%), Positives = 303/445 (68%), Gaps = 28/445 (6%)
 Frame = +1

Query  412   NFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMR  591
             NFL W G + +LV+T+ EL+KEILS+  G YPK++  GF R++LGDG+ ++ GE W R R
Sbjct  2     NFLTWYGSRAQLVITQPELIKEILSNSDGTYPKVQAPGFLRKILGDGLVTAGGENWHRQR  61

Query  592   KLANNVFHGESLR--------------------------GMLPAMIESAETMVEAWREHE  693
             KLA   F+ ESLR                           M+PAM+ S E M++ WR  E
Sbjct  62    KLATLAFYAESLRVTKSNCLMFKLKSVIVMLFNVFAPMQDMIPAMVASVEIMLKRWRHSE  121

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE  +EF+LLTSE+ISRTAFGS+YLEG++IF  L  +  LAS+N   ++ P +   +
Sbjct  122   GKEIEVSQEFKLLTSEIISRTAFGSSYLEGESIFNKLTNMSFLASRNAYKIKIPLIGDFV  181

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K +D++E +KLE+G+R+ II+++K RE+ K  + +     +D+   LL+A H  +   +I
Sbjct  182   KTSDDVEGDKLEQGIRDSIIKMMKTREE-KALKGESEGYGNDYFGLLLKAYHDPDMTKRI  240

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ ++DECKTFY AGHETTT LL W  LLLATH DWQE+ R+EV+E+FGQ+NP P GI 
Sbjct  241   SLDVLIDECKTFYIAGHETTTKLLTWTILLLATHTDWQEKLREEVLELFGQKNPAPDGIG  300

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             +LK M+M++ E+LRLYPP   I R VE++ V LG   LP N+ L I  LA+ HDP+IWG+
Sbjct  301   KLKTMSMVINESLRLYPPAVNISRNVERE-VRLGKYILPANMELVIPILAIHHDPQIWGE  359

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             DV  FKPERFA+GV KA+NN P AFLPF  GPR C+GLNFA  EAKI LSMILQRY   L
Sbjct  360   DVDLFKPERFADGVAKASNNTPAAFLPFSSGPRICVGLNFAATEAKIALSMILQRYRFNL  419

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILH  1668
             S SYVHSPV +  LRP+ G+QVI  
Sbjct  420   SPSYVHSPVLVVTLRPQHGLQVIFQ  444



>gb|KHG30791.1| Cytochrome P450 protein [Gossypium arboreum]
Length=476

 Score =   464 bits (1194),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 247/518 (48%), Positives = 336/518 (65%), Gaps = 56/518 (11%)
 Frame = +1

Query  160   ISSLLVLAAAWLCEKLW-----------WAPVHIQKLMSSQGIKGPSYRFLHGNTKEISE  306
             + +LL+L  A+LC  L+           W P  +Q +M+SQGI+GP Y F+HGN KE  +
Sbjct  1     MGNLLILFTAFLCICLFVALHYVLYEYLWVPHRVQFIMNSQGIRGPPYEFIHGNNKEALQ  60

Query  307   ARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILS  486
              R+  +SKPM   L+HD+FPR++PH YS  + YG N+L W G + +LV+T+ ELVKE+L 
Sbjct  61    MRKEASSKPMA--LTHDIFPRVMPHDYSCIKKYGKNYLSWNGVRAQLVITDPELVKEVLK  118

Query  487   DRKGDYPKIELQGFSRRLLGDGIGSSKGEKW-ARMRKLANNVFHGESLRGMLPAMIESAE  663
               +  + K +   F ++LLGD I + K EKW AR RKLAN+ FHGESL+ M+PAMI S  
Sbjct  119   TSEKAFSKPKPSYFFKKLLGDSISTIKSEKWGARHRKLANHAFHGESLKNMIPAMIASVG  178

Query  664   TMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLN  843
             TM+E W++ EGKE+E F+EFR LTSE+ISRTAFGS+YLEG+ IF+ML             
Sbjct  179   TMLEKWKDKEGKEMEVFQEFRFLTSEMISRTAFGSSYLEGEKIFDML-------------  225

Query  844   VRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLE  1020
                  M++  K+ DE+ES+KLE+ + + +++IIK+RE+   TGE        DFL  L+ 
Sbjct  226   -----MNKFWKSADEIESDKLEKTIHDSVMKIIKQREEKVMTGEVDSCGH--DFLGLLVN  278

Query  1021  ANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVF  1200
               H  +  N+  I+ +VDECKTFYFAG ETT SLL W TLLLA H DWQ++AR EV    
Sbjct  279   VYHDSDEKNRFLIQDIVDECKTFYFAGQETTNSLLAWITLLLAIHTDWQDKARAEV----  334

Query  1201  GQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPL  1380
                              MI+ ETLRLYPP+  + RK   ++V LG + LP  + L I  +
Sbjct  335   ----------------TMIVNETLRLYPPLNGVVRKA-VRDVQLGELALPNYLDLNIRFI  377

Query  1381  ALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVL  1560
             AL HDP +WG DVH FKPERFAEG+ KATNN+  AF+PFG  PR+C+G++FA+ E KI L
Sbjct  378   ALHHDPAVWGDDVHLFKPERFAEGIAKATNNNAAAFMPFGLEPRSCVGMSFAITETKIAL  437

Query  1561  SMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SMILQRY+  LS +YVH+P+    L+P+ G+ ++ H +
Sbjct  438   SMILQRYTFTLSPTYVHAPLPNLSLKPQHGLHLLFHSL  475



>gb|KDP41344.1| hypothetical protein JCGZ_15751 [Jatropha curcas]
Length=430

 Score =   460 bits (1183),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 228/444 (51%), Positives = 308/444 (69%), Gaps = 29/444 (7%)
 Frame = +1

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
             +LSH VFPR+ PH Y W +L+G NF+ WLGP+P+L+VTE +LVKEIL+++   YPK E  
Sbjct  11    ELSHQVFPRLQPHYYLWSKLHGKNFINWLGPRPQLIVTEPQLVKEILNNKDELYPKPEFF  70

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              +  +L GDG+ ++K                         AMI S E M+  WR++E KE
Sbjct  71    TYMTKLFGDGLVTTK-------------------------AMITSVEMMLRRWRQNEHKE  105

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             I+ ++EF+LLTSEVISRTAFGS+YLEG++IF+ML++L  L SKN   VR P + + +K  
Sbjct  106   IDVWKEFKLLTSEVISRTAFGSSYLEGQHIFDMLMELVLLLSKNGYEVRIPIIKKFIKTK  165

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D+++SEKLE+GVR+ I+++IKKRE+  +   +  S  SD+L  L++AN   +   +I I+
Sbjct  166   DDIKSEKLEQGVRDSILKMIKKREEEAS---EMDSYGSDYLGVLIKANQDPDKTKKISID  222

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDECKTFY AG ETT SLL W   LLA H DWQE+ARKEV+E+FG  +PT   I +LK
Sbjct  223   DLVDECKTFYIAGQETTLSLLTWTIFLLAIHTDWQEKARKEVLELFGPRSPTSDEINKLK  282

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IMNMIL ETLRLY P+  + R+V+K +  LG +  P  + L I  L + HDP+IWG+DVH
Sbjct  283   IMNMILNETLRLYSPITTLIREVQKGSK-LGKLLAPARMDLLIPTLGVHHDPDIWGEDVH  341

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEGV KAT N+  AF+PFG GPR+C+G+NFAMAE KI LSMIL+RY   LS +
Sbjct  342   LFKPERFAEGVAKATKNNIAAFVPFGLGPRSCVGMNFAMAETKIALSMILRRYRFTLSPT  401

Query  1603  YVHSPVQLFMLRPKDGVQVILHRI  1674
             Y+HSP+ +  + PK G+Q+IL  +
Sbjct  402   YIHSPIVVIGVSPKKGLQIILQAL  425



>ref|XP_006437869.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
 gb|ESR51109.1| hypothetical protein CICLE_v10033485mg, partial [Citrus clementina]
Length=421

 Score =   459 bits (1180),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 221/423 (52%), Positives = 307/423 (73%), Gaps = 6/423 (1%)
 Frame = +1

Query  400   LYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKW  579
             LYG NFL W G Q ELVV E +L+KEI+++ +  +PK E + +  +LLG+G+ +++GEKW
Sbjct  1     LYGTNFLMWHGSQAELVVAEPKLIKEIMNNNRS-FPKREPREY-LKLLGNGLVTTRGEKW  58

Query  580   ARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTA  759
              + RKLA N FH E+L+ M+P MI S + M+E WR++EGKEI+A+ E ++LTSE+ISRTA
Sbjct  59    LKKRKLAVNAFHAENLKNMIPDMIASVDMMLERWRDYEGKEIDAYREIKVLTSEIISRTA  118

Query  760   FGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQI  939
             FGS YLEG+NIF ML K+  + +K    +  PG+ +++K ND++ES+KLE+ +R+ II++
Sbjct  119   FGSCYLEGENIFNMLTKMAYIVAKKKYKLEIPGIGKLLKTNDDIESDKLEQDIRDSIIKV  178

Query  940   IKKREQTK-TGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTT  1116
             +KKRE    TGE +  S  +D L  L+ A H  +   +I ++ ++DECKTFY AG +TT 
Sbjct  179   VKKRESNVLTGEAE--SYGNDLLGILMRAYHSADETQKISLDDLIDECKTFYVAGTDTTA  236

Query  1117  SLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPY  1296
             SLL W   LLA H DWQ++ARKEV+E+ GQ+NP+   I+RLKI+ MI+ ETLRLYPP   
Sbjct  237   SLLSWTIFLLAIHSDWQDKARKEVLELLGQQNPSADNISRLKIVGMIINETLRLYPPFVV  296

Query  1297  IKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNH  1476
               R+V KK V LG++ +P N+ + I  +A+ HDP+IWG+D H +KPERFA+GV KAT+N+
Sbjct  297   FVREV-KKEVKLGDLIVPANVDVTIPVIAVHHDPQIWGEDFHLYKPERFAQGVPKATSNN  355

Query  1477  PIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQ  1656
               AFLPFG GPRTC+G NF + EAKI LSMIL+RY   LS +YVHSPV    L P+ G+Q
Sbjct  356   MAAFLPFGLGPRTCVGFNFTIIEAKIALSMILRRYKFTLSPNYVHSPVPRITLCPQHGIQ  415

Query  1657  VIL  1665
             V+L
Sbjct  416   VML  418



>ref|XP_010046246.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=462

 Score =   456 bits (1173),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 230/479 (48%), Positives = 324/479 (68%), Gaps = 31/479 (6%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPME--DDLSHDVFPRILPHIYSWKRLYGA  411
             M+SQGIKGP Y+F+HG+TKEI + +  + +K  E   ++SH++ P +  HI+   +  G 
Sbjct  1     MASQGIKGPPYKFIHGSTKEIFKLKEDVMTKTNEPMTNVSHEILPIVENHIHGGIKYMGG  60

Query  412   NFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMR  591
               LYW GPQ +L++++ ELVKE+L++R   Y K E  G  ++LLGDG+ S++G+KW R R
Sbjct  61    ICLYWYGPQAQLLISDTELVKEVLNNRDKTYVKPEFPGDIKKLLGDGLVSTEGKKWTRQR  120

Query  592   KLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSN  771
             +LA+  FHGESL+ M+PAM++S   +++ W+  E + +E FEEF  +TS+VISRTAFGS+
Sbjct  121   RLAHLAFHGESLKCMIPAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSS  180

Query  772   YLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKR  951
             Y+EG+N+F+ML +L T+AS+N   +R PG+  I K  DE++SE+LE+ +R+ +++II+KR
Sbjct  181   YIEGRNMFQMLGELTTIASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKR  240

Query  952   EQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGW  1131
             E+ K    + +   +D L  LL+A H  +   +I I+ ++DECKTFYFAG ETT S+L W
Sbjct  241   EE-KVNTGEMNDYGNDLLGSLLKAYHDPDESKRITIDDVMDECKTFYFAGQETTNSVLTW  299

Query  1132  ATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKV  1311
                LLA H+DWQ+ ARKEV +VFG E+P                           + RKV
Sbjct  300   TLFLLAIHKDWQQEARKEVTDVFGNEDP---------------------------LLRKV  332

Query  1312  EKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFL  1491
              KK V LGN+ LP +I L I  LA+ HD  IWG DVH FKPERF+EG+ KATNN+  AFL
Sbjct  333   -KKQVTLGNLVLPADIVLDIPTLAIHHDRRIWGNDVHLFKPERFSEGIAKATNNNAAAFL  391

Query  1492  PFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             PFG GPRTC+G+NFA  EAKI ++MILQRYS  LS  Y+H P  +  + P+ GV+VILH
Sbjct  392   PFGLGPRTCVGINFATNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVKVILH  450



>ref|XP_010041134.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Eucalyptus 
grandis]
Length=430

 Score =   448 bits (1153),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 224/473 (47%), Positives = 309/473 (65%), Gaps = 43/473 (9%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M++QGI+GP Y F HG+TKE+ + ++ +T +PM  +LSHD+FP + PH+Y W + YG NF
Sbjct  1     MAAQGIRGPPYGFFHGSTKEMLQMKKEVTKRPM--NLSHDIFPYVQPHLYEWTKTYGRNF  58

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L W G Q  LV+++ E+VKE+L++R   Y K  +Q   ++ +GDG+ + +GEKWA+ RKL
Sbjct  59    LMWYGAQAFLVISDLEMVKEVLNNRDDTYSKEFVQDQVKKYIGDGLATFRGEKWAKHRKL  118

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN  FHGE+L+ M+PAM++SA TM++ W + EGKEI+ ++E RL  S+VIS+TAFGS+Y 
Sbjct  119   ANFAFHGENLKDMVPAMVDSAHTMLKRWSDREGKEIDVYKELRLYASDVISKTAFGSSYT  178

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ  957
             EGK+IFE + KL  L   N  +  FP + ++ ++  E+E EK+E+G R  +++IIKKR Q
Sbjct  179   EGKSIFENVNKL-ILVMVN-ASSSFPILRKLWRSAYEIEGEKIEKGFREAVLEIIKKR-Q  235

Query  958   TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWAT  1137
              K    +  S  +DFL  LL A+H+ +   +I I+ +V ECKTFY AGHET TS L W  
Sbjct  236   EKVNSGELESYGNDFLGLLLRASHEVDEKKKITIDNVVSECKTFYIAGHETATSFLAWT-  294

Query  1138  LLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEK  1317
                                                 + MI+ E+LRLYPPV +I R+V +
Sbjct  295   ------------------------------------IGMIINESLRLYPPVTFISREVSR  318

Query  1318  KNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPF  1497
             +   LGN  LP  I L+I  L + HDP+IWG D H FKPERF +GV KAT+N+P  FLPF
Sbjct  319   Q-AKLGNFILPAGIKLHIPTLKIHHDPQIWGDDAHLFKPERFLDGVAKATSNNPATFLPF  377

Query  1498  GYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQ  1656
             G GPR+C+G NF + EAKIVLSMILQRY+  LS +YVHSP QL +  PK GVQ
Sbjct  378   GLGPRSCVGSNFVVVEAKIVLSMILQRYAFTLSPAYVHSPAQLLIAYPKYGVQ  430



>gb|KCW44686.1| hypothetical protein EUGRSUZ_L01780, partial [Eucalyptus grandis]
Length=407

 Score =   441 bits (1133),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 214/406 (53%), Positives = 289/406 (71%), Gaps = 4/406 (1%)
 Frame = +1

Query  460   AELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGML  639
              ELVKE+L++R   Y K + Q   ++L GDG+ S+K EKWAR R+LA+  FHGESL+ M+
Sbjct  1     TELVKEVLNNRDKTYVKPDFQENIKKLFGDGLFSTKREKWARQRRLAHLAFHGESLKCMI  60

Query  640   PAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKT  819
             PAM++S   +++ W+  E +E+E FEEF  +TS+VISRTAFGS+Y+EG+NIF ML +L T
Sbjct  61    PAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGRNIFRMLGELTT  120

Query  820   LASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRS  996
             +AS+N   +R P + +I K +DE++SE+LE+ +R+ +++IIKKRE+   TGE       +
Sbjct  121   IASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVNTGEMNDYG--N  178

Query  997   DFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERA  1176
             DFL  LL+A H  +   +I I+ ++DECKTFYFAG ETT S+L W   LLA H+DWQ+ A
Sbjct  179   DFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEA  238

Query  1177  RKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPN  1356
             RKEV  VFG E+P   G+ +LK + MI+ E+LRLYPP+  I RKV KK V LG++ LP +
Sbjct  239   RKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPLISIFRKV-KKQVTLGSLVLPAD  297

Query  1357  IHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFA  1536
             I L+I  L + HD  IWG DVH FKPERF+EG+ KATNN+  AFLPFG GPR C+GLNFA
Sbjct  298   IVLHIPTLIIHHDRRIWGIDVHLFKPERFSEGIAKATNNNTAAFLPFGLGPRNCVGLNFA  357

Query  1537  MAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             M E KI ++MILQRYS  LS  Y+  P     + P+ GV+VILH +
Sbjct  358   MNEVKIAIAMILQRYSFTLSPGYIPLPAHFLTIHPQHGVKVILHSL  403



>gb|KHG29404.1| Cytochrome P450 protein [Gossypium arboreum]
Length=439

 Score =   441 bits (1133),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 222/452 (49%), Positives = 311/452 (69%), Gaps = 23/452 (5%)
 Frame = +1

Query  322   TSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGD  501
             ++KPM   L+HD+FPR++PH+YSW   Y                 + E VKE+L + +  
Sbjct  6     STKPMA--LTHDIFPRVMPHVYSWINKY-----------------DPEWVKEVLKNSEKA  46

Query  502   YPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAW  681
             +PK +   F  +L+GDG+ S++ EKWAR RKLAN  FHGESL+ M PA++ S ETM+E W
Sbjct  47    FPKPKRSYFIDKLIGDGLASTESEKWARQRKLANYAFHGESLKNMTPAVVASVETMLEKW  106

Query  682   REHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGM  861
             +  EGKEIE F+EFRLLTSEVISRTAFGS+YLEG+ IF+ML KL  +  +N    + P +
Sbjct  107   KSKEGKEIEVFQEFRLLTSEVISRTAFGSSYLEGEKIFDMLTKLSVITGRNIFKAKIPII  166

Query  862   SRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQEN  1038
             S+  K+ DE+ESE++ + + + ++ I++KRE+   TGE        DFL  L+ A H+ +
Sbjct  167   SKFWKSADEIESERIAKMIHDSVMSIVEKREKRVVTGEADNFG--CDFLGLLVNAYHEVD  224

Query  1039  GDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPT  1218
               N++ I+  VDECKTFYF G ET  SLL WATLLLA H DWQ++AR EV+EVFG +NP 
Sbjct  225   EKNRLSIQDFVDECKTFYFVGQETVNSLLAWATLLLAIHTDWQDKARAEVIEVFGNQNPD  284

Query  1219  PYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDP  1398
               G+A+LK + MI+ ETLRLYPP+  + R+V ++ V LG + LP +  + +  +AL HDP
Sbjct  285   SEGMAKLKTITMIINETLRLYPPLSGVIREVGRE-VQLGKLVLPTHSEVDMRIIALHHDP  343

Query  1399  EIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQR  1578
             ++WG DV+ FKPERFAEG+ KAT  +  AF+PFG GPR+C+G++FA+ EAK  LSMILQR
Sbjct  344   DLWGDDVNLFKPERFAEGIAKATKYNAAAFMPFGLGPRSCVGISFAITEAKTALSMILQR  403

Query  1579  YSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             Y+  +S +YVH+P     L+P+ G+Q++ H +
Sbjct  404   YTFTVSPTYVHAPALRLTLKPQHGMQLLFHSL  435



>gb|KDP41343.1| hypothetical protein JCGZ_15750 [Jatropha curcas]
Length=432

 Score =   436 bits (1120),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 219/442 (50%), Positives = 296/442 (67%), Gaps = 27/442 (6%)
 Frame = +1

Query  343   DLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQ  522
             +LSH +F RI PH Y W++L+G N++ WLGP+P LVVTE +LVKEIL+++   YPK E +
Sbjct  11    ELSHQMFSRIQPHYYLWRKLHGKNYISWLGPRPRLVVTEPQLVKEILNNKDEMYPKPEFE  70

Query  523   GFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKE  702
              +  +L GDG+ ++K                          MI   E M+  WR++E KE
Sbjct  71    SYMIKLFGDGLVTTK-------------------------VMITRVEMMLGRWRQYENKE  105

Query  703   IEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNN  882
             I+ ++EF+ LTS+VISRT+FGS+Y E ++IF+M+++L  LAS+N   VR P + + +K  
Sbjct  106   IDVWKEFKQLTSDVISRTSFGSSYSEAQDIFDMIMELLILASQNSFEVRIPLIKKFIKTK  165

Query  883   DELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIE  1062
             D++ES+KLE+ +R  I+++I+KRE+     E   S  SDFL  LL+AN   N  N+I I 
Sbjct  166   DDIESDKLEQRLRESILKMIRKREEEAKMAE-PDSHGSDFLGVLLKANQDPNKSNKISIN  224

Query  1063  AMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
              +VDE KTFY AG ETT++ L W   LLA H DWQE+ RKEV+E+FG+ NPT   I +LK
Sbjct  225   DIVDEYKTFYIAGQETTSAALNWTIFLLAIHIDWQEKVRKEVLELFGRRNPTLNEINKLK  284

Query  1243  IMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVH  1422
             IMNM++ ETLRLY PV  + R+V K +  LG +  P  + + I PLA+ HDP+IWG+DVH
Sbjct  285   IMNMVVNETLRLYAPVTNLLREVPKGSK-LGKLLAPARMDILIPPLAVHHDPDIWGEDVH  343

Query  1423  KFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSS  1602
              FKPERFAEGV KAT  +  AF+PF  GPR C+G+NFAM E KI LSMILQRYS  LS +
Sbjct  344   LFKPERFAEGVAKATKGNIGAFVPFSLGPRNCVGMNFAMTETKIALSMILQRYSFTLSPN  403

Query  1603  YVHSPVQLFMLRPKDGVQVILH  1668
             YVHSPV L  + PK G+Q+ L 
Sbjct  404   YVHSPVVLIGVIPKKGLQITLQ  425



>ref|XP_010041049.1| PREDICTED: cytochrome P450 734A1-like [Eucalyptus grandis]
Length=824

 Score =   445 bits (1145),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/417 (52%), Positives = 295/417 (71%), Gaps = 4/417 (1%)
 Frame = +1

Query  427   LGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANN  606
             L P   L +++ ELVKE+L++R   Y K + Q   ++L GDG+ S+K EKWAR R+LA+ 
Sbjct  342   LHPLSRLSISDTELVKEVLNNRDKTYVKPDFQENIKKLFGDGLFSTKREKWARQRRLAHL  401

Query  607   VFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGK  786
              FHGESL+ M+PAM++S   +++ W+  E +E+E FEEF  +TS+VISRTAFGS+Y+EG+
Sbjct  402   AFHGESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSYIEGR  461

Query  787   NIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TK  963
             NIF ML +L T+AS+N   +R P + +I K +DE++SE+LE+ +R+ +++IIKKRE+   
Sbjct  462   NIFRMLGELTTIASQNHFKLRLPEVRKIWKTSDEIDSERLEKAIRDAVLEIIKKREEKVN  521

Query  964   TGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLL  1143
             TGE       +DFL  LL+A H  +   +I I+ ++DECKTFYFAG ETT S+L W   L
Sbjct  522   TGEMNDYG--NDFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWTLFL  579

Query  1144  LATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKN  1323
             LA H+DWQ+ ARKEV  VFG E+P   G+ +LK + MI+ E+LRLYPP+  I RKV KK 
Sbjct  580   LAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPLISIFRKV-KKQ  638

Query  1324  VVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGY  1503
             V LG++ LP +I L+I  L + HD  IWG DVH FKPERF+EG+ KATNN+  AFLPFG 
Sbjct  639   VTLGSLVLPADIVLHIPTLIIHHDRRIWGIDVHLFKPERFSEGIAKATNNNTAAFLPFGL  698

Query  1504  GPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             GPR C+GLNFAM E KI ++MILQRYS  LS  Y+  P     + P+ GV+VILH +
Sbjct  699   GPRNCVGLNFAMNEVKIAIAMILQRYSFTLSPGYIPLPAHFLTIHPQHGVKVILHSL  755


 Score =   376 bits (966),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 249/345 (72%), Gaps = 2/345 (1%)
 Frame = +1

Query  634   MLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKL  813
             M+PAM++S   +++ W+  E KE+E FEEF  ++SEVISRTAFGS+Y+EG++IF+ML +L
Sbjct  1     MIPAMVDSVHMLLKRWQNLETKEVELFEEFTAISSEVISRTAFGSSYIEGRDIFQMLGEL  60

Query  814   KTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRR  993
               + S+N   +R PG+S+I K +DE++S +LE+ +R+ ++ II KRE+ K    +     
Sbjct  61    AIIVSRNLFKLRLPGISKIWKTSDEIKSNQLEKAIRDVVLGIIDKREK-KLNAGEIDDYG  119

Query  994   SDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQER  1173
             +DFL  LL+A H  +   +I I  +VDECKTFY AG ETT S+L W   LLA H+DWQE 
Sbjct  120   NDFLGSLLKAYHDPDESKRITINDLVDECKTFYLAGQETTNSILTWTFFLLAIHKDWQEE  179

Query  1174  ARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPP  1353
             ARKEV +VFG E+P   GI +LK + MI+ ETLRLYPPV  + RKVE++ V LGN+ LPP
Sbjct  180   ARKEVADVFGDEDPNHEGIMKLKTVEMIINETLRLYPPVINVIRKVERQ-VTLGNLLLPP  238

Query  1354  NIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNF  1533
             +I L+I  L +  DP IWG DVH FKPERF+EG+ KATNN+  AFLPFG GPR+C+GL F
Sbjct  239   DIILHIPILKIHQDPRIWGDDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRSCVGLYF  298

Query  1534  AMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             AM EAKI ++MILQRYS  LS  Y+H P Q+  +RP  GV+VILH
Sbjct  299   AMNEAKITIAMILQRYSFTLSPDYIHLPTQILAMRPHHGVKVILH  343



>ref|XP_010091619.1| Cytochrome P450 734A1 [Morus notabilis]
 gb|EXB44885.1| Cytochrome P450 734A1 [Morus notabilis]
Length=496

 Score =   430 bits (1105),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 214/417 (51%), Positives = 293/417 (70%), Gaps = 6/417 (1%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANF  417
             M+SQGI+GPSYRF+ GN KEI    +   SKPM    +H++F ++ P+   W  +YG N+
Sbjct  1     MASQGIRGPSYRFVLGNAKEIHNMLKEAMSKPMSLSDAHNIFHKVQPNQEYWANMYGKNY  60

Query  418   LYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKL  597
             L WLG QP+LV+TE EL+KE+L+++   Y K   Q F ++L GDG+  ++GEKW ++RKL
Sbjct  61    LQWLGTQPQLVITELELIKEVLNNKNRVYLKSGAQRFVKQLFGDGLVVTEGEKWDKLRKL  120

Query  598   ANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYL  777
             AN+ FH E+L+ M+PAMI S E M+E W+ +EGKEIE FEEFR+LTS+VIS+TAFGS+YL
Sbjct  121   ANHFFHAENLKSMVPAMISSVEMMLERWKNYEGKEIEVFEEFRVLTSDVISKTAFGSSYL  180

Query  778   EGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKRE-  954
             EGK IF+ML +L  + + +F  ++ P +S+  K  DE+ES+ LE  + N I+ + KKRE 
Sbjct  181   EGKKIFDMLRRLTFIVTMSFFKIKLPIISKFTK--DEIESDMLEREISNSIMVMAKKRED  238

Query  955   QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWA  1134
             +  +GEE    R  D L  L++A+H  +   QI +  ++ E ++FYFAG ETT SLL W 
Sbjct  239   KVMSGEEGNYGR--DLLGGLMKAHHDADRKKQISMGDLITEVRSFYFAGQETTNSLLAWT  296

Query  1135  TLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVE  1314
              LLLA H DWQE ARKE +  FG+ NPT  GI+RLK+++ I+ E+ RLYPPV    R VE
Sbjct  297   VLLLAIHTDWQEEARKEAVNSFGEHNPTSDGISRLKVISQIINESTRLYPPVVAFSRHVE  356

Query  1315  KKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIA  1485
             ++ V LGN+ LP  + L IS L L  DP+IWG+DV +FKPERF+EGVVKATNN+P A
Sbjct  357   EE-VRLGNLNLPAKMGLIISNLPLHLDPQIWGEDVLEFKPERFSEGVVKATNNNPAA  412



>gb|KCW44878.1| hypothetical protein EUGRSUZ_L01541, partial [Eucalyptus grandis]
Length=397

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/400 (53%), Positives = 287/400 (72%), Gaps = 4/400 (1%)
 Frame = +1

Query  460   AELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGML  639
              ELVKE+L++R   Y K +  G  ++LLGDG+ S+KGEKWAR R+LA+  FHGESL+ M+
Sbjct  1     TELVKEVLNNRDKTYVKPDFPGDIKKLLGDGLFSTKGEKWARQRRLAHLAFHGESLKCMI  60

Query  640   PAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKT  819
             PAM++S   +++ W+  E + +E FEEF  +TS+VISRTAFGS+Y+EG+N+F+ML +L T
Sbjct  61    PAMVDSVHMLLKRWQNLEARVVELFEEFTAITSDVISRTAFGSSYIEGRNMFQMLGELTT  120

Query  820   LASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQ-TKTGEEQKSSRRS  996
             +AS+N   +R PG+  I K  DE++SE+LE+ +R+ +++II+KRE+   TGE       +
Sbjct  121   IASRNIFKLRLPGVRNIWKTIDEIDSERLEKAIRDVVLEIIRKREEKVNTGEMNDYG--N  178

Query  997   DFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERA  1176
             D L  LL+A H  +   +  I+ ++DECKTFYFAG ETT S+L W   LLA H+DWQ+ A
Sbjct  179   DLLGSLLKAYHDPDESKRTTIDDVMDECKTFYFAGQETTNSVLTWTLFLLAIHKDWQQEA  238

Query  1177  RKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPN  1356
             RKEV +VFG E+P   GI +LK + MI+ E+LRLYPPV  + RKV KK V LGN+ LP +
Sbjct  239   RKEVTDVFGNEDPNHDGIMKLKTVGMIINESLRLYPPVISLLRKV-KKQVTLGNLVLPAD  297

Query  1357  IHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFA  1536
             I L I  LA+ HD  IWG DVH FKPERF+EG+ KATNN+  AFLPFG GPRTC+G+NFA
Sbjct  298   IVLDIPTLAIHHDRRIWGNDVHLFKPERFSEGIAKATNNNAAAFLPFGLGPRTCVGINFA  357

Query  1537  MAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQ  1656
               EAKI ++MILQRYS  LS  Y+H P  +  + P+ GV+
Sbjct  358   TNEAKIAIAMILQRYSFTLSPGYIHLPAHILTIHPQHGVK  397



>ref|XP_010046249.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=497

 Score =   430 bits (1105),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 307/480 (64%), Gaps = 57/480 (12%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSK---PMEDDLSHDVFPRILPHIYSWKRLYG  408
             M+SQGIKGP Y+F+HG TKEIS+ ++ +  K   PM + +SH++ P + PHI+ W +LYG
Sbjct  1     MASQGIKGPPYKFIHGCTKEISKLKKDVMMKMNEPMTN-VSHEILPIVEPHIHKWNKLYG  59

Query  409   ANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARM  588
               FL+W GP+  L +++ ELVKE                                     
Sbjct  60    GIFLFWHGPEALLSISDTELVKEC------------------------------------  83

Query  589   RKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGS  768
                            M+PAM++S   +++ W+  E +E+E FEEF  +TS+VISRTAFGS
Sbjct  84    ---------------MIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGS  128

Query  769   NYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKK  948
             +Y+EG+NIF ML +L T+ S+N   +R PG+ +I K +DE++SE+LE+ + + +++IIK 
Sbjct  129   SYIEGRNIFRMLGELTTIVSRNLFKLRLPGVRKIWKTSDEIDSERLEKAIHDAVLEIIKN  188

Query  949   REQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLG  1128
             RE+ K    + ++  +DFL  LL+A H  +   +I I+ ++DECKTFYFAG ETT S+L 
Sbjct  189   REE-KVNTGEMNNYGNDFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLT  247

Query  1129  WATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRK  1308
             W   LLA H+DWQ+ ARKEV  VFG E+P   G+ +LK + MI+ E+LRLYPPV  + RK
Sbjct  248   WTLFLLAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPVISVFRK  307

Query  1309  VEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAF  1488
             V KK V LG++ LP +I L+I  LA+ HD  IWG DVH FKPERF+EG+ KATNN+  AF
Sbjct  308   V-KKQVTLGSLVLPADIVLHIPTLAIHHDARIWGNDVHLFKPERFSEGIAKATNNNAAAF  366

Query  1489  LPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LPFG GPR C+GLNFAM E KI ++MILQRYS  LS  Y+  P     + P+ GV+VILH
Sbjct  367   LPFGLGPRNCVGLNFAMNEVKIAVAMILQRYSFTLSPGYIPWPAHFLTIHPQPGVKVILH  426



>gb|ABK25130.1| unknown [Picea sitchensis]
Length=517

 Score =   430 bits (1106),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 219/515 (43%), Positives = 320/515 (62%), Gaps = 23/515 (4%)
 Frame = +1

Query  175   VLAAAWLC---------EKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
             VLAAA+ C           +WW P+ ++K   SQG++GP YR L+GN  ++        S
Sbjct  7     VLAAAFGCLGYFVLRIVTVIWWKPLQVKKCFESQGVRGPPYRLLNGNFADMVRMNTQAKS  66

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYP  507
              P+    SHD+ PR+LP+ + W + YG +F+YW+G +P L V   EL+KEILS++ G Y 
Sbjct  67    TPIP--WSHDIVPRVLPYYHHWTKTYGKDFIYWVGSKPRLNVPHPELIKEILSNKFGHYE  124

Query  508   KIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE  687
              I      R+L+G G+   +GEKW + R++ N  FH + L+GM+P ++ES   M+E W +
Sbjct  125   NISSNPLGRQLVGQGLVGLRGEKWVQHRRIINPAFHLDFLKGMVPTIVESTANMLEKWGK  184

Query  688   ---HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPG  858
                   +E+E  +EF  LT++VISRTA GS+Y E K+IF +  +   L ++  L+V  PG
Sbjct  185   LVLSGAEEVEVLKEFCNLTADVISRTALGSSYAEAKHIFNLQDQQMLLTAELVLSVYVPG  244

Query  859   MSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQEN  1038
               R +      +  KLE+ +R  + Q+I+ RE+T    EQ  S  +D L  ++ A ++  
Sbjct  245   F-RFLPTRKNRQRWKLEKEIRKCMRQVIEARERT-ADIEQSGSYGTDLLGLMMSAKNKRV  302

Query  1039  G----DNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ  1206
             G    D ++  E ++DECKTFYFAGHETT+ LL W  +LL  H+DWQ+R RKEV+EV G+
Sbjct  303   GGKLQDVRMTTEEIIDECKTFYFAGHETTSILLTWTIILLGMHQDWQDRGRKEVLEVCGK  362

Query  1207  E-NPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLA  1383
                P    +  LKI+ MIL E LRLYPP  +++R+  K  + LG +++P    L +  LA
Sbjct  363   NVVPDADSVNHLKIVGMILNEALRLYPPAVFLQRQAVKP-MQLGRLSIPAGTQLLLPILA  421

Query  1384  LQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLS  1563
             + HD  +WG D ++F P RF+EG+ KA   HP+AF+PFG+GPR C+G NFA+ EAK+VL+
Sbjct  422   IHHDQCLWGNDANEFNPARFSEGIAKAV-KHPLAFMPFGFGPRICVGQNFALLEAKVVLA  480

Query  1564  MILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             MILQR+S   S SY H+PV +  +RP+ G QVILH
Sbjct  481   MILQRFSFVTSPSYAHAPVMVVTVRPQHGAQVILH  515



>ref|XP_008339617.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=399

 Score =   422 bits (1085),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 205/369 (56%), Positives = 266/369 (72%), Gaps = 5/369 (1%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             +  KLWW P+ IQ L++ QGIKGPSYRF+HGNTKEIS  +    S+P    LSHD+F ++
Sbjct  26    IFHKLWWTPIRIQNLVALQGIKGPSYRFIHGNTKEISSMQEEAMSRP--KSLSHDIFSQV  83

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
              PHI+ W + YGANFL W G Q +L++TE EL KEIL+++   YPK E +G++RRLLGDG
Sbjct  84    QPHIHLWTKTYGANFLQWYGAQAQLIITEPELCKEILTNKDKAYPKSETKGYARRLLGDG  143

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLL  732
             +  S GEKWA+MRKLAN  FHGE L+GM P MI SAET++E W+EH+GKEI+ F+EFRL 
Sbjct  144   LVVSDGEKWAKMRKLANYAFHGEILKGMAPTMITSAETLLENWKEHDGKEIDVFKEFRLY  203

Query  733   TSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEE  912
             TSEVISRTAFGS+YLEGKNIFE L KL  L+ KN  N+RFPG+S+ +K+ DE+ESEKLE+
Sbjct  204   TSEVISRTAFGSSYLEGKNIFENLEKLAYLSFKNAFNLRFPGISKFIKSKDEIESEKLEK  263

Query  913   GVRNGIIQIIKKRE-QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTF  1089
              +R  I+++IKKRE +   GEE   S  +DFL  L +A+H  + + +I I+ +VDECKTF
Sbjct  264   SIRGSIMEMIKKREDKAMVGEE--GSFGNDFLGVLTKAHHDADENQRISIDEIVDECKTF  321

Query  1090  YFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEET  1269
             Y  G ETT+S L W   LLA H DWQE ARKEV+++FG +NP   GIA+ K     L+  
Sbjct  322   YLGGQETTSSGLAWTVFLLAIHTDWQEEARKEVIQIFGNQNPNLDGIAKTKNYEYDLQRV  381

Query  1270  LRLYPPVPY  1296
              ++     Y
Sbjct  382   AKVISTGSY  390



>ref|XP_010046255.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=413

 Score =   409 bits (1051),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 211/480 (44%), Positives = 294/480 (61%), Gaps = 72/480 (15%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSK---PMEDDLSHDVFPRILPHIYSWKRLYG  408
             M+SQGIKGP Y+F+HG TKEIS+ ++ +  K   PM + +SH++ P + PHI+ W +LY 
Sbjct  1     MASQGIKGPPYKFIHGCTKEISKLKQDVMMKMNEPMTN-VSHEILPIVEPHIHKWNKLY-  58

Query  409   ANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARM  588
                             + ELVKE+L++R   Y K+E  G  +++ GDG+ +++G+KWAR 
Sbjct  59    ----------------DTELVKEVLNNRDKTYVKLEFPGDIKKIFGDGLVATEGKKWARQ  102

Query  589   RKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGS  768
             R+LA+  FHGESL+GM+PAM++S   +++ W++ E KE+E FEE                
Sbjct  103   RRLAHLAFHGESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEE----------------  146

Query  769   NYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKK  948
                                             +I K +DE++SE+LE+ + + ++ IIKK
Sbjct  147   --------------------------------KIWKTSDEIKSERLEKAICDALLGIIKK  174

Query  949   REQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLG  1128
             RE+   GE       +D+L  LL+A H  +   +I ++ + DECKTF+FAG ETTTS+L 
Sbjct  175   REEKAKGEMDDYG--NDYLGSLLKAYHDPDKSKRITMDDLRDECKTFHFAGQETTTSILT  232

Query  1129  WATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRK  1308
             W   LLA H+DWQE ARKEV +VF  E+P   GI +LK ++MI+ E+LRLYPPV    RK
Sbjct  233   WTLFLLAIHKDWQEEARKEVTDVFDNEDPNHEGIIKLKTVDMIINESLRLYPPVVSAIRK  292

Query  1309  VEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAF  1488
             V ++ V LGN+ LP  I L+I  L + H P IWG DVH FKPERF EG+  A +N   AF
Sbjct  293   VVRQ-VTLGNLVLPQGIALHIPILTIHHSPRIWGDDVHLFKPERFREGIAGAVSNDAAAF  351

Query  1489  LPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             LPFG GPR C+G NFA  EAKI L+MIL+ YS  +S  YVH P Q FM+RP+ G++VILH
Sbjct  352   LPFGLGPRNCVGSNFATTEAKITLAMILRHYSFTVSPDYVHLPTQTFMIRPQHGLKVILH  411



>ref|XP_008358468.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
 ref|XP_008358469.1| PREDICTED: cytochrome P450 CYP749A22-like [Malus domestica]
Length=378

 Score =   405 bits (1042),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 257/361 (71%), Gaps = 4/361 (1%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+    VL    +  KLWW P  IQK M+ QGIKGP YR +HGNTKEI +  +   SKP 
Sbjct  14    FLCVFFVLVIIKILHKLWWTPHRIQKQMALQGIKGPPYRLIHGNTKEIFDMIKEAMSKP-  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               +LSHD+FP + PH++SW R YG N+L W G QP+LV+TE EL +EIL+++   YPK E
Sbjct  73    -KNLSHDIFPIVQPHMHSWTRTYGXNYLQWQGSQPQLVITELELCREILNNKDRAYPKSE  131

Query  517   LQGFSRRLLGDGI-GSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
               GF R+LLGDG+  ++ GEKW +MRKL  + FHGESL+ M   M+ SAET++E W+ +E
Sbjct  132   PTGFLRKLLGDGLLTTADGEKWKKMRKLGTHAFHGESLKSMFTEMVASAETILERWKSYE  191

Query  694   GKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIM  873
             GKEIE FEEF+L TSEVIS+TAFGS+Y+EG+NIFEML KL  L  K+   +R PG+S+  
Sbjct  192   GKEIEVFEEFKLFTSEVISKTAFGSSYIEGQNIFEMLTKLTLLFFKSVYIIRLPGISKFF  251

Query  874   KNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQI  1053
             K++DE+E+EKLE+G+   I +I KKRE+ K+  + + S  SDFL  LLEA+H  N + +I
Sbjct  252   KSSDEIEAEKLEKGIHASIAEIFKKREK-KSLTKGRDSFGSDFLGLLLEAHHDANDNQRI  310

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              ++ MVDECK+FY AG ETT +LL W   LLA H DWQE ARKEVM++FG++ P P GI 
Sbjct  311   SVDDMVDECKSFYIAGQETTNTLLAWTIFLLAHHTDWQEEARKEVMDLFGKQTPNPDGIV  370

Query  1234  R  1236
             R
Sbjct  371   R  371



>gb|KCW85138.1| hypothetical protein EUGRSUZ_B01978 [Eucalyptus grandis]
Length=424

 Score =   404 bits (1039),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 208/418 (50%), Positives = 278/418 (67%), Gaps = 31/418 (7%)
 Frame = +1

Query  415   FLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRK  594
             FL+W GP+  L +++ ELVKE+L++R   Y K + Q   R+L GDG+ S+K EKWAR R+
Sbjct  20    FLFWHGPEALLSISDTELVKEVLNNRDKTYVKPDFQENIRKLFGDGLFSTKREKWARQRR  79

Query  595   LANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNY  774
             LA+  FHGESL+ M+PAM++S   +++ W+  E +E+E FEEF  +TS+VISRTAFGS+Y
Sbjct  80    LAHLAFHGESLKCMIPAMVDSVHMLLKRWQNLEAREVELFEEFTGITSDVISRTAFGSSY  139

Query  775   LEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKRE  954
             +EG+NIF ML +L T+ S+N   +R PG+                            + E
Sbjct  140   IEGRNIFRMLGELTTIVSRNLFKLRLPGV----------------------------REE  171

Query  955   QTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWA  1134
             +  TGE   ++  +DFL  LL+A H  +   +I I+ ++DECKTFYFAG ETT S+L W 
Sbjct  172   KVNTGE--MNNYGNDFLGSLLKAYHDPDESKRITIDDVIDECKTFYFAGQETTNSVLTWT  229

Query  1135  TLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVE  1314
               LLA H+DWQ+ ARKEV  VFG E+P   G+ +LK + MI+ E+LRLYPPV  + RKV 
Sbjct  230   LFLLAIHKDWQQEARKEVTNVFGNEDPNHDGMMKLKTVGMIINESLRLYPPVISVFRKV-  288

Query  1315  KKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLP  1494
             KK V LG++ LP +I L+I  LA+ HD  IWG DVH FKPERF+EG+ KATNN+  AFLP
Sbjct  289   KKQVTLGSLVLPADIVLHIPTLAIHHDARIWGNDVHLFKPERFSEGIAKATNNNAAAFLP  348

Query  1495  FGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILH  1668
             FG GPR C+GLNFAM E KI ++MILQRYS  LS  Y+  P     + P+ GV+VILH
Sbjct  349   FGLGPRNCVGLNFAMNEVKIAVAMILQRYSFTLSPGYIPWPAHFLTIHPQPGVKVILH  406



>gb|KCW82723.1| hypothetical protein EUGRSUZ_C04098 [Eucalyptus grandis]
Length=393

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 259/348 (74%), Gaps = 5/348 (1%)
 Frame = +1

Query  202   KLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPH  381
             KLWW P  IQ+ M+SQGI+GP Y+  +GNT+EI + +   +S+P+  +LSHD+FPR+ PH
Sbjct  22    KLWWTPYRIQRTMASQGIRGPPYKLFYGNTREILQFKNEASSRPL--NLSHDIFPRVQPH  79

Query  382   IYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGS  561
             I +W   YGAN+L W G  P L+VTE EL+KE+L+++   +PK E+  F ++LLGDG+ +
Sbjct  80    ISTWTGTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVT  139

Query  562   SKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSE  741
             ++GEKW + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE
Sbjct  140   TEGEKWVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSE  199

Query  742   VISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVR  921
             +ISRTAFGS+Y+EG+NIFEML KL  +AS+N   +RFPG+S++ K NDELESEKLE G+R
Sbjct  200   IISRTAFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIR  259

Query  922   NGIIQIIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFA  1098
             + +++II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY A
Sbjct  260   DAMLEIIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIA  317

Query  1099  GHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
             G++T+ ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK
Sbjct  318   GYDTSNTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPDPDGIAKLK  365



>ref|XP_009784592.1| PREDICTED: cytochrome P450 CYP749A22-like, partial [Nicotiana 
sylvestris]
Length=266

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 189/270 (70%), Positives = 228/270 (84%), Gaps = 4/270 (1%)
 Frame = +1

Query  865   RIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGD  1044
             +I K+ DE+ESEKLE+G+R+ I +IIKKR+Q   G+E      SDFL KLLEA +Q+  +
Sbjct  1     QIWKSRDEIESEKLEQGIRDSITRIIKKRQQEIFGQEHNFG--SDFLGKLLEA-YQDYNE  57

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPY  1224
               I +E +VDECKTFYFAGHETTTSLLGW  LLLAT+++WQE+ARKEV+E FG+  PT  
Sbjct  58    KPISVEDIVDECKTFYFAGHETTTSLLGWTILLLATNKNWQEKARKEVLESFGKNVPTAD  117

Query  1225  GIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEI  1404
             G++RLKIMNMI+EE+LRLYPPVP+IKRKV KK V LG +TLPP + LYISPLA+QHDP+I
Sbjct  118   GLSRLKIMNMIIEESLRLYPPVPFIKRKVNKK-VQLGKLTLPPQMQLYISPLAVQHDPKI  176

Query  1405  WGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYS  1584
             WG+DVH FKPERFAEGVVKATNN+P+AFLPFGYGPRTCLGLNFAM E+K+ LSMILQRY 
Sbjct  177   WGEDVHIFKPERFAEGVVKATNNNPVAFLPFGYGPRTCLGLNFAMIESKVTLSMILQRYM  236

Query  1585  LALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
               +S SYVHSPVQLFMLRP+ GV++ILH+I
Sbjct  237   FTVSPSYVHSPVQLFMLRPQHGVKIILHKI  266



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   399 bits (1026),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 214/507 (42%), Positives = 313/507 (62%), Gaps = 24/507 (5%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L + +W+ P  ++KL+  QG  G SYR LHG+ KE +  R    SKPM  + S+ + PR+
Sbjct  31    LVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPM--NFSNYIAPRV  88

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY--PKIELQGFSRRLLG  546
             +P ++   + YG N   W+GP P + + + E +K + S    DY  P   L   ++ LL 
Sbjct  89    IPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFS-LINDYQKPTASLNPLAK-LLA  146

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH---EG-KEIEAF  714
             DG+ + +G+KW + RK+ N  FH E L+ M+PA   S + M+  W      EG  E++  
Sbjct  147   DGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVM  206

Query  715   EEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELE  894
                + +T++VISRTAFGS+Y +GK IF++  +L  +  ++ L +  PG  R +      +
Sbjct  207   PYLQNMTADVISRTAFGSSYEKGKKIFKLQTELGEMVMQSTLGIYIPGW-RFLPTKSNNK  265

Query  895   SEKLEEGVRNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEAN------HQENGDNQI  1053
              + + + +   I+ II +RE + K+GE    + ++D L  L+E+N      H  N D  +
Sbjct  266   MKVISKEISTLIMDIINERETSMKSGE----AIQTDLLSILMESNLNEIKQHGNNKDIGM  321

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              IE ++DECK FY AG ETT +LL W  +LL+++ DWQERAR EV E+FG + P   G++
Sbjct  322   SIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSDWQERARAEVFEIFGNKKPNYDGLS  381

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLK++ MIL E LRLYPPV    R V KK   LG +TLP  + L +  + +Q DPE+WG+
Sbjct  382   RLKVVTMILNEVLRLYPPVSMFGRLV-KKETKLGKLTLPAGVMLGLPVVLMQCDPELWGE  440

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H+FKPERF+EGV KA  N P AF+PFG+GPR C+GLNFAM EAK+ LSMILQR+SL L
Sbjct  441   DAHEFKPERFSEGVSKAAKN-PGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLEL  499

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SSSY H+P+     +P+ G  +ILH++
Sbjct  500   SSSYTHAPIAAITTQPQHGAHIILHKL  526



>ref|XP_004309425.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=334

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 246/336 (73%), Gaps = 2/336 (1%)
 Frame = +1

Query  667   MVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNV  846
             MVE+W+ HEGKEI+ FEEFRL TSEVISRTAFGS+Y EG+ IFE L KL  L  + +L V
Sbjct  1     MVESWKIHEGKEIDVFEEFRLYTSEVISRTAFGSSYFEGQTIFEKLSKLYDLIIRTYLIV  60

Query  847   RFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEAN  1026
             R PG+S++ +N+D++E+++LE+G+R+ I++I+KKRE      E KS   +DFL  LLEA+
Sbjct  61    RIPGISKVFRNSDDIETDELEKGIRDSILKIVKKREMEAILGEDKSIG-NDFLGLLLEAH  119

Query  1027  HQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ  1206
             H  N   +I I+ +V+EC+TFYFAG ETT S+L W  LLLA H  WQE ARKEV+++FG+
Sbjct  120   HGSNVKQRISIDELVEECRTFYFAGQETTNSVLSWIILLLAQHPYWQEEARKEVLQLFGK  179

Query  1207  ENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLAL  1386
             + P   G+A+LK M+MI+ ET RLYPP   I RKV ++ V LGN+ LP N+ L + PLAL
Sbjct  180   QTPNYDGLAKLKTMSMIMNETPRLYPPAVLIVRKVARE-VRLGNLLLPANMELLVPPLAL  238

Query  1387  QHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSM  1566
              H+ + WG+D   FKP+RF+EGV KATN++  AF+PFG GPR C+G NFA  E KI LSM
Sbjct  239   HHEAQFWGQDAGLFKPDRFSEGVGKATNDNMAAFMPFGMGPRMCVGFNFATTEIKIALSM  298

Query  1567  ILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             ILQRYS  LS  YVHSP Q   LRP+ GVQ+IL  +
Sbjct  299   ILQRYSFTLSPGYVHSPFQFMTLRPQHGVQIILQSL  334



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   394 bits (1012),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 211/505 (42%), Positives = 309/505 (61%), Gaps = 22/505 (4%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             + + +W+ P  ++KL+  QG  G SYR LHG+ KE +  R+   SKPM  + S+ + PR+
Sbjct  31    IVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPM--NFSNHIAPRV  88

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDG  552
             +P +Y   ++YG N   WLGP P + + + E +K + S    D+ K  +   +R LL  G
Sbjct  89    IPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFS-FINDFQKPTMNPLTR-LLVQG  146

Query  553   IGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE---HEGK-EIEAFEE  720
             I + +GEKWA+ RK+ N  FH E L+ M+PA   S   MV  W      EG  E++    
Sbjct  147   IANLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREGSCELDVMPC  206

Query  721   FRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRI-MKNNDELES  897
              + + S+VISRTAFGS+Y +G  IF++  +L  L  +  L +  PG S +  K+N +++ 
Sbjct  207   LKNMASDVISRTAFGSSYEKGXKIFKLQTELGNLVIQASLGIYIPGWSFLPTKSNRKMK-  265

Query  898   EKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEAN------HQENGDNQICI  1059
              ++ + +   I+ I+ +RE++    E   + ++D L  L+E+N      H  N D  + I
Sbjct  266   -EISKEITTLILGIMNEREKSMNAGE---AIQTDLLSILMESNMNEIKQHGNNKDIGMSI  321

Query  1060  EAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARL  1239
             E +++ECK FY AG ETT +LL W  +LL+++ +WQERAR EV E+FG + P   G+ RL
Sbjct  322   EEVIEECKLFYIAGQETTATLLVWTMVLLSSYSEWQERARAEVFEIFGNKKPNYDGLNRL  381

Query  1240  KIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDV  1419
             K++ MI  E LRLYPPV    R V +K   LGN+TLP  + L +  + +Q DPE+WG+D 
Sbjct  382   KVVTMIFNEVLRLYPPVSIFGRIV-RKETKLGNLTLPKGVMLGLPIVLIQRDPELWGEDA  440

Query  1420  HKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSS  1599
             H+F PERF+EGV KAT N P AF+PFG+GPR C+GLNF M EAK+ LSMILQR+S  LS 
Sbjct  441   HEFNPERFSEGVSKATKN-PCAFIPFGWGPRICIGLNFTMIEAKMTLSMILQRFSFELSP  499

Query  1600  SYVHSPVQLFMLRPKDGVQVILHRI  1674
             SY HSP      +P+ G  +ILH++
Sbjct  500   SYTHSPSASLTTQPQHGAHIILHKL  524



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   394 bits (1012),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 212/507 (42%), Positives = 312/507 (62%), Gaps = 24/507 (5%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L + +W+ P  ++KL+  QG  G SYR LHG+ KE +  R    SKPM  + S+ + PR+
Sbjct  31    LVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPM--NFSNYIAPRV  88

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY--PKIELQGFSRRLLG  546
             +P ++   + YG N   W+GP P + + + E +K + S    DY  P   L   ++ LL 
Sbjct  89    IPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFS-LINDYQKPTASLNPLAK-LLA  146

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREH---EG-KEIEAF  714
             DG+ + +G+KW + RK+ N  FH E L+ M+PA   S + M+  W      EG  E++  
Sbjct  147   DGLLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVM  206

Query  715   EEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELE  894
                + +T++VISRTAFGS+Y +GK  F++  +L  +  ++ L +  PG  R +      +
Sbjct  207   PYLQNMTADVISRTAFGSSYEKGKRXFKLQTELGEMVMQSTLGIYIPGW-RFLPTKSNNK  265

Query  895   SEKLEEGVRNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEAN------HQENGDNQI  1053
              + + + +   I+ II +RE + K+GE    + ++D L  L+E+N      H  N D  +
Sbjct  266   MKVISKEISTLIMDIINERETSMKSGE----AIQTDLLSILMESNLNEIKQHGNNKDIGM  321

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              IE ++DECK FY AG ETT +LL W  +LL+++ +WQERAR EV E+FG + P   G++
Sbjct  322   SIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLS  381

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLK++ MIL E LRLYPPV    R V KK   LG +TLP  + L +  + +Q DPE+WG+
Sbjct  382   RLKVVTMILNEVLRLYPPVSMFGRLV-KKETKLGKLTLPAGVMLGLPVVLMQCDPELWGE  440

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H+FKPERF+EGV KA  N P AF+PFG+GPR C+GLNFAM EAK+ LSMILQR+SL L
Sbjct  441   DAHEFKPERFSEGVSKAAKN-PGAFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLEL  499

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SSSY H+P+     +P+ G  +ILH++
Sbjct  500   SSSYTHAPIAAITTQPQHGAHIILHKL  526



>ref|XP_011013342.1| PREDICTED: cytochrome P450 734A1-like [Populus euphratica]
Length=521

 Score =   393 bits (1010),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 214/528 (41%), Positives = 316/528 (60%), Gaps = 21/528 (4%)
 Frame = +1

Query  106   YYCRLIKmmmmmiiiiiFISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHG  285
             YY  LIK++ +      F++ +L+L  A L   LWW P  I+   + QGI+GP YRF  G
Sbjct  7     YYHWLIKLLAIS-----FLALVLLLKIAVL---LWWRPRRIEHHFAKQGIRGPPYRFFIG  58

Query  286   NTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAE  465
             N KEI E     +S+PM    SH++ PR+L   + WK++YGA FL W GP   L V++ +
Sbjct  59    NVKEIVEMMLKASSQPM--PFSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPD  116

Query  466   LVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPA  645
             L++EI + +   Y KIE     ++L GDG+ S KGEKWA  RK+    FH E+L+ ++P 
Sbjct  117   LIREIFTSKSEFYEKIEAHPLVKQLEGDGLLSLKGEKWAHHRKIIAPTFHMENLKLLVPV  176

Query  646   MIESAETMVEAW---REHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLK  816
             + +S   M+E W      +  EIE  E F+ LT EVI+RTAFGS+Y +GK IF +  +  
Sbjct  177   VAKSVTDMLEQWSTVSNSDEVEIEVSEWFQTLTEEVITRTAFGSSYEDGKAIFRLQAQQM  236

Query  817   TLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQII-KKREQTKTGEEQKSSRR  993
              LA+  F  V  PG  R       + S KL++ +R  ++++I ++RE +    E      
Sbjct  237   VLAAVAFQRVLIPGY-RFFPTKRNVNSWKLDKEIRRSLMKLIERRREGSSIINETHRHGP  295

Query  994   SDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQER  1173
              D L  +++A+   N    + +  +V+ECK+F+FAG +TT++LL W T+LLA H  WQ +
Sbjct  296   KDLLGLMIQAS---NSSKDVTVHDIVEECKSFFFAGKQTTSNLLTWTTVLLAMHPHWQVQ  352

Query  1174  ARKEVMEVFGQEN-PTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLP  1350
             AR+EV+ V G  + P+   +A+LK + MIL E+LRLYPP     R+  K +V LG   +P
Sbjct  353   AREEVLRVCGSRDIPSKDDVAKLKTLTMILNESLRLYPPTIATIRR-SKADVELGGYKIP  411

Query  1351  PNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLN  1530
                 L I  LAL HD  IWG D ++F P RF+ GV +A  +H +AF+PFG G RTC+G N
Sbjct  412   RGTELLIPILALHHDQSIWGHDANEFNPRRFSNGVARAAKHH-VAFIPFGLGVRTCIGQN  470

Query  1531  FAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              A+ +AK+ L++ILQR+S  L++SY H+P  L +L P+ G  +I  R+
Sbjct  471   LAILQAKLTLAIILQRFSFRLATSYQHAPTVLMLLYPQHGAPIIFQRL  518



>ref|XP_010046256.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=382

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/400 (47%), Positives = 273/400 (68%), Gaps = 24/400 (6%)
 Frame = +1

Query  238   MSSQGIKGPSYRFLHGNTKEISEARRGITSK---PMEDDLSHDVFPRILPHIYSWKRLYG  408
             M+SQGIKGP Y+F+HG TKEIS+ +  +  K   PM + +SH++ P + PHI+ W +LY 
Sbjct  1     MASQGIKGPPYKFIHGCTKEISKLKEDVMMKMNEPMTN-VSHEILPIVEPHIHKWNKLY-  58

Query  409   ANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARM  588
                             + ELVKE+L++R   Y K+E  G  +++ GDG+ +++G+KWAR 
Sbjct  59    ----------------DTELVKEVLNNRDKTYVKLEFPGDIKKIFGDGLVATEGKKWARQ  102

Query  589   RKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRTAFGS  768
             R+LA+  FHGESL+GM+PAM++S   +++ W++ E KE+E FEEF  +TS+VISRTAFGS
Sbjct  103   RRLAHLAFHGESLKGMIPAMVDSVHALLDRWQKLEAKEVEIFEEFATITSDVISRTAFGS  162

Query  769   NYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKK  948
             +Y+EG+ IF+ML +L  + S+NF  +R PG+ +I K +DE++SE+LE+ + + ++ IIKK
Sbjct  163   SYMEGREIFQMLSELTIVVSRNFFKLRLPGIRKIWKTSDEIKSERLEKAICDALLGIIKK  222

Query  949   REQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLG  1128
             RE+   GE       +D+L  LL+A H  +   +I ++ + DECKTF+FAG ETTTS+L 
Sbjct  223   REEKAKGEMDDYG--NDYLGSLLKAYHDPDKSKRITMDDLRDECKTFHFAGQETTTSILT  280

Query  1129  WATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRK  1308
             W   LLA H+DWQE ARKEV +VFG E+P   GI +LK ++MI+ E+LRLYPPV    RK
Sbjct  281   WTLFLLAIHKDWQEEARKEVTDVFGNEDPNHEGIIKLKTVDMIINESLRLYPPVVSAIRK  340

Query  1309  VEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKF  1428
             V ++ V LGN+ LP  I L+I  L + H P IWG DVH +
Sbjct  341   VVRQ-VTLGNLALPQGIALHIPILTIHHSPRIWGDDVHTY  379



>ref|XP_011012397.1| PREDICTED: cytochrome P450 734A1-like [Populus euphratica]
Length=521

 Score =   391 bits (1005),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 207/528 (39%), Positives = 319/528 (60%), Gaps = 21/528 (4%)
 Frame = +1

Query  106   YYCRLIKmmmmmiiiiiFISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHG  285
             YY  LIK++ + ++ ++F+  ++VL        LW  P  I++  S QGI+GP YRF  G
Sbjct  7     YYYWLIKLLAISLLALVFLIKIVVL--------LWCTPRRIEQHFSKQGIRGPPYRFFIG  58

Query  286   NTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAE  465
             N KEI E     +S+PM    SH++ PR+L   + WK++YGA FL W GP   L V++ +
Sbjct  59    NVKEIVEMMLKASSQPMP--FSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPD  116

Query  466   LVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPA  645
             L++EI + +   Y K+E     ++L GDG+ S KGEKWA  RK+    FH E+L+ ++P 
Sbjct  117   LIREIFTSKSELYEKVEAHPLVKQLEGDGLLSLKGEKWALHRKIITPTFHMENLKLLVPV  176

Query  646   MIESAETMVEAWREHEGK---EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLK  816
             + +S   M+E W         EIE  E F+ LT +VI+RTAFGS+Y +GK IF++  +  
Sbjct  177   VAKSVIDMLEQWSAMTNSDEVEIEVSEWFQTLTEDVITRTAFGSSYEDGKAIFQLQAQQM  236

Query  817   TLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQII-KKREQTKTGEEQKSSRR  993
              LA+  F  V  PG  R       + S +L++ ++  ++++I ++RE++   +  + S  
Sbjct  237   VLAAVAFRRVLIPGY-RFFPTRRNINSWRLDKEIKKSLMRLIERRREKSSVNKAHQDSCP  295

Query  994   SDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQER  1173
              D L  +++A+H       + +  +V+ECK+F+FAG  TT++LL W T+LLA H  WQ +
Sbjct  296   KDLLGLMIQASH---SCADVTVHDIVEECKSFFFAGQHTTSNLLTWTTVLLAMHPQWQAQ  352

Query  1174  ARKEVMEVFG-QENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLP  1350
             AR+EV+ V G +E PT   +A+LK + MIL E+LRLYPP     R+  K +V LG+  +P
Sbjct  353   AREEVLRVCGSRETPTKDDVAKLKTLTMILNESLRLYPPTIATIRR-SKADVELGDYKVP  411

Query  1351  PNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLN  1530
                 + I  LAL HD  IWG D ++F P RF+ GV +A  +H +AF+PFG G RTC+G N
Sbjct  412   SGTEILIPILALHHDQSIWGNDANEFNPARFSGGVARAAKHH-VAFIPFGLGVRTCIGQN  470

Query  1531  FAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              A+ +AK+ L+++LQR+S  L+ SY H+P  L +L P+ G  +I   +
Sbjct  471   LAILQAKLTLAILLQRFSFRLAPSYQHAPTVLMLLYPQYGAPIIFQHL  518



>gb|KCW73209.1| hypothetical protein EUGRSUZ_E016722, partial [Eucalyptus grandis]
Length=371

 Score =   385 bits (989),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 249/353 (71%), Gaps = 3/353 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +LSHD+FP
Sbjct  20    AKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPM-SNLSHDIFP  78

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I  W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   +GF ++LLG
Sbjct  79    KIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKLLG  138

Query  547   DGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+ G EKWA+ RKLAN  FHGESL+ M PAM++S  TM+E W+  EGKEIE F +F
Sbjct  139   DGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDF  198

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             ++LTSEVISRTAFGS+Y+EG+NIF+ML  L  L S+N   +R PG+S++ K  DE+E+EK
Sbjct  199   KVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEK  258

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+ + I+Q+IK+RE+ K    +      DFL +L++A H  +   +I ++ +VDECK
Sbjct  259   LEKGICDSIVQMIKRREK-KVMAGEVDCFGDDFLGQLVKALHDADKSKKITVDNLVDECK  317

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
             TFY AGHET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK
Sbjct  318   TFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLK  370



>ref|XP_004508536.1| PREDICTED: cytochrome P450 734A1-like [Cicer arietinum]
Length=528

 Score =   390 bits (1003),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 206/511 (40%), Positives = 313/511 (61%), Gaps = 14/511 (3%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             FI  L VL    L    WW P  IQ   S QGI+GP YRF  GN KE+ E     +S+PM
Sbjct  16    FIFLLFVLKVTVL---FWWRPRKIQGHFSKQGIRGPPYRFFIGNVKELVEMMLKASSQPM  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
               + SH++ PR+L   + WK++YGA FL W GP   L V++ +L++EI + +   Y K E
Sbjct  73    -PNFSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPDLIREIFTSKSEFYEKNE  131

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEG  696
                  ++L GDG+ S KGEKWA  RK+ +  FH E+L+ ++P M  S   M+E W     
Sbjct  132   APPLVKQLEGDGLLSLKGEKWAHHRKIISPTFHMENLKLLIPVMATSVVEMLEKWSAMAE  191

Query  697   K---EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
             K   EIE  E F+ LT +VI++TAFGS+Y +GK +F +  +   LA+  F  V  PG  R
Sbjct  192   KGQVEIEVSECFQTLTEDVITKTAFGSSYEDGKAVFRLQAQQMVLAADAFQKVFIPGY-R  250

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSR-RSDFLEKLLEANHQENGD  1044
                    ++  KLE+ ++  ++++I++R++  +G E+   +   D L  +++AN++ + +
Sbjct  251   FFPTRRNIKCWKLEKEIKKSLVKLIERRKENWSGNEKIFEKGPKDLLGLMIQANNKISSN  310

Query  1045  NQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQEN-PTP  1221
               + ++ +V+ECK+F+FAG +TT++LL W T+LLA H  WQ +AR EV+++ G  + PT 
Sbjct  311   --VTVDDIVEECKSFFFAGKQTTSNLLTWTTILLAMHPHWQVQARDEVLKMCGSRDLPTK  368

Query  1222  YGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPE  1401
               + +LK +NMI+ E+LRLYPP     R+  K +V LG   +P    L I  LA+ HD  
Sbjct  369   DHVVKLKTLNMIVNESLRLYPPTIATIRRT-KTDVELGGYKIPRGTELLIPILAVHHDLA  427

Query  1402  IWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRY  1581
             IWG DV++F P RF+EGV +A   HP+AF+PFG G RTC+G N A+ + K+ L++ILQR+
Sbjct  428   IWGNDVNEFNPGRFSEGVARAA-KHPVAFIPFGLGVRTCIGQNLAVLQTKLALAIILQRF  486

Query  1582  SLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             S  L+ SY H+P  L +L P+ G  +I +++
Sbjct  487   SFRLAPSYQHAPTVLMLLYPQYGAPIIFNQL  517



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   390 bits (1002),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 209/507 (41%), Positives = 308/507 (61%), Gaps = 24/507 (5%)
 Frame = +1

Query  193   LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRI  372
             L + +W+ P  ++KL+  QG  G SYR L+G+ KE +  R    SKPM  + S+ + PR+
Sbjct  30    LVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPM--NFSNHIAPRV  87

Query  373   LPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY--PKIELQGFSRRLLG  546
             +P ++   + YG N   W+GP P + + + E +K + S    DY  P   L   ++ LL 
Sbjct  88    IPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFS-LINDYQKPTASLNPLAK-LLA  145

Query  547   DGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWRE----HEGKEIEAF  714
             DG+ + +G KW + RK+ N  FH E L+ M+PA   S + M+  W          E++  
Sbjct  146   DGLLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVQGSCELDVM  205

Query  715   EEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELE  894
                + +T++VISRTAFGS+Y +GK IF++  +L  +  ++ L +  PG  R +      +
Sbjct  206   PYLQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGW-RFLPTKSNNK  264

Query  895   SEKLEEGVRNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEAN------HQENGDNQI  1053
              + + + +   I+ II +RE + K GE    + ++D L  L+E+N      H  N D  +
Sbjct  265   MKVISKEISTLIMGIINERETSMKAGE----ATQTDLLSILMESNLNEIKQHGNNKDIGM  320

Query  1054  CIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIA  1233
              IE ++DECK FY AG ETT +LL W  +LL+++ +WQERAR EV E+FG + P   G++
Sbjct  321   SIEDVIDECKLFYIAGQETTATLLTWTMVLLSSYSEWQERARAEVFEIFGNKKPDYDGLS  380

Query  1234  RLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGK  1413
             RLK++ MIL E LRLYPPV    R + KK   LG +TLP  + L +  + +Q DPE+WG+
Sbjct  381   RLKVVTMILNEVLRLYPPVSMFGRFI-KKETKLGKLTLPAGVMLGLPTVLIQCDPELWGE  439

Query  1414  DVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLAL  1593
             D H+FKPERF EGV KAT N   AF+PFG+GPR C+GLNFAM EAK+ LSMILQR+SL L
Sbjct  440   DAHEFKPERFFEGVSKATKNSG-AFVPFGWGPRICIGLNFAMIEAKMTLSMILQRFSLEL  498

Query  1594  SSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             SSSY H+P+     +P+ G  +ILH++
Sbjct  499   SSSYTHAPIVAITTQPQHGAHIILHKL  525



>ref|XP_003569398.1| PREDICTED: cytochrome P450 72A15-like [Brachypodium distachyon]
Length=531

 Score =   389 bits (1000),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 216/524 (41%), Positives = 309/524 (59%), Gaps = 31/524 (6%)
 Frame = +1

Query  157   FISSLLVLAAAW----LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGIT  324
              +  LL     W    L E+LWW P  +++ + +QG+ G SYRFL G+  + +   R   
Sbjct  19    LVCGLLGFVFLWQTARLLEQLWWQPRRLERALRAQGLHGTSYRFLTGDVNDFARLNREAW  78

Query  325   SKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDY  504
             SKPM    SHD+ PRILP +Y   + +G   + W GP P++ +T+  LV+E++S + G  
Sbjct  79    SKPMPLG-SHDIGPRILPFLYKTVQEHGKPCISWFGPLPKVTITDPALVREVMSSKFGHI  137

Query  505   PKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR  684
              K++    SR LL DG+GS +GEKW   R++ N  FH E L+ M+PA     E +V  W 
Sbjct  138   EKMKFPALSR-LLADGVGSYEGEKWVTHRRILNPAFHLEKLKLMMPAFSACCEELVSRWT  196

Query  685   EHEGK----EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIF----EMLIKLKTLASKNFL  840
             E  G     E++   E + LT +VIS TAFGS+Y EG+ IF    E + +      K F+
Sbjct  197   ESLGSDGSWEVDVCSELQSLTGDVISHTAFGSSYREGRRIFQLQNEQIGRFMAAVHKFFI  256

Query  841   NVRFPG-MSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLL  1017
                 PG MS   KNN  ++  ++   + + +  +I KR QT    ++  S + D L  LL
Sbjct  257   ----PGYMSFPTKNNRRMQ--QINNEIESILRGLIGKRLQTM---QEGESTKDDLLGLLL  307

Query  1018  EANHQENGDN-----QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARK  1182
             E++  +   N      + IE +V+ECK FYFAG ETT+ LL W  ++L+ H +WQ+RAR+
Sbjct  308   ESSMTDTDANGKSSLAMSIEEVVEECKLFYFAGMETTSVLLTWTMIVLSMHPEWQDRARE  367

Query  1183  EVMEVFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIH  1362
             EV+ +FG++ P   G+ RLK + MIL E LRLYPP   + R+  K+ + +G I  P  + 
Sbjct  368   EVVTLFGKQKPEYEGLNRLKFVTMILYEVLRLYPPASALTRRTYKE-IEIGGIRYPAGVV  426

Query  1363  LYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMA  1542
               +  L + HDPEIWG DVH+F+P+RFAEGV KA+ N P AFLPFG+GPR C+G NFA+ 
Sbjct  427   FEMPVLFIHHDPEIWGTDVHQFRPDRFAEGVSKASKN-PGAFLPFGWGPRICIGQNFALL  485

Query  1543  EAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             EAK+ L MILQR+   L+ SY H+P  + MLRP  G Q+ L  I
Sbjct  486   EAKMALCMILQRFEFELAPSYAHAPHTVMMLRPMHGAQIKLRGI  529



>gb|KCW44245.1| hypothetical protein EUGRSUZ_L02323 [Eucalyptus grandis]
Length=350

 Score =   382 bits (982),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 255/345 (74%), Gaps = 5/345 (1%)
 Frame = +1

Query  217   PVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWK  396
             PV   + M+SQGI+GP Y+  +GNT+EI + +   +S+P+  +LSHD+FPR+ PHI +W 
Sbjct  4     PVSHPETMASQGIRGPPYKLFYGNTREILQFKNETSSRPL--NLSHDIFPRVQPHISTWT  61

Query  397   RLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEK  576
               YGAN+L W G  P L+VTE EL+KE+L+++   +PK E+  F ++LLGDG+ +++GEK
Sbjct  62    GTYGANYLSWYGLLPRLIVTEPELIKEVLNNKDKAFPKPEMDEFVKKLLGDGLVTAEGEK  121

Query  577   WARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEFRLLTSEVISRT  756
             W + RKLAN  FHG+SL+GMLPAM++S   M++ W+   G EIE ++EF +LTSE+ISRT
Sbjct  122   WVKQRKLANYAFHGDSLKGMLPAMVDSVHMMLDRWKNLHGDEIEVYQEFTILTSEIISRT  181

Query  757   AFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQ  936
             AFGS+Y+EG+NIFEML KL  +AS+N   +RFPG+S++ K NDELESEKLE G+R+ +++
Sbjct  182   AFGSSYVEGRNIFEMLRKLTLIASRNTFRIRFPGISKLWKTNDELESEKLENGIRDAMLE  241

Query  937   IIKKREQ-TKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETT  1113
             II+KRE+  K GE       +DFL  L++A+H ++   +I I  +VDECKTFY AG++T+
Sbjct  242   IIRKREEKVKAGELDDLG--NDFLGLLVKASHSDDESRRITITDLVDECKTFYIAGYDTS  299

Query  1114  TSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLKIM  1248
              ++L W   LLA H +WQ+ ARKEV+ VFG ++P P GIA+LK +
Sbjct  300   NTMLTWTVFLLAIHPEWQDEARKEVLNVFGNQDPYPDGIAKLKTV  344



>ref|XP_010058553.1| PREDICTED: cytochrome P450 CYP749A22-like [Eucalyptus grandis]
Length=439

 Score =   386 bits (991),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 249/353 (71%), Gaps = 3/353 (1%)
 Frame = +1

Query  187   AWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFP  366
             A L  KLWW P+ IQ++M+ QGI GP YRFLHG+TKE  +      + PM  +LSHD+FP
Sbjct  87    AKLLHKLWWNPLRIQRMMAQQGITGPPYRFLHGSTKETIKMHMEARNTPM-SNLSHDIFP  145

Query  367   RILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLG  546
             +I P I  W   YG N+L WLGPQ +LV+TE ELVKE+L +R   YPK   +GF ++LLG
Sbjct  146   KIQPQINKWIGTYGRNYLSWLGPQAQLVITEPELVKEVLLNRDKTYPKTGNRGFPKKLLG  205

Query  547   DGIGSSKG-EKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGKEIEAFEEF  723
             DG+ S+ G EKWA+ RKLAN  FHGESL+ M PAM++S  TM+E W+  EGKEIE F +F
Sbjct  206   DGLASTPGGEKWAKKRKLANRAFHGESLKNMAPAMVDSVHTMLEKWKNQEGKEIEVFRDF  265

Query  724   RLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEK  903
             ++LTSEVISRTAFGS+Y+EG+NIF+ML  L  L S+N   +R PG+S++ K  DE+E+EK
Sbjct  266   KVLTSEVISRTAFGSSYIEGRNIFQMLTGLALLTSRNAFTIRLPGLSKLWKTVDEVEAEK  325

Query  904   LEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECK  1083
             LE+G+ + I+Q+IK+RE+ K    +      DFL +L++A H  +   +I ++ +VDECK
Sbjct  326   LEKGICDSIVQMIKRREK-KVMAGEVDCFGDDFLGQLVKALHDADKSKKITVDNLVDECK  384

Query  1084  TFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQENPTPYGIARLK  1242
             TFY AGHET  SL+ W   LLA + +WQE AR EV+ VFG ++P   G+ +LK
Sbjct  385   TFYVAGHETANSLMAWMLFLLAIYPEWQEEARMEVLNVFGNKDPNFDGLGKLK  437



>ref|XP_002324347.2| hypothetical protein POPTR_0018s06550g [Populus trichocarpa]
 gb|EEF02912.2| hypothetical protein POPTR_0018s06550g [Populus trichocarpa]
Length=521

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 206/528 (39%), Positives = 316/528 (60%), Gaps = 21/528 (4%)
 Frame = +1

Query  106   YYCRLIKmmmmmiiiiiFISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHG  285
             YY  LIK++ +  + ++F+  ++VL        LW  P  I+   S QGI+GP YRF  G
Sbjct  7     YYYWLIKLLAISFLALVFLIKIVVL--------LWCRPRRIEHHFSKQGIRGPPYRFFIG  58

Query  286   NTKEISEARRGITSKPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAE  465
             N KEI E     +S+PM    SH++ PR+L   + WK++YGA FL W GP   L V++ +
Sbjct  59    NVKEIVEMMLKASSQPMP--FSHNILPRVLSFYHHWKKIYGATFLVWFGPTVRLTVSDPD  116

Query  466   LVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPA  645
             L++EI + +   Y K+E     ++L GDG+ S KGEKWA  RK+    FH E+L+ ++P 
Sbjct  117   LIREIFTSKSELYEKVEAHPLVKQLEGDGLLSLKGEKWALHRKIITPTFHMENLKLLVPV  176

Query  646   MIESAETMVEAWREHEGK---EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLK  816
             + +S   M+E W         EIE  E F+ LT +VI+RTAFGS+Y +GK IF++  +  
Sbjct  177   VAKSVSDMLEQWSAMTNSDEVEIEVSEWFQTLTEDVITRTAFGSSYEDGKAIFQLQAQQM  236

Query  817   TLASKNFLNVRFPGMSRIMKNNDELESEKLEEGVRNGIIQII-KKREQTKTGEEQKSSRR  993
              LA+  F  V  PG  R       + S +L++ ++  ++++I ++RE++   +  + S  
Sbjct  237   VLAAVAFRRVLIPGY-RFFPTRRNINSWRLDKEIKKSLMKLIERRREKSSVNKTHQDSCP  295

Query  994   SDFLEKLLEANHQENGDNQICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQER  1173
              D L  +++A+   N    + +  +V+ECK+F+FAG  TT++LL W T+LLA H  WQ +
Sbjct  296   KDLLGLMIQAS---NSCTDVTVHDIVEECKSFFFAGQHTTSNLLTWTTVLLAMHPQWQAQ  352

Query  1174  ARKEVMEVFG-QENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLP  1350
             AR+EV+ V G ++ PT   +A+LK + MIL E+LRLYPP     R+  K +V LG   +P
Sbjct  353   AREEVLRVCGSRDTPTKDDVAKLKTLTMILNESLRLYPPTIATIRR-SKADVELGGYKVP  411

Query  1351  PNIHLYISPLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLN  1530
                 + I  LAL HD  IWG D ++F P RF+ GV +A  +H +AF+PFG G RTC+G N
Sbjct  412   SGTEILIPILALHHDQSIWGNDANEFNPARFSGGVARAAKHH-VAFIPFGLGVRTCIGQN  470

Query  1531  FAMAEAKIVLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              A+ +AK+ L+++LQR+S  L+ SY H+P  L +L P+ G  +I   +
Sbjct  471   LAILQAKLTLAILLQRFSFRLAPSYQHAPTVLMLLYPQYGAPIIFQHL  518



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 209/516 (41%), Positives = 311/516 (60%), Gaps = 24/516 (5%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             +ISS    A  W+    W  P  ++K +  QGIKGPSY+FL GN K+I  A +   +KPM
Sbjct  17    YISSWAWKAFVWV----WLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSATQEARAKPM  72

Query  337   EDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIE  516
             E  LSH + PR++P ++     YG     W GP   + + + +++++ILS++ G + KI 
Sbjct  73    E--LSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFGHFEKIR  130

Query  517   LQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWR---E  687
                  + LL  G+ S +GEKW + R++ N  FH E L+ MLPA+  S   MV  W     
Sbjct  131   TNPLGK-LLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCSEMVNKWEMMVS  189

Query  688   HEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSR  867
              +  E++ +   + LT++VISRTAFGS+Y EG+ IF++  +   L  K   ++  PG+ R
Sbjct  190   QDSCELDVWPHLQNLTADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKALQSIYIPGL-R  248

Query  868   IMKNNDELESEKLEEGVRNGIIQIIKKREQT-KTGEEQKSSRRSDFLEKLLEANHQENGD  1044
              +        +++    R  +  I+ KRE+  K GE    +   D L  L+E+N +E  D
Sbjct  249   FLPTKRNNRMKEIYGEARVLLRDIVNKREKAMKIGE----AHNDDLLGLLMESNFKEITD  304

Query  1045  N------QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFGQ  1206
             N       + I+ ++DECK FYFAG ETT++LL W  ++L+ H DWQE+AR+EV++VFG 
Sbjct  305   NVNSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPDWQEKAREEVLQVFGG  364

Query  1207  ENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLAL  1386
             ++P   G+  LKI+ MIL E LRLYPP   + R    K + LG ITLP  +HL +  L +
Sbjct  365   KDPDFDGLNHLKIVTMILYEVLRLYPPAVLMARGT-YKTMKLGEITLPAGVHLAMPTLLV  423

Query  1387  QHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSM  1566
              HD E+WG+D   F PERF+ GV KAT N  ++F PF +GPR C+G NFA+ E+K+ ++M
Sbjct  424   HHDRELWGEDAEDFNPERFSGGVSKATKNQ-VSFFPFSWGPRICIGQNFALLESKMAIAM  482

Query  1567  ILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
             ILQR+S  LSS+YVH+P  +  L+P+ G Q+ILH++
Sbjct  483   ILQRFSFELSSTYVHAPYTVITLQPQHGAQLILHKL  518



>ref|XP_006644394.1| PREDICTED: secologanin synthase-like [Oryza brachyantha]
Length=531

 Score =   388 bits (997),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 211/520 (41%), Positives = 310/520 (60%), Gaps = 23/520 (4%)
 Frame = +1

Query  157   FISSLLVLAAAWLCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPM  336
             F+  LL+  A  L  +LWW P  I+  + +QG++G  YRFL G+  E     R   ++P+
Sbjct  21    FLGLLLLWQAVRLLHRLWWRPRRIELALRAQGVRGTRYRFLTGDLGEHGRLNREAWARPL  80

Query  337   EDDL-SHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKI  513
                L  H + PR+ P +++  R +G  FL W GP P++   +  + +++LS++ G + K 
Sbjct  81    PLPLRCHHIAPRVAPFLHNASREHGRTFLSWFGPNPKVTFVDPAVARDVLSNKFGHFEKF  140

Query  514   ELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHE  693
             + QG ++ ++ DG+ S +GE+WA+ R++ N  FH E L+ MLPA     E ++  W E  
Sbjct  141   KFQGLTK-VISDGLASHEGERWAKHRRILNPAFHVEKLKRMLPAFSACCEELISRWMESV  199

Query  694   GK----EIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPG-  858
             G     E++ + E + LT +VISRTAFGS+YLEG+ IF++  +      K       PG 
Sbjct  200   GSGGSYEVDVWPEMQSLTGDVISRTAFGSSYLEGRRIFQLQAEQADRVMKCIQKTVIPGY  259

Query  859   MSRIMKNNDELESEKLE-EGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEANHQ-  1032
             MS   KNN  ++  K E + +  G+I   K+ +  K GE    S + D L  LLE+N + 
Sbjct  260   MSLPTKNNRRMKHIKKEIDSILRGLID--KRMQALKEGE----STKDDLLGLLLESNMRQ  313

Query  1033  ----ENGDNQ--ICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVME  1194
                 E+G +   + IE +++ECK FYFAG ETT+ LL W  LLL+ H +WQ+RAR+E++ 
Sbjct  314   MEMAEDGQSSQGLTIEEVIEECKLFYFAGMETTSVLLTWTMLLLSMHPEWQDRAREEILG  373

Query  1195  VFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYIS  1374
             +FG+  P   G+ RLKI+ MIL E LRLYPP     R+  K+ + +G +T P  + + + 
Sbjct  374   LFGKNKPEYEGLNRLKIVTMILYEVLRLYPPAVTFTRQTYKQ-MEIGGVTYPAGVMIELP  432

Query  1375  PLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKI  1554
              L +  DP IWG DVH FKPERFAEG+ +A+ + P AFLPFG+GPR C+G NFA+ EAK+
Sbjct  433   VLLIHGDPSIWGSDVHDFKPERFAEGISRASKD-PGAFLPFGWGPRICIGQNFALLEAKM  491

Query  1555  VLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              L MILQR  L L+ SY H+P  +  LRP  G QV L  I
Sbjct  492   ALCMILQRLELELAPSYTHAPQSVLTLRPIHGAQVKLRAI  531



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   388 bits (996),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 210/520 (40%), Positives = 311/520 (60%), Gaps = 27/520 (5%)
 Frame = +1

Query  157   FISSLLVLAAAW---LCEKLWWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITS  327
               S++++    W   +   +W  P  ++K    QG+ G  YR L+G+TKE++E  +    
Sbjct  7     LFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAEMTKEAKF  66

Query  328   KPMEDDLSHDVFPRILPHIYSWKRLYGANFLYWLGPQPELVVTEAELVKEILSDR---KG  498
             KP++  L+ D+ PRI P  +     YG +   W+GP+P + V + EL+KEI+++    K 
Sbjct  67    KPIK--LTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNNTIFKK  124

Query  499   DYPKIELQGFSRRLLGDGIGSSKGEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEA  678
               P   +Q     LL  GI S + +KWA+ RK+ N  F+ E L+ MLPAM  S E M+  
Sbjct  125   PKPAPLVQ-----LLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMINK  179

Query  679   WR----EHEGKEIEAFEEFRLLTSEVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNV  846
             W     E++  E++    F   TS+VISRTAFGS+Y EG  IF +  +L  L  + F +V
Sbjct  180   WEILLSENKSCELDVHPYFEDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSV  239

Query  847   RFPGMSRIMKNNDELESEKLEEGVRNGIIQIIKKREQTKTGEEQKSSRRSDFLEKLLEAN  1026
               PG  R +        + ++  +R+ + +I+ KRE+   GE   +S + D L  LL++N
Sbjct  240   YIPGW-RYLPTRTNRRMKAIDNELRDILRKIVSKRERAMVGE---ASDQEDLLGILLKSN  295

Query  1027  H---QENGDN-QICIEAMVDECKTFYFAGHETTTSLLGWATLLLATHEDWQERARKEVME  1194
                 QE G    +  + +++ECK FYFAG E++++LL W  +LL+ H+ WQ RAR+EV +
Sbjct  296   LKEIQERGSKFGMTTDEVIEECKVFYFAGQESSSNLLVWTMVLLSVHQTWQARAREEVQQ  355

Query  1195  VFGQENPTPYGIARLKIMNMILEETLRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYIS  1374
             VF    P   G++RLKI+ MIL E LRLYPP PY  RKV K+   LGN+++PP + L I 
Sbjct  356   VFQNNKPDFEGLSRLKIVTMILNEVLRLYPPAPYFVRKVYKET-KLGNMSIPPEVILVIP  414

Query  1375  PLALQHDPEIWGKDVHKFKPERFAEGVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKI  1554
              + + H+PE+WG+DV +FKPERFAEG+  AT N  + FLPF +GPR C+G NFAM E KI
Sbjct  415   TIFVHHNPELWGEDVKEFKPERFAEGIATATKNR-LCFLPFSWGPRICIGNNFAMLETKI  473

Query  1555  VLSMILQRYSLALSSSYVHSPVQLFMLRPKDGVQVILHRI  1674
              L+MILQR++  LS SY H+P  +  LRP+ G  +IL ++
Sbjct  474   ALAMILQRFAFELSPSYAHAPTYVVTLRPQCGAHLILQKL  513



>gb|KHN27404.1| Cytochrome P450 734A1 [Glycine soja]
Length=504

 Score =   387 bits (994),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 202/495 (41%), Positives = 301/495 (61%), Gaps = 11/495 (2%)
 Frame = +1

Query  208   WWAPVHIQKLMSSQGIKGPSYRFLHGNTKEISEARRGITSKPMEDDLSHDVFPRILPHIY  387
             WW P  I+   S QGI+GP YRF  GN KE+       +S+PM    SH++ PR+L   +
Sbjct  14    WWRPRKIEGHFSKQGIRGPPYRFFIGNVKELVGMMLKASSQPM--PFSHNILPRVLSFYH  71

Query  388   SWKRLYGANFLYWLGPQPELVVTEAELVKEILSDRKGDYPKIELQGFSRRLLGDGIGSSK  567
              WK++YGA FL W GP   L V+E +L++EI + +   Y K E     ++L GDG+ S K
Sbjct  72    HWKKIYGATFLVWFGPTVRLTVSEPDLIREIFTSKSEFYEKNEAPPLVKQLEGDGLLSLK  131

Query  568   GEKWARMRKLANNVFHGESLRGMLPAMIESAETMVEAWREHEGK---EIEAFEEFRLLTS  738
             GEKWA  RK+ +  FH E+L+ ++P M  S   M+E W     K   EIE  E F+ LT 
Sbjct  132   GEKWAHHRKIISPTFHMENLKLLVPVMATSVVEMLEKWSAMGEKGEVEIEVSEWFQSLTE  191

Query  739   EVISRTAFGSNYLEGKNIFEMLIKLKTLASKNFLNVRFPGMSRIMKNNDELESEKLEEGV  918
             +VI+RTAFGS+Y +GK IF +  +   LA+  F  V  PG  R       + S KLE+ +
Sbjct  192   DVITRTAFGSSYEDGKAIFRLQAQQMDLAADAFQKVFIPGY-RFFPTRRNIRSWKLEKEI  250

Query  919   RNGIIQIIKKREQTK--TGEEQKSSRRSDFLEKLLEANHQENGDNQICIEAMVDECKTFY  1092
             +  ++++I +R + +   G E+K     D L  +++A++     + + ++ MV+ECK+F+
Sbjct  251   KKSLVKLISRRRENEKGCGVEEKEKGPKDLLGLMIQASNMNMNMSNVTVDDMVEECKSFF  310

Query  1093  FAGHETTTSLLGWATLLLATHEDWQERARKEVMEVFG-QENPTPYGIARLKIMNMILEET  1269
             FAG +TT++LL W T+LLA H  WQ RAR+EV++V G +++PT   +A+L+ ++MI+ E+
Sbjct  311   FAGKQTTSNLLTWTTILLAMHPHWQVRAREEVLKVCGSRDHPTKDHVAKLRTLSMIVNES  370

Query  1270  LRLYPPVPYIKRKVEKKNVVLGNITLPPNIHLYISPLALQHDPEIWGKDVHKFKPERFAE  1449
             LRLYPP     R+  K +V LG   +P    L I  LA+ HD  IWGKD ++F P RF E
Sbjct  371   LRLYPPTIATIRRA-KADVDLGGYKIPGGTELLIPILAVHHDQAIWGKDANEFNPGRFRE  429

Query  1450  GVVKATNNHPIAFLPFGYGPRTCLGLNFAMAEAKIVLSMILQRYSLALSSSYVHSPVQLF  1629
             GV +A   HP+ F+PFG G RTC+G N A+ + K+ L++ILQR++  L+ +Y H+P  L 
Sbjct  430   GVSRA-GKHPLGFIPFGVGVRTCIGQNLALLQTKLALAIILQRFTFCLAPTYQHAPTVLM  488

Query  1630  MLRPKDGVQVILHRI  1674
             +L P+ G  +I   I
Sbjct  489   LLYPQYGAPIIFQLI  503



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6068496228312