BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25855_g3_i3 len=466 path=[757:0-384 22088:385-465]

Length=466
                                                                      Score     E

ref|XP_009600219.1|  PREDICTED: poly(A)-specific ribonuclease PARN      187   2e-52   
dbj|BAE47488.1|  polyA specific ribonuclease                            161   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009784553.1|  PREDICTED: poly(A)-specific ribonuclease PARN      171   1e-46   
ref|XP_010644585.1|  PREDICTED: poly(A)-specific ribonuclease PARN      170   2e-46   
emb|CBI39748.3|  unnamed protein product                                170   2e-46   
emb|CDY52905.1|  BnaA06g00130D                                          168   9e-46   
emb|CAN76999.1|  hypothetical protein VITISV_007764                     168   1e-45   Vitis vinifera
ref|XP_006304676.1|  hypothetical protein CARUB_v10011913mg             167   2e-45   
ref|XP_010462450.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    166   4e-45   
emb|CDY53757.1|  BnaCnng25490D                                          166   5e-45   
ref|XP_009147470.1|  PREDICTED: poly(A)-specific ribonuclease PARN      166   7e-45   
ref|XP_010273437.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    163   1e-44   
emb|CDP13712.1|  unnamed protein product                                164   3e-44   
ref|XP_010273436.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    164   3e-44   
ref|XP_002891857.1|  Poly(A)-specific ribonuclease                      164   3e-44   
ref|XP_010273434.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    163   7e-44   
ref|XP_010501213.1|  PREDICTED: poly(A)-specific ribonuclease PARN      163   7e-44   
ref|XP_006392591.1|  hypothetical protein EUTSA_v10011283mg             162   9e-44   
ref|XP_006346129.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    162   2e-43   
ref|XP_007020484.1|  Poly(A)-specific ribonuclease PARN isoform 1       162   2e-43   
ref|XP_010061446.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    161   3e-43   
ref|XP_010061447.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    161   3e-43   
gb|AAF79314.1|AC002304_7  F14J16.11                                     161   3e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061445.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    161   3e-43   
ref|NP_175983.5|  poly(A)-specific ribonuclease PARN                    160   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004244040.1|  PREDICTED: poly(A)-specific ribonuclease PARN      160   7e-43   
gb|KHF97874.1|  Poly (A)-specific ribonuclease PARN -like protein       160   8e-43   
gb|KDP25970.1|  hypothetical protein JCGZ_22700                         160   9e-43   
ref|XP_011097756.1|  PREDICTED: poly(A)-specific ribonuclease PARN      160   9e-43   
ref|XP_010480146.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    159   2e-42   
ref|XP_002522771.1|  conserved hypothetical protein                     159   2e-42   Ricinus communis
ref|XP_010942842.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    154   3e-41   
ref|XP_004148252.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    155   3e-41   
ref|XP_008449056.1|  PREDICTED: poly(A)-specific ribonuclease PARN      155   3e-41   
ref|XP_010675952.1|  PREDICTED: poly(A)-specific ribonuclease PARN      154   1e-40   
ref|XP_010552367.1|  PREDICTED: poly(A)-specific ribonuclease PARN      154   1e-40   
ref|XP_010942841.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    154   1e-40   
ref|XP_011038803.1|  PREDICTED: poly(A)-specific ribonuclease PARN      153   2e-40   
ref|XP_008219726.1|  PREDICTED: poly(A)-specific ribonuclease PARN      152   4e-40   
ref|XP_007207137.1|  hypothetical protein PRUPE_ppa002362mg             152   4e-40   
ref|XP_002300380.2|  CAF1 family ribonuclease family protein            152   5e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008363350.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    151   2e-39   
ref|XP_009348053.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    150   2e-39   
ref|XP_009348051.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    150   4e-39   
ref|XP_009348052.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    149   5e-39   
ref|XP_009391781.1|  PREDICTED: poly(A)-specific ribonuclease PARN      149   7e-39   
ref|XP_008384548.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...    148   2e-38   
ref|XP_009379459.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    147   5e-38   
ref|XP_004296331.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    147   5e-38   
ref|XP_006474884.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    146   8e-38   
ref|XP_006474883.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    146   1e-37   
ref|XP_006452602.1|  hypothetical protein CICLE_v10007611mg             145   2e-37   
ref|XP_008808744.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    145   3e-37   
ref|XP_008808745.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    145   3e-37   
ref|XP_004516095.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    144   4e-37   
ref|XP_006586143.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    142   5e-37   
ref|XP_003530802.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    142   2e-36   
ref|XP_006602126.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    139   1e-35   
ref|XP_006602125.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    138   1e-35   
ref|XP_006602123.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    139   2e-35   
ref|XP_007146650.1|  hypothetical protein PHAVU_006G058000g             140   2e-35   
ref|NP_001169499.1|  hypothetical protein                               139   4e-35   Zea mays [maize]
gb|AFW58529.1|  hypothetical protein ZEAMMB73_225129                    139   4e-35   
ref|XP_006602122.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    139   4e-35   
gb|EPS70287.1|  hypothetical protein M569_04472                         137   4e-35   
ref|XP_003552994.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    139   5e-35   
ref|NP_001173974.1|  Os04g0467400                                       130   3e-34   
ref|XP_004975901.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    135   1e-33   
gb|EMT26628.1|  Poly(A)-specific ribonuclease PARN                      135   1e-33   
ref|XP_010088438.1|  Poly(A)-specific ribonuclease PARN                 135   1e-33   
ref|XP_002447992.1|  hypothetical protein SORBIDRAFT_06g019420          135   1e-33   Sorghum bicolor [broomcorn]
ref|XP_010240011.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    133   5e-33   
ref|XP_003581331.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    133   6e-33   
emb|CAE05998.4|  OSJNBa0016O02.8                                        131   1e-32   Oryza sativa [red rice]
ref|XP_006857781.1|  hypothetical protein AMTR_s00061p00208140          130   4e-32   
ref|XP_001765586.1|  predicted protein                                  115   4e-27   
ref|XP_006653504.1|  PREDICTED: poly(A)-specific ribonuclease PAR...    110   7e-25   
ref|XP_002970869.1|  hypothetical protein SELMODRAFT_451150             108   4e-24   
ref|XP_002969601.1|  hypothetical protein SELMODRAFT_410403             107   5e-24   
gb|EYU33709.1|  hypothetical protein MIMGU_mgv1a003022mg                106   1e-23   
ref|XP_002985556.1|  hypothetical protein SELMODRAFT_424560             106   1e-23   
ref|XP_002987014.1|  hypothetical protein SELMODRAFT_446815             103   9e-23   
emb|CAH66773.1|  OSIGBa0115M15.11                                     94.0    4e-19   Oryza sativa [red rice]
emb|CAH67368.1|  OSIGBa0128P10.2                                      90.5    7e-18   Oryza sativa [red rice]
ref|XP_004247263.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  86.3    2e-16   
emb|CDP11722.1|  unnamed protein product                              85.1    4e-16   
gb|EPS58289.1|  hypothetical protein M569_16526                       81.6    7e-16   
ref|XP_006345714.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  84.0    9e-16   
ref|XP_011089616.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  84.0    1e-15   
ref|XP_011089613.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  84.0    1e-15   
ref|XP_011089615.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  83.6    1e-15   
ref|XP_010095607.1|  Poly(A)-specific ribonuclease PARN-like protein  82.8    3e-15   
ref|XP_002321239.2|  hypothetical protein POPTR_0014s175701g          79.3    4e-15   Populus trichocarpa [western balsam poplar]
gb|KDP45240.1|  hypothetical protein JCGZ_15105                       80.1    4e-15   
ref|XP_009606035.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.0    5e-15   
ref|XP_009606034.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  82.0    5e-15   
ref|XP_009792348.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  81.6    6e-15   
ref|XP_009792347.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  81.6    6e-15   
ref|XP_003622728.1|  Poly(A)-specific ribonuclease PARN-like protein  76.6    3e-14   
ref|XP_010245934.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  79.3    4e-14   
ref|XP_004161545.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  79.3    4e-14   
ref|XP_004148964.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  79.3    4e-14   
gb|KHG18700.1|  Poly(A)-specific ribonuclease PARN-like               79.0    5e-14   
ref|XP_010069588.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  79.0    6e-14   
gb|KHG18699.1|  Poly(A)-specific ribonuclease PARN-like               79.3    6e-14   
gb|EYU40665.1|  hypothetical protein MIMGU_mgv1a018070mg              78.2    9e-14   
ref|XP_008451634.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  78.2    9e-14   
ref|XP_011009330.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.8    1e-13   
ref|XP_010678977.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.8    1e-13   
ref|XP_010678978.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.8    1e-13   
ref|XP_008465473.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  73.9    1e-13   
ref|XP_008465472.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  74.3    1e-13   
ref|XP_009334241.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.4    2e-13   
ref|XP_006492222.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  77.0    2e-13   
ref|XP_010943605.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  76.6    4e-13   
gb|KDO58560.1|  hypothetical protein CISIN_1g006991mg                 76.3    4e-13   
gb|KDO58559.1|  hypothetical protein CISIN_1g006991mg                 76.3    5e-13   
ref|XP_008382764.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  76.3    5e-13   
emb|CDY27893.1|  BnaA07g04830D                                        75.9    7e-13   
ref|XP_009415962.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  75.1    1e-12   
ref|XP_004342975.1|  conserved hypothetical protein                   75.1    1e-12   
ref|XP_010645230.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  74.7    1e-12   
gb|EFW42758.2|  hypothetical protein CAOG_07890                       75.1    1e-12   
emb|CDY00839.1|  BnaCnng00390D                                        74.7    2e-12   
ref|XP_002527264.1|  ribonuclease, putative                           74.3    2e-12   Ricinus communis
ref|XP_009102413.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  73.9    3e-12   
ref|XP_002320703.1|  hypothetical protein POPTR_0014s01880g           73.6    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_006847462.1|  hypothetical protein AMTR_s00163p00014030        72.4    3e-12   
ref|XP_004492235.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  73.6    3e-12   
ref|XP_004492234.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  73.6    4e-12   
ref|XP_008348961.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  73.2    4e-12   
ref|XP_008235892.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  72.0    6e-12   
ref|XP_006418630.1|  hypothetical protein EUTSA_v10002449mg           72.8    7e-12   
ref|XP_008678596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  69.7    1e-11   
ref|XP_006299254.1|  hypothetical protein CARUB_v10015403mg           72.0    1e-11   
ref|XP_008799184.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  72.0    1e-11   
ref|XP_008799185.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.6    1e-11   
ref|XP_008235891.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  71.6    2e-11   
ref|XP_008364676.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  71.2    2e-11   
emb|CBI35579.3|  unnamed protein product                              72.0    3e-11   
ref|XP_002444414.1|  hypothetical protein SORBIDRAFT_07g021600        70.9    3e-11   Sorghum bicolor [broomcorn]
ref|WP_028831969.1|  hypothetical protein                             70.9    3e-11   
ref|XP_009358962.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.5    4e-11   
ref|XP_004348604.1|  ribonuclease, putative                           70.5    4e-11   
ref|XP_010514159.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.5    4e-11   
ref|XP_010466956.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.1    5e-11   
ref|XP_007140707.1|  hypothetical protein PHAVU_008G135000g           70.1    5e-11   
ref|XP_007049586.1|  Poly(A)-specific ribonuclease PARN-like, put...  70.1    5e-11   
ref|XP_010488642.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  70.1    6e-11   
ref|NP_001061902.1|  Os08g0440200                                     67.8    9e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007049585.1|  Poly(A)-specific ribonuclease PARN-like, put...  69.3    9e-11   
ref|XP_007049584.1|  Polynucleotidyl transferase, ribonuclease H-...  69.3    9e-11   
ref|NP_189170.1|  poly(A)-specific ribonuclease PARN-like protein     68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001433738.1|  hypothetical protein                             68.6    1e-10   Paramecium tetraurelia strain d4-2
dbj|BAB01314.1|  unnamed protein product                              68.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883605.1|  predicted protein                                68.6    2e-10   
gb|KFK39841.1|  hypothetical protein AALP_AA3G294900                  68.6    2e-10   
gb|KFK39842.1|  hypothetical protein AALP_AA3G294900                  68.6    2e-10   
ref|XP_007549755.1|  PREDICTED: poly(A)-specific ribonuclease PARN    67.8    3e-10   
ref|XP_008436164.1|  PREDICTED: poly(A)-specific ribonuclease PARN    67.8    3e-10   
ref|XP_005813387.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.8    4e-10   
ref|XP_003572239.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  67.4    5e-10   
gb|EEC83639.1|  hypothetical protein OsI_29373                        66.6    9e-10   Oryza sativa Indica Group [Indian rice]
gb|EEE68767.1|  hypothetical protein OsJ_27469                        66.2    9e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CEI86889.1|  hypothetical protein RMCBS344292_01314               65.9    1e-09   
emb|CEI93743.1|  hypothetical protein RMCBS344292_07971               65.5    1e-09   
emb|CEI93744.1|  hypothetical protein RMCBS344292_07971               65.5    1e-09   
emb|CEG72444.1|  hypothetical protein RMATCC62417_08002               65.5    2e-09   
ref|XP_006681993.1|  hypothetical protein BATDEDRAFT_36029            65.5    2e-09   
ref|XP_001622538.1|  hypothetical protein NEMVEDRAFT_v1g1365          64.7    3e-09   Nematostella vectensis
emb|CEG77716.1|  hypothetical protein RMATCC62417_12419               63.9    3e-09   
emb|CCX06373.1|  Similar to Poly(A)-specific ribonuclease PARN; a...  64.7    3e-09   
ref|XP_010532929.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  64.7    4e-09   
ref|XP_010792702.1|  PREDICTED: poly(A)-specific ribonuclease PARN    63.9    4e-09   
ref|XP_003532241.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  64.7    4e-09   
ref|XP_001634577.1|  predicted protein                                63.9    6e-09   Nematostella vectensis
ref|XP_011113705.1|  hypothetical protein H072_7980                   63.5    7e-09   
ref|XP_008292120.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.9    7e-09   
ref|XP_008292118.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.9    7e-09   
ref|XP_006804394.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.9    7e-09   
ref|XP_004973547.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.5    7e-09   
gb|EIE81980.1|  hypothetical protein RO3G_06685                       63.5    8e-09   
ref|XP_003457808.1|  PREDICTED: poly(A)-specific ribonuclease PARN    63.5    8e-09   
ref|XP_005744604.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.5    8e-09   
ref|XP_005947045.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  63.5    8e-09   
gb|EXX68717.1|  hypothetical protein RirG_102580                      62.0    1e-08   
ref|XP_010731915.1|  PREDICTED: poly(A)-specific ribonuclease PARN    63.2    1e-08   
gb|EPB82776.1|  hypothetical protein HMPREF1544_10479                 62.8    1e-08   
gb|ERZ96763.1|  hypothetical protein GLOINDRAFT_330565                62.8    2e-08   
ref|XP_003972409.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  62.4    2e-08   
gb|AAQ97826.1|  poly(A)-specific ribonuclease                         62.0    2e-08   Danio rerio [leopard danio]
sp|Q7ZU92.2|PARN_DANRE  RecName: Full=Poly(A)-specific ribonuclea...  62.0    2e-08   Danio rerio [leopard danio]
ref|NP_957382.1|  poly(A)-specific ribonuclease PARN                  62.0    3e-08   Danio rerio [leopard danio]
ref|XP_008314796.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  61.6    4e-08   
ref|XP_008314795.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  61.6    4e-08   
emb|CBK19633.2|  unnamed protein product                              61.2    5e-08   
gb|KFH62568.1|  hypothetical protein MVEG_11961                       61.2    6e-08   
ref|XP_010901706.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  60.8    8e-08   
ref|XP_011119302.1|  hypothetical protein AOL_s00043g514              60.1    8e-08   
gb|EIE80249.1|  hypothetical protein RO3G_04954                       60.5    9e-08   
gb|KDR21432.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  60.1    1e-07   
gb|EPB89144.1|  hypothetical protein HMPREF1544_04011                 59.7    2e-07   
emb|CAF98128.1|  unnamed protein product                              59.3    2e-07   Tetraodon nigroviridis
ref|XP_003228705.2|  PREDICTED: poly(A)-specific ribonuclease PARN    59.3    2e-07   
dbj|BAK06461.1|  predicted protein                                    58.9    3e-07   
ref|NP_001081143.1|  poly(A)-specific ribonuclease PARN               57.8    6e-07   Xenopus laevis [clawed frog]
sp|Q90ZA1.1|PARN_XENLA  RecName: Full=Poly(A)-specific ribonuclea...  57.8    6e-07   Xenopus laevis [clawed frog]
gb|KGL77093.1|  Poly(A)-specific ribonuclease PARN                    57.8    6e-07   
ref|XP_002949475.1|  hypothetical protein VOLCADRAFT_120753           57.8    7e-07   
ref|XP_006637035.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.8    7e-07   
ref|XP_010212713.1|  PREDICTED: poly(A)-specific ribonuclease PARN    57.8    7e-07   
gb|AAH73682.1|  Unknown (protein for IMAGE:5572400)                   57.4    7e-07   Xenopus laevis [clawed frog]
ref|XP_008139791.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.8    7e-07   
ref|XP_005150742.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.4    8e-07   
gb|EHJ78364.1|  putative poly                                         57.4    9e-07   
ref|XP_002606119.1|  hypothetical protein BRAFLDRAFT_125118           57.0    9e-07   Branchiostoma floridae
ref|XP_002160561.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.0    9e-07   
ref|XP_536966.2|  PREDICTED: poly(A)-specific ribonuclease PARN i...  57.0    1e-06   Canis lupus familiaris [dogs]
ref|XP_006759737.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.0    1e-06   
ref|XP_006759736.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.0    1e-06   
emb|CDW90995.1|  poly-specific ribonuclease (deadenylation nuclease)  57.0    1e-06   
ref|XP_003417760.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.0    1e-06   
ref|XP_010595596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  57.0    1e-06   
ref|XP_007076924.1|  PREDICTED: poly(A)-specific ribonuclease PARN    57.0    1e-06   
ref|XP_006105281.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.6    1e-06   
ref|XP_003998895.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.6    1e-06   
ref|XP_006257909.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.6    1e-06   
ref|XP_010337706.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.6    1e-06   
ref|XP_004057290.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.6    2e-06   
ref|XP_007237945.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_002711808.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.6    2e-06   Oryctolagus cuniculus [domestic rabbit]
ref|XP_003269351.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.6    2e-06   
ref|XP_004408976.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_004750405.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_006728698.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|NP_001184102.1|  poly(A)-specific ribonuclease (deadenylation...  56.2    2e-06   
ref|XP_007984527.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|NP_002573.1|  poly(A)-specific ribonuclease PARN isoform 1        56.2    2e-06   Homo sapiens [man]
ref|XP_006146609.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|XP_510832.3|  PREDICTED: poly(A)-specific ribonuclease PARN       56.2    2e-06   Pan troglodytes
ref|XP_006212136.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_005591355.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_004652333.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_005591354.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
emb|CAL49352.1|  poly(A)-specific ribonuclease (deadenylation nuc...  56.2    2e-06   Xenopus tropicalis [western clawed frog]
ref|XP_008695138.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
gb|AAI69159.1|  Unknown (protein for IMAGE:8898488)                   56.2    2e-06   Xenopus tropicalis [western clawed frog]
ref|XP_009194320.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|XP_004750403.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_006867301.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|XP_005957883.1|  PREDICTED: uncharacterized protein LOC102328871  53.9    2e-06   
ref|XP_004586831.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_002918111.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_005323743.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|XP_006910997.1|  PREDICTED: poly(A)-specific ribonuclease PARN    56.2    2e-06   
ref|XP_010959415.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_002755955.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   Callithrix jacchus [common marmoset]
ref|XP_010981175.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_006179128.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_010838177.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_007188428.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  56.2    2e-06   
ref|XP_010817612.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_007904625.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    2e-06   
ref|XP_003832732.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    2e-06   
ref|XP_005697572.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    2e-06   
ref|XP_004270210.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    2e-06   
ref|XP_009897136.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_010817608.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_010817609.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    2e-06   
ref|XP_007188429.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_007467023.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    3e-06   
ref|XP_007106207.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|NP_001094588.1|  poly(A)-specific ribonuclease PARN               55.8    3e-06   Bos taurus [bovine]
ref|XP_005522951.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_007498687.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_008201922.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_010817613.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_004332390.1|  PREDICTED: LOW QUALITY PROTEIN: poly(A)-spec...  55.8    3e-06   
ref|XP_005420477.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
gb|KFV66105.1|  Poly(A)-specific ribonuclease PARN                    55.8    3e-06   
ref|XP_002197536.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.8    3e-06   
ref|XP_006049827.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_006894585.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.8    3e-06   
ref|XP_008063052.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.5    3e-06   
dbj|BAG64410.1|  unnamed protein product                              53.9    3e-06   
ref|XP_007529597.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.5    3e-06   
ref|XP_005103432.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.5    3e-06   
ref|XP_004706318.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.5    4e-06   
ref|XP_005054114.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.5    4e-06   
ref|XP_008546939.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.5    4e-06   
ref|XP_008063053.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.1    4e-06   
pdb|2A1R|A  Chain A, Crystal Structure Of Parn Nuclease Domain        55.1    4e-06   
gb|EPZ32187.1|  Ribonuclease CAF1 domain-containing protein           54.7    5e-06   
ref|XP_009090176.1|  PREDICTED: poly(A)-specific ribonuclease PARN    55.1    5e-06   
ref|XP_004454677.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  55.1    6e-06   
ref|XP_004441909.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    6e-06   
ref|XP_007650658.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    6e-06   
ref|XP_004368205.1|  RNA binding domain containing protein            54.7    7e-06   
ref|XP_004373325.1|  PREDICTED: poly(A)-specific ribonuclease PARN    54.7    7e-06   
ref|XP_002838529.1|  hypothetical protein                             54.3    7e-06   
gb|ERE68849.1|  poly(A)-specific ribonuclease PARN isoform 2          52.0    7e-06   
ref|XP_008828122.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    7e-06   
ref|XP_008201919.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    7e-06   
ref|XP_003496745.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    7e-06   
ref|XP_008828121.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.7    7e-06   
gb|ELK13541.1|  Poly(A)-specific ribonuclease PARN                    54.7    7e-06   
gb|EJY69575.1|  Poly(A)-specific ribonuclease PARN                    54.7    7e-06   
ref|XP_009475558.1|  PREDICTED: poly(A)-specific ribonuclease PARN    54.3    7e-06   
ref|XP_009837586.1|  hypothetical protein H257_12163                  54.3    8e-06   
ref|XP_008201921.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.3    8e-06   
ref|XP_009637874.1|  PREDICTED: poly(A)-specific ribonuclease PARN    54.3    8e-06   
ref|NP_001125357.1|  poly(A)-specific ribonuclease PARN               54.3    8e-06   
ref|XP_010608324.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.3    9e-06   
gb|EJY86423.1|  hypothetical protein OXYTRI_13677                     54.3    9e-06   
ref|XP_010608325.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.3    9e-06   
ref|XP_009884889.1|  PREDICTED: poly(A)-specific ribonuclease PARN    54.3    9e-06   
ref|XP_001490195.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  54.3    9e-06   
emb|CDS08630.1|  hypothetical protein LRAMOSA09991                    54.3    9e-06   
ref|XP_009521153.1|  hypothetical protein PHYSODRAFT_540459           54.3    1e-05   
gb|EFX66955.1|  hypothetical protein DAPPUDRAFT_203845                53.9    1e-05   
ref|XP_004692171.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.9    1e-05   
ref|XP_006134193.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.9    1e-05   
gb|EAR94228.2|  CAF1 family ribonuclease                              53.9    1e-05   
ref|XP_005391192.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.9    1e-05   
ref|XP_005598954.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.9    1e-05   
ref|XP_005391197.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.5    1e-05   
ref|XP_005391191.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.5    1e-05   
ref|XP_003477815.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.5    1e-05   
emb|CEG64045.1|  hypothetical protein RMATCC62417_01090               53.5    1e-05   
emb|CEI85857.1|  hypothetical protein RMCBS344292_00306               53.5    1e-05   
ref|XP_002129059.1|  PREDICTED: poly(A)-specific ribonuclease PARN    53.5    2e-05   
ref|XP_004644290.1|  PREDICTED: poly(A)-specific ribonuclease PARN    53.5    2e-05   
ref|XP_308433.4|  AGAP007399-PA                                       53.1    2e-05   
ref|XP_005840350.1|  hypothetical protein GUITHDRAFT_101074           53.1    2e-05   
gb|EMR90375.1|  putative caf1 family ribonuclease protein             53.1    2e-05   
ref|XP_004886596.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  53.1    2e-05   
gb|EWM21105.1|  poly -specific ribonuclease parn                      53.1    2e-05   
ref|XP_006009665.1|  PREDICTED: poly(A)-specific ribonuclease PARN    53.1    2e-05   
gb|ETK75973.1|  hypothetical protein L915_17489                       53.1    2e-05   
ref|XP_001454910.1|  hypothetical protein                             52.8    2e-05   
gb|ETP33679.1|  hypothetical protein F442_17814                       52.8    2e-05   
ref|XP_001546053.1|  hypothetical protein BC1G_15528                  52.8    2e-05   
gb|ETI35752.1|  hypothetical protein F443_17972                       52.8    2e-05   
gb|EMT01997.1|  Poly(A)-specific ribonuclease PARN-like protein       52.8    2e-05   
emb|CEG81630.1|  hypothetical protein RMATCC62417_15806               52.8    3e-05   
ref|XP_001659202.1|  poly(a)-specific ribonuclease (deadenylation...  52.8    3e-05   
ref|XP_002905017.1|  Poly(A)-specific ribonuclease PARN-like protein  52.8    3e-05   
emb|CDW82058.1|  oxysterol binding family protein                     52.8    3e-05   
ref|XP_008896484.1|  hypothetical protein PPTG_04345                  52.4    3e-05   
gb|EMP37329.1|  Poly(A)-specific ribonuclease PARN                    51.6    3e-05   
gb|ETL82650.1|  hypothetical protein L917_17220                       52.4    3e-05   
pdb|3D45|A  Chain A, Crystal Structure Of Mouse Parn In Complex W...  52.0    4e-05   
ref|XP_011057198.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  52.0    4e-05   
emb|CDW88855.1|  c transferase                                        52.4    4e-05   
emb|CDS09676.1|  hypothetical protein LRAMOSA02353                    52.0    4e-05   
gb|EJY64371.1|  Putative poly                                         52.4    4e-05   
gb|ESZ92144.1|  hypothetical protein SBOR_7475                        52.0    4e-05   
ref|XP_003707168.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  52.0    5e-05   
ref|XP_002681865.1|  poly(A)-specific ribonuclease                    52.0    5e-05   
gb|EJY83125.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  52.0    5e-05   
ref|NP_001153677.1|  poly(A)-specific ribonuclease                    52.0    5e-05   
gb|ETP38993.1|  hypothetical protein F442_13517                       52.0    5e-05   
gb|ETO69751.1|  hypothetical protein F444_13723                       52.0    5e-05   
ref|XP_008894536.1|  hypothetical protein PPTG_03612                  52.0    5e-05   
gb|ETM41075.1|  hypothetical protein L914_13127                       52.0    5e-05   
gb|ETL87848.1|  hypothetical protein L917_13035                       52.0    5e-05   
gb|ETL34586.1|  hypothetical protein L916_13214                       52.0    5e-05   
gb|ETK81152.1|  hypothetical protein L915_13333                       52.0    5e-05   
gb|ETI41088.1|  hypothetical protein F443_13658                       52.0    5e-05   
gb|ENN80687.1|  hypothetical protein YQE_02889                        51.6    5e-05   
gb|ETN61263.1|  polyA-specific ribonuclease                           51.6    6e-05   
gb|KDR16211.1|  Poly(A)-specific ribonuclease PARN                    51.6    6e-05   
dbj|BAE35913.1|  unnamed protein product                              51.6    6e-05   
ref|NP_083037.1|  poly(A)-specific ribonuclease PARN                  51.6    6e-05   
ref|XP_011057199.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  51.6    6e-05   
gb|EDK97364.1|  poly(A)-specific ribonuclease (deadenylation nucl...  51.6    7e-05   
ref|XP_006983981.1|  PREDICTED: poly(A)-specific ribonuclease PARN    51.6    7e-05   
emb|CCI50323.1|  unnamed protein product                              51.6    7e-05   
gb|ELK33278.1|  Poly(A)-specific ribonuclease PARN                    51.2    7e-05   
gb|KFB51637.1|  AGAP007399-PA-like protein                            51.2    7e-05   
ref|XP_002423735.1|  poly A-specific ribonuclease PARN, putative      51.2    8e-05   
gb|EPQ11307.1|  Poly(A)-specific ribonuclease PARN                    51.2    8e-05   
ref|XP_001701773.1|  predicted protein                                50.8    8e-05   
ref|XP_001585433.1|  hypothetical protein SS1G_13672                  51.2    8e-05   
ref|XP_005350397.1|  PREDICTED: poly(A)-specific ribonuclease PARN    51.2    9e-05   
ref|XP_001008100.1|  CAF1 family ribonuclease containing protein      51.2    9e-05   
ref|XP_967921.2|  PREDICTED: poly(A)-specific ribonuclease PARN       51.2    9e-05   
sp|Q8VDG3.1|PARN_MOUSE  RecName: Full=Poly(A)-specific ribonuclea...  51.2    1e-04   
ref|NP_001257344.1|  poly(A)-specific ribonuclease PARN               50.8    1e-04   
gb|EDL96165.1|  rCG49798                                              50.8    1e-04   
emb|CCA26275.1|  Poly(A)specific ribonuclease PARNlike protein pu...  50.8    1e-04   
gb|EPY85169.1|  poly(A)-specific ribonuclease PARN                    50.8    1e-04   
gb|KGG52769.1|  putative ribonuclease                                 49.3    1e-04   
gb|EZA62295.1|  Poly(A)-specific ribonuclease PARN-like domain-co...  50.4    1e-04   
ref|XP_003761743.1|  PREDICTED: poly(A)-specific ribonuclease PARN    50.4    2e-04   
ref|XP_008919990.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  50.4    2e-04   
gb|EFZ22121.1|  hypothetical protein SINV_07959                       50.4    2e-04   
gb|EWC47046.1|  hypothetical protein DRE_03808                        50.1    2e-04   
gb|EHH31444.1|  Poly(A)-specific ribonuclease PARN                    50.4    2e-04   
ref|XP_002959151.1|  hypothetical protein VOLCADRAFT_108501           50.4    2e-04   
ref|XP_008873086.1|  hypothetical protein H310_08934                  50.1    2e-04   
ref|XP_002785766.1|  conserved hypothetical protein                   50.1    2e-04   
gb|ELR48641.1|  Poly(A)-specific ribonuclease PARN                    50.1    2e-04   
gb|KFH68813.1|  hypothetical protein MVEG_05617                       50.1    2e-04   
gb|KFQ33753.1|  Poly(A)-specific ribonuclease PARN                    50.1    2e-04   
gb|EHH60178.1|  Poly(A)-specific ribonuclease PARN                    50.1    2e-04   
gb|EFN61018.1|  Poly(A)-specific ribonuclease PARN                    49.7    2e-04   
gb|KFO75744.1|  Poly(A)-specific ribonuclease PARN                    49.7    3e-04   
ref|XP_007673685.1|  hypothetical protein BAUCODRAFT_59256            49.3    3e-04   
ref|XP_007925243.1|  hypothetical protein MYCFIDRAFT_152853           49.7    3e-04   
emb|CBJ26041.1|  conserved unknown protein                            49.7    3e-04   
ref|XP_819489.1|  ribonuclease                                        49.7    3e-04   
ref|XP_809055.1|  ribonuclease                                        49.3    3e-04   
ref|XP_009358963.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  49.3    3e-04   
gb|KFO58896.1|  Poly(A)-specific ribonuclease PARN                    49.3    3e-04   
gb|EKG08788.1|  ribonuclease, putative                                49.3    3e-04   
gb|KFP32610.1|  Poly(A)-specific ribonuclease PARN                    49.3    3e-04   
ref|XP_003707832.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  49.3    3e-04   
emb|CCC49627.1|  putative ribonuclease, fragment                      47.8    4e-04   
gb|EFB16183.1|  hypothetical protein PANDA_006508                     49.3    4e-04   
ref|XP_007663083.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  48.9    4e-04   
gb|KFQ03489.1|  Poly(A)-specific ribonuclease PARN                    49.3    4e-04   
gb|AGC92706.1|  poly(A)-specific ribonuclease PARN-like protein       49.3    4e-04   
gb|KGL94587.1|  Poly(A)-specific ribonuclease PARN                    48.9    4e-04   
emb|CDH57526.1|  poly-specific ribonuclease parn                      48.9    4e-04   
gb|KFQ35206.1|  Poly(A)-specific ribonuclease PARN                    48.9    4e-04   
gb|KFW67601.1|  Poly(A)-specific ribonuclease PARN                    48.9    5e-04   
gb|KFM09138.1|  Poly(A)-specific ribonuclease PARN                    48.9    5e-04   
ref|XP_009535836.1|  hypothetical protein PHYSODRAFT_423896           48.1    5e-04   
gb|KFV48490.1|  Poly(A)-specific ribonuclease PARN                    48.9    5e-04   
gb|KFP65999.1|  Poly(A)-specific ribonuclease PARN                    48.9    5e-04   
gb|KFQ41688.1|  Poly(A)-specific ribonuclease PARN                    48.5    5e-04   
emb|CCU81237.1|  CAF1 family ribonuclease                             48.5    6e-04   
gb|KFQ59750.1|  Poly(A)-specific ribonuclease PARN                    48.5    6e-04   
gb|KFV03233.1|  Poly(A)-specific ribonuclease PARN                    48.5    6e-04   
gb|KHJ32627.1|  putative caf1 family ribonuclease                     48.5    6e-04   
gb|KFZ62922.1|  Poly(A)-specific ribonuclease PARN                    48.5    6e-04   
gb|KFW05870.1|  Poly(A)-specific ribonuclease PARN                    48.5    6e-04   
gb|KFW04594.1|  Poly(A)-specific ribonuclease PARN                    48.5    6e-04   
gb|KFQ87427.1|  Poly(A)-specific ribonuclease PARN                    48.1    7e-04   
gb|KFW94766.1|  Poly(A)-specific ribonuclease PARN                    48.1    7e-04   
ref|XP_009023768.1|  hypothetical protein HELRODRAFT_193079           48.1    7e-04   
ref|XP_004278952.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  48.1    7e-04   
gb|ESS63757.1|  Poly(A)-specific ribonuclease PARN                    48.1    8e-04   
ref|XP_006263653.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  48.1    8e-04   
gb|KFQ69044.1|  Poly(A)-specific ribonuclease PARN                    48.1    9e-04   
ref|XP_008121494.1|  PREDICTED: poly(A)-specific ribonuclease PAR...  47.8    0.001   



>ref|XP_009600219.1| PREDICTED: poly(A)-specific ribonuclease PARN [Nicotiana tomentosiformis]
Length=721

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 107/131 (82%), Gaps = 9/131 (7%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFS---RALCSSA------FALKNVTRSNFESALEDL  176
            MKK  M++ LS TLI   HA +TSF+   RAL SS+      FALKNVT+SNFESAL DL
Sbjct  1    MKKHCMLKPLSTTLIQISHAPITSFTTRRRALSSSSSSSSSSFALKNVTKSNFESALNDL  60

Query  177  RGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWD  356
            RGL++ ADFVA+DLEMTGVTSAPWRDSF+ DRYDIRYLKVKDSAEKFAVVQFGVCPFRWD
Sbjct  61   RGLVRDADFVAVDLEMTGVTSAPWRDSFDFDRYDIRYLKVKDSAEKFAVVQFGVCPFRWD  120

Query  357  SVKHFFIAHPY  389
            S K  F+AHP+
Sbjct  121  SHKQSFLAHPH  131



>dbj|BAE47488.1| polyA specific ribonuclease [Arabidopsis thaliana]
Length=131

 Score =   161 bits (407),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            +  K+W +R+L  +  S+    +T+ + A  ++AF LK+VTRSNFE+ L DLR L+KAAD
Sbjct  2    RRHKRWPLRSLVCSFSSSAAETVTTSTAASATAAFPLKHVTRSNFETTLNDLRSLVKAAD  61

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F++
Sbjct  62   FVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVS  121

Query  381  HPYVTV  398
            +P V++
Sbjct  122  YPLVSL  127



>ref|XP_009784553.1| PREDICTED: poly(A)-specific ribonuclease PARN [Nicotiana sylvestris]
Length=708

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 99/128 (77%), Gaps = 10/128 (8%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFAL------KNVTRSNFESALEDLRGL  185
            MKKQ M+    K LI   HA +TSF+    + + +       KNVT+SNFESAL DLRGL
Sbjct  1    MKKQCML----KPLIQISHAPITSFASRRRALSSSSSSSFALKNVTKSNFESALNDLRGL  56

Query  186  IKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVK  365
            ++ ADFVA+DLEMTGVTSAPWRDSF+ DRYDIRYLKVKDSAEKFAVVQFG+CPFRWDS K
Sbjct  57   VRDADFVAVDLEMTGVTSAPWRDSFDFDRYDIRYLKVKDSAEKFAVVQFGICPFRWDSHK  116

Query  366  HFFIAHPY  389
              F+AHP+
Sbjct  117  KSFLAHPH  124



>ref|XP_010644585.1| PREDICTED: poly(A)-specific ribonuclease PARN [Vitis vinifera]
 ref|XP_010644586.1| PREDICTED: poly(A)-specific ribonuclease PARN [Vitis vinifera]
Length=734

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 5/125 (4%)
 Frame = +3

Query  30   KQW-MIRALSKTLIS--APHAGLTS--FSRALCSSAFALKNVTRSNFESALEDLRGLIKA  194
            KQW ++R+LS++L    A H+  T    S A  S  FALKNVT+SNFES+L DLR  ++ 
Sbjct  2    KQWPLLRSLSESLTRTLAAHSAYTLRFLSSATASPTFALKNVTKSNFESSLADLRRHVRD  61

Query  195  ADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFF  374
            ADFVAIDLEMTGVTSAPWR+SFE DR+D++YLKVKDSAEKFAVVQFGVCPFRWDS +H F
Sbjct  62   ADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKDSAEKFAVVQFGVCPFRWDSSRHCF  121

Query  375  IAHPY  389
            +AHP+
Sbjct  122  VAHPH  126



>emb|CBI39748.3| unnamed protein product [Vitis vinifera]
Length=715

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 101/125 (81%), Gaps = 5/125 (4%)
 Frame = +3

Query  30   KQW-MIRALSKTLIS--APHAGLTS--FSRALCSSAFALKNVTRSNFESALEDLRGLIKA  194
            KQW ++R+LS++L    A H+  T    S A  S  FALKNVT+SNFES+L DLR  ++ 
Sbjct  2    KQWPLLRSLSESLTRTLAAHSAYTLRFLSSATASPTFALKNVTKSNFESSLADLRRHVRD  61

Query  195  ADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFF  374
            ADFVAIDLEMTGVTSAPWR+SFE DR+D++YLKVKDSAEKFAVVQFGVCPFRWDS +H F
Sbjct  62   ADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKDSAEKFAVVQFGVCPFRWDSSRHCF  121

Query  375  IAHPY  389
            +AHP+
Sbjct  122  VAHPH  126



>emb|CDY52905.1| BnaA06g00130D [Brassica napus]
Length=680

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 104/150 (69%), Gaps = 8/150 (5%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSF-SRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            +  K+W +R L+  LI +  +      +    + AF LK+VTRSNFE+ L DLR  +KAA
Sbjct  2    RRHKRWPLRPLASALIRSRFSSTAEIATTPTTTEAFPLKHVTRSNFETTLNDLRTHVKAA  61

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS+ H F+
Sbjct  62   DFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSLTHSFL  121

Query  378  AHPY-VTVISTATIQFLFLLIAVHDEFICK  464
            +HP+   V     + F       H EF+C+
Sbjct  122  SHPHNFFVFPRQELAF------DHHEFLCQ  145



>emb|CAN76999.1| hypothetical protein VITISV_007764 [Vitis vinifera]
Length=720

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 5/125 (4%)
 Frame = +3

Query  30   KQW-MIRALSKTLIS--APHAGLTS--FSRALCSSAFALKNVTRSNFESALEDLRGLIKA  194
            KQW ++R LS++L    A H+  T    S A  S  FALKNVT+SNFES+L DLR  ++ 
Sbjct  2    KQWPLLRFLSESLTRTLAAHSAYTLRFLSSATASPTFALKNVTKSNFESSLADLRRHVRD  61

Query  195  ADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFF  374
            ADFVAIDLEMTGVTSAPWR+SFE DR+D++YLKVKDSAEKFAVVQFGVCPFRWDS +H F
Sbjct  62   ADFVAIDLEMTGVTSAPWRESFEFDRFDVQYLKVKDSAEKFAVVQFGVCPFRWDSSRHCF  121

Query  375  IAHPY  389
            +AHP+
Sbjct  122  VAHPH  126



>ref|XP_006304676.1| hypothetical protein CARUB_v10011913mg [Capsella rubella]
 gb|EOA37574.1| hypothetical protein CARUB_v10011913mg [Capsella rubella]
Length=689

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  30   KQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVA  209
            KQW +R L+ +  S+    ++S + A  ++AF LK+VTRSNFE+ L DLR L+KAADFVA
Sbjct  5    KQWPLRPLAYSFCSSAAEAVSSSTAAAATAAFPLKHVTRSNFETTLNDLRALVKAADFVA  64

Query  210  IDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            IDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS  H F++HP+
Sbjct  65   IDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTHSFVSHPH  124



>ref|XP_010462450.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=690

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  21   KMKKQWMIRAL-SKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            + +KQW +R L + +  S+    +++ + A  + AF LK+VTRSNFE  L DLR L+KAA
Sbjct  2    RRQKQWPLRPLLAYSFCSSAAERVSNSTAAAATVAFPLKHVTRSNFEKTLNDLRALVKAA  61

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWD+    F+
Sbjct  62   DFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDARTQSFV  121

Query  378  AHP  386
            +HP
Sbjct  122  SHP  124



>emb|CDY53757.1| BnaCnng25490D [Brassica napus]
Length=669

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTS---FSRALCSSAFALKNVTRSNFESALEDLRGLIK  191
            +  K+W +R L   LI +    L+S    +    + AF LK+VTRSNFE  L DLR  +K
Sbjct  2    RRHKRWPLRPLGSALIRSRFFCLSSAAEIATTPTTEAFPLKHVTRSNFERTLNDLRTHVK  61

Query  192  AADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHF  371
            AADFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS  H 
Sbjct  62   AADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSHTHS  121

Query  372  FIAHPY  389
            F++HP+
Sbjct  122  FVSHPH  127



>ref|XP_009147470.1| PREDICTED: poly(A)-specific ribonuclease PARN [Brassica rapa]
Length=680

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 103/150 (69%), Gaps = 8/150 (5%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSF-SRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            +  K+W +R L+   I +  +      +    + AF LK+VTRSNFE+ L DLR  +KAA
Sbjct  2    RRHKRWPLRPLASASIRSRFSSTAEIATTPTTTEAFPLKHVTRSNFETTLNDLRTHVKAA  61

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS+ H F+
Sbjct  62   DFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSLTHSFL  121

Query  378  AHPY-VTVISTATIQFLFLLIAVHDEFICK  464
            +HP+   V     + F       H EF+C+
Sbjct  122  SHPHNFFVFPRQELAF------DHHEFLCQ  145



>ref|XP_010273437.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Nelumbo 
nucifera]
Length=470

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +3

Query  24   MKKQWMIRALSK--TLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            MKK  ++RA S+  TL+ + +     FS A   S F++K VT++NFESALEDLR  ++ A
Sbjct  1    MKKPALVRAFSEALTLVRSTYLLTRPFSSA-TPSTFSVKKVTKTNFESALEDLRRHVRDA  59

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFV+ DLEMTGVTSAPWRDSFE DR+D+RYLKVKDSAEKFAVVQFGVCPFRWD+ K  F+
Sbjct  60   DFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKDSAEKFAVVQFGVCPFRWDASKESFV  119

Query  378  AHP  386
            AHP
Sbjct  120  AHP  122



>emb|CDP13712.1| unnamed protein product [Coffea canephora]
Length=716

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 99/128 (77%), Gaps = 11/128 (9%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALC------SSAFALKNVTRSNFESALEDLRGL  185
            MK  + IRA  K+LIS     L+S +R  C      +S FA+KNVT+SNFESAL DLR  
Sbjct  1    MKNLFTIRAFHKSLIS-----LSSSTRHFCCSSSSSASTFAIKNVTKSNFESALNDLRLY  55

Query  186  IKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVK  365
            +K ADFVA+DLEMTGVTSAPWR+SFELDR+DI+YLKVKDSAEKFA VQFGVCPFRW+  +
Sbjct  56   VKDADFVAVDLEMTGVTSAPWRESFELDRFDIQYLKVKDSAEKFAAVQFGVCPFRWEPHR  115

Query  366  HFFIAHPY  389
              F+AHP+
Sbjct  116  QSFVAHPH  123



>ref|XP_010273436.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Nelumbo 
nucifera]
Length=723

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  24   MKKQWMIRALSK--TLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            MKK  ++RA S+  TL+ + +     FS A   S F++K VT++NFESALEDLR  ++ A
Sbjct  1    MKKPALVRAFSEALTLVRSTYLLTRPFSSA-TPSTFSVKKVTKTNFESALEDLRRHVRDA  59

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFV+ DLEMTGVTSAPWRDSFE DR+D+RYLKVKDSAEKFAVVQFGVCPFRWD+ K  F+
Sbjct  60   DFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKDSAEKFAVVQFGVCPFRWDASKESFV  119

Query  378  AHPY  389
            AHP+
Sbjct  120  AHPH  123



>ref|XP_002891857.1| Poly(A)-specific ribonuclease [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68116.1| Poly(A)-specific ribonuclease [Arabidopsis lyrata subsp. lyrata]
Length=689

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            +  K+W +R L+ +  S+    +T+ + A  ++AF LK+VTRSNFE+ L DLR L+KAAD
Sbjct  2    RRHKRWPLRPLACSFSSSAAETVTTSTAASATAAFPLKHVTRSNFETTLNDLRSLVKAAD  61

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F++
Sbjct  62   FVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVS  121

Query  381  HPY  389
            HP+
Sbjct  122  HPH  124



>ref|XP_010273434.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Nelumbo 
nucifera]
Length=724

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +3

Query  24   MKKQWMIRALSK--TLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            MKK  ++RA S+  TL+ + +     FS A   S F++K VT++NFESALEDLR  ++ A
Sbjct  1    MKKPALVRAFSEALTLVRSTYLLTRPFSSA-TPSTFSVKKVTKTNFESALEDLRRHVRDA  59

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFV+ DLEMTGVTSAPWRDSFE DR+D+RYLKVKDSAEKFAVVQFGVCPFRWD+ K  F+
Sbjct  60   DFVSFDLEMTGVTSAPWRDSFEFDRFDVRYLKVKDSAEKFAVVQFGVCPFRWDASKESFV  119

Query  378  AHP  386
            AHP
Sbjct  120  AHP  122



>ref|XP_010501213.1| PREDICTED: poly(A)-specific ribonuclease PARN [Camelina sativa]
Length=690

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = +3

Query  21   KMKKQWMIRAL-SKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            +  KQW +R L + +  S+    +++ + A  ++AF LK+VTRSNFE+ L DLR L+KAA
Sbjct  2    RRHKQWPLRPLLAYSFCSSAAERVSTSTAAAATAAFPLKHVTRSNFETTLNDLRALVKAA  61

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F+
Sbjct  62   DFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFV  121

Query  378  AHPY  389
            +HP+
Sbjct  122  SHPH  125



>ref|XP_006392591.1| hypothetical protein EUTSA_v10011283mg [Eutrema salsugineum]
 gb|ESQ29877.1| hypothetical protein EUTSA_v10011283mg [Eutrema salsugineum]
Length=680

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 91/123 (74%), Gaps = 5/123 (4%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            +  K+W +R L+  L  +        S A  + AF LK+VTRSNFE  L DLR  +KAAD
Sbjct  2    RRHKRWPLRPLASALARSRFC-----SSAAAAGAFPLKHVTRSNFEMTLNDLRSHVKAAD  56

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F++
Sbjct  57   FVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVS  116

Query  381  HPY  389
            HP+
Sbjct  117  HPH  119



>ref|XP_006346129.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum tuberosum]
Length=715

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F +KNVT+SNFESAL+DLRGL++ ADFVA+DLEMTGVTSAPWR+SF+ DRYDI YLKVKD
Sbjct  37   FDIKNVTKSNFESALKDLRGLLRDADFVAVDLEMTGVTSAPWRESFDYDRYDISYLKVKD  96

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAVVQFGVCPFRWDS K  FIAHP+
Sbjct  97   SAEKFAVVQFGVCPFRWDSHKQSFIAHPH  125



>ref|XP_007020484.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 ref|XP_007020485.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 gb|EOY12009.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
 gb|EOY12010.1| Poly(A)-specific ribonuclease PARN isoform 1 [Theobroma cacao]
Length=726

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +3

Query  30   KQWMIRAL--SKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADF  203
            K W  RAL  S+ L  A  +  ++   A  S  F LK+VTRSNF+SAL +LR  ++AADF
Sbjct  5    KHWPKRALILSRVLSRAFFSNTST--SASPSPTFPLKHVTRSNFDSALVELRSHVRAADF  62

Query  204  VAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAH  383
            VAIDLEMTGVTSAPWR+SFE DR+DIRYLKVKDSAEKFAVVQFGVCPFRWDS+K  FIAH
Sbjct  63   VAIDLEMTGVTSAPWRESFEFDRFDIRYLKVKDSAEKFAVVQFGVCPFRWDSLKQSFIAH  122

Query  384  PY  389
            P+
Sbjct  123  PH  124



>ref|XP_010061446.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Eucalyptus 
grandis]
Length=722

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISA-PHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            MK++  + ALS+ L  A      T+ S+A   S F +KNVTRSNFE ALE LR  ++AAD
Sbjct  1    MKRRCPVGALSRALSRALTTTTATAGSQAPTPSTFPIKNVTRSNFEPALESLREHVRAAD  60

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            +VA+DLEMTGVTSAPWR+SFE DRYD+RYLKVKDSAEKFAVVQFGVCPFRWD  +  F+A
Sbjct  61   YVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDPQELCFVA  120

Query  381  HPY  389
            HP+
Sbjct  121  HPH  123



>ref|XP_010061447.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Eucalyptus 
grandis]
Length=696

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISA-PHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            MK++  + ALS+ L  A      T+ S+A   S F +KNVTRSNFE ALE LR  ++AAD
Sbjct  1    MKRRCPVGALSRALSRALTTTTATAGSQAPTPSTFPIKNVTRSNFEPALESLREHVRAAD  60

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            +VA+DLEMTGVTSAPWR+SFE DRYD+RYLKVKDSAEKFAVVQFGVCPFRWD  +  F+A
Sbjct  61   YVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDPQELCFVA  120

Query  381  HPY  389
            HP+
Sbjct  121  HPH  123



>gb|AAF79314.1|AC002304_7 F14J16.11 [Arabidopsis thaliana]
Length=660

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            +  K+W +R+L  +  S+    +T+ + A  ++AF LK+VTRSNFE+ L DLR L+KAAD
Sbjct  61   RRHKRWPLRSLVCSFSSSAAETVTTSTAASATAAFPLKHVTRSNFETTLNDLRSLVKAAD  120

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F++
Sbjct  121  FVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVS  180

Query  381  HPY  389
            +P+
Sbjct  181  YPH  183



>ref|XP_010061445.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Eucalyptus 
grandis]
 gb|KCW68391.1| hypothetical protein EUGRSUZ_F02044 [Eucalyptus grandis]
Length=734

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISA-PHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            MK++  + ALS+ L  A      T+ S+A   S F +KNVTRSNFE ALE LR  ++AAD
Sbjct  1    MKRRCPVGALSRALSRALTTTTATAGSQAPTPSTFPIKNVTRSNFEPALESLREHVRAAD  60

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            +VA+DLEMTGVTSAPWR+SFE DRYD+RYLKVKDSAEKFAVVQFGVCPFRWD  +  F+A
Sbjct  61   YVAVDLEMTGVTSAPWRESFEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDPQELCFVA  120

Query  381  HPY  389
            HP+
Sbjct  121  HPH  123



>ref|NP_175983.5| poly(A)-specific ribonuclease PARN [Arabidopsis thaliana]
 sp|Q9LG26.2|PARN_ARATH RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Polyadenylate-specific 
ribonuclease; Short=AtPARN; AltName: 
Full=Protein ABA hypersensitive germination 2 [Arabidopsis 
thaliana]
 dbj|BAD98514.1| poly(A)-specific ribonuclease [Arabidopsis thaliana]
 gb|AEE33311.1| poly(A)-specific ribonuclease PARN [Arabidopsis thaliana]
Length=689

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 98/123 (80%), Gaps = 0/123 (0%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            +  K+W +R+L  +  S+    +T+ + A  ++AF LK+VTRSNFE+ L DLR L+KAAD
Sbjct  2    RRHKRWPLRSLVCSFSSSAAETVTTSTAASATAAFPLKHVTRSNFETTLNDLRSLVKAAD  61

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQFGVCPFRWDS    F++
Sbjct  62   FVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQFGVCPFRWDSRTQSFVS  121

Query  381  HPY  389
            +P+
Sbjct  122  YPH  124



>ref|XP_004244040.1| PREDICTED: poly(A)-specific ribonuclease PARN [Solanum lycopersicum]
Length=711

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +3

Query  24   MKKQWMIRALSKT--LISAPHAGLTSFSRALCSSA-FALKNVTRSNFESALEDLRGLIKA  194
            MKK  M ++LS T  L  AP    T+  R L SS+ F +KNVT+SNFESAL+DLRGL++ 
Sbjct  1    MKKLCMWKSLSTTRHLSHAPTTIFTTRRRTLSSSSSFDIKNVTKSNFESALKDLRGLLRD  60

Query  195  ADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFF  374
            ADFVA+DLEMTGVTSAPWR+SF+ DRYDI YLKVKDSAEKFAVVQFGVCPFRWD  K  F
Sbjct  61   ADFVAVDLEMTGVTSAPWRESFDYDRYDISYLKVKDSAEKFAVVQFGVCPFRWDPHKQSF  120

Query  375  IAHPY  389
            IAHP+
Sbjct  121  IAHPH  125



>gb|KHF97874.1| Poly (A)-specific ribonuclease PARN -like protein [Gossypium 
arboreum]
Length=718

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 89/115 (77%), Gaps = 12/115 (10%)
 Frame = +3

Query  45   RALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEM  224
            RALS+     P            S  F LK+VTRSNFESAL +LR  ++AADFVAID+EM
Sbjct  16   RALSRAFSDTP------------SPTFPLKHVTRSNFESALVELRSHVRAADFVAIDMEM  63

Query  225  TGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            TGVTSAPWR+SFE DR+DIRYLKVKDSAEKFAV+QFGVCPFRWDS+K  FIAHP+
Sbjct  64   TGVTSAPWRESFEFDRFDIRYLKVKDSAEKFAVLQFGVCPFRWDSLKQSFIAHPH  118



>gb|KDP25970.1| hypothetical protein JCGZ_22700 [Jatropha curcas]
Length=706

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 95/122 (78%), Gaps = 7/122 (6%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADF  203
            M KQW +RALS+ L          +S +  SS+F LK+VT+SNFESAL  L+  + AADF
Sbjct  1    MSKQWPLRALSRALSRV-------YSSSSSSSSFPLKHVTKSNFESALAKLKSHVGAADF  53

Query  204  VAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAH  383
            +AIDLEMTG+TSAPWR+S E DR+D+RYLK KDSAEKFA+VQFGVCPFRWDS +H FIAH
Sbjct  54   IAIDLEMTGITSAPWRESLEYDRFDVRYLKAKDSAEKFAIVQFGVCPFRWDSHRHSFIAH  113

Query  384  PY  389
            P+
Sbjct  114  PH  115



>ref|XP_011097756.1| PREDICTED: poly(A)-specific ribonuclease PARN [Sesamum indicum]
Length=725

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 97/129 (75%), Gaps = 12/129 (9%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSA-------FALKNVTRSNFESALEDLRG  182
            MK+ +++RAL++T         +  +R+LCSSA        ALKNVT+SNFE AL +LR 
Sbjct  1    MKRSYLVRALTRT-----RNRTSLLTRSLCSSASQPSGADVALKNVTKSNFEPALAELRH  55

Query  183  LIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSV  362
             ++ ADFVA+DLEMTGVTSAPWR+SFE DR DI+YLK+KDSAEKFAVVQFGVCPFRWD  
Sbjct  56   HVREADFVAVDLEMTGVTSAPWRESFEFDRSDIQYLKIKDSAEKFAVVQFGVCPFRWDPH  115

Query  363  KHFFIAHPY  389
               F+AHP+
Sbjct  116  SRSFVAHPH  124



>ref|XP_010480146.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=678

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 91/139 (65%), Gaps = 30/139 (22%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSA----------------FALKNVTRSN  152
            +  KQW +R L               + + CSSA                F LK+VTRSN
Sbjct  2    RRHKQWPLRPL--------------LAYSFCSSAAERVSTSTASAAATAAFPLKHVTRSN  47

Query  153  FESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQF  332
            FE  L DLR L+KAADFVAIDLEMTGVTSAPWRDS E DRYD+RYLKVKDSAEKFAVVQF
Sbjct  48   FEKTLNDLRALVKAADFVAIDLEMTGVTSAPWRDSLEFDRYDVRYLKVKDSAEKFAVVQF  107

Query  333  GVCPFRWDSVKHFFIAHPY  389
            GVCPFRWDS    F++HP+
Sbjct  108  GVCPFRWDSRTQSFVSHPH  126



>ref|XP_002522771.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39622.1| conserved hypothetical protein [Ricinus communis]
Length=699

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADF  203
            M KQW ++ALS+ L  A     +S S +  + +F LK+V +SNF S+L DL+  + AADF
Sbjct  1    MTKQWPLKALSRALSRA----YSSSSTSNSTPSFPLKHVVKSNFNSSLADLKRHVIAADF  56

Query  204  VAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAH  383
            +AIDLEMTG+T+APWR+SFE DR+D+RYLKVKDSAEKFAVVQFGVCPFRWDS  H FIAH
Sbjct  57   IAIDLEMTGITTAPWRESFEYDRFDVRYLKVKDSAEKFAVVQFGVCPFRWDSDHHSFIAH  116

Query  384  PYVTVISTATIQFL  425
            PY   I     +FL
Sbjct  117  PYNFFIFREDCEFL  130



>ref|XP_010942842.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Elaeis 
guineensis]
Length=460

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISA--PHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            M+ +W++ A S+TL  A   H     FS A   +  A+K VT SNFE ALE+LR  ++ A
Sbjct  1    MRSRWLVSAFSRTLTLAFSRHVHRRRFSSA---TGVAVKKVTNSNFEPALEELRVRVREA  57

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTG+ SAPWRD+FE DR D+RYLKVKDS EKFAVVQ GVCPFRWD  K  FI
Sbjct  58   DFVAIDLEMTGIMSAPWRDAFEFDRSDVRYLKVKDSVEKFAVVQVGVCPFRWDGAKGSFI  117

Query  378  AHPY  389
            AHP+
Sbjct  118  AHPH  121



>ref|XP_004148252.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
 ref|XP_004169292.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
 gb|KGN56034.1| hypothetical protein Csa_3G048430 [Cucumis sativus]
Length=700

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 88/103 (85%), Gaps = 1/103 (1%)
 Frame = +3

Query  81   AGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSF  260
            A +T+ S A  +S+F LKNVT+SNFE+AL +LR  ++AADFVAIDLEMTG+TSAPWRD  
Sbjct  26   AAVTAPSTA-SNSSFPLKNVTKSNFEAALSELRSHVRAADFVAIDLEMTGITSAPWRDLL  84

Query  261  ELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            E DR+D+RYL VKDSAEKFAV+QFG+CPFRWDS K+ F+AHP+
Sbjct  85   EFDRFDVRYLNVKDSAEKFAVLQFGICPFRWDSAKNSFVAHPH  127



>ref|XP_008449056.1| PREDICTED: poly(A)-specific ribonuclease PARN [Cucumis melo]
Length=702

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            +S+F LKNVT+SNFE+AL +LR  ++AADFVA+DLEMTG+TSAPWRD  E DR+D+RYL 
Sbjct  34   NSSFPLKNVTKSNFEAALSELRSHVRAADFVAVDLEMTGITSAPWRDLLEFDRFDVRYLN  93

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            VKDSAEKFAVVQFGVCPFRWDS K  F+AHP+
Sbjct  94   VKDSAEKFAVVQFGVCPFRWDSAKKSFVAHPH  125



>ref|XP_010675952.1| PREDICTED: poly(A)-specific ribonuclease PARN [Beta vulgaris 
subsp. vulgaris]
Length=711

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSR-ALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            MKK  +IR    +L S     LT++   +  ++ F+LKNVT+SNFE  L DL   +K+AD
Sbjct  1    MKK--LIRVTPFSLSSTLLRTLTTYHHYSTSTTNFSLKNVTKSNFEETLIDLTTHVKSAD  58

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTG+TS+PWR+SFE DR+D+RYLK+KDSAEKFAVVQFGVCPFRWDS K+ F+A
Sbjct  59   FVAIDLEMTGITSSPWRESFEFDRHDVRYLKMKDSAEKFAVVQFGVCPFRWDSSKNSFVA  118

Query  381  HPY  389
            HP+
Sbjct  119  HPH  121



>ref|XP_010552367.1| PREDICTED: poly(A)-specific ribonuclease PARN [Tarenaya hassleriana]
Length=708

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LK+VTRSNFE+ L DLR  + AADFVAIDLEMTGVTSAPWR+S E DR+D+RYLKVKD
Sbjct  44   FPLKHVTRSNFETTLSDLRSHVHAADFVAIDLEMTGVTSAPWRESLEFDRFDVRYLKVKD  103

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAVVQFGVCPFRWDS+ H F+A+P+
Sbjct  104  SAEKFAVVQFGVCPFRWDSLSHSFVAYPH  132



>ref|XP_010942841.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Elaeis 
guineensis]
Length=716

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISA--PHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAA  197
            M+ +W++ A S+TL  A   H     FS A   +  A+K VT SNFE ALE+LR  ++ A
Sbjct  1    MRSRWLVSAFSRTLTLAFSRHVHRRRFSSA---TGVAVKKVTNSNFEPALEELRVRVREA  57

Query  198  DFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            DFVAIDLEMTG+ SAPWRD+FE DR D+RYLKVKDS EKFAVVQ GVCPFRWD  K  FI
Sbjct  58   DFVAIDLEMTGIMSAPWRDAFEFDRSDVRYLKVKDSVEKFAVVQVGVCPFRWDGAKGSFI  117

Query  378  AHPY  389
            AHP+
Sbjct  118  AHPH  121



>ref|XP_011038803.1| PREDICTED: poly(A)-specific ribonuclease PARN [Populus euphratica]
Length=675

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 93/121 (77%), Gaps = 12/121 (10%)
 Frame = +3

Query  27   KKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFV  206
            K QW+  ALS+       A   +FS     S+F LK+VT+SNFESA+ DL+  +KAADFV
Sbjct  5    KHQWLRTALSR-------AYYCTFS-----SSFPLKHVTQSNFESAVADLKTHLKAADFV  52

Query  207  AIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHP  386
            AIDLEMTGVTSAPWR+S E DR+D++YLKVKDSAEKFAVVQ GVCPFRWD ++  FIAHP
Sbjct  53   AIDLEMTGVTSAPWRESLEFDRFDVKYLKVKDSAEKFAVVQLGVCPFRWDPLRLSFIAHP  112

Query  387  Y  389
            +
Sbjct  113  H  113



>ref|XP_008219726.1| PREDICTED: poly(A)-specific ribonuclease PARN [Prunus mume]
Length=683

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL +LR  + AADFVAIDLEMTG+TSAPWRDS E DR D+ YLKVKD
Sbjct  32   FPLKNVTKSNFEPALAELRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKD  91

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS KH FIAHP+
Sbjct  92   SAEKFAVLQFGVCPFRWDSSKHSFIAHPH  120



>ref|XP_007207137.1| hypothetical protein PRUPE_ppa002362mg [Prunus persica]
 gb|EMJ08336.1| hypothetical protein PRUPE_ppa002362mg [Prunus persica]
Length=682

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADF  203
            M     +RALS+ L     A   S S    SS F LKNVT+SNFE AL +LR  + AADF
Sbjct  1    MNTHRPVRALSRAL---SRALSNSSSSVQPSSTFPLKNVTKSNFEPALAELRRHVAAADF  57

Query  204  VAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAH  383
            VAIDLEMTG+TSAPWRDS E DR D+ YLKVKDSAEKFAV+QFGVCPFRWDS K +FIAH
Sbjct  58   VAIDLEMTGITSAPWRDSLEFDRADVCYLKVKDSAEKFAVLQFGVCPFRWDSSKQYFIAH  117

Query  384  PY  389
            P+
Sbjct  118  PH  119



>ref|XP_002300380.2| CAF1 family ribonuclease family protein [Populus trichocarpa]
 gb|EEE85185.2| CAF1 family ribonuclease family protein [Populus trichocarpa]
Length=674

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 12/121 (10%)
 Frame = +3

Query  27   KKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFV  206
            K QW+  ALS+       A   +FS     S+F LK+VT+SNFE+A+ DL+  +KAADFV
Sbjct  5    KHQWLRTALSR-------AYYCTFS-----SSFPLKHVTQSNFETAVADLKTHLKAADFV  52

Query  207  AIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHP  386
            AIDLEMTGVTSAPWR+S E DR+D++YLKVKDSAEKFAVVQ GVCPFRWD ++  FIAHP
Sbjct  53   AIDLEMTGVTSAPWRESLEFDRFDVKYLKVKDSAEKFAVVQLGVCPFRWDPLRLSFIAHP  112

Query  387  Y  389
            +
Sbjct  113  H  113



>ref|XP_008363350.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=724

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TSAPWRDS E DR D+ YLKVKD
Sbjct  35   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKD  94

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS K  FIAHP+
Sbjct  95   SAEKFAVLQFGVCPFRWDSSKRSFIAHPH  123



>ref|XP_009348053.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Pyrus x bretschneideri]
 ref|XP_009348066.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Pyrus x bretschneideri]
Length=606

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TS+PWRDS E DR D+ YLKVKD
Sbjct  40   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKD  99

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS K  FIAHP+
Sbjct  100  SAEKFAVLQFGVCPFRWDSSKRSFIAHPH  128



>ref|XP_009348051.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009348064.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
Length=729

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TS+PWRDS E DR D+ YLKVKD
Sbjct  40   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKD  99

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS K  FIAHP+
Sbjct  100  SAEKFAVLQFGVCPFRWDSSKRSFIAHPH  128



>ref|XP_009348052.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009348065.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Pyrus x bretschneideri]
Length=679

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TS+PWRDS E DR D+ YLKVKD
Sbjct  40   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSSPWRDSLEFDRADVCYLKVKD  99

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHP  386
            SAEKFAV+QFGVCPFRWDS K  FIAHP
Sbjct  100  SAEKFAVLQFGVCPFRWDSSKRSFIAHP  127



>ref|XP_009391781.1| PREDICTED: poly(A)-specific ribonuclease PARN [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTRSNFE ALEDLR L++ ADFVA+DLEMTGVTSAPWRDSFE DR D+RYLK+KDS
Sbjct  41   AVKKVTRSNFEPALEDLRALVREADFVAVDLEMTGVTSAPWRDSFEFDRSDVRYLKLKDS  100

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AEKFAVVQFGVCPFRW+  +  F+A+P+
Sbjct  101  AEKFAVVQFGVCPFRWEPSRGSFVAYPH  128



>ref|XP_008384548.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Malus domestica]
Length=725

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TSAPWRDS E DR D+ YLKVKD
Sbjct  35   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKD  94

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCP RWDS K  FIAHP+
Sbjct  95   SAEKFAVLQFGVCPXRWDSSKRSFIAHPH  123



>ref|XP_009379459.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=725

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE AL DLR  + AADFVAIDLEMTG+TSAPWRDS E DR D+ YLKVKD
Sbjct  35   FPLKNVTKSNFEPALADLRRHVAAADFVAIDLEMTGITSAPWRDSLEFDRADVCYLKVKD  94

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPF WDS K  FIAHP+
Sbjct  95   SAEKFAVLQFGVCPFCWDSSKRSFIAHPH  123



>ref|XP_004296331.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Fragaria 
vesca subsp. vesca]
Length=717

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F LKNVT+SNFE  L +LR  + AADFVA+DLEM+GVTSAPWRDS E DR D+ YLKVKD
Sbjct  30   FPLKNVTKSNFEQVLAELRRHVAAADFVAVDLEMSGVTSAPWRDSLEFDRPDVSYLKVKD  89

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS K  FIAHP+
Sbjct  90   SAEKFAVLQFGVCPFRWDSSKKSFIAHPH  118



>ref|XP_006474884.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Citrus sinensis]
Length=673

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            LK+V +SNF+SAL  LR  I+AADFVAIDLEMTG+TSAPWRDSFE DR+D+RYLKVKDSA
Sbjct  27   LKHVKKSNFDSALSSLRHHIQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            EKFAV+QFGV PFRWD +K  FI HP+
Sbjct  87   EKFAVIQFGVSPFRWDPLKQSFITHPH  113



>ref|XP_006474883.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Citrus sinensis]
Length=711

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            LK+V +SNF+SAL  LR  I+AADFVAIDLEMTG+TSAPWRDSFE DR+D+RYLKVKDSA
Sbjct  27   LKHVKKSNFDSALSSLRHHIQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            EKFAV+QFGV PFRWD +K  FI HP+
Sbjct  87   EKFAVIQFGVSPFRWDPLKQSFITHPH  113



>ref|XP_006452602.1| hypothetical protein CICLE_v10007611mg [Citrus clementina]
 gb|ESR65842.1| hypothetical protein CICLE_v10007611mg [Citrus clementina]
Length=711

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            LK+V +SNF+SAL  LR  ++AADFVAIDLEMTG+TSAPWRDSFE DR+D+RYLKVKDSA
Sbjct  27   LKHVKKSNFDSALSSLRHHVQAADFVAIDLEMTGITSAPWRDSFEFDRFDVRYLKVKDSA  86

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            EKFAV+QFGV PFRWD +K  FI HP+
Sbjct  87   EKFAVIQFGVSPFRWDPLKQSFITHPH  113



>ref|XP_008808744.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Phoenix 
dactylifera]
Length=724

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGL------TSFSRALCSSAFALKNVTRSNFESALEDLRGL  185
            M+ +W+I A S+TL  A    +      +S + A  ++A A+K VT+SNFE ALEDLR  
Sbjct  1    MRSRWLISAFSRTLTLACSHPVHCRRFSSSATAAAATTAVAVKKVTKSNFEPALEDLRLR  60

Query  186  IKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVK  365
            ++ ADFVAIDLEMTG+TSAPWRD+FE DR D+RYLKVKDSAEKFAVVQFGVCPFRWD  K
Sbjct  61   VREADFVAIDLEMTGITSAPWRDAFEFDRSDVRYLKVKDSAEKFAVVQFGVCPFRWDGAK  120

Query  366  HFFIAHPY  389
              FIAHP+
Sbjct  121  GSFIAHPH  128



>ref|XP_008808745.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Phoenix 
dactylifera]
Length=723

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 97/128 (76%), Gaps = 6/128 (5%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGL------TSFSRALCSSAFALKNVTRSNFESALEDLRGL  185
            M+ +W+I A S+TL  A    +      +S + A  ++A A+K VT+SNFE ALEDLR  
Sbjct  1    MRSRWLISAFSRTLTLACSHPVHCRRFSSSATAAAATTAVAVKKVTKSNFEPALEDLRLR  60

Query  186  IKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVK  365
            ++ ADFVAIDLEMTG+TSAPWRD+FE DR D+RYLKVKDSAEKFAVVQFGVCPFRWD  K
Sbjct  61   VREADFVAIDLEMTGITSAPWRDAFEFDRSDVRYLKVKDSAEKFAVVQFGVCPFRWDGAK  120

Query  366  HFFIAHPY  389
              FIAHP+
Sbjct  121  GSFIAHPH  128



>ref|XP_004516095.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cicer arietinum]
Length=721

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 85/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  48   ALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMT  227
            ALS+ L  A     T+ +   C SAF  K VT SNFE +L +LR  ++++DFVAIDLEMT
Sbjct  10   ALSRALSRALSTSTTTTTPLQCGSAFPSKTVTVSNFEPSLAELRHHVRSSDFVAIDLEMT  69

Query  228  GVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            GVTSAPWR+SFE DR D+RYLKV+DSA +FAVVQFGVCPFRWD     F+A+PY
Sbjct  70   GVTSAPWRESFEFDRSDVRYLKVRDSASRFAVVQFGVCPFRWDPSNQSFVAYPY  123



>ref|XP_006586143.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Glycine max]
Length=479

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 12/149 (8%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RAL++ L SA    +T+     C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPSLSRALARALSSAT---ITTH----CGPAFPSKTVTTANFEPSLAELRHHVRCSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+S   DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRESLAFDRSDVRYLKVRDSAAKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY-VTVISTATIQFLFLLIAVHDEFICK  464
            HP+   V     I  L       DEF+C+
Sbjct  118  HPHNFYVFPRQEIAGL----GPCDEFLCQ  142



>ref|XP_003530802.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Glycine max]
Length=718

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 96/149 (64%), Gaps = 12/149 (8%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RAL++ L SA    +T+     C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPSLSRALARALSSAT---ITTH----CGPAFPSKTVTTANFEPSLAELRHHVRCSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+S   DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRESLAFDRSDVRYLKVRDSAAKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY-VTVISTATIQFLFLLIAVHDEFICK  464
            HP+   V     I  L       DEF+C+
Sbjct  118  HPHNFYVFPRQEIAGL----GPCDEFLCQ  142



>ref|XP_006602126.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X6 
[Glycine max]
Length=479

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RA ++ L SA  A         C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPALSRAFARALGSATTA-------TQCGVAFPSKTVTTANFEPSLAELRRHVRTSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+  E DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY  389
            +P+
Sbjct  118  YPH  120



>ref|XP_006602125.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X5 
[Glycine max]
Length=488

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RA ++ L SA  A         C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPALSRAFARALGSATTA-------TQCGVAFPSKTVTTANFEPSLAELRRHVRTSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+  E DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY  389
            +P+
Sbjct  118  YPH  120



>ref|XP_006602123.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Glycine max]
Length=596

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RA ++ L SA  A         C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPALSRAFARALGSATTA-------TQCGVAFPSKTVTTANFEPSLAELRRHVRTSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+  E DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY  389
            +P+
Sbjct  118  YPH  120



>ref|XP_007146650.1| hypothetical protein PHAVU_006G058000g [Phaseolus vulgaris]
 gb|ESW18644.1| hypothetical protein PHAVU_006G058000g [Phaseolus vulgaris]
Length=712

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = +3

Query  24   MKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADF  203
            MK +    +LS+ +  A    L   +   C SAF  K VT +NFE +L +LR  ++++DF
Sbjct  1    MKHKLPTPSLSRAVARA----LCPATTTQCDSAFPSKTVTTANFEPSLAELRRHVRSSDF  56

Query  204  VAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAH  383
            VAIDLEM+G+TSAPWR+S E DR D+RYLKV+DSA KFAVVQFGVCPFRWDS  + F+A+
Sbjct  57   VAIDLEMSGITSAPWRESLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDSSNNSFVAY  116

Query  384  PY  389
            P+
Sbjct  117  PH  118



>ref|NP_001169499.1| hypothetical protein [Zea mays]
 gb|ACN33924.1| unknown [Zea mays]
 gb|AFW58530.1| hypothetical protein ZEAMMB73_225129 [Zea mays]
Length=693

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N E ALE LRG ++ A FV +DLEM+GVTSAPWRD+FELDR D+RYLK++DS
Sbjct  36   AVKQVTRGNMEEALEKLRGRVREAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKLRDS  95

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AE+FA +Q GVCPFRWD  K  F+AHP+
Sbjct  96   AERFAALQLGVCPFRWDPAKSAFVAHPH  123



>gb|AFW58529.1| hypothetical protein ZEAMMB73_225129 [Zea mays]
Length=686

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N E ALE LRG ++ A FV +DLEM+GVTSAPWRD+FELDR D+RYLK++DS
Sbjct  36   AVKQVTRGNMEEALEKLRGRVREAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKLRDS  95

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AE+FA +Q GVCPFRWD  K  F+AHP+
Sbjct  96   AERFAALQLGVCPFRWDPAKSAFVAHPH  123



>ref|XP_006602122.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Glycine max]
Length=676

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RA ++ L SA  A         C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPALSRAFARALGSATTA-------TQCGVAFPSKTVTTANFEPSLAELRRHVRTSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+  E DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY  389
            +P+
Sbjct  118  YPH  120



>gb|EPS70287.1| hypothetical protein M569_04472 [Genlisea aurea]
Length=593

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            + +VT +NF +AL +LR L++ ADFV+IDLEMTGVTSAPWR++ E DR DI+YLK+KDSA
Sbjct  40   VNDVTETNFSTALTELRRLVRDADFVSIDLEMTGVTSAPWREALEFDRSDIQYLKIKDSA  99

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            E+F+VVQFGVCPFRWD+  H F+AHPY
Sbjct  100  ERFSVVQFGVCPFRWDTHSHCFVAHPY  126



>ref|XP_003552994.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Glycine max]
Length=714

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +3

Query  21   KMKKQWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAAD  200
            K+    + RA ++ L SA  A         C  AF  K VT +NFE +L +LR  ++ +D
Sbjct  5    KLPSPALSRAFARALGSATTA-------TQCGVAFPSKTVTTANFEPSLAELRRHVRTSD  57

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FVAIDLEMTGVTSAPWR+  E DR D+RYLKV+DSA KFAVVQFGVCPFRWD   H F+A
Sbjct  58   FVAIDLEMTGVTSAPWRELLEFDRSDVRYLKVRDSATKFAVVQFGVCPFRWDPSNHSFVA  117

Query  381  HPY  389
            +P+
Sbjct  118  YPH  120



>ref|NP_001173974.1| Os04g0467400 [Oryza sativa Japonica Group]
 dbj|BAH92702.1| Os04g0467400 [Oryza sativa Japonica Group]
Length=207

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE+LR  ++ A FV IDLEM+GVTSAPWRD+  LDR D+RYLK++DS
Sbjct  45   AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLGLDRADVRYLKLRDS  104

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AE+FA +Q GVCPFRWD  K  F+AHP+
Sbjct  105  AERFAALQLGVCPFRWDPAKSAFVAHPH  132



>ref|XP_004975901.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Setaria italica]
Length=692

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE+LRG ++ A FV +DLEM+GVTSAPWRD+FELDR D+RYLK++DS
Sbjct  35   AVKQVTRGNLAEALEELRGRVREATFVGLDLEMSGVTSAPWRDTFELDRDDVRYLKLRDS  94

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AE+FA +Q GVCPFRWD  K  F+A+P+
Sbjct  95   AERFAALQLGVCPFRWDPAKSAFVAYPH  122



>gb|EMT26628.1| Poly(A)-specific ribonuclease PARN [Aegilops tauschii]
Length=761

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            +  A+K VTR N   ALE+LR  ++ A FV IDLEM+GVTSAPWRD+FELDR D+RYLK+
Sbjct  52   AGVAVKQVTRGNLAEALEELRARVRDAAFVGIDLEMSGVTSAPWRDTFELDRADVRYLKL  111

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +DSA++FAV+Q GVCPFRWD  K  F+AHP+
Sbjct  112  RDSAKRFAVLQLGVCPFRWDPAKSAFVAHPH  142



>ref|XP_010088438.1| Poly(A)-specific ribonuclease PARN [Morus notabilis]
 gb|EXB36053.1| Poly(A)-specific ribonuclease PARN [Morus notabilis]
Length=754

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            F  K VTRSNFE+AL +LR  ++AADFVA+DLEM+GVTSAPWR+S   DR D+ YLKVK 
Sbjct  36   FPQKLVTRSNFEAALAELRRHVRAADFVAVDLEMSGVTSAPWRESLGFDRSDVLYLKVKH  95

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            SAEKFAV+QFGVCPFRWDS K  F+A+P+
Sbjct  96   SAEKFAVIQFGVCPFRWDSSKQTFVAYPH  124



>ref|XP_002447992.1| hypothetical protein SORBIDRAFT_06g019420 [Sorghum bicolor]
 gb|EES12320.1| hypothetical protein SORBIDRAFT_06g019420 [Sorghum bicolor]
Length=719

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE LRG ++ A FV +DLEM+GVTSAPWRD+FE DR D+RYLK++DS
Sbjct  44   AVKQVTRGNMAEALEKLRGRVREAAFVGVDLEMSGVTSAPWRDTFEFDRADVRYLKLRDS  103

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AE+FA +Q GVCPFRWD  K  F+AHP+
Sbjct  104  AERFAALQLGVCPFRWDPAKSAFVAHPH  131



>ref|XP_010240011.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Brachypodium 
distachyon]
Length=691

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
               A+K VTR N   ALE+LR  ++ A FV +DLEM+GVTSAPWRD+FELDR D+RYLK+
Sbjct  43   GGVAVKQVTRGNLAEALEELRARVRDAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKL  102

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +DSA++FA +Q GVCPFRWD  K  F+AHP+
Sbjct  103  RDSAQRFAALQLGVCPFRWDPAKSAFVAHPH  133



>ref|XP_003581331.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Brachypodium 
distachyon]
Length=729

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
               A+K VTR N   ALE+LR  ++ A FV +DLEM+GVTSAPWRD+FELDR D+RYLK+
Sbjct  43   GGVAVKQVTRGNLAEALEELRARVRDAAFVGLDLEMSGVTSAPWRDTFELDRADVRYLKL  102

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +DSA++FA +Q GVCPFRWD  K  F+AHP+
Sbjct  103  RDSAQRFAALQLGVCPFRWDPAKSAFVAHPH  133



>emb|CAE05998.4| OSJNBa0016O02.8 [Oryza sativa Japonica Group]
Length=622

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE+LR  ++ A FV IDLEM+GVTSAPWRD+  LDR D+RYLK++DS
Sbjct  45   AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLGLDRADVRYLKLRDS  104

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHP  386
            AE+FA +Q GVCPFRWD  K  F+AHP
Sbjct  105  AERFAALQLGVCPFRWDPAKSAFVAHP  131



>ref|XP_006857781.1| hypothetical protein AMTR_s00061p00208140 [Amborella trichopoda]
 gb|ERN19248.1| hypothetical protein AMTR_s00061p00208140 [Amborella trichopoda]
Length=716

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S  ++K VTR+NF S+ E+LR  ++ ADFVA+DLEM+G+TSAPWR+SFE D   IRYLK+
Sbjct  28   STISIKKVTRNNFTSSFEELRHHVREADFVALDLEMSGITSAPWRESFEFDHSTIRYLKI  87

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            KDSAEKFAVVQFGVCPFR+D+     IA+P+
Sbjct  88   KDSAEKFAVVQFGVCPFRYDNSTKTLIAYPH  118



>ref|XP_001765586.1| predicted protein [Physcomitrella patens]
 gb|EDQ69636.1| predicted protein [Physcomitrella patens]
Length=487

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            ++ NVTR NF  +LE LRG +  ADFVA+DLEMTGV S  WR + ELD Y+ RY  +K S
Sbjct  6    SMANVTRRNFVESLEQLRGQLAGADFVAVDLEMTGVESTKWRRNLELDSYETRYQNLKHS  65

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AEKFAV Q GVCPF+WD   + ++A+PY
Sbjct  66   AEKFAVWQCGVCPFKWDEAHNKWVAYPY  93



>ref|XP_006653504.1| PREDICTED: poly(A)-specific ribonuclease PARN-like, partial [Oryza 
brachyantha]
Length=659

 Score =   110 bits (274),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +3

Query  201  FVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIA  380
            FV +DLEM+GVTSAPWRD+ ELDR D+RYLK++DSAE+FA +Q GVCPFRWD  K  F+A
Sbjct  2    FVGVDLEMSGVTSAPWRDTLELDRADVRYLKLRDSAERFAALQLGVCPFRWDPAKSAFVA  61

Query  381  HPY  389
            HP+
Sbjct  62   HPH  64



>ref|XP_002970869.1| hypothetical protein SELMODRAFT_451150 [Selaginella moellendorffii]
 gb|EFJ28195.1| hypothetical protein SELMODRAFT_451150 [Selaginella moellendorffii]
Length=648

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            +TR NF +A + L+GL++ ADFVA+DLEM+GV SAPWR S ELD  + RY  V+DSAEKF
Sbjct  33   ITRQNFGAAFQRLKGLLREADFVAMDLEMSGVHSAPWRKSMELDTLETRYHNVRDSAEKF  92

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
            +++Q G+C FR+D     F+ HP+
Sbjct  93   SLLQCGLCLFRYDQASSKFLGHPF  116



>ref|XP_002969601.1| hypothetical protein SELMODRAFT_410403 [Selaginella moellendorffii]
 gb|EFJ29689.1| hypothetical protein SELMODRAFT_410403 [Selaginella moellendorffii]
Length=648

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            +TR NF +A + L+GL++ ADFVA+DLEM+GV SAPWR S ELD  + RY  V+DSAEKF
Sbjct  33   ITRQNFGAAFQRLKGLLRDADFVAMDLEMSGVHSAPWRKSMELDTLETRYHNVRDSAEKF  92

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
            +++Q G+C FR+D     F+ HP+
Sbjct  93   SLLQCGLCLFRYDQASSKFLGHPF  116



>gb|EYU33709.1| hypothetical protein MIMGU_mgv1a003022mg [Erythranthe guttata]
Length=614

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +3

Query  222  MTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            MTGVTSAPWR+SF+ DR DI+YLK+KDSAEKFAVVQFGVCPFRWD + H F+AHP+
Sbjct  1    MTGVTSAPWRESFDFDRPDIQYLKIKDSAEKFAVVQFGVCPFRWDPLSHSFLAHPH  56



>ref|XP_002985556.1| hypothetical protein SELMODRAFT_424560 [Selaginella moellendorffii]
 gb|EFJ13430.1| hypothetical protein SELMODRAFT_424560 [Selaginella moellendorffii]
Length=603

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VTRSN+E AL + R  I+ A FVA+DLE+TGV + PWR + E+D    RYL ++DSAEKF
Sbjct  4    VTRSNWEEALVEARAHIRQAAFVAVDLELTGVQTTPWRGATEVDNLHTRYLNLRDSAEKF  63

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
            A++QFG+CP  WD+    FIA+PY
Sbjct  64   AMIQFGLCPVLWDAAGGKFIAYPY  87



>ref|XP_002987014.1| hypothetical protein SELMODRAFT_446815 [Selaginella moellendorffii]
 gb|EFJ11857.1| hypothetical protein SELMODRAFT_446815 [Selaginella moellendorffii]
Length=603

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VTRSN+E AL + R  I+ A FVA+DLE++GV + PWR + E+D    RYL ++DSAEKF
Sbjct  4    VTRSNWEEALVEARAHIRQAAFVAVDLELSGVQTTPWRGATEVDNLHTRYLNLRDSAEKF  63

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
            A++QFG+CP  WD+    FIA+PY
Sbjct  64   AMIQFGLCPVVWDAASVKFIAYPY  87



>emb|CAH66773.1| OSIGBa0115M15.11 [Oryza sativa Indica Group]
Length=703

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE+LR  ++ A FV IDLEM+GVTSAPWRD+ ELDR D+RYLK++DS
Sbjct  45   AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLELDRADVRYLKLRDS  104

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVISTATIQFL  425
            AE+     F       D   H F+         T +I FL
Sbjct  105  AERHNFFIFSRNEPLNDCSTHEFLCQ-------TTSIDFL  137



>emb|CAH67368.1| OSIGBa0128P10.2 [Oryza sativa Indica Group]
Length=702

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VTR N   ALE+LR  ++ A FV IDLEM+GVTSAPWRD+ ELDR D+RYLK++DS
Sbjct  45   AVKQVTRGNLAEALEELRARVRGAAFVGIDLEMSGVTSAPWRDTLELDRADVRYLKLRDS  104

Query  306  A  308
            A
Sbjct  105  A  105



>ref|XP_004247263.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum lycopersicum]
Length=619

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S + +K VT+SNF +ALE++R  I  +DF+AI L+ TG  SAPW+    +D     YLK 
Sbjct  25   SKWNVKQVTKSNFSAALEEIRNCISDSDFIAISLKNTGAYSAPWQRIMPIDTARTAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFAVCPFSIKGSK--LIVHPY  113



>emb|CDP11722.1| unnamed protein product [Coffea canephora]
Length=628

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  108  LCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRY  287
            L +  +A+K VT+SNF   LE+++  I  +DF+A+ L+ TG  S+PW+     D  ++ Y
Sbjct  27   LNNKKWAIKQVTKSNFAETLEEIKTHIFNSDFIAVSLQKTGAFSSPWQKVLPFDTAEVAY  86

Query  288  LKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            LK K +AE+F V+QF VCPF   S K   IAHPY
Sbjct  87   LKAKYAAERFQVLQFAVCPFSVKSSK--IIAHPY  118



>gb|EPS58289.1| hypothetical protein M569_16526, partial [Genlisea aurea]
Length=252

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 10/106 (9%)
 Frame = +3

Query  96   FSRALCSSAFA--------LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWR  251
            F R LC+ A A        +K VT++NF  A+ ++  LI ++DFVA+ LE TG  +A W+
Sbjct  3    FKRLLCTPAAAYNRRHVWPVKQVTKNNFSEAVAEICDLIHSSDFVAVSLERTGNHAANWQ  62

Query  252  DSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
                +D     YLK K +AE++  +QF VCPF  D  K   +AHPY
Sbjct  63   KILSIDTPGTAYLKAKHAAERYQTLQFSVCPFSVDGSK--LLAHPY  106



>ref|XP_006345714.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Solanum tuberosum]
Length=619

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S + +K VT+SNF +ALE++   I  +DF+A+ L+ TG  SAPW+    +D   I YLK 
Sbjct  25   SKWNVKQVTKSNFSAALEEISTCISDSDFIAVSLKNTGAYSAPWQRIMPIDTAHIAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFTVCPFSIKGSK--LIVHPY  113



>ref|XP_011089616.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X4 
[Sesamum indicum]
Length=605

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +3

Query  96   FSRALCSSAFA---------LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPW  248
            F R+LC+ A A         +K VT+SNF  AL +++  I  +D+VA+  + TG  SAPW
Sbjct  3    FRRSLCTQAAARHRRRIQWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPW  62

Query  249  RDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
                 +D  +  Y K K +AE+F ++QF VCPF   + K   IAHPY
Sbjct  63   HKILPIDTAETAYFKAKHAAERFQILQFAVCPFSVKASK--LIAHPY  107



>ref|XP_011089613.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Sesamum indicum]
 ref|XP_011089614.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Sesamum indicum]
Length=615

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +3

Query  96   FSRALCSSAFA---------LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPW  248
            F R+LC+ A A         +K VT+SNF  AL +++  I  +D+VA+  + TG  SAPW
Sbjct  3    FRRSLCTQAAARHRRRIQWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPW  62

Query  249  RDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
                 +D  +  Y K K +AE+F ++QF VCPF   + K   IAHPY
Sbjct  63   HKILPIDTAETAYFKAKHAAERFQILQFAVCPFSVKASK--LIAHPY  107



>ref|XP_011089615.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X3 
[Sesamum indicum]
Length=614

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 61/107 (57%), Gaps = 11/107 (10%)
 Frame = +3

Query  96   FSRALCSSAFA---------LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPW  248
            F R+LC+ A A         +K VT+SNF  AL +++  I  +D+VA+  + TG  SAPW
Sbjct  3    FRRSLCTQAAARHRRRIQWPVKQVTKSNFSEALAEIKACILNSDYVAVSFKQTGGHSAPW  62

Query  249  RDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
                 +D  +  Y K K +AE+F ++QF VCPF   + K   IAHPY
Sbjct  63   HKILPIDTAETAYFKAKHAAERFQILQFAVCPFSVKASK--LIAHPY  107



>ref|XP_010095607.1| Poly(A)-specific ribonuclease PARN-like protein [Morus notabilis]
 gb|EXB61180.1| Poly(A)-specific ribonuclease PARN-like protein [Morus notabilis]
Length=613

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 60/99 (61%), Gaps = 5/99 (5%)
 Frame = +3

Query  102  RALCSSA---FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDR  272
            R  CS+    + +K VT++NF  +LE+++  I ++DFVA+ L+ TG  SAPW      D 
Sbjct  7    RLFCSAVPKKWPVKQVTKTNFPESLEEIKRHISSSDFVAVSLQKTGSFSAPWHRLLPFDT  66

Query  273  YDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             D  Y K K SAE+F + QF +CPF  ++ K   +AHPY
Sbjct  67   ADTAYSKAKSSAERFQLFQFALCPFSLENSK--LVAHPY  103



>ref|XP_002321239.2| hypothetical protein POPTR_0014s175701g, partial [Populus trichocarpa]
 gb|EEE99554.2| hypothetical protein POPTR_0014s175701g, partial [Populus trichocarpa]
Length=224

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF   LED++  +  +DFVA+ L+ TG  SAPW+     D  D  YLK K 
Sbjct  28   WSVKQVTKSNFADTLEDIKSHVSNSDFVAVSLQNTGFFSAPWQRVSPFDTADTAYLKAKY  87

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AE+F V+ F VCPF   + K    A+PY
Sbjct  88   AAERFQVLHFAVCPFTVRASK--VTAYPY  114



>gb|KDP45240.1| hypothetical protein JCGZ_15105 [Jatropha curcas]
Length=345

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 11/119 (9%)
 Frame = +3

Query  33   QWMIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAI  212
             W+ R L  T +   H           +S + +K VT+SNF ++LE+++  I  +DF+A+
Sbjct  6    HWLQRRLFSTHLPKNHQ---------TNSQWNVKQVTKSNFTNSLEEVKSHISTSDFIAV  56

Query  213  DLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             L+ TG  S+PW      D  D  YLK K  AE+F V+QF VCPF   + K    A+PY
Sbjct  57   SLQKTGSFSSPWHRVSPFDTADTAYLKAKHVAERFQVLQFAVCPFTVRASK--ITAYPY  113



>ref|XP_009606035.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Nicotiana tomentosiformis]
Length=620

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S +++K V++SNF +ALE++   I  +DF+A+ L+ TG  SAPW+    +D     YLK 
Sbjct  25   SKWSVKQVSKSNFSAALEEISTFISDSDFIAVSLKNTGAYSAPWQRILPIDTAHTAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFAVCPFSIRGSK--LIVHPY  113



>ref|XP_009606034.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Nicotiana tomentosiformis]
Length=621

 Score = 82.0 bits (201),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S +++K V++SNF +ALE++   I  +DF+A+ L+ TG  SAPW+    +D     YLK 
Sbjct  25   SKWSVKQVSKSNFSAALEEISTFISDSDFIAVSLKNTGAYSAPWQRILPIDTAHTAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFAVCPFSIRGSK--LIVHPY  113



>ref|XP_009792348.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Nicotiana sylvestris]
Length=620

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S +++K VT+SNF + LE++   I  +DF+A+ L+ TG  SAPW+    +D     YLK 
Sbjct  25   SKWSVKQVTKSNFSATLEEISTFISDSDFIAVSLKNTGAYSAPWQRILPIDTAHTAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFAVCPFSIRGSK--LIVHPY  113



>ref|XP_009792347.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Nicotiana sylvestris]
Length=621

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = +3

Query  117  SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKV  296
            S +++K VT+SNF + LE++   I  +DF+A+ L+ TG  SAPW+    +D     YLK 
Sbjct  25   SKWSVKQVTKSNFSATLEEISTFISDSDFIAVSLKNTGAYSAPWQRILPIDTAHTAYLKA  84

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            K +AE+F V+QF VCPF     K   I HPY
Sbjct  85   KYAAERFQVLQFAVCPFSIRGSK--LIVHPY  113



>ref|XP_003622728.1| Poly(A)-specific ribonuclease PARN-like protein [Medicago truncatula]
Length=206

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +3

Query  102  RALC----SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTS-APWRDSFEL  266
            R+LC    SS + +K VT SNF  +LE+++  I  +DF+AI +E TG +S  PW      
Sbjct  16   RSLCTKISSSKWKVKQVTISNFNDSLEEIKTNISNSDFIAISMEKTGSSSTTPWHRVQPF  75

Query  267  DRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            D  +  YLK   SA++F ++QF VCPF      +  +AHPY
Sbjct  76   DTAETAYLKASQSAQRFQLLQFAVCPFSVTDSNN-LVAHPY  115



>ref|XP_010245934.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Nelumbo nucifera]
Length=623

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 2/101 (2%)
 Frame = +3

Query  87   LTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFEL  266
            L+S   A     +++K VT+SNF  +LE+++  I    F+ +  + TG  SAPWR     
Sbjct  13   LSSSKNAQKEQQWSVKQVTKSNFLESLEEIQKHIHDCHFITVSSQKTGGFSAPWRRVLPF  72

Query  267  DRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            D  D+ YLK KD+AE+F + QF VCPF  +S K   +A+PY
Sbjct  73   DTPDMAYLKAKDAAERFQLFQFAVCPFTIESSK--VVAYPY  111



>ref|XP_004161545.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Cucumis sativus]
Length=610

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            +S ++++ V  SNF  +LEDL+  I  +DF+A+ L+ TG +S PW      D +D  Y K
Sbjct  18   TSQWSVRQVRNSNFLGSLEDLKNDISDSDFIALSLQRTGSSSFPWHRLQPFDTHDTAYCK  77

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             K +AEKF ++QF +CPF     K   IAHPY
Sbjct  78   AKYAAEKFQIIQFSLCPFSVRDSK--LIAHPY  107



>ref|XP_004148964.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis sativus]
Length=610

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            +S ++++ V  SNF  +LEDL+  I  +DF+A+ L+ TG +S PW      D +D  Y K
Sbjct  18   TSQWSVRQVRNSNFLGSLEDLKNDISDSDFIALSLQRTGSSSFPWHRLQPFDTHDTAYCK  77

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             K +AEKF ++QF +CPF     K   IAHPY
Sbjct  78   AKYAAEKFQIIQFSLCPFSVRDSK--LIAHPY  107



>gb|KHG18700.1| Poly(A)-specific ribonuclease PARN-like [Gossypium arboreum]
Length=618

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF  +L++ +  + A+DFVA+ L+ TG  SAPW      D  +  YLKV+ 
Sbjct  25   WSVKQVTKSNFSDSLQEFKSHLSASDFVAVSLQNTGSFSAPWNRVSSFDSPETAYLKVRR  84

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AE+F ++QF +CPF     K    AHPY
Sbjct  85   AAERFQLLQFAICPFTISGSK--VTAHPY  111



>ref|XP_010069588.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Eucalyptus grandis]
 gb|KCW57979.1| hypothetical protein EUGRSUZ_H00715 [Eucalyptus grandis]
Length=615

 Score = 79.0 bits (193),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++  V +SNF  +LE LR  +  ADFVA+ L  TG  SAPW     LD  +  Y K + 
Sbjct  24   WSVAQVFKSNFADSLERLRAHVSGADFVAVSLRRTGWPSAPWHRVSRLDTLETAYAKARH  83

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AEKF V+QF VCPF     K   +AHPY
Sbjct  84   AAEKFQVLQFAVCPFEVGPTK--VVAHPY  110



>gb|KHG18699.1| Poly(A)-specific ribonuclease PARN-like [Gossypium arboreum]
Length=1127

 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF  +L++ +  + A+DFVA+ L+ TG  SAPW      D  +  YLKV+ 
Sbjct  25   WSVKQVTKSNFSDSLQEFKSHLSASDFVAVSLQNTGSFSAPWNRVSSFDSPETAYLKVRR  84

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AE+F ++QF +CPF     K    AHPY
Sbjct  85   AAERFQLLQFAICPFTISGSK--VTAHPY  111



>gb|EYU40665.1| hypothetical protein MIMGU_mgv1a018070mg [Erythranthe guttata]
Length=623

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 14/110 (13%)
 Frame = +3

Query  96   FSRALCSSAFA------------LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTS  239
            F R LCS   A            +K VT SNF  AL +++  I  +DFVA+ L+ TG  S
Sbjct  3    FKRFLCSHTAAARRRHHHGKQWSVKQVTNSNFSEALPEIKACIFNSDFVAVSLQKTGGHS  62

Query  240  APWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            A W+    +D  +  Y+KVKD+A +F ++QF VCPF     K   IAHP+
Sbjct  63   ATWQRILPIDTAETAYMKVKDAATRFQILQFSVCPFSVKGSK--VIAHPF  110



>ref|XP_008451634.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Cucumis melo]
Length=595

 Score = 78.2 bits (191),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K V  SNF S L DL+  I  +DF+A+ L+ TG +S PW      D  D  Y K K 
Sbjct  22   WSIKQVRNSNFHSCLGDLKNHISDSDFIALSLQRTGSSSFPWHRPQPFDTLDTAYCKAKY  81

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AEKF ++QF +CPF     K   IAHPY
Sbjct  82   AAEKFQILQFSLCPFSVRDSK--LIAHPY  108



>ref|XP_011009330.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Populus euphratica]
Length=626

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF   LED++  +  +DFVA+ L+ TG  SAPW+     D  D  YLK K 
Sbjct  28   WSIKQVTKSNFADTLEDIKSHVSNSDFVAVSLQNTGFFSAPWQRVSPFDTADTAYLKAKY  87

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +AE+F V+ F VCPF   + K    A+PY
Sbjct  88   AAERFQVLHFAVCPFTVRASK--VTAYPY  114



>ref|XP_010678977.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=622

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K V +SNF   LE+++  I  +DF+AI L+ TG  S+PW+     D  +I YLK K SA
Sbjct  29   IKQVKKSNFNQNLEEIKSHISNSDFIAISLQKTGSYSSPWQKVLPFDTPEIAYLKSKRSA  88

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            EKF ++Q  VCPF   + K    A+PY
Sbjct  89   EKFQLLQLAVCPFTLRASK--LTAYPY  113



>ref|XP_010678978.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=605

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K V +SNF   LE+++  I  +DF+AI L+ TG  S+PW+     D  +I YLK K SA
Sbjct  29   IKQVKKSNFNQNLEEIKSHISNSDFIAISLQKTGSYSSPWQKVLPFDTPEIAYLKSKRSA  88

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            EKF ++Q  VCPF   + K    A+PY
Sbjct  89   EKFQLLQLAVCPFTLRASK--LTAYPY  113



>ref|XP_008465473.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Cucumis melo]
Length=160

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            +  +++K V  SNF   L DL+  I  +DF+A  L+ TG +S PW      D  D  Y K
Sbjct  19   TDQWSIKQVRNSNFHGCLGDLKNHISDSDFIAFFLQRTGSSSFPWHRPQPFDTLDTAYCK  78

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             K +AEKF ++QF +CPF     K   IAHPY
Sbjct  79   AKYAAEKFQILQFSLCPFSVRDSK--LIAHPY  108



>ref|XP_008465472.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Cucumis melo]
Length=170

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            ++K V  SNF   L DL+  I  +DF+A  L+ TG +S PW      D  D  Y K K +
Sbjct  23   SIKQVRNSNFHGCLGDLKNHISDSDFIAFFLQRTGSSSFPWHRPQPFDTLDTAYCKAKYA  82

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            AEKF ++QF +CPF     K   IAHPY
Sbjct  83   AEKFQILQFSLCPFSVRDSK--LIAHPY  108



>ref|XP_009334241.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pyrus x bretschneideri]
Length=606

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            S  +A+K VT+SNF  +LE+ +  + ++DFVA+ L+ TG   APW      D  D  Y K
Sbjct  21   SRKWAVKKVTKSNFSESLEEFKNHLSSSDFVAVSLQKTGSYCAPWHRPQPFDTVDTSYFK  80

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
             K +AE+F ++QF  CPF   + K     HPY  V+
Sbjct  81   AKYAAERFQLLQFAACPFTLRASK--LTPHPYNFVL  114



>ref|XP_006492222.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Citrus sinensis]
Length=622

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K +T++NF  +L +++  I ++DF+A+ L+ TG  S+PW      D  D  YLK K +A
Sbjct  30   IKQITKTNFNESLSEIKNHISSSDFIAVSLQNTGSFSSPWHCVSTFDTPDTAYLKAKFAA  89

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            E+F ++QF +CPF+  + K   IA+PY
Sbjct  90   ERFQILQFAICPFKLQASK--VIAYPY  114



>ref|XP_010943605.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Elaeis guineensis]
Length=610

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSA------PWRDSFELDRYDIRY  287
            A+K +T+SNF +AL+ ++  IK ADF+A+  + TG  SA      PWR    +D  +  Y
Sbjct  13   AVKQITKSNFSAALQQIKAHIKDADFIAVSSQKTGDLSASSSHRYPWRRVLPIDVPETAY  72

Query  288  LKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            LK K +AE F ++QF VCPFR+   K   +A PY
Sbjct  73   LKAKLAAETFELLQFAVCPFRFQGSK--LVAFPY  104



>gb|KDO58560.1| hypothetical protein CISIN_1g006991mg [Citrus sinensis]
Length=622

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K +T++NF  +L +++  I ++DF+A+ L+ TG  S+PW      D  +  YLK K +A
Sbjct  29   IKQITKTNFNESLSEIKNHISSSDFIAVSLQNTGSFSSPWHRVSTFDTPETAYLKAKFAA  88

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            E+F ++QF +CPF+  + K   IA+PY
Sbjct  89   ERFQILQFAICPFKLQASK--VIAYPY  113



>gb|KDO58559.1| hypothetical protein CISIN_1g006991mg [Citrus sinensis]
Length=621

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 56/87 (64%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K +T++NF  +L +++  I ++DF+A+ L+ TG  S+PW      D  +  YLK K +A
Sbjct  29   IKQITKTNFNESLSEIKNHISSSDFIAVSLQNTGSFSSPWHRVSTFDTPETAYLKAKFAA  88

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            E+F ++QF +CPF+  + K   IA+PY
Sbjct  89   ERFQILQFAICPFKLQASK--VIAYPY  113



>ref|XP_008382764.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=628

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            S  +A+K VT+SNF  +LE+ +  + ++DFVA+ L+ TG   APW      D  D  Y K
Sbjct  44   SRKWAVKEVTKSNFSESLEEFKNHLSSSDFVAVSLQKTGSHRAPWXRPQPFDTVDTSYXK  103

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
             K +AE+F ++QF  CPF   + K     HPY  V+
Sbjct  104  AKYAAERFQLLQFAACPFTLRASK--LTLHPYNFVL  137



>emb|CDY27893.1| BnaA07g04830D [Brassica napus]
Length=616

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L    +++K VT+SNF+S+L++LR  I+++DFVA+ L+ TG  +A W     +D   
Sbjct  19   SKTLNHRRWSVKQVTKSNFKSSLDELRTSIESSDFVALSLQNTGSHAAAWHRVSAIDTPQ  78

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ + QF +CPF     K     HPY
Sbjct  79   TSYLKAKYAAERYQIFQFALCPFSLRGSK--LTVHPY  113



>ref|XP_009415962.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Musa acuminata 
subsp. malaccensis]
Length=609

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 7/95 (7%)
 Frame = +3

Query  120  AFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSA-----PWRDSFELDRYDIR  284
            A A+K VT+SNF +AL+ LR  + +ADFVAI    TG + A     PW     +D  ++ 
Sbjct  11   AGAVKQVTKSNFAAALQQLRTDVDSADFVAISCRKTGDSVASSRRHPWHRVLPIDTPEVA  70

Query  285  YLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            YLK + +AE + ++QF VCPFR    K   +A+PY
Sbjct  71   YLKARLAAESYEILQFAVCPFRLRGYK--VLAYPY  103



>ref|XP_004342975.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
Length=813

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            NV RSNF S L  ++  I   DFVAID E TG+ S     S   D    RY KV+ SA +
Sbjct  2    NVDRSNFASVLPLVKQAIAKCDFVAIDAEFTGLHSERAAASNHFDTLAERYAKVRRSASQ  61

Query  315  FAVVQFGVCPFRWDSVKHFFIAHPY  389
            F V+Q+GVC FRW   +H + A P+
Sbjct  62   FGVLQYGVCAFRWLPERHTYEAQPF  86



>ref|XP_010645230.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Vitis vinifera]
Length=610

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K VT+SNF   LE L+  I  +DFVA+ L+ TG  SAPW      D     Y K + +A
Sbjct  16   VKQVTKSNFSQTLESLKPQISQSDFVAVSLQKTGSFSAPWHRVLPFDTPQTAYSKARFAA  75

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +KF V QF VCPF   + K   +AHPY
Sbjct  76   DKFQVFQFAVCPFSVRASK--VVAHPY  100



>gb|EFW42758.2| hypothetical protein CAOG_07890 [Capsaspora owczarzaki ATCC 30864]
Length=809

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            NV RSNF S L  ++  I   DFVAID E TG+ S     S   D    RY KV+ SA +
Sbjct  2    NVDRSNFASVLPLVKQAIAKCDFVAIDAEFTGLHSERAAASNHFDTLAERYAKVRRSASQ  61

Query  315  FAVVQFGVCPFRWDSVKHFFIAHPY  389
            F V+Q+GVC FRW   +H + A P+
Sbjct  62   FGVLQYGVCAFRWLPERHTYEAQPF  86



>emb|CDY00839.1| BnaCnng00390D [Brassica napus]
Length=616

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L +  +++K VT+SNF+S+L++ R  I+++DFVA+ L+ TG  +A W     +D   
Sbjct  19   SKTLNNRRWSVKQVTKSNFKSSLDEFRTSIESSDFVALSLQNTGSYAAAWHRVSAIDTPQ  78

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ + QF +CPF     K     HPY
Sbjct  79   TSYLKAKYAAERYQIFQFALCPFSLRGSK--LTVHPY  113



>ref|XP_002527264.1| ribonuclease, putative [Ricinus communis]
 gb|EEF35108.1| ribonuclease, putative [Ricinus communis]
Length=624

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = +3

Query  102  RALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDI  281
            RA   + + +K +T+SNF  +L ++   I  +DF++I L+ TG  S+PW      D  D+
Sbjct  23   RAHTHNQWNVKQITKSNFADSLPEINSHIMCSDFISISLKTTGSFSSPWHRVSPFDTPDV  82

Query  282  RYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             YLK K +AEKF ++Q  VCPF   + K    A+PY
Sbjct  83   AYLKSKHAAEKFQILQLAVCPFTVSASK--VTAYPY  116



>ref|XP_009102413.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brassica 
rapa]
Length=616

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L    +++K VT+SNF+S+L++ R  I+++DFVA+ L+ TG  +A W     +D   
Sbjct  19   SKTLNHRRWSVKQVTKSNFKSSLDEFRSSIESSDFVALSLQNTGSHAAAWHRVSAIDTPQ  78

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ + QF +CPF     K     HPY
Sbjct  79   TSYLKAKYAAERYQIFQFALCPFSLRGSK--LTLHPY  113



>ref|XP_002320703.1| hypothetical protein POPTR_0014s01880g [Populus trichocarpa]
 gb|EEE99018.1| hypothetical protein POPTR_0014s01880g [Populus trichocarpa]
Length=544

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 61/106 (58%), Gaps = 4/106 (4%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF   L+D++  +  +DFVA+ L+ TG  SAPW+     D  D  YLK K 
Sbjct  28   WSIKQVTKSNFADTLKDIKSHVSNSDFVAVSLQNTGSFSAPWQRVSPFDTADTAYLKAKY  87

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVISTATIQFLFLLIA  440
            +AE+F V+ F VCP    + K    A+P     STA IQ    ++A
Sbjct  88   AAERFQVLHFAVCPITVRASK--VTAYPEQE--STAKIQMGNPILA  129



>ref|XP_006847462.1| hypothetical protein AMTR_s00163p00014030 [Amborella trichopoda]
 gb|ERN09043.1| hypothetical protein AMTR_s00163p00014030 [Amborella trichopoda]
Length=340

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            S  + +K +T+SNF   L  ++  I  ADF+ +  + TG  SAPWR    +D  +  Y K
Sbjct  14   SKQWRIKQITKSNFSRILPQVKERIHGADFICVSSQKTGTFSAPWRRILPIDTPETAYCK  73

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             +D+AE+F ++ F VCP  +   K   IA+PY
Sbjct  74   SRDAAERFELLHFTVCPITFQGTK--VIAYPY  103



>ref|XP_004492235.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Cicer arietinum]
Length=622

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +3

Query  102  RALCS----SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVT-SAPWRDSFEL  266
            R+LC+    S + +K VT SNF  +LE+++  I ++DF+AI +E TG +   PW      
Sbjct  14   RSLCTKVPTSKWKVKQVTTSNFNESLEEIKIHISSSDFIAISMEKTGSSLVTPWHRVQPF  73

Query  267  DRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            D  +  YLK   SA++F ++QF VCPF      +  +AHPY
Sbjct  74   DTAETAYLKASHSAQRFQLLQFAVCPFSVTDSNN-LVAHPY  113



>ref|XP_004492234.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Cicer arietinum]
Length=623

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 59/101 (58%), Gaps = 6/101 (6%)
 Frame = +3

Query  102  RALCS----SAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVT-SAPWRDSFEL  266
            R+LC+    S + +K VT SNF  +LE+++  I ++DF+AI +E TG +   PW      
Sbjct  14   RSLCTKVPTSKWKVKQVTTSNFNESLEEIKIHISSSDFIAISMEKTGSSLVTPWHRVQPF  73

Query  267  DRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            D  +  YLK   SA++F ++QF VCPF      +  +AHPY
Sbjct  74   DTAETAYLKASHSAQRFQLLQFAVCPFSVTDSNN-LVAHPY  113



>ref|XP_008348961.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Malus domestica]
Length=614

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            S  +A+K VT+SN   +LE+ +  + ++DFVA+ L+ TG   APW      D  D  Y K
Sbjct  21   SRKWAVKEVTKSNXSESLEEFKNHLSSSDFVAVSLQKTGSHRAPWXRPQPFDTVDTSYXK  80

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
             K +AE+F ++QF  CPF   + K     HPY  V+
Sbjct  81   AKYAAERFQLLQFAACPFTLRASK--LTLHPYNFVL  114



>ref|XP_008235892.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Prunus mume]
Length=385

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDS  305
            A+K VT+ NF+ +LE+ +  +  ADFVA+ L+ TG  SA W      D  D  Y K K +
Sbjct  24   AVKEVTKLNFKKSLEEFKDHLAGADFVAVSLQKTGSFSAAWHRPQPFDTADTSYCKAKYA  83

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
            AE+F ++QF  CPF   + K     HPY  V+
Sbjct  84   AERFQLLQFAACPFTLRASK--LTPHPYNFVL  113



>ref|XP_006418630.1| hypothetical protein EUTSA_v10002449mg [Eutrema salsugineum]
 gb|ESQ37066.1| hypothetical protein EUTSA_v10002449mg [Eutrema salsugineum]
Length=610

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = +3

Query  102  RALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDI  281
            + L +  +++K V +SNF+S L+++R  I ++DFVA+ L+ TG  +A W     +D   +
Sbjct  17   KTLNNGRWSVKQVKKSNFKSTLDEIRTSIDSSDFVALSLQNTGSYAAAWHRISAIDTPQM  76

Query  282  RYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  77   SYLKAKYAAERYQILQFALCPFSLRGSK--LTVHPY  110



>ref|XP_008678596.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Zea mays]
 gb|AFW62306.1| hypothetical protein ZEAMMB73_533831 [Zea mays]
 gb|AFW62307.1| hypothetical protein ZEAMMB73_533831 [Zea mays]
Length=244

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  132  KNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAE  311
            K VTR NF  A+ +LR  ++A D+VA+  + TG  +  WR +  +D  +  YLK K +AE
Sbjct  12   KQVTRQNFAEAVLELRAHLEACDYVAVAAQKTGAPTG-WRRALPVDTAETAYLKAKLAAE  70

Query  312  KFAVVQFGVCPFRW-DSVKHFFIAHPY  389
             F  +Q  VCPFR  +S     +A+PY
Sbjct  71   SFQPLQIAVCPFRQRNSYPSTLVAYPY  97



>ref|XP_006299254.1| hypothetical protein CARUB_v10015403mg [Capsella rubella]
 gb|EOA32152.1| hypothetical protein CARUB_v10015403mg [Capsella rubella]
Length=616

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +3

Query  81   AGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSF  260
            +G    S+ L    +++K V +SNF   L+++R  I+++DF+A+ L+ TG  +A W    
Sbjct  10   SGTAGNSKTLNQGRWSVKQVKKSNFHVTLDEIRTSIESSDFIALSLQNTGSYAAAWHRVS  69

Query  261  ELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             +D     YLK K +AE++ + QF +CPF     K     HPY
Sbjct  70   AIDTPQTSYLKAKYAAERYQIFQFALCPFSLQGSK--LTVHPY  110



>ref|XP_008799184.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Phoenix dactylifera]
Length=609

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSA------PWRDSFELDRYDIRY  287
            A+K +T+SNF +AL+ ++  I+ ADF+A+  + TG  +A      PWR    +D  +  Y
Sbjct  13   AVKQITKSNFSAALQQIKVHIQDADFIAVSSQKTGDLAASSSHRYPWRRILPIDIAETAY  72

Query  288  LKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            LK K +AE F ++QF VCPFR+   K   +A PY
Sbjct  73   LKAKLAAETFELLQFAVCPFRFQGSK--VVAFPY  104



>ref|XP_008799185.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Phoenix dactylifera]
Length=537

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = +3

Query  126  ALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSA------PWRDSFELDRYDIRY  287
            A+K +T+SNF +AL+ ++  I+ ADF+A+  + TG  +A      PWR    +D  +  Y
Sbjct  13   AVKQITKSNFSAALQQIKVHIQDADFIAVSSQKTGDLAASSSHRYPWRRILPIDIAETAY  72

Query  288  LKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            LK K +AE F ++QF VCPFR+   K   +A PY
Sbjct  73   LKAKLAAETFELLQFAVCPFRFQGSK--VVAFPY  104



>ref|XP_008235891.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Prunus mume]
Length=614

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +A+K VT+ NF+ +LE+ +  +  ADFVA+ L+ TG  SA W      D  D  Y K K 
Sbjct  23   WAVKEVTKLNFKKSLEEFKDHLAGADFVAVSLQKTGSFSAAWHRPQPFDTADTSYCKAKY  82

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
            +AE+F ++QF  CPF   + K     HPY  V+
Sbjct  83   AAERFQLLQFAACPFTLRASK--LTPHPYNFVL  113



>ref|XP_008364676.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Malus domestica]
Length=628

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +A+K VT+SNF  +L + +  + ++DFVA  L+ TG   APWR     D  D  Y K K 
Sbjct  41   WAVKEVTKSNFSESLXEFKDHLSSSDFVAFSLQKTGSYRAPWRHPQPFDTADTSYFKAKY  100

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVISTATIQFLFLLIAVH  446
            +AE+F ++QF  CP+   + K     +PY  V+       + LL +V 
Sbjct  101  AAERFQLLQFAACPYTLRASK--LTPYPYNFVLFPRDELMMGLLXSVQ  146



>emb|CBI35579.3| unnamed protein product [Vitis vinifera]
Length=6458

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +K VT+SNF   LE L+  I  +DFVA+ L+ TG  SAPW      D     Y K + +A
Sbjct  16   VKQVTKSNFSQTLESLKPQISQSDFVAVSLQKTGSFSAPWHRVLPFDTPQTAYSKARFAA  75

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHP  386
            +KF V QF VCPF   + K   +AHP
Sbjct  76   DKFQVFQFAVCPFSVRASK--VVAHP  99



>ref|XP_002444414.1| hypothetical protein SORBIDRAFT_07g021600 [Sorghum bicolor]
 gb|EES13909.1| hypothetical protein SORBIDRAFT_07g021600 [Sorghum bicolor]
Length=599

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +3

Query  132  KNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAE  311
            K VTR NF  A+ +LR  ++A D+VA+  + TG  +  WR +  +D  +  YLK K +AE
Sbjct  12   KQVTRQNFAEAVRELRAHLEACDYVAVAAQKTGAPTG-WRRALPVDTAETAYLKAKLAAE  70

Query  312  KFAVVQFGVCPFRW-DSVKHFFIAHPY  389
             F  +QF VCPFR   S     +A+PY
Sbjct  71   SFQPLQFAVCPFRLRSSSPSTLVAYPY  97



>ref|WP_028831969.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=598

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            +VT  NF    E +   I   DF AID EMTG+ S+    +   D Y  RYL V+DSA K
Sbjct  2    DVTSLNFAEISEGMCAAIDGCDFCAIDCEMTGLNSSSGTKNSPSDNYQARYLSVRDSAAK  61

Query  315  FAVVQFGVCPFRWDSVKHFFIAHPY  389
            F ++Q+G+  F++D   + ++  PY
Sbjct  62   FLLLQYGITTFKFDQTNNRYVCRPY  86



>ref|XP_009358962.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Pyrus x bretschneideri]
Length=615

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +3

Query  87   LTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFEL  266
            L+S +    S  +A+K VT+SNF  +L + +  + ++DFVA+ L+ TG   APW+     
Sbjct  13   LSSTTTTNVSKKWAVKEVTKSNFSESLVEFKDHLSSSDFVAVSLQKTGSYRAPWQRPQPF  72

Query  267  DRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI  401
            D  +  Y K K +AE+F ++QF  CPF   + K     +PY  V+
Sbjct  73   DTAETSYCKAKYAAERFQLLQFAACPFTLRASK--LTPYPYNFVL  115



>ref|XP_004348604.1| ribonuclease, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR22146.1| ribonuclease, putative [Acanthamoeba castellanii str. Neff]
Length=546

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VT+SNF + L D++  I A+DF++ DLE TG+T   + D+  +D  + RY K+K+++  F
Sbjct  3    VTKSNFAAVLPDVKEAIAASDFLSFDLEFTGLTLGGYLDNHPVDLLEERYKKLKENSSAF  62

Query  318  AVVQFGVCPFRWDSVKHFFIA  380
             + QFG+  F WD+ ++ ++A
Sbjct  63   TITQFGLSAFTWDATENKYVA  83



>ref|XP_010514159.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=619

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L    +++K V +SNF   L+ +R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   SKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQNTGSYTAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYTAERYQILQFALCPFSLHGTK--LTVHPY  110



>ref|XP_010466956.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Camelina sativa]
Length=619

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L    +++K V +SNF   L+ +R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   SKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQNTGSYAAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYAAERYQILQFALCPFSLQGSK--LTVHPY  110



>ref|XP_007140707.1| hypothetical protein PHAVU_008G135000g [Phaseolus vulgaris]
 gb|ESW12701.1| hypothetical protein PHAVU_008G135000g [Phaseolus vulgaris]
Length=617

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 7/104 (7%)
 Frame = +3

Query  102  RALC-SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAP-WRDSFELDRY  275
            R LC SS + +K VT SNFE +L++++  I ++D+VA+ +  TG  S P W      D  
Sbjct  10   RFLCTSSKWKVKQVTTSNFEESLQEIKTHISSSDYVAVSMARTGSPSPPSWLRPLPFDTA  69

Query  276  DIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHF--FIAHPYVTVI  401
               Y K + +A +F V+ F VCPF   SV H    +AHPY  V+
Sbjct  70   QTAYSKARRAAHRFQVLHFAVCPF---SVSHSDKLLAHPYNFVL  110



>ref|XP_007049586.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 3 [Theobroma 
cacao]
 gb|EOX93743.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 3 [Theobroma 
cacao]
Length=508

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF  +L D    + ++DFVA+  + TG  SA W      D  +  YLK + 
Sbjct  25   WSVKQVTKSNFNDSLHDFHSHLSSSDFVAVSFQNTGSFSAAWHRVSSFDCPETAYLKARR  84

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +A++F ++QF VCPF     K    AHPY
Sbjct  85   AADRFQLLQFAVCPFTISGSK--VTAHPY  111



>ref|XP_010488642.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Camelina 
sativa]
Length=615

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (56%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            S+ L    +++K V +SNF   L+ +R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   SKTLNQGRWSVKQVKKSNFHVTLDKIRASIDSSDFIALSLQNTGSYAAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYAAERYQILQFALCPFSLQGSK--LTVHPY  110



>ref|NP_001061902.1| Os08g0440200 [Oryza sativa Japonica Group]
 dbj|BAF23816.1| Os08g0440200 [Oryza sativa Japonica Group]
Length=291

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
             VT+ NF  A++DL   ++A D+VAI  + TG  +  WR +  +D  +  YLK K +AE 
Sbjct  15   QVTKRNFAEAVQDLAAHVEACDYVAIAAQRTGAPTG-WRRALPVDTPETAYLKAKLAAES  73

Query  315  FAVVQFGVCPFRWDSV-KHFFIAHPY  389
            F  + F +CPFR D+      +A+PY
Sbjct  74   FQPLHFAICPFRVDATSPSTLVAYPY  99



>ref|XP_007049585.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 2 [Theobroma 
cacao]
 gb|EOX93742.1| Poly(A)-specific ribonuclease PARN-like, putative isoform 2 [Theobroma 
cacao]
Length=623

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF  +L D    + ++DFVA+  + TG  SA W      D  +  YLK + 
Sbjct  25   WSVKQVTKSNFNDSLHDFHSHLSSSDFVAVSFQNTGSFSAAWHRVSSFDCPETAYLKARR  84

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +A++F ++QF VCPF     K    AHPY
Sbjct  85   AADRFQLLQFAVCPFTISGSK--VTAHPY  111



>ref|XP_007049584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein, putative isoform 1 [Theobroma cacao]
 gb|EOX93741.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein, putative isoform 1 [Theobroma cacao]
Length=623

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKD  302
            +++K VT+SNF  +L D    + ++DFVA+  + TG  SA W      D  +  YLK + 
Sbjct  25   WSVKQVTKSNFNDSLHDFHSHLSSSDFVAVSFQNTGSFSAAWHRVSSFDCPETAYLKARR  84

Query  303  SAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +A++F ++QF VCPF     K    AHPY
Sbjct  85   AADRFQLLQFAVCPFTISGSK--VTAHPY  111



>ref|NP_189170.1| poly(A)-specific ribonuclease PARN-like protein [Arabidopsis 
thaliana]
 sp|Q8W4C3.1|PARNL_ARATH RecName: Full=Poly(A)-specific ribonuclease PARN-like; AltName: 
Full=Polyadenylate-specific ribonuclease-like protein [Arabidopsis 
thaliana]
 gb|AAL32742.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37744.1| At3g25430 [Arabidopsis thaliana]
 gb|AEE77010.1| poly(A)-specific ribonuclease PARN-like protein [Arabidopsis 
thaliana]
Length=618

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            ++ L    +++K V +SNF   L+++R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   TKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQNTGSYAAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYAAERYQILQFALCPFSLQGSK--LTVHPY  110



>ref|XP_001433738.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK66341.1| unnamed protein product [Paramecium tetraurelia]
Length=526

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            N+TR N+   L  ++  IK A+++A+D E TGV ++    +  LD + +RY KVK++  +
Sbjct  2    NLTRYNYLHNLAFIQQRIKEANYIALDFEFTGVLASSLLRNSLLDSFQMRYWKVKENVRR  61

Query  315  FAVVQFGVCPFRWDSVKHFFIAHPY  389
            F  +Q G+C FR D+  +  IAHP+
Sbjct  62   FLPIQMGLCTFREDANSNNVIAHPF  86



>dbj|BAB01314.1| unnamed protein product [Arabidopsis thaliana]
Length=1115

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            ++ L    +++K V +SNF   L+++R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   TKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQNTGSYAAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYAAERYQILQFALCPFSLQGSK--LTVHPY  110



>ref|XP_002883605.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59864.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1055

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  99   SRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYD  278
            ++ L    +++K V +SNF   L+++R  I ++DF+A+ L+ TG  +A W     +D   
Sbjct  16   TKTLNQGRWSVKQVKKSNFHVTLDEIRTSIDSSDFIALSLQNTGSYAAAWHRVSAIDTPQ  75

Query  279  IRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
              YLK K +AE++ ++QF +CPF     K     HPY
Sbjct  76   TSYLKAKYAAERYQILQFALCPFSLHGSK--LTVHPY  110



>gb|KFK39841.1| hypothetical protein AALP_AA3G294900 [Arabis alpina]
Length=795

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query  120  AFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVK  299
             +++K V +SNF SAL+ +R  I ++DFVA+ L+ TG  +A W     +D  +  Y K K
Sbjct  196  GWSVKQVKKSNFSSALDQIRTSIDSSDFVALSLQNTGSYAAAWHRVSAIDTPETSYFKAK  255

Query  300  DSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             +AE++ + QF +CPF           HPY
Sbjct  256  YAAERYQIFQFALCPFSLGGST--LTVHPY  283



>gb|KFK39842.1| hypothetical protein AALP_AA3G294900 [Arabis alpina]
Length=791

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = +3

Query  120  AFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVK  299
             +++K V +SNF SAL+ +R  I ++DFVA+ L+ TG  +A W     +D  +  Y K K
Sbjct  196  GWSVKQVKKSNFSSALDQIRTSIDSSDFVALSLQNTGSYAAAWHRVSAIDTPETSYFKAK  255

Query  300  DSAEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
             +AE++ + QF +CPF           HPY
Sbjct  256  YAAERYQIFQFALCPFSLGGST--LTVHPY  283



>ref|XP_007549755.1| PREDICTED: poly(A)-specific ribonuclease PARN [Poecilia formosa]
Length=683

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C FR+DS K  +I  P+
Sbjct  63   DFLMFQFGLCTFRYDSAKSKYITKPF  88



>ref|XP_008436164.1| PREDICTED: poly(A)-specific ribonuclease PARN [Poecilia reticulata]
Length=683

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C FR+DS K  +I  P+
Sbjct  63   DFLMFQFGLCTFRYDSAKSKYITKPF  88



>ref|XP_005813387.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Xiphophorus 
maculatus]
Length=682

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRQNFKDCLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C FR+DS K  +I  P+
Sbjct  63   DFLMFQFGLCTFRYDSSKSKYITKPF  88



>ref|XP_003572239.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brachypodium 
distachyon]
 ref|XP_010235167.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Brachypodium 
distachyon]
Length=596

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = +3

Query  132  KNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAE  311
            K VT+ NF  AL++L   +K  D+VA+    TG  +  WR +  +D  +  YLK K +AE
Sbjct  9    KQVTKRNFPEALQELAAHLKECDYVAVAALKTGAPTG-WRRALPVDTAETAYLKAKLAAE  67

Query  312  KFAVVQFGVCPFRWDSVKH-FFIAHPY  389
             F  +   VCPFR+D+  H   +A+PY
Sbjct  68   SFQPLHIAVCPFRFDATSHSTVVAYPY  94



>gb|EEC83639.1| hypothetical protein OsI_29373 [Oryza sativa Indica Group]
Length=602

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VT+ NF  A++DL   ++A D+VAI  + TG  +  WR +  +D  +  YLK K +AE F
Sbjct  17   VTKRNFAEAVQDLAAHVEACDYVAIAAQRTGAPTG-WRRALPVDTPETAYLKAKLAAESF  75

Query  318  AVVQFGVCPFRWDSVK-HFFIAHPY  389
              + F +CPFR D+      +A+PY
Sbjct  76   QPLHFAICPFRVDATSPSTLVAYPY  100



>gb|EEE68767.1| hypothetical protein OsJ_27469 [Oryza sativa Japonica Group]
Length=601

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VT+ NF  A++DL   ++A D+VAI  + TG  +  WR +  +D  +  YLK K +AE F
Sbjct  16   VTKRNFAEAVQDLAAHVEACDYVAIAAQRTGAPTG-WRRALPVDTPETAYLKAKLAAESF  74

Query  318  AVVQFGVCPFRWDSVK-HFFIAHPY  389
              + F +CPFR D+      +A+PY
Sbjct  75   QPLHFAICPFRVDATSPSTLVAYPY  99



>emb|CEI86889.1| hypothetical protein RMCBS344292_01314 [Rhizopus microsporus]
Length=527

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + +S+FE  L  ++  I  ADF+AID E TG+T  P  +    D    RY K++ S E+F
Sbjct  3    ILKSDFEQKLPFIKKAILEADFIAIDCEFTGLTP-PHININNTDDLAQRYSKIRSSVEEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             +VQ+GVC F+ D     FIA P+
Sbjct  62   TIVQYGVCTFKRDKETGDFIARPF  85



>emb|CEI93743.1| hypothetical protein RMCBS344292_07971 [Rhizopus microsporus]
Length=534

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + +S+FE  L  ++  I  ADF+AID E TG+T  P  +    D    RY K++ S E+F
Sbjct  3    ILKSDFEQKLPFIKKAILEADFIAIDCEFTGLTP-PHININNADDLAQRYSKIRSSVEEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             +VQ+GVC F+ D     FIA P+
Sbjct  62   TIVQYGVCTFKRDKETGDFIARPF  85



>emb|CEI93744.1| hypothetical protein RMCBS344292_07971 [Rhizopus microsporus]
Length=535

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + +S+FE  L  ++  I  ADF+AID E TG+T  P  +    D    RY K++ S E+F
Sbjct  3    ILKSDFEQKLPFIKKAILEADFIAIDCEFTGLTP-PHININNADDLAQRYSKIRSSVEEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             +VQ+GVC F+ D     FIA P+
Sbjct  62   TIVQYGVCTFKRDKETGDFIARPF  85



>emb|CEG72444.1| hypothetical protein RMATCC62417_08002 [Rhizopus microsporus]
Length=534

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + +S+FE  L  ++  I  ADF+AID E TG+T  P  +    D    RY K++ S E+F
Sbjct  3    ILKSDFEQKLPFIKKAILEADFIAIDCEFTGLTP-PHININNADDLAQRYSKIRSSVEEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             +VQ+GVC F+ D     FIA P+
Sbjct  62   TIVQYGVCTFKRDKETGDFIARPF  85



>ref|XP_006681993.1| hypothetical protein BATDEDRAFT_36029 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77459.1| hypothetical protein BATDEDRAFT_36029 [Batrachochytrium dendrobatidis 
JAM81]
Length=581

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            V +SNFE  L+ +R  I+ ADF+A+D E TG+   P      LD    RYLK + +A  F
Sbjct  3    VVQSNFEEVLDSVREAIENADFIAVDTEFTGLGLTPNERLSLLDTPQERYLKHRSAARLF  62

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
              +Q G+  F+WD+ +  +++ P+
Sbjct  63   EPIQIGLAAFKWDAEQGVYMSKPF  86



>ref|XP_001622538.1| hypothetical protein NEMVEDRAFT_v1g1365 [Nematostella vectensis]
 gb|EDO30438.1| predicted protein [Nematostella vectensis]
Length=459

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + RSNF   L  +   I+ A F+A+D E +G+ S  W+    LD    RY K+K+++  F
Sbjct  3    ILRSNFSQCLPIVSEAIEEASFLAVDAEFSGLNSH-WKQQNALDSPQERYTKLKNTSHDF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPYVTVI-------STATIQFL  425
             +VQFG+C F W+   + +IA P+   I       ST  ++FL
Sbjct  62   IIVQFGLCAFIWNENLNKYIAKPFNFYIFPRQIHRSTPDVRFL  104



>emb|CEG77716.1| hypothetical protein RMATCC62417_12419 [Rhizopus microsporus]
Length=325

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + +S+FE  L  ++  I  ADF+AID E TG+T  P  +    D    RY K++ S E+F
Sbjct  3    ILKSDFEQKLPFIKKAILEADFIAIDCEFTGLT-PPHININNADDLAQRYSKIRSSVEEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             +VQ+GVC F+ D     FIA P+
Sbjct  62   TIVQYGVCTFKRDKETGDFIARPF  85



>emb|CCX06373.1| Similar to Poly(A)-specific ribonuclease PARN; acc. no. Q90ZA1 
[Pyronema omphalodes CBS 100304]
Length=551

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 15/126 (12%)
 Frame = +3

Query  78   HAGLTSFSRALCSSAF----------ALKNVTRSNFESA----LEDLRGLIKAADFVAID  215
            HA    + RA  +S F          A   VTR  FE+     L +++  IK ADFV+ID
Sbjct  19   HARCFHWRRATTASKFWNLLFPRPTVATMEVTRELFENERYALLREIKAEIKKADFVSID  78

Query  216  LEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVT  395
            LE +GV+  P     +    + RY + K++A K+ V+Q G+C  R+D  +  FIA P+  
Sbjct  79   LEFSGVSKTPSPHGRK-HTLEERYQQSKEAASKYQVLQLGICIVRFDKKEQSFIARPFTF  137

Query  396  VISTAT  413
             +S  T
Sbjct  138  PVSAMT  143



>ref|XP_010532929.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Tarenaya 
hassleriana]
Length=617

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 5/103 (5%)
 Frame = +3

Query  39   MIRALSKTLISAPHAGLTSFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFVAIDL  218
            M R    +  +    G T   R  C+     K V +SNF+  ++++R  I ++DFVA+ L
Sbjct  1    MQRRFLSSFPAGAGGGKTLNHRRWCA-----KQVKKSNFQDTIDEVRTCIDSSDFVAVSL  55

Query  219  EMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPF  347
            + TG  +A W     LD  +  Y+K K +AE++ + QF +CPF
Sbjct  56   QNTGSYAAAWHRVSALDTPETAYMKAKYAAERYQIFQFALCPF  98



>ref|XP_010792702.1| PREDICTED: poly(A)-specific ribonuclease PARN [Notothenia coriiceps]
Length=368

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+ +L+ +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRQNFKDSLKTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F +D  K  +I  P+
Sbjct  63   DFLLFQFGICTFTYDQAKSKYIIKPF  88



>ref|XP_003532241.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Glycine max]
 gb|KHN10920.1| Poly(A)-specific ribonuclease PARN-like [Glycine soja]
Length=619

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAP-WRDSFELDRYDIRYLKVKDS  305
            +K VT SNF+ +L++++  I  +DFVAI +  TG  SAP W      D     Y K + +
Sbjct  22   VKQVTTSNFQESLQEIKTHISNSDFVAISMGKTGSPSAPSWLRPLPFDTAQTAYSKARRA  81

Query  306  AEKFAVVQFGVCPFRWDSVKHFFIAHPY  389
            A++F ++ F VCPF   S     +AHPY
Sbjct  82   AQRFQLLHFAVCPFSV-SRSDKLLAHPY  108



>ref|XP_001634577.1| predicted protein [Nematostella vectensis]
 gb|EDO42514.1| predicted protein [Nematostella vectensis]
Length=640

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + RSNF   L  +   I+ A F+A+D E +G+ S  W+    LD    RY K+K+++  F
Sbjct  45   ILRSNFSQCLPIVSEAIEEASFLAVDAEFSGLNSH-WKQQNALDSPQERYTKLKNTSHDF  103

Query  318  AVVQFGVCPFRWDSVKHFFIAHPYVTVI-------STATIQFL  425
             +VQFG+C F W+   + +IA P+   I       ST  ++FL
Sbjct  104  IIVQFGLCAFIWNENLNKYIAKPFNFYIFPRQIHRSTPDVRFL  146



>ref|XP_011113705.1| hypothetical protein H072_7980 [Dactylellina haptotyla CBS 200.50]
 gb|EPS38216.1| hypothetical protein H072_7980 [Dactylellina haptotyla CBS 200.50]
Length=469

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 7/104 (7%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSF--ELDR-----YDIRYLK  293
            +VTR+NF+  L ++  LI+ ++F+A D E +G+ S   R  F  +++R      + RY  
Sbjct  2    DVTRANFKDQLPEILKLIEESEFIAFDFEYSGLLSEHGRGPFPGKIERGRKPTMEERYQL  61

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHFFIAHPYVTVISTATIQFL  425
             K+SAE++ + Q G+C   WD+  + ++  P+   I+ A I  L
Sbjct  62   SKESAERYCIFQMGICCLTWDTKSNRYLGRPFNFYITPAVIPSL  105



>ref|XP_008292120.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X2 
[Stegastes partitus]
Length=681

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++ +L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRRNYKDSLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQTKSKYITKPF  88



>ref|XP_008292118.1| PREDICTED: poly(A)-specific ribonuclease PARN-like isoform X1 
[Stegastes partitus]
Length=682

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++ +L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRRNYKDSLSTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQTKSKYITKPF  88



>ref|XP_006804394.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Neolamprologus 
brichardi]
Length=679

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQAKSKYITKPF  88



>ref|XP_004973547.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Setaria italica]
Length=599

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  132  KNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAE  311
            K VTR NF  ++ +L   +++ D+V +  + TG  +  WR +  +D  +  YLK K +AE
Sbjct  12   KQVTRRNFAESVRELGAHLESCDYVTVAAQKTGAPTG-WRRALPVDTAETVYLKAKLAAE  70

Query  312  KFAVVQFGVCPFRW-DSVKHFFIAHPY  389
             F  +Q  VCPFR  DS     +A+PY
Sbjct  71   SFQPLQIAVCPFRLRDSSPSTLVAYPY  97



>gb|EIE81980.1| hypothetical protein RO3G_06685 [Rhizopus delemar RA 99-880]
Length=622

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            V +S+FE  L  ++  +  ADF+++D E TG+T  P    F+ D    RY K+K   ++F
Sbjct  3    VLKSDFEKILPVIKEALLEADFISVDAEFTGLTP-PNIQMFQTDDLTQRYNKIKSCVQEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++Q+GVC F+ D     FIA P+
Sbjct  62   TIIQYGVCAFKRDKETGDFIAKPF  85



>ref|XP_003457808.1| PREDICTED: poly(A)-specific ribonuclease PARN [Oreochromis niloticus]
Length=679

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQAKSKYITKPF  88



>ref|XP_005744604.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Pundamilia 
nyererei]
Length=676

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQAKSKYITKPF  88



>ref|XP_005947045.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Haplochromis 
burtoni]
Length=679

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKDCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQAKSKYITKPF  88



>gb|EXX68717.1| hypothetical protein RirG_102580 [Rhizophagus irregularis DAOM 
197198w]
Length=296

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + ++NF      ++  I+ ADF+AID E+TG+  +  R     D    RY KV+ +A KF
Sbjct  3    IIKNNFHELFPIVQEAIEGADFIAIDTELTGLNESIERIK-TFDDPQSRYTKVRIAATKF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++QFG+C F +   ++ FIA P+
Sbjct  62   LIIQFGICTFTYSEAENTFIARPF  85



>ref|XP_010731915.1| PREDICTED: poly(A)-specific ribonuclease PARN [Larimichthys crocea]
Length=683

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRRNFKECLNTVYTAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDHTKSKYIIKPF  88



>gb|EPB82776.1| hypothetical protein HMPREF1544_10479 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=558

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            ++R  F   L ++   IK  DF+AID E++G+   P   S  L     RY + K++ E+F
Sbjct  3    ISRQQFPQKLPEVEKAIKECDFMAIDTELSGLHRPPT--SVRLYNMADRYQEYKEATERF  60

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++QFG+C F WD     +IA P+
Sbjct  61   LIIQFGLCTFTWDEPAGRYIAKPF  84



>gb|ERZ96763.1| hypothetical protein GLOINDRAFT_330565 [Rhizophagus irregularis 
DAOM 181602]
Length=689

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + ++NF      ++  I+ ADF+AID E+TG+  +  R     D    RY KV+ +A KF
Sbjct  3    IIKNNFHELFPIVQEAIEGADFIAIDTELTGLNESIERIK-TFDDPQSRYTKVRIAATKF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++QFG+C F +   ++ FIA P+
Sbjct  62   LIIQFGICTFTYSEAENTFIARPF  85



>ref|XP_003972409.1| PREDICTED: LOW QUALITY PROTEIN: poly(A)-specific ribonuclease 
PARN-like [Takifugu rubripes]
Length=559

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    LTRRNFKECLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  K  +I  P+
Sbjct  63   DFLLFQFGLCTFKYDQTKSKYIIKPF  88



>gb|AAQ97826.1| poly(A)-specific ribonuclease [Danio rerio]
Length=660

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L ++   ++ ADF++ID E TG++  P   +    LD  + RY K++  + 
Sbjct  3    VTRQNFKEVLPEVCNAVQEADFISIDGEFTGISDGPSVSALTNGLDTPEERYTKLRKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFGVC FR+D  +  +I   +
Sbjct  63   NFLLFQFGVCTFRYDQNQSTYITKAF  88



>sp|Q7ZU92.2|PARN_DANRE RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Polyadenylate-specific 
ribonuclease [Danio rerio]
Length=660

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L ++   ++ ADF++ID E TG++  P   +    LD  + RY K++  + 
Sbjct  3    VTRQNFKEVLPEVCNAVQEADFISIDGEFTGISDGPSVSALTNGLDTPEERYTKLRKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFGVC FR+D  +  +I   +
Sbjct  63   NFLLFQFGVCTFRYDQNQSTYITKAF  88



>ref|NP_957382.1| poly(A)-specific ribonuclease PARN [Danio rerio]
 gb|AAH50496.1| Zgc:56067 [Danio rerio]
Length=647

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR NF+  L ++   ++ ADF++ID E TG++  P   +    LD  + RY K++  + 
Sbjct  3    VTRQNFKEVLPEVCNAVQEADFISIDGEFTGISDGPSVSALTNGLDTPEERYTKLRKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFGVC FR+D  +  +I   +
Sbjct  63   NFLLFQFGVCTFRYDQNQSTYITKAF  88



>ref|XP_008314796.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Cynoglossus 
semilaevis]
Length=685

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++S L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKSCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F +D     +I  P+
Sbjct  63   DFLLFQFGLCTFTYDQTNSKYIIKPF  88



>ref|XP_008314795.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Cynoglossus 
semilaevis]
Length=686

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTR N++S L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    VTRKNYKSCLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F +D     +I  P+
Sbjct  63   DFLLFQFGLCTFTYDQTNSKYIIKPF  88



>emb|CBK19633.2| unnamed protein product [Blastocystis hominis]
Length=567

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 26/80 (33%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            ++T +NFE  L  +   I+ ++F+A DLE +G    P+      D ++ RY K +  AE 
Sbjct  11   DITVNNFEECLPYVLETIRKSEFIAFDLEFSGTDYKPYFRCVYADTFETRYAKYRVDAEN  70

Query  315  FAVVQFGVCPFRWDSVKHFF  374
            +  ++ G+C F WD  KH++
Sbjct  71   YYPIELGICCFYWDDEKHWY  90



>gb|KFH62568.1| hypothetical protein MVEG_11961 [Mortierella verticillata NRRL 
6337]
Length=730

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            + + NFE++L  L+  I+  DFVA+D EMTG+ + P       D    RY KV  SA  F
Sbjct  3    IIKDNFEASLPMLKKAIEECDFVAMDTEMTGL-ALPINVPKNTDSLSTRYQKVSTSAGSF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             V+Q G+C F W      + A P+
Sbjct  62   LVIQLGICTFTWRDEIGGYEARPF  85



>ref|XP_010901706.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Esox lucius]
Length=754

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +3

Query  123  FALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKV  296
            FA   VTR NF+ +L  +   I+ ADF+AID E +G++  P   +    LD  + RY+K+
Sbjct  72   FAGMEVTRQNFKDSLTTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYMKL  131

Query  297  KDSAEKFAVVQFGVCPFRWDSVKHFFI  377
            K  +  F + QFG+C F +D     ++
Sbjct  132  KKHSMDFLLFQFGLCTFTYDEAASEYV  158



>ref|XP_011119302.1| hypothetical protein AOL_s00043g514 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX52124.1| hypothetical protein AOL_s00043g514 [Arthrobotrys oligospora 
ATCC 24927]
Length=474

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDI---RYLKVKDSA  308
            + R++F+  L +L  LI+  DF+A+D E +GV S P R   +++       RY ++ +SA
Sbjct  15   IDRADFDEELPNLLKLIEDCDFIALDFEFSGVGSDPRRGQVDMNHKPTLAERYKELCESA  74

Query  309  EKFAVVQFGVCPFRWD  356
            E + ++Q G+CP +W+
Sbjct  75   EAYRIMQMGICPVKWE  90



>gb|EIE80249.1| hypothetical protein RO3G_04954 [Rhizopus delemar RA 99-880]
Length=747

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 13/135 (10%)
 Frame = +3

Query  45   RALSKTLISA-PHAGLT-----SFSRALCSSAFALKNVTRSNFESALEDLRGLIKAADFV  206
            R ++ TLI A P   L       F    C++  +     R N E AL  +   IK  D +
Sbjct  165  RGITVTLIRAFPIHSLNFLIPLVFRTLFCNTKISASQNDR-NTEFALSIVEEAIKECDVI  223

Query  207  AIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKFAVVQFGVCPFRWDSVKHFFIAHP  386
            AID E++G+   P  +   L     RY++ K++ E+F V+QFG+C F+WD+    +IA P
Sbjct  224  AIDTELSGL-HRPLNNK-RLYSLQDRYIEYKEATERFIVIQFGLCTFKWDASSGRYIAKP  281

Query  387  YVTVI----STATIQ  419
            +   I    +T T+Q
Sbjct  282  FNFYIFPTSTTGTVQ  296



>gb|KDR21432.1| Poly(A)-specific ribonuclease PARN-like domain-containing protein 
1 [Zootermopsis nevadensis]
Length=565

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 3/115 (3%)
 Frame = +3

Query  129  LKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSA  308
            +  +TR+NFE     +   ++ A F+A+D E TG+ S P   +   D  + RY K++ S 
Sbjct  1    MSEITRNNFEQKYPKIVESLRNAVFIAVDTEFTGLLSDPDFKASLFDTSNERYDKLRRSV  60

Query  309  EKFAVVQFGVCPFRWDSVKHFFIAHPYVTVI---STATIQFLFLLIAVHDEFICK  464
            + F ++Q G+C FR+   K+ + A  Y   I   S A++   F+  A   EF+C+
Sbjct  61   QHFIIMQIGICTFRFVQDKNKYEASRYTFYIFPKSFASVDNKFMCQASSLEFLCQ  115



>gb|EPB89144.1| hypothetical protein HMPREF1544_04011 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=680

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 44/84 (52%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            V R  FE  L  +   +  ADF+AID E TG+ S P       D    RY K+K   ++F
Sbjct  3    VLRKEFEDTLPLIEEAMNEADFIAIDTEFTGL-STPDVQFQHADEIATRYSKLKSCVQEF  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++Q+GVC F+ D     +IA P+
Sbjct  62   TIIQYGVCAFKRDPSNGNYIAKPF  85



>emb|CAF98128.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=614

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 47/83 (57%), Gaps = 2/83 (2%)
 Frame = +3

Query  147  SNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAEKFA  320
            ++F+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  +  F 
Sbjct  1    TDFKECLNTVYSAIEEADFLAIDGEFSGISDGPNVSALTNGLDTPEERYTKLKKHSMDFL  60

Query  321  VVQFGVCPFRWDSVKHFFIAHPY  389
            + QFGVC F++D  K  +I  P+
Sbjct  61   LFQFGVCTFKYDQTKSKYIIKPF  83



>ref|XP_003228705.2| PREDICTED: poly(A)-specific ribonuclease PARN [Anolis carolinensis]
Length=897

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    VTRSNFKDNLNKVYAAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDLAESKYIMKSF  88



>dbj|BAK06461.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 2/93 (2%)
 Frame = +3

Query  114  SSAFALKNVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLK  293
            ++A + K VTR NF  A+ +L   +K  D+VAI    TG  +  WR +  +D  +  YLK
Sbjct  2    AAAASAKQVTRRNFPEAVRELAAHVKECDYVAIAALKTGAPTV-WRRALPVDTAETAYLK  60

Query  294  VKDSAEKFAVVQFGVCPFRWDSVKHF-FIAHPY  389
             K ++E F  +   VCPFR  S      +A+P+
Sbjct  61   AKFASESFQPLHIAVCPFRLGSASGSDVVAYPH  93



>ref|NP_001081143.1| poly(A)-specific ribonuclease PARN [Xenopus laevis]
 gb|AAH68919.1| Parn-A protein [Xenopus laevis]
Length=631

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    ITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +F + QFG+C F +D+ +  ++   +
Sbjct  63   EFLLFQFGLCTFNYDNTEAKYLMKSF  88



>sp|Q90ZA1.1|PARN_XENLA RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Deadenylating 
nuclease; AltName: Full=Deadenylation nuclease; 
AltName: Full=Polyadenylate-specific ribonuclease; AltName: 
Full=parn-A [Xenopus laevis]
 gb|AAK64218.1|AF309688_1 poly(A)-specific ribonuclease [Xenopus laevis]
Length=631

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    ITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +F + QFG+C F +D+ +  ++   +
Sbjct  63   EFLLFQFGLCTFNYDNTEAKYLMKSF  88



>gb|KGL77093.1| Poly(A)-specific ribonuclease PARN, partial [Tinamus guttatus]
Length=622

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    VTRSNFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHEEEKYIMKSF  88



>ref|XP_002949475.1| hypothetical protein VOLCADRAFT_120753 [Volvox carteri f. nagariensis]
 gb|EFJ49494.1| hypothetical protein VOLCADRAFT_120753 [Volvox carteri f. nagariensis]
Length=570

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/73 (41%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            +V R NF+  L  +R  I  A FVAID E TG+      +   LD Y+ RY ++  SA+ 
Sbjct  48   DVNRHNFKDVLPIMRSAIHEATFVAIDAEFTGLFPEGVSED-PLDDYEERYKRLLASADN  106

Query  315  FAVVQFGVCPFRW  353
            FA+ QFG+  F+W
Sbjct  107  FAICQFGLSAFKW  119



>ref|XP_006637035.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Lepisosteus 
oculatus]
Length=815

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TR NF+  L  +   I+ ADF+AID E +G++  P   +    LD  + RY K+K  + 
Sbjct  3    ITRKNFKERLNAIYSAIEEADFLAIDGEFSGISDGPSVSALTNGLDTPEERYRKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  ++   +
Sbjct  63   DFLLFQFGLCTFKYDHSESKYVMKAF  88



>ref|XP_010212713.1| PREDICTED: poly(A)-specific ribonuclease PARN [Tinamus guttatus]
Length=638

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    VTRSNFKDNLNKVYEAIEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHEEEKYIMKSF  88



>gb|AAH73682.1| Unknown (protein for IMAGE:5572400), partial [Xenopus laevis]
Length=517

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    ITRSNFKDTLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
            +F + QFG+C F +D+ +  ++   +
Sbjct  63   EFLLFQFGLCTFNYDNTEAKYLMKSF  88



>ref|XP_008139791.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Eptesicus 
fuscus]
Length=634

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTTLTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D V   +I   +
Sbjct  63   DFLLFQFGLCAFKYDCVHSKYIIKSF  88



>ref|XP_005150742.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Melopsittacus 
undulatus]
Length=638

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            VTRSNF+  L  +   I+ +DF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    VTRSNFKDNLNKVYEAIEESDFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTEEKYIMKSF  88



>gb|EHJ78364.1| putative poly [Danaus plexippus]
Length=616

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 2/84 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VTR NF+  L  +R  I+AADF+AID E TG+ S   RD    D     Y  + +    F
Sbjct  3    VTRKNFKEVLPLVRDSIQAADFLAIDTEFTGLMSG--RDVSMFDSPPEYYATLLNGTADF  60

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++QFG+C F WD  +  ++   Y
Sbjct  61   LLIQFGLCTFYWDEKEKQYMNDAY  84



>ref|XP_002606119.1| hypothetical protein BRAFLDRAFT_125118 [Branchiostoma floridae]
 gb|EEN62129.1| hypothetical protein BRAFLDRAFT_125118 [Branchiostoma floridae]
Length=490

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 47/84 (56%), Gaps = 2/84 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            +TR NF+  ++ +   +  A F+ ID E TG+ + P    F  D    RY K++  +  F
Sbjct  3    ITRHNFKQVIDQVSEAVDEASFLCIDGEFTGLNNGPALHGF--DTPQERYDKLRKGSLDF  60

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
              VQFG+C F++++ +  F+A P+
Sbjct  61   LFVQFGLCAFKYETEESRFVARPF  84



>ref|XP_002160561.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Hydra vulgaris]
Length=502

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 1/84 (1%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEKF  317
            VTRSNF++A E ++  I   DF++ID E +G+++    +S      + +Y  +KD + K 
Sbjct  3    VTRSNFDAAFELIKSEINNTDFISIDAEFSGLSTIK-SNSGSCSNLEEKYNMLKDGSNKL  61

Query  318  AVVQFGVCPFRWDSVKHFFIAHPY  389
             ++Q+G+  F+W   K  + A P+
Sbjct  62   LLIQYGISLFKWSEKKKSYKAMPF  85



>ref|XP_536966.2| PREDICTED: poly(A)-specific ribonuclease PARN isoformX1 [Canis 
lupus familiaris]
Length=638

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   IK ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYEAIKEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_006759737.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Myotis 
davidii]
Length=557

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSHLHKVYQAIEEADFFAIDGEFSGISDGPSVTTLTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D +   +I   +
Sbjct  63   DFLLFQFGLCAFKYDCIHSKYIIKSF  88



>ref|XP_006759736.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Myotis 
davidii]
Length=634

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSHLHKVYQAIEEADFFAIDGEFSGISDGPSVTTLTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D +   +I   +
Sbjct  63   DFLLFQFGLCAFKYDCIHSKYIIKSF  88



>emb|CDW90995.1| poly-specific ribonuclease (deadenylation nuclease) [Stylonychia 
lemnae]
Length=671

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = +3

Query  135  NVTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFELDRYDIRYLKVKDSAEK  314
            N+TR NF+  L  +   +  +DF+AID E +G+      ++ + D    RY K K++  K
Sbjct  2    NITRYNFKKQLPSIIKCLNQSDFIAIDFEFSGLNFDKELENLQSDTVAQRYWKSKENVSK  61

Query  315  FAVVQFGVCPFRWDSVKHFFIAHPY  389
            F   Q G+C F++   +     HP+
Sbjct  62   FMAPQMGICAFKYHQNEKRLECHPF  86



>ref|XP_003417760.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Loxodonta 
africana]
Length=638

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTESKYITKSF  88



>ref|XP_010595596.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Loxodonta 
africana]
Length=619

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTESKYITKSF  88



>ref|XP_007076924.1| PREDICTED: poly(A)-specific ribonuclease PARN [Panthera tigris 
altaica]
Length=638

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L+ +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLQKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_006105281.1| PREDICTED: poly(A)-specific ribonuclease PARN [Myotis lucifugus]
Length=529

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSHLHKVYQAIEEADFFAIDGEFSGISDGPSVTTLTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D +   +I   +
Sbjct  63   DFLLFQFGLCAFKYDCIHSKYIIKSF  88



>ref|XP_003998895.1| PREDICTED: poly(A)-specific ribonuclease PARN [Felis catus]
Length=638

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L+ +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLQKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_006257909.1| PREDICTED: poly(A)-specific ribonuclease PARN [Alligator mississippiensis]
Length=638

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/86 (33%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            V RSNF+  L  +   ++ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    VIRSNFKDTLNKVYDAVEEADFLAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D  +  +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTEEKYIMKSF  88



>ref|XP_010337706.1| PREDICTED: poly(A)-specific ribonuclease PARN [Saimiri boliviensis 
boliviensis]
Length=626

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_004057290.1| PREDICTED: poly(A)-specific ribonuclease PARN [Gorilla gorilla 
gorilla]
Length=634

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_007237945.1| PREDICTED: poly(A)-specific ribonuclease PARN-like [Astyanax 
mexicanus]
Length=548

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TR NF+ +L  +   ++ ADF+AID E +G++  P   +    +D  + RY K++  + 
Sbjct  3    ITRQNFKESLSTVYSAVEEADFLAIDGEFSGISDGPSVSALTNGMDTPEERYGKLRKHSM  62

Query  312  KFAVVQFGVCPFRWDSVK  365
             F + QFG+C FR+D  +
Sbjct  63   DFLLFQFGLCTFRYDQTQ  80



>ref|XP_002711808.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Oryctolagus 
cuniculus]
Length=638

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|XP_003269351.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform 1 [Nomascus 
leucogenys]
Length=639

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_004408976.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform 1 [Odobenus 
rosmarus divergens]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|XP_004750405.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Mustela 
putorius furo]
 ref|XP_004797526.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X3 [Mustela 
putorius furo]
Length=520

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|XP_006728698.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Leptonychotes 
weddellii]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|NP_001184102.1| poly(A)-specific ribonuclease (deadenylation nuclease) [Xenopus 
(Silurana) tropicalis]
Length=632

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    MTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVK  365
            +F + QFG+C F +D+ +
Sbjct  63   EFLLFQFGLCTFNYDNTE  80



>ref|XP_007984527.1| PREDICTED: poly(A)-specific ribonuclease PARN [Chlorocebus sabaeus]
Length=639

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|NP_002573.1| poly(A)-specific ribonuclease PARN isoform 1 [Homo sapiens]
 sp|O95453.1|PARN_HUMAN RecName: Full=Poly(A)-specific ribonuclease PARN; AltName: Full=Deadenylating 
nuclease; AltName: Full=Deadenylation nuclease; 
AltName: Full=Polyadenylate-specific ribonuclease [Homo 
sapiens]
 emb|CAA06683.1| poly(A)-specific ribonuclease [Homo sapiens]
 gb|AAH50029.1| PARN protein [Homo sapiens]
 gb|EAW85110.1| poly(A)-specific ribonuclease (deadenylation nuclease), isoform 
CRA_a [Homo sapiens]
 dbj|BAG37510.1| unnamed protein product [Homo sapiens]
 gb|ADZ15574.1| poly(A)-specific ribonuclease (deadenylation nuclease) [synthetic 
construct]
 gb|AIC49339.1| PARN, partial [synthetic construct]
Length=639

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_006146609.1| PREDICTED: poly(A)-specific ribonuclease PARN [Tupaia chinensis]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L+ +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLQKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFI  377
             F + QFG+C F++D+    +I
Sbjct  63   DFLLFQFGLCTFKYDNTDSKYI  84



>ref|XP_510832.3| PREDICTED: poly(A)-specific ribonuclease PARN [Pan troglodytes]
Length=639

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_006212136.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Vicugna 
pacos]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDCTDSKYITKSF  88



>ref|XP_005591355.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X2 [Macaca 
fascicularis]
Length=620

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_004652333.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Jaculus 
jaculus]
Length=636

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|XP_005591354.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Macaca 
fascicularis]
Length=639

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>emb|CAL49352.1| poly(A)-specific ribonuclease (deadenylation nuclease) [Xenopus 
(Silurana) tropicalis]
Length=519

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    MTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVK  365
            +F + QFG+C F +D+ +
Sbjct  63   EFLLFQFGLCTFNYDNTE  80



>ref|XP_008695138.1| PREDICTED: poly(A)-specific ribonuclease PARN [Ursus maritimus]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>gb|AAI69159.1| Unknown (protein for IMAGE:8898488) [Xenopus (Silurana) tropicalis]
Length=525

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            +TRSNF+  L  +   I+ ADF+AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    MTRSNFKDNLPKVYKAIEEADFLAIDGEFSGISDGPSVSTLTNGFDTPEERYTKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVK  365
            +F + QFG+C F +D+ +
Sbjct  63   EFLLFQFGLCTFNYDNTE  80



>ref|XP_009194320.1| PREDICTED: poly(A)-specific ribonuclease PARN [Papio anubis]
Length=635

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDYTDSKYITKSF  88



>ref|XP_004750403.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Mustela 
putorius furo]
 ref|XP_004797524.1| PREDICTED: poly(A)-specific ribonuclease PARN isoform X1 [Mustela 
putorius furo]
Length=638

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVTALTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



>ref|XP_006867301.1| PREDICTED: poly(A)-specific ribonuclease PARN [Chrysochloris 
asiatica]
Length=630

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  138  VTRSNFESALEDLRGLIKAADFVAIDLEMTGVTSAPWRDSFE--LDRYDIRYLKVKDSAE  311
            + RSNF+S L  +   I+ ADF AID E +G++  P   +     D  + RY K+K  + 
Sbjct  3    IIRSNFKSNLPKVYQAIEEADFFAIDGEFSGISDGPSVTTLTNGFDTPEERYQKLKKHSM  62

Query  312  KFAVVQFGVCPFRWDSVKHFFIAHPY  389
             F + QFG+C F++D     +I   +
Sbjct  63   DFLLFQFGLCTFKYDHTDSKYITKSF  88



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514802592608