BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25850_g3_i1 len=693 path=[16853:0-0 16854:1-23 2917:24-128
16998:129-163 17028:164-239 10716:240-241 3135:242-260 3154:261-279
17153:280-283 17157:284-286 3180:287-368 17243:369-370 17245:371-377
17252:378-388 8426:389-405 3296:406-412 3303:413-421 3312:422-459
17324:460-552 8766:553-558 3449:559-599 17430:600-625 3516:626-692]

Length=693
                                                                      Score     E

emb|CDX80531.1|  BnaC07g29130D                                          196   2e-56   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    196   2e-56   
emb|CDX74027.1|  BnaA03g30200D                                          196   2e-56   
emb|CDY07972.1|  BnaC03g35510D                                          196   4e-56   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      195   4e-56   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    194   1e-55   
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    195   2e-55   
gb|KGN43436.1|  Polygalacturonase                                       191   4e-55   
emb|CDY35969.1|  BnaA05g29810D                                          194   7e-55   
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    194   1e-54   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    191   1e-54   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    190   2e-54   
emb|CDY28013.1|  BnaC05g44150D                                          191   5e-54   
gb|ADK92878.1|  polygalacturonase                                       187   3e-53   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    187   7e-53   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               186   1e-52   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             187   6e-52   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               183   1e-51   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               183   1e-51   
ref|XP_002884670.1|  exopolygalacturonase                               184   1e-51   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          182   3e-51   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    182   4e-51   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               182   4e-51   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               182   5e-51   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               181   5e-51   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    182   6e-51   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               180   2e-50   
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    179   2e-50   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    181   3e-50   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               181   3e-50   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               179   3e-50   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    179   3e-50   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    180   5e-50   
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    179   7e-50   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               178   1e-49   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    177   2e-49   Vitis vinifera
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    177   3e-49   Vitis vinifera
emb|CBI22050.3|  unnamed protein product                                177   3e-49   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               177   3e-49   
gb|KDO58458.1|  hypothetical protein CISIN_1g045893mg                   175   3e-49   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               175   1e-48   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               175   1e-48   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     176   2e-48   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          175   2e-48   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    174   3e-48   Vitis vinifera
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               174   5e-48   
emb|CBI28390.3|  unnamed protein product                                174   8e-48   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    172   1e-47   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     172   1e-47   
ref|XP_006447721.1|  hypothetical protein CICLE_v10017883mg             171   1e-47   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               172   1e-47   
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    172   2e-47   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    171   3e-47   
emb|CBI22052.3|  unnamed protein product                                178   4e-47   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    171   4e-47   
emb|CBI37725.3|  unnamed protein product                                171   4e-47   
ref|XP_010999531.1|  PREDICTED: polygalacturonase-like                  169   5e-47   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               171   6e-47   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    172   8e-47   
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          169   1e-46   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               170   1e-46   
dbj|BAA89476.1|  polygalacturonase                                      170   1e-46   Salix gilgiana
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    169   2e-46   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               169   2e-46   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               169   2e-46   
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    169   3e-46   
ref|XP_007049259.1|  Polygalacturonase                                  169   3e-46   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               169   5e-46   
emb|CBI28399.3|  unnamed protein product                                167   6e-46   
ref|XP_006371365.1|  hypothetical protein POPTR_0019s09490g             166   6e-46   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    168   6e-46   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    168   7e-46   Vitis vinifera
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    168   1e-45   
ref|XP_006424158.1|  hypothetical protein CICLE_v10030302mg             166   1e-45   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               167   1e-45   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               167   1e-45   
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               167   2e-45   
ref|XP_009406303.1|  PREDICTED: exopolygalacturonase-like               163   2e-45   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             166   3e-45   
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               166   4e-45   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    168   5e-45   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               166   5e-45   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  165   8e-45   Ricinus communis
gb|ABY21306.1|  pollen allergen Pla o 2                                 164   1e-44   Platanus orientalis
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    165   1e-44   Gossypium hirsutum [American cotton]
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             165   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009421468.1|  PREDICTED: exopolygalacturonase-like               164   2e-44   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             165   2e-44   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     167   2e-44   Vitis vinifera
dbj|BAA89477.1|  polygalacturonase                                      164   2e-44   Salix gilgiana
emb|CAA51033.1|  exopolygalacturonase                                   165   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               164   3e-44   
dbj|BAA89479.1|  polygalacturonase                                      163   4e-44   Salix gilgiana
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               163   4e-44   
ref|XP_002862616.1|  polygalacturonase                                  164   5e-44   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               162   5e-44   
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         162   6e-44   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               163   6e-44   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    163   6e-44   Gossypium barbadense [Egyptian cotton]
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               163   7e-44   
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         162   7e-44   
ref|XP_002885005.1|  polygalacturonase                                  164   8e-44   
gb|EMT33862.1|  putative Exopolygalacturonase                           162   8e-44   
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         163   8e-44   
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               162   1e-43   
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               162   1e-43   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               162   1e-43   
emb|CAA51692.1|  exopolygalacturonase                                   163   1e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             162   1e-43   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     162   1e-43   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               161   2e-43   
ref|NP_187442.1|  polygalacturonase-like protein                        162   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               162   2e-43   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    160   2e-43   Oenothera organensis
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    162   2e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                      162   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                            162   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       161   2e-43   
ref|XP_009387205.1|  PREDICTED: exopolygalacturonase-like               157   2e-43   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    161   3e-43   
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               162   3e-43   
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               161   3e-43   
emb|CDX90415.1|  BnaA03g43660D                                          161   3e-43   
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             160   4e-43   Brassica oleracea
gb|AAP42648.1|  polygalacturonase                                       160   4e-43   Brassica napus [oilseed rape]
ref|XP_011015579.1|  PREDICTED: exopolygalacturonase clone GBGE184      162   4e-43   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    160   5e-43   Brassica napus [oilseed rape]
ref|XP_002301488.2|  hypothetical protein POPTR_0002s20330g             160   5e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010093135.1|  hypothetical protein L484_009327                   160   6e-43   
ref|XP_004499458.1|  PREDICTED: exopolygalacturonase-like               161   6e-43   
ref|XP_002301489.1|  Exopolygalacturonase clone GBGE184 precursor...    160   7e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               160   8e-43   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  160   8e-43   
dbj|BAA89478.1|  polygalacturonase                                      159   9e-43   Salix gilgiana
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               159   1e-42   
ref|XP_007050989.1|  Polygalacturonase 4, putative                      160   1e-42   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    159   1e-42   Platanus x hispanica [London plane tree]
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             159   2e-42   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       159   2e-42   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               159   2e-42   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               160   2e-42   
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    159   2e-42   
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       159   3e-42   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             159   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               158   3e-42   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  159   3e-42   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  158   3e-42   
emb|CDY01524.1|  BnaC07g35140D                                          158   4e-42   
ref|XP_010489712.1|  PREDICTED: polygalacturonase-like                  157   4e-42   
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               158   4e-42   
ref|XP_009411633.1|  PREDICTED: exopolygalacturonase-like               158   5e-42   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  157   6e-42   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  157   6e-42   
ref|XP_008660316.1|  PREDICTED: exopolygalacturonase-like               157   6e-42   
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               157   6e-42   
emb|CDY22140.1|  BnaC01g39610D                                          157   7e-42   
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               157   7e-42   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               157   7e-42   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              157   8e-42   Ricinus communis
ref|XP_002444237.1|  hypothetical protein SORBIDRAFT_07g016970          157   8e-42   Sorghum bicolor [broomcorn]
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               157   9e-42   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               157   9e-42   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               157   1e-41   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  157   1e-41   
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       155   1e-41   
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    157   1e-41   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             157   1e-41   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               157   1e-41   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   157   1e-41   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    156   1e-41   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               156   1e-41   
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               157   2e-41   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               156   2e-41   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             156   2e-41   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             156   2e-41   
dbj|BAK05779.1|  predicted protein                                      156   2e-41   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    156   2e-41   Nicotiana tabacum [American tobacco]
gb|EAZ14447.1|  hypothetical protein OsJ_04368                          156   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             156   2e-41   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  156   2e-41   
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          156   2e-41   Sorghum bicolor [broomcorn]
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       156   2e-41   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             155   3e-41   
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             155   3e-41   
ref|NP_199625.1|  putative polygalacturonase / pectinase                155   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    156   3e-41   
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               157   3e-41   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  155   4e-41   
ref|NP_001045053.1|  Os01g0891100                                       155   4e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CDP04350.1|  unnamed protein product                                155   4e-41   
ref|XP_004974598.1|  PREDICTED: exopolygalacturonase-like               155   4e-41   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  155   4e-41   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  155   5e-41   
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               155   5e-41   
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    155   5e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  155   6e-41   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               155   7e-41   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  155   7e-41   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               156   7e-41   
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             155   7e-41   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    155   7e-41   
gb|KEH33414.1|  polygalacturonase/glycoside hydrolase family protein    154   8e-41   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  154   8e-41   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             154   9e-41   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  154   9e-41   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               154   1e-40   
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           154   1e-40   
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             155   1e-40   
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               154   1e-40   
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               154   1e-40   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               154   1e-40   
ref|XP_008226319.1|  PREDICTED: exopolygalacturonase                    154   1e-40   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  154   1e-40   
emb|CDY22137.1|  BnaC01g39640D                                          154   1e-40   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               154   1e-40   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  154   1e-40   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  154   2e-40   
gb|ABN13878.1|  polygalacturonase                                       154   2e-40   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  153   2e-40   
ref|XP_008438909.1|  PREDICTED: exopolygalacturonase-like               154   2e-40   
ref|XP_010548799.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    149   2e-40   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             153   2e-40   Populus trichocarpa [western balsam poplar]
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               153   2e-40   
ref|XP_010472056.1|  PREDICTED: exopolygalacturonase-like               153   2e-40   
ref|XP_010419249.1|  PREDICTED: exopolygalacturonase-like               150   3e-40   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  153   3e-40   
ref|NP_001061556.1|  Os08g0327200                                       153   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               152   3e-40   
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    153   4e-40   Zea mays [maize]
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             152   4e-40   
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    153   4e-40   
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               152   4e-40   
emb|CDP06168.1|  unnamed protein product                                152   5e-40   
emb|CAA50335.1|  polygalacturonase                                      152   5e-40   Nicotiana tabacum [American tobacco]
emb|CDY07974.1|  BnaC03g35490D                                          152   5e-40   
ref|XP_002437842.1|  hypothetical protein SORBIDRAFT_10g003580          152   5e-40   Sorghum bicolor [broomcorn]
gb|ABL63521.1|  pollen-specific protein MF9l                            152   5e-40   Brassica oleracea var. alboglabra
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             152   5e-40   
ref|XP_006444403.1|  hypothetical protein CICLE_v10023712mg             152   5e-40   
ref|XP_006480116.1|  PREDICTED: exopolygalacturonase clone GBGE18...    152   6e-40   
gb|AHL24657.1|  Sal k 6.01 allergen                                     152   6e-40   
ref|XP_006838947.1|  hypothetical protein AMTR_s00002p00270640          152   6e-40   
ref|XP_002437276.1|  hypothetical protein SORBIDRAFT_10g024020          152   6e-40   Sorghum bicolor [broomcorn]
gb|ABG38468.1|  pollen-expressed protein MF9c                           152   6e-40   Brassica oleracea
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    154   6e-40   
ref|NP_001152243.1|  polygalacturonase precursor                        152   6e-40   Zea mays [maize]
ref|NP_187439.1|  polygalacturonase-like protein                        152   7e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CAA44248.1|  polygalacturonase                                      150   7e-40   Zea mays [maize]
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    152   8e-40
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    152   8e-40
gb|ABD79098.1|  Zea m 13 allergen                                       152   8e-40   Zea mays [maize]
ref|XP_008678508.1|  PREDICTED: exopolygalacturonase-like               152   9e-40   
gb|ADC53480.1|  polygalacturonase                                       152   9e-40   Gossypium hirsutum [American cotton]
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  152   1e-39   
ref|XP_007020651.1|  Pectin lyase-like superfamily protein, putative    152   1e-39   
emb|CAA05892.1|  polygalacturonase                                      151   1e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CBM42660.1|  group 13 grass pollen allergen                         151   1e-39   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               152   1e-39   
emb|CBM42661.1|  group 13 grass pollen allergen                         151   1e-39   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  151   1e-39   
ref|XP_010026119.1|  PREDICTED: exopolygalacturonase-like               152   1e-39   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  151   1e-39   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  151   2e-39   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          152   2e-39   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  151   2e-39   
gb|KCW66880.1|  hypothetical protein EUGRSUZ_F00634                     150   2e-39   
ref|XP_002884668.1|  polygalacturonase 3                                150   2e-39   
dbj|BAK06865.1|  predicted protein                                      151   2e-39   
gb|ADP09681.1|  polygalacturonase                                       151   2e-39   
ref|NP_187440.1|  polygalacturonase-like protein                        150   2e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          151   2e-39   Sorghum bicolor [broomcorn]
gb|KHN40047.1|  Polygalacturonase                                       150   2e-39   
emb|CDX88444.1|  BnaC06g38880D                                          150   2e-39   
gb|KCW62361.1|  hypothetical protein EUGRSUZ_H05001                     150   2e-39   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     156   2e-39   Vitis vinifera
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             150   2e-39   
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              150   2e-39   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             150   2e-39   
emb|CDP04348.1|  unnamed protein product                                150   3e-39   
ref|XP_010064302.1|  PREDICTED: exopolygalacturonase-like               150   3e-39   
gb|EMT18530.1|  Exopolygalacturonase                                    150   3e-39   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             150   3e-39   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                150   3e-39   
emb|CDP04343.1|  unnamed protein product                                150   4e-39   
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       150   4e-39   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               150   4e-39   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               150   5e-39   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  149   5e-39   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               150   5e-39   
ref|XP_010064300.1|  PREDICTED: exopolygalacturonase-like               149   5e-39   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                150   6e-39   
emb|CBM42662.1|  group 13 grass pollen allergen                         149   6e-39   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  149   6e-39   
emb|CBM42663.1|  group 13 grass pollen allergen                         149   6e-39   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             149   6e-39   
gb|KFK31078.1|  hypothetical protein AALP_AA6G065400                    147   7e-39   
gb|KDP29565.1|  hypothetical protein JCGZ_19278                         149   7e-39   
emb|CAA40910.1|  polygalacturonase                                      149   7e-39   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             149   8e-39   
ref|XP_004304844.1|  PREDICTED: polygalacturonase-like                  149   8e-39   
emb|CAA46680.1|  polygalacturonase                                      149   9e-39   
emb|CAA40851.1|  polygalacturonase                                      149   9e-39   
ref|NP_001105432.1|  exopolygalacturonase precursor                     149   9e-39   
gb|KHN46909.1|  Polygalacturonase                                       149   9e-39   
ref|XP_009367790.1|  PREDICTED: exopolygalacturonase-like               149   1e-38   
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    149   1e-38   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  149   1e-38   
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               149   1e-38   
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               149   1e-38   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       149   1e-38   
ref|NP_187441.1|  polygalacturonase-like protein                        149   1e-38   
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                    149   1e-38   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  149   1e-38   
ref|XP_008645431.1|  PREDICTED: exopolygalacturonase-like               149   1e-38   
ref|XP_009354960.1|  PREDICTED: exopolygalacturonase-like               148   1e-38   
emb|CDP18013.1|  unnamed protein product                                149   1e-38   
ref|XP_003535015.1|  PREDICTED: polygalacturonase-like                  148   2e-38   
ref|XP_008383110.1|  PREDICTED: exopolygalacturonase-like               148   2e-38   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  148   2e-38   
ref|NP_177961.2|  pectin lyase-like superfamily protein                 148   2e-38   
gb|AAF71796.1|AC013430_5  F3F9.9                                        148   2e-38   
ref|XP_008645416.1|  PREDICTED: exopolygalacturonase-like               149   2e-38   
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               149   2e-38   
ref|XP_004144607.1|  PREDICTED: polygalacturonase-like                  149   2e-38   
gb|EMS56561.1|  Exopolygalacturonase                                    149   2e-38   
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             148   2e-38   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    148   2e-38   
ref|XP_010910801.1|  PREDICTED: exopolygalacturonase-like               148   2e-38   
gb|AAQ62998.1|  oil palm polygalacturonase allergen PEST459             148   2e-38   
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           148   2e-38   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                148   2e-38   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                148   3e-38   
gb|AEW90949.1|  polygalacturonase R2-7                                  148   3e-38   
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          147   3e-38   
ref|XP_010112808.1|  hypothetical protein L484_020040                   147   3e-38   
ref|XP_010099972.1|  hypothetical protein L484_014009                   147   3e-38   
ref|XP_003571072.1|  PREDICTED: exopolygalacturonase-like               148   3e-38   
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  147   3e-38   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  147   3e-38   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    147   3e-38   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  147   4e-38   
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                147   4e-38   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               147   4e-38   
ref|XP_006495385.1|  PREDICTED: polygalacturonase-like                  145   4e-38   
ref|XP_010112807.1|  hypothetical protein L484_020039                   147   4e-38   
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               147   4e-38   
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               147   4e-38   
gb|KDP24950.1|  hypothetical protein JCGZ_24417                         147   5e-38   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  147   5e-38   
gb|ABD79097.1|  Zea m 13 allergen                                       147   5e-38   
ref|XP_008649072.1|  PREDICTED: exopolygalacturonase-like               147   5e-38   
ref|NP_172056.1|  pectin lyase-like protein                             147   5e-38   
ref|NP_001105862.1|  exopolygalacturonase precursor                     147   5e-38   
sp|P35339.1|PGLR3_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    147   5e-38   
dbj|BAC22689.1|  polygalacturonase                                      147   5e-38   
emb|CDX86325.1|  BnaA06g30420D                                          147   5e-38   
gb|KDO51595.1|  hypothetical protein CISIN_1g047322mg                   145   5e-38   
ref|XP_006647023.1|  PREDICTED: exopolygalacturonase-like               147   5e-38   
ref|XP_002529091.1|  Polygalacturonase precursor, putative              147   6e-38   
ref|NP_001141808.1|  uncharacterized protein LOC100273946 precursor     147   6e-38   
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             147   6e-38   
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                146   7e-38   
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    146   7e-38   
ref|XP_004289544.1|  PREDICTED: exopolygalacturonase-like               145   8e-38   
gb|AER27668.1|  polygalacturonase                                       146   9e-38   
ref|XP_003615080.1|  Polygalacturonase                                  144   9e-38   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               146   9e-38   
emb|CAH18935.1|  polygalacturonase                                      146   1e-37   
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  146   1e-37   
ref|XP_010469513.1|  PREDICTED: exopolygalacturonase-like               146   1e-37   
emb|CDY54512.1|  BnaC07g49180D                                          146   1e-37   
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               146   1e-37   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  146   1e-37   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             145   2e-37   
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               145   2e-37   
ref|XP_006493148.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    145   2e-37   
emb|CAA16789.1|  polygalacturonase-like protein                         145   2e-37   
ref|XP_011074245.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               145   2e-37   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       145   2e-37   
gb|KDP27317.1|  hypothetical protein JCGZ_21001                         146   2e-37   
dbj|BAF42034.1|  polygalacturonase3                                     145   2e-37   
gb|KHN41437.1|  Polygalacturonase                                       145   2e-37   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
ref|XP_010065343.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    145   2e-37   
ref|XP_011005268.1|  PREDICTED: polygalacturonase-like isoform X1       145   2e-37   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       145   2e-37   
ref|XP_002529089.1|  Polygalacturonase precursor, putative              145   2e-37   
ref|NP_172057.1|  pectin lyase-like protein                             145   3e-37   
ref|XP_006301427.1|  hypothetical protein CARUB_v10021845mg             145   3e-37   
ref|XP_011005270.1|  PREDICTED: polygalacturonase-like isoform X3       145   3e-37   
ref|XP_010040120.1|  PREDICTED: polygalacturonase-like                  145   3e-37   
ref|XP_002456767.1|  hypothetical protein SORBIDRAFT_03g042350          145   3e-37   
ref|XP_006659306.1|  PREDICTED: exopolygalacturonase-like               145   3e-37   
gb|ABR26683.1|  polygalacturonase                                       145   3e-37   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               144   4e-37   
gb|KDO51597.1|  hypothetical protein CISIN_1g046411mg                   144   4e-37   
emb|CDY52447.1|  BnaA07g39240D                                          144   4e-37   
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               145   4e-37   
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               145   4e-37   
ref|XP_002889191.1|  predicted protein                                  144   4e-37   
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                144   4e-37   
gb|ABD33834.1|  polygalacturonase                                       144   5e-37   
ref|XP_002309716.1|  hypothetical protein POPTR_0007s00490g             144   5e-37   
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like               144   6e-37   
gb|AGR44470.1|  polygalacturonase 2                                     144   6e-37   
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               144   6e-37   
ref|XP_007140804.1|  hypothetical protein PHAVU_008G143500g             144   7e-37   
ref|XP_006845403.1|  hypothetical protein AMTR_s00019p00068350          140   7e-37   
ref|XP_003561199.1|  PREDICTED: polygalacturonase ADPG1-like            145   7e-37   
emb|CDY05701.1|  BnaC02g38360D                                          144   7e-37   
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                  144   7e-37   
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    142   8e-37   
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    144   8e-37   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               144   9e-37   
gb|ABE77145.1|  putative polygalacturonase                              144   1e-36   
gb|AAP37458.1|  polygalacturonase                                       144   1e-36   
ref|XP_002310385.2|  hypothetical protein POPTR_0007s00510g             143   1e-36   
ref|XP_010112809.1|  hypothetical protein L484_020041                   143   1e-36   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               143   1e-36   
ref|XP_004302209.1|  PREDICTED: polygalacturonase-like                  143   1e-36   
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               143   2e-36   
ref|XP_003595563.1|  Polygalacturonase                                  143   2e-36   
gb|KCW45458.1|  hypothetical protein EUGRSUZ_L00826                     142   2e-36   
gb|KDP29562.1|  hypothetical protein JCGZ_19275                         142   2e-36   
ref|XP_010050936.1|  PREDICTED: exopolygalacturonase-like               143   2e-36   
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     143   2e-36   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               143   2e-36   
gb|KHN17819.1|  Polygalacturonase                                       140   2e-36   
ref|XP_008451635.1|  PREDICTED: exopolygalacturonase-like               144   2e-36   
ref|XP_006304501.1|  hypothetical protein CARUB_v10011292mg             142   2e-36   
gb|ACP74159.1|  putative polygalacturonase                              142   2e-36   
gb|AFW76327.1|  hypothetical protein ZEAMMB73_655172                    140   2e-36   
ref|XP_008227253.1|  PREDICTED: polygalacturonase                       142   2e-36   
ref|XP_002892306.1|  hypothetical protein ARALYDRAFT_887757             142   3e-36   
gb|AFD62267.1|  endopolygalacturonase                                   142   3e-36   
ref|XP_003563631.1|  PREDICTED: exopolygalacturonase-like               142   3e-36   
ref|XP_006493147.1|  PREDICTED: polygalacturonase-like                  142   3e-36   
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               142   3e-36   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    141   4e-36   
ref|XP_003563839.1|  PREDICTED: exopolygalacturonase-like               142   4e-36   
emb|CBI36886.3|  unnamed protein product                                142   4e-36   
ref|XP_010652203.1|  PREDICTED: exopolygalacturonase                    142   4e-36   
ref|XP_010509923.1|  PREDICTED: exopolygalacturonase-like               142   4e-36   
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             142   5e-36   
gb|KEH18863.1|  polygalacturonase/glycoside hydrolase family protein    142   5e-36   
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               141   5e-36   
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               142   6e-36   
gb|AFK41055.1|  unknown                                                 141   6e-36   
emb|CDP21016.1|  unnamed protein product                                138   6e-36   
gb|AAX45476.1|  polygalacturonase                                       142   6e-36   
ref|XP_006379419.1|  hypothetical protein POPTR_0008s01120g             140   6e-36   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               141   7e-36   
ref|XP_004513513.1|  PREDICTED: polygalacturonase-like                  140   7e-36   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               141   7e-36   
emb|CDP08142.1|  unnamed protein product                                140   7e-36   
ref|XP_009142978.1|  PREDICTED: polygalacturonase                       141   7e-36   
ref|XP_004153320.1|  PREDICTED: polygalacturonase-like                  139   8e-36   
ref|XP_004161540.1|  PREDICTED: polygalacturonase-like                  142   8e-36   
pir||S16998  polygalacturonase (EC 3.2.1.15) - maize                    140   8e-36
ref|XP_010498061.1|  PREDICTED: exopolygalacturonase-like               141   8e-36   
ref|XP_002451722.1|  hypothetical protein SORBIDRAFT_04g006610          142   8e-36   
gb|ADT82706.1|  endopolygalacturonase                                   141   8e-36   
ref|XP_004510830.1|  PREDICTED: exopolygalacturonase-like               141   8e-36   
gb|ABV32553.1|  endopolygalacturonase                                   141   8e-36   
gb|KHN15656.1|  Polygalacturonase                                       140   9e-36   
ref|XP_009132913.1|  PREDICTED: exopolygalacturonase-like               141   1e-35   
ref|NP_001057815.1|  Os06g0545400                                       141   1e-35   
gb|EAZ01276.1|  hypothetical protein OsI_23299                          141   1e-35   
gb|KGN58367.1|  hypothetical protein Csa_3G629740                       137   1e-35   
ref|XP_004488265.1|  PREDICTED: polygalacturonase-like                  140   1e-35   
ref|XP_004170505.1|  PREDICTED: exopolygalacturonase clone GBGE18...    140   1e-35   
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               140   1e-35   
ref|XP_007213884.1|  hypothetical protein PRUPE_ppa006857mg             140   1e-35   
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             140   1e-35   
ref|XP_002529095.1|  Polygalacturonase precursor, putative              140   1e-35   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  141   1e-35   
ref|XP_004148972.1|  PREDICTED: polygalacturonase-like                  141   1e-35   
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               141   1e-35   
emb|CDY17902.1|  BnaC04g03170D                                          140   1e-35   
dbj|BAD25264.1|  putative exopolygalacturonase precursor                140   1e-35   
gb|AAC64184.1|  endopolygalacturonase                                   140   1e-35   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    140   1e-35   
gb|EMS53080.1|  Exopolygalacturonase                                    141   1e-35   
ref|NP_001046194.1|  Os02g0196700                                       141   1e-35   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  140   2e-35   
ref|XP_006372690.1|  hypothetical protein POPTR_0017s03910g             140   2e-35   
ref|XP_004146727.1|  PREDICTED: polygalacturonase-like                  139   2e-35   
ref|XP_002455693.1|  hypothetical protein SORBIDRAFT_03g021050          140   2e-35   
gb|ACR38466.1|  unknown                                                 139   2e-35   
gb|ACN85237.1|  exopolygalacturonase precursor                          140   2e-35   
ref|XP_008788347.1|  PREDICTED: uncharacterized protein LOC103706119    144   2e-35   
gb|EEC80963.1|  hypothetical protein OsI_23684                          140   2e-35   
ref|XP_002529092.1|  Polygalacturonase precursor, putative              140   2e-35   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  143   2e-35   
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative    140   2e-35   
gb|KGN44972.1|  hypothetical protein Csa_7G404800                       140   2e-35   
ref|XP_004969212.1|  PREDICTED: polygalacturonase-like                  140   2e-35   



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DD+ AF  AW + C++  PS +KV +GKY +  + F GPCKS
Sbjct  41   SGETIDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKS  100

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
            AVTF+       +AP+  +  K   GWI F  +++F L+G    ++GQG+ AWKIN C +
Sbjct  101  AVTFEM--DGHIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGATAWKINDCAK  158

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C  LPIN+ +  LTN+ +KGIKS +SK FHMN+I CKNLTL  I I AP +S N
Sbjct  159  TGK---CNTLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLN  215

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS+GV +  A+IKTGD
Sbjct  216  TDGIHIGRSDGVRLVRAKIKTGD  238



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DD+ AF  AW + C++  PS +KV +GKY +  + F GPCKS
Sbjct  41   SGETIDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKS  100

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
            AVTF+       +AP+  +  K   GWI F  +++F L+G    ++GQG+ AWKIN C +
Sbjct  101  AVTFEM--DGHIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGAHAWKINDCAK  158

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C  LPIN+ +  LTN+ +KGIKS +SK FHMN+I CKNLTL  I I AP +S N
Sbjct  159  TGK---CNTLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLN  215

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS+GV +  A+IKTGD
Sbjct  216  TDGIHIGRSDGVRLVRAKIKTGD  238



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DD+ AF  AW + C++  PS +KV +GKY +  + F GPCKS
Sbjct  41   SGETIDVKASGAKGDGKTDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKS  100

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
            AVTF+       +AP+  +  K   GWI F  +++F L+G    ++GQG+ AWKIN C +
Sbjct  101  AVTFEM--DGHIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGAHAWKINDCAK  158

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C  LPIN+ +  LTN+ +KGIKS +SK FHMN+I CKNLTL  I I AP +S N
Sbjct  159  TGK---CNTLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLN  215

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS+GV +  A+IKTGD
Sbjct  216  TDGIHIGRSDGVRLVRAKIKTGD  238



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score =   196 bits (497),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 134/203 (66%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DD+ AF  AW + C++  PS +KV +GKY +  + F GPCKS
Sbjct  41   SGETIDVKASGAKGDGITDDSKAFADAWKKACESKSPSKIKVRKGKYLVKTLEFKGPCKS  100

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
            AVTF+       +AP+  +  K   GWI F  +++F L+G    ++GQG+ AWKIN C +
Sbjct  101  AVTFEM--DGHIMAPSKATPGKPHCGWINFEKLENFNLNGHGAIFDGQGATAWKINDCAK  158

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C  LPIN+ +  LTN+ +KGIKS +SK FHMN+I CKNLTL  I I AP +S N
Sbjct  159  TGK---CNTLPINIRITGLTNSKIKGIKSTNSKLFHMNIINCKNLTLEDIGIDAPPESLN  215

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS+GV +  A+IKTGD
Sbjct  216  TDGIHIGRSDGVRLVRAKIKTGD  238



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 136/215 (63%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
             I F    L+  VQ V+ +VK  GA+ +G+ DD+ A  KAW + C +T+PS + +P G+Y
Sbjct  13   FILFLFIGLITNVQAVDFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  72

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQ  288
             +  + F GPC + +     EG +  APT++ + +    WI+F  I   T+SG GT++G+
Sbjct  73   VVDSMKFQGPCLAPIHVQV-EG-RLQAPTNIKKMRNDASWIVFQYINGLTVSGKGTFDGR  130

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            GS AWK N+C  +     C +LPI++   +L N+++K I S DSKFFHMNV  C+N+TL 
Sbjct  131  GSLAWKQNQCASSGK---CGSLPISLRFFSLNNSLIKDITSTDSKFFHMNVHNCRNVTLR  187

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             I I AP DS NTDGIHIG S G+T+ DA IKTGD
Sbjct  188  NINIDAPGDSPNTDGIHIGGSSGITIHDARIKTGD  222



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 138/224 (62%), Gaps = 6/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MGS  +  A  F ++  L    +  ++++K  GAK DG  DD+ A   AW E C +  PS
Sbjct  1    MGSKFVLRATFFLFLVALFIKAKAADIDIKKFGAKADGKTDDSQAINSAWKEACTSATPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
            T+ + +G Y +G + F GPCK+ V+    EG    AP +  + K++DGW++F  I   ++
Sbjct  61   TVVIAKGNYMVGPVKFQGPCKAPVSLRV-EGT-LQAPAEPEKLKSQDGWVIFQNIDALSV  118

Query  311  SGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SGG T++GQGS AW  N C +      C +LPI++ L  LTNA ++ I S +SK FHMN+
Sbjct  119  SGGGTFDGQGSIAWSKNDCAKTGK---CNSLPISLRLTGLTNAHIQDITSTNSKLFHMNI  175

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKN+TL  + I+AP +S NTDGIHIGRS  + +  AEI+TGD
Sbjct  176  LNCKNVTLQHVTIKAPGESLNTDGIHIGRSTNINITGAEIQTGD  219



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 129/200 (65%), Gaps = 7/200 (4%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
             ++VK +GAKGDG  DDTAAF   W   C+A  PST+ VP+G Y +  I FLGPCK  VT
Sbjct  99   SLDVKAAGAKGDGTTDDTAAFTAVWKTACEAPGPSTITVPKGDYLVNNIEFLGPCKGPVT  158

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKENMN  243
            F+ +   K  AP  ++  K   GW+ F+ + DFTL+G    ++GQGS AWK N C +   
Sbjct  159  FEMSGNMK--APATVAAVKPNSGWVDFTNLADFTLNGNGAIFDGQGSLAWKANDCAKTGK  216

Query  242  APLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDG  63
               C +LPIN+    LTN+ + GI S +SK FHMNV+ CKN+TL  I I AP +S NTDG
Sbjct  217  ---CNSLPINIRFTGLTNSKIIGITSTNSKLFHMNVLNCKNVTLENIGIDAPPESLNTDG  273

Query  62   IHIGRSEGVTVDDAEIKTGD  3
            IHIGRS GV +  A++KTGD
Sbjct  274  IHIGRSVGVNLIGAKVKTGD  293



>gb|KGN43436.1| Polygalacturonase [Cucumis sativus]
Length=340

 Score =   191 bits (484),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
             I F    L+   Q  + +VK  GA+ +G+ DD+ A  KAW + C +T+PS + +P G+Y
Sbjct  12   FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQ  288
             +  + F GPC + +     EG +  APT++ + +    WI+F  I   TLSG GT++G+
Sbjct  72   VVDSMKFQGPCLAPIHVQV-EG-RLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGR  129

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            GS AWK N+C  +     C +LPI++   +L N+++K I S DSKFFH+NV  C+NLTL 
Sbjct  130  GSLAWKQNQCASSGK---CGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQ  186

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             I I AP DS NTDGIHIG S GVT+ +A IKTGD
Sbjct  187  NINIDAPGDSPNTDGIHIGGSSGVTIHNARIKTGD  221



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score =   194 bits (493),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 131/203 (65%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DDTAAF   W +  +A  P+T+ VP+G Y + ++   GP K 
Sbjct  137  SGPSIDVKASGAKGDGKTDDTAAFMAVWKKAIEAATPTTITVPKGDYLVNELMLEGPSKC  196

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL--SGGTYNGQGSAAWKINKCKE  252
            A+TFD     K  AP+ ++  K   GW+ F  +KDF L  +G  ++GQGS AWK+N CK+
Sbjct  197  AITFDMHGNLK--APSAVTTRKPHSGWVNFRKLKDFKLIGNGAIFDGQGSVAWKVNDCKQ  254

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C NLPIN+ L  L N+++ GI S +SK FHMN+ QC N+TL  + I AP +S N
Sbjct  255  TGK---CNNLPINIRLTQLNNSIISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLN  311

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIH+G+S GVT+  ++IKTGD
Sbjct  312  TDGIHVGKSVGVTIRGSKIKTGD  334



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 131/203 (65%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DDTAAF   W +  +A  P+T+ VP+G Y + ++   GP K 
Sbjct  137  SGPSIDVKASGAKGDGKTDDTAAFMAVWKKAIEAATPTTITVPKGDYLVNELMLEGPSKC  196

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL--SGGTYNGQGSAAWKINKCKE  252
            A+TFD     K  AP+ ++  K   GW+ F  +KDF L  +G  ++GQGS AWK+N CK+
Sbjct  197  AITFDMHGNLK--APSAVTTRKPHSGWVNFRKLKDFKLIGNGAIFDGQGSVAWKVNDCKQ  254

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C NLPIN+ L  L N+++ GI S +SK FHMN+ QC N+TL  + I AP +S N
Sbjct  255  TGK---CNNLPINIRLTQLNNSIISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLN  311

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIH+G+S GVT+  ++IKTGD
Sbjct  312  TDGIHVGKSVGVTIRGSKIKTGD  334



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
             I F    L+   Q  + +VK  GA+ +G+ DD+ A  KAW + C +T+PS + +P G+Y
Sbjct  12   FILFLFIGLITNAQAADFHVKRYGARANGNSDDSQAIMKAWKDACSSTKPSKIVIPGGRY  71

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQ  288
             +  + F GPC + +     EG +  APT++ + +    WI+F  I   TLSG GT++G+
Sbjct  72   VVDSMKFQGPCLAPIHVQV-EG-RLQAPTNIKKMRNDASWIVFQYINGLTLSGKGTFDGR  129

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            GS AWK N+C  +     C +LPI++   +L N+++K I S DSKFFH+NV  C+NLTL 
Sbjct  130  GSLAWKQNQCASSGK---CGSLPISLRFYSLNNSLIKDITSTDSKFFHVNVHNCRNLTLQ  186

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             I I AP DS NTDGIHIG S GVT+ +A IKTGD
Sbjct  187  NINIDAPGDSPNTDGIHIGGSSGVTIHNARIKTGD  221



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 134/224 (60%), Gaps = 6/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MGS  I     F ++       +  + ++K  GAK DG  DD+ A  +AW E C +T PS
Sbjct  1    MGSKFILGTTFFLFLISFSIKARAADFDIKKYGAKADGKTDDSQAINRAWKEACASTTPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
            T+ + +G Y  G + F GPCK+ V+    EG    AP +  + K++DGW++F  I   T+
Sbjct  61   TVLIAKGNYMAGPVKFQGPCKAPVSIRV-EGT-LQAPAEPEKLKSQDGWVVFRNIDGLTV  118

Query  311  SGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SGG T++GQGS AW  N C +      C +LPIN+    LTN+ ++ I S +SK FH+NV
Sbjct  119  SGGGTFDGQGSIAWSKNDCAKTGK---CNSLPINIRFSGLTNSHIQNITSSNSKLFHINV  175

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKN+TL  + I AP +S NTDGIHIGRS  + +  AEIKTGD
Sbjct  176  LNCKNVTLQHVIITAPGESLNTDGIHIGRSSNINITGAEIKTGD  219



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 131/203 (65%), Gaps = 7/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAKGDG  DDTAAF   W +  +AT P+T+ VP+G Y + ++   GP KS
Sbjct  127  SGPSIDVKASGAKGDGKTDDTAAFMAVWKKAIEATTPTTITVPKGDYLVEELLLEGPSKS  186

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL--SGGTYNGQGSAAWKINKCKE  252
             +TF+     K  AP+ ++  K   GW+ F  +KDF L  +G  ++GQGS AWK+N CK+
Sbjct  187  PITFEMHGNLK--APSAVTTRKPHSGWVNFRKLKDFNLIGNGAIFDGQGSVAWKVNDCKQ  244

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C NLPIN+ L  L N+ + GI S +SK FHMN+ QC N+TL  + I AP +S N
Sbjct  245  TGK---CNNLPINIRLTQLDNSRISGITSTNSKLFHMNIHQCTNVTLQDVHIDAPPESLN  301

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIH+G+S GVT+  ++IKTGD
Sbjct  302  TDGIHVGKSVGVTIRGSKIKTGD  324



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 138/217 (64%), Gaps = 9/217 (4%)
 Frame = -2

Query  650  AALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEG  471
            A+L+F   + ++A  + + ++VK  G K DG  DD+ A  KAW + C AT  +TL++ +G
Sbjct  10   ASLLFLLHSVILA--KALTLDVKHYGVKVDGKTDDSQAINKAWKDACAATNATTLRIGKG  67

Query  470  KYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL-SGGTYN  294
             Y + ++ F GPCKS +T D      F AP++   +K ++ W+ F+ +   TL  GGT++
Sbjct  68   NYMVSKMAFQGPCKSPLTVDFQ--GTFKAPSNAKNYKNQE-WVSFTNLNGLTLFGGGTFD  124

Query  293  GQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLT  114
            GQG+ AW IN C +      C +LP N+ +  LTN++++ I S+DSK FH+N+I CKNLT
Sbjct  125  GQGAVAWSINNCAKTGK---CGSLPNNLRMTGLTNSIIRDITSLDSKLFHINIINCKNLT  181

Query  113  LNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            L +I I AP  S NTDGIHIGRS GV +  A IKTGD
Sbjct  182  LERITITAPESSLNTDGIHIGRSTGVNITSATIKTGD  218



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 140/232 (60%), Gaps = 14/232 (6%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQ--GV------EVNVKTSGAKGDGDCDDTAAFKKAWDE  516
            MGS  +  A IF Y+  L A ++  GV      E++V+  GAK DG  DD+     AW++
Sbjct  1    MGSKMMARAAIFLYLLSLAAAMRTGGVSMIGQAEIDVRKFGAKADGRSDDSQIIVNAWNK  60

Query  515  VCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILF  336
             C +  PST+ + +G Y  G + F GPCK+ V        K  AP DL++FK++  W+LF
Sbjct  61   ACTSPSPSTVVISKGSYLAGPLKFQGPCKADVNLKVEGAVK--APADLNKFKSQGSWVLF  118

Query  335  SMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVD  159
              I   TLSGG +++GQG+AAWK N C +      C +LP N+   ++ N+ V+ I S++
Sbjct  119  QNIDGLTLSGGGSFDGQGAAAWKENNCAQTGK---CNSLPTNLQFTSINNSHVQDITSLN  175

Query  158  SKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            SK FH+ ++ C N+TL  + I AP DS NTDGIH+GRS GV +  A+I+TGD
Sbjct  176  SKLFHVELLNCNNVTLQHVTIDAPEDSLNTDGIHVGRSMGVNIIGADIRTGD  227



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 126/197 (64%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV T GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  APTD S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APTDPSLFKT-DGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK+F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 125/203 (62%), Gaps = 6/203 (3%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++VK SGAK DG  DD+ AF  AW E C +  PST+ VP+G+Y +  I F GPCK 
Sbjct  145  SGASIDVKASGAKADGKTDDSGAFAAAWKEACASASPSTILVPKGEYLVNNIEFKGPCKG  204

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
             +TF+   G     P  L   K   GW+ F  + DFT++G    ++GQG+ AWK+N C +
Sbjct  205  PITFEV-NGNLKAPPNWLGGGKPHCGWLEFEKLTDFTINGNGAIFDGQGAIAWKVNDCAK  263

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C  LPIN+    LTN+ + GI S +SK FHMN+I CKN+T   I I AP +S N
Sbjct  264  TGK---CNTLPINIRFTGLTNSKIIGITSTNSKLFHMNIIDCKNVTFQNIGIDAPPESLN  320

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS GV + +++I+TGD
Sbjct  321  TDGIHIGRSNGVILRESKIRTGD  343



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV T GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APADPSLFKT-DGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK+F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV T GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVATYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APADPSLFKT-DGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK+F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 127/206 (62%), Gaps = 9/206 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A   G  ++VK SGAKGDG  DD+AAF  AW E C A   ST+ VP+G+Y +  + F GP
Sbjct  68   AKAGGASLDVKASGAKGDGKTDDSAAFMAAWKEACAAG--STITVPKGEYLVESLEFKGP  125

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINK  261
            CK  VT +     K  AP  +   K   GWI F  + DFTL+G    ++GQGS AWK N 
Sbjct  126  CKGPVTLELNGNLK--APATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKAND  183

Query  260  CKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPAD  81
            C +      C +LPIN+    LTN+ +K I S +SK FHMN++ CKN+TL  I I AP +
Sbjct  184  CAKTGK---CNSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPE  240

Query  80   SANTDGIHIGRSEGVTVDDAEIKTGD  3
            S NTDGIHIGRS GV +  A+IKTGD
Sbjct  241  SLNTDGIHIGRSNGVNLIGAKIKTGD  266



>ref|XP_006856225.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
 gb|ERN17692.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
Length=403

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 122/197 (62%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GAKGDG  DDT AF  AW E C +  P  L +P G Y +G + F GPCK+  T  
Sbjct  35   NVKDYGAKGDGKTDDTKAFMDAWKEACGSRGPGRLLIPWGAYLVGPLEFRGPCKNVPTMH  94

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    AP D+S+F + D W+LF  +   TL+GG T++GQGS+AW +NKC  N     
Sbjct  95   IQLIGILKAPRDMSKFGSLDTWVLFGWVDGLTLTGGGTFDGQGSSAWPLNKCTTNTK---  151

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++   +LTN VV+GI S++SKFFH+ ++ CK+   + IKI AP DS NTDGIH+
Sbjct  152  CKLLPTSVKFASLTNTVVRGISSLNSKFFHIAILDCKHFKASSIKITAPEDSPNTDGIHL  211

Query  53   GRSEGVTVDDAEIKTGD  3
              +  +T+  + I TGD
Sbjct  212  EGNTDITISQSTIGTGD  228



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 131/213 (62%), Gaps = 4/213 (2%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            I+  +  +VA       +VK+ GAK DG  DD+ A   AW   C + + S + +P+G Y 
Sbjct  6    IWMLMMAMVAGNHAAVFDVKSYGAKADGKSDDSKAILDAWKAACNSGQASNVLIPKGTYM  65

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGS  282
            +G +   GPCK+ +T +A + A+F+AP + +Q + ++GWI F  I  F L GG ++GQG 
Sbjct  66   VGSMIMEGPCKAPITIEANK-ARFVAPINPNQLRARNGWINFVGIDRFGLQGGRFDGQGE  124

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
             AW  N C   +    C ++PIN++   +TNA++  I S DSK +H++V+ CKN+T   I
Sbjct  125  LAWHQNNC---VGTGKCGSMPINLSFNRITNALIHSITSYDSKQYHIDVLSCKNVTFRSI  181

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +I AP  S NTDGIHI RS G+ V +A+IKTGD
Sbjct  182  RISAPDQSLNTDGIHIVRSSGINVTEADIKTGD  214



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APADPSLFKT-DGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK+F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 134/221 (61%), Gaps = 10/221 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLV--ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            + A L+ F +A  +  A   GV  NV   GA  DG  D++ AF+ AW E C     ST+ 
Sbjct  11   VLAILVLFSLAQNIINAASNGV-FNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVL  69

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP GKY +  + F GPCK+ ++F        +AP  LS+   K+ WI F  ++ FTL+GG
Sbjct  70   VPPGKYLVTSVVFKGPCKAPISFQLQ--GLILAPPGLSKLADKESWITFESLRSFTLTGG  127

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++GQG  AW  N+C +N N      LPI++    L ++ + G++SVDSKFFH+N++ C
Sbjct  128  GTFHGQGRTAWPENQCHKNSNC----QLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             NL LNKI I AP DS NTDGIHIGRS G+ + ++ I TGD
Sbjct  184  YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGD  224



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 134/221 (61%), Gaps = 10/221 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLV--ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            + A L+ F +A  +  A   GV  NV   GA  DG  D++ AF+ AW E C     ST+ 
Sbjct  11   VLAILVLFSLAQNIINAASNGV-FNVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVL  69

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP GKY +  + F GPCK+ ++F        +AP  LS+   K+ WI F  ++ FTL+GG
Sbjct  70   VPPGKYLVTSVVFKGPCKAPISFQLQ--GLILAPPGLSKLADKESWITFESLRSFTLTGG  127

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++GQG  AW  N+C +N N      LPI++    L ++ + G++SVDSKFFH+N++ C
Sbjct  128  GTFHGQGRTAWPENQCHKNSNC----QLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             NL LNKI I AP DS NTDGIHIGRS G+ + ++ I TGD
Sbjct  184  YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGD  224



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 124/198 (63%), Gaps = 9/198 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GAKGDG  DD AAF KAW +VC A    TL VP+G+Y +G +   GPCK  VT +
Sbjct  71   DVKVLGAKGDGKTDDCAAFAKAWTDVCAAG--GTLIVPKGEYLVGSLELKGPCKGPVTLE  128

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKENMNAP  237
                 K  AP  ++  K   GWI    + DFTL G     +GQG+ AWK+N C +     
Sbjct  129  LNGNLK--APATVAATKPHAGWIEIDNVCDFTLKGNNAILDGQGALAWKVNDCAKTGK--  184

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C +LPIN+ L  LTN+ + GI S +SK FHMN+I CKNLTL  I I APA+S NTDGIH
Sbjct  185  -CNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIH  243

Query  56   IGRSEGVTVDDAEIKTGD  3
            IGRS GV +  A+I+TGD
Sbjct  244  IGRSNGVNLIGAKIRTGD  261



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 133/221 (60%), Gaps = 10/221 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLV--ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            + A L+ F +A  +  A   GV  NV   GA  DG  D++ AF+ AW E C     ST+ 
Sbjct  11   VLAILVLFSLAQNIINAASNGV-FNVIDFGAMADGIRDNSKAFENAWREACNWNTYSTVL  69

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP GKY +    F GPCK+ ++F        +AP  LS+   K+ WI F  ++ FTL+GG
Sbjct  70   VPPGKYFVTSAVFKGPCKAPISFQLQ--GLILAPPGLSKLADKESWITFESLRSFTLTGG  127

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++GQG  AW  N+C +N N      LPI++    L ++ + G++SVDSKFFH+N++ C
Sbjct  128  GTFHGQGRTAWPENQCHKNSNC----QLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             NL LNKI I AP DS NTDGIHIGRS G+ + ++ I TGD
Sbjct  184  YNLKLNKINISAPDDSPNTDGIHIGRSNGIEISNSIIATGD  224



>ref|XP_006492953.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Citrus 
sinensis]
Length=360

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA  DG  D++ AF+ AW E C     ST+ VP GKY +  + F GPCK+ ++F 
Sbjct  6    NVIDFGAIADGIRDNSRAFENAWREACYWNTYSTVLVPPGKYLVTSVVFKGPCKAPISFQ  65

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                   +AP  LS+   K+ WI F  ++ FTL+GG T++GQG  AW  N+C +N N   
Sbjct  66   LQ--GLILAPPGLSKLADKESWITFESLRSFTLTGGGTFHGQGRTAWPENQCHKNSN---  120

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LPI++    L ++ + G++SVDSKFFH+N++ C NL LNKI I AP DS NTDGIHI
Sbjct  121  CQ-LPISIRFNKLNDSTITGVQSVDSKFFHINILGCYNLKLNKINISAPDDSPNTDGIHI  179

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + ++ I TGD
Sbjct  180  GRSNGIEISNSIIATGD  196



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 125/198 (63%), Gaps = 9/198 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GAK DG  DD AAF KAW +VC A    TL VP+G+Y +G++   GPCK  VT +
Sbjct  71   DVKILGAKADGKTDDCAAFSKAWTDVCAAG--GTLVVPKGEYLVGKLALKGPCKGPVTLE  128

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKENMNAP  237
                 K  AP  ++  +   GWI    + DFTL+G     +GQG+ AWK+N C +     
Sbjct  129  LNGNLK--APATVAANEPHAGWIEIDNVCDFTLNGNNAILDGQGALAWKVNDCAKTGK--  184

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C +LPIN+ L  LTN+ + GI S +SK FHMN+I CKNLTL  I I APA+S NTDGIH
Sbjct  185  -CNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIH  243

Query  56   IGRSEGVTVDDAEIKTGD  3
            IGRS GV +  A+I+TGD
Sbjct  244  IGRSNGVNLIGAKIRTGD  261



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APADPSLFKT-DGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK+F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKYFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V F+
Sbjct  26   NVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVEFE  85

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   
Sbjct  86   LQGTLK--APADPSLFKT-DGWVVFQHIDGLTMSGGGTFDGQGKTAWGQNDCAKNTN---  139

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TNA++  + ++DSK F +NV+  KN+T     + APADS NTDGIHI
Sbjct  140  CRTLPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGIHI  199

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS+GV + D++IKTGD
Sbjct  200  GRSDGVNILDSDIKTGD  216



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 125/199 (63%), Gaps = 7/199 (4%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
             +NV + GAKGDG  D + A   AW E C +T P+ + +P G + L ++   GPCK+ V 
Sbjct  24   SLNVASYGAKGDGSSDISQALLSAWKEACASTTPAKVLIPGGTFALTEVALDGPCKAPVE  83

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
            F+     K  AP D S FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N 
Sbjct  84   FELQGTLK--APADPSLFKT-DGWVVFQRIDGLTVSGGGTFDGQGKTAWGQNDCAKNTN-  139

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              C+ LP N+    +TNA++  + ++DSK F +NV+  KN+T     + APADS NTDGI
Sbjct  140  --CRTLPTNLRFNFVTNALIHDVTTLDSKNFQVNVLGAKNMTFQNFHVNAPADSINTDGI  197

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HIGRS+GV + D++IKTGD
Sbjct  198  HIGRSDGVNILDSDIKTGD  216



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 122/198 (62%), Gaps = 9/198 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GAKGDG  DD AAF  AW +VC A    TL VP+G Y +G +   GPCK  VT +
Sbjct  66   DVKVLGAKGDGKTDDCAAFATAWKDVCAAG--GTLIVPKGDYLVGSLELKGPCKGPVTLE  123

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKENMNAP  237
                 K  AP  ++  K   GWI    + DFTL G     +GQG+ AWK+N C +     
Sbjct  124  LNGNLK--APATVAATKPHAGWIEIDNVCDFTLKGNNAILDGQGALAWKVNDCAKTGK--  179

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C +LPIN+ L  LTN+ + GI S +SK FHMN+I CKNLTL  I I APA+S NTDGIH
Sbjct  180  -CNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIH  238

Query  56   IGRSEGVTVDDAEIKTGD  3
            IGRS GV +  A+I+TGD
Sbjct  239  IGRSNGVNLIGAKIRTGD  256



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 122/198 (62%), Gaps = 9/198 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GAKGDG  DD AAF  AW +VC A    TL VP+G Y +G +   GPCK  VT +
Sbjct  66   DVKVLGAKGDGKTDDCAAFATAWKDVCAAG--GTLIVPKGDYLVGSLELKGPCKGPVTLE  123

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGT--YNGQGSAAWKINKCKENMNAP  237
                 K  AP  ++  K   GWI    + DFTL G     +GQG+ AWK+N C +     
Sbjct  124  LNGNLK--APATVAATKPHAGWIEIDNVCDFTLKGNNVILDGQGALAWKVNDCAKTGK--  179

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C +LPIN+ L  LTN+ + GI S +SK FHMN+I CKNLTL  I I APA+S NTDGIH
Sbjct  180  -CNSLPINIRLTGLTNSKIMGITSTNSKLFHMNIINCKNLTLENIGIDAPAESLNTDGIH  238

Query  56   IGRSEGVTVDDAEIKTGD  3
            IGRS GV +  A+I+TGD
Sbjct  239  IGRSNGVNLIGAKIRTGD  256



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/229 (43%), Positives = 130/229 (57%), Gaps = 12/229 (5%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVAT-----VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCK  507
            M S+ I AAL       LVA+        +  ++   G KG  D D T AF  AW+  C 
Sbjct  3    MESHCI-AALCVLVTHLLVASFVQSAADSITFSITNYGLKGTEDEDITKAFSVAWEAACS  61

Query  506  ATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMI  327
            +T PS L VP+G Y L Q+ F GPCK+ +        K  AP D S F  K GWI F  I
Sbjct  62   STSPSKLIVPKGTYVLRQVVFEGPCKAPLELQVHGTIK--APEDPSYFIEKAGWISFQRI  119

Query  326  KDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKF  150
              F L G GT++GQGS AW  N C +      C  LPIN+    +TN +V+ I S++SK 
Sbjct  120  DRFALVGNGTFDGQGSTAWSQNDCHKTGE---CNKLPINIRFNFITNGLVQDITSLNSKL  176

Query  149  FHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            FH+NV+ C NLT +++ I+AP DS NTDGIHIGRS+ + + D+ + TGD
Sbjct  177  FHINVLGCNNLTFSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGD  225



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG+ D + A  KAW + C +   ST+ +P+G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+F+ + GWI F  I  FTLSG G ++GQG   W   KC   +++  
Sbjct  88   VVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWG-TKC---LSSAY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPIN+    +TN++VK I S DSK FH+N++ CKNLT   I I AP +S NTDGIHI
Sbjct  143  CNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG+ D + A  KAW + C +   ST+ +P+G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+F+ + GWI F  I  FTLSG G ++GQG   W   KC   +++  
Sbjct  88   VVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWG-TKC---LSSSY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPIN+    +TN++VK I S DSK FH+N++ CKNLT   + I AP +S NTDGIHI
Sbjct  143  CNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG+ D + A  KAW + C +   ST+ +P+G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+F+ + GWI F  I  FTLSG G ++GQG   W   KC   +++  
Sbjct  88   VVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKTVWG-TKC---LSSSY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPIN+    +TN++VK I S DSK FH+N++ CKNLT   + I AP +S NTDGIHI
Sbjct  143  CNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNVVISAPQESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 129/229 (56%), Gaps = 12/229 (5%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVAT-----VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCK  507
            M S+ I AAL       LVA+        V  ++   G KG  D D T AF  AW   C 
Sbjct  3    MESHCI-AALCALVTHLLVASFVQSAADSVTFSIANYGLKGTEDEDITKAFSVAWKAACS  61

Query  506  ATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMI  327
            +T PS L VP+G Y L Q+ F GPCK+ +        K  AP D S F  K GWI F  I
Sbjct  62   STSPSKLIVPKGTYVLRQVVFEGPCKAPLELQVHGTIK--APEDPSDFIEKAGWISFQRI  119

Query  326  KDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKF  150
              F L G GT++GQGS AW  N C +      C  LPIN+    +TN +V+ I S++SK 
Sbjct  120  DRFALVGNGTFDGQGSTAWSQNDCHKTGE---CNKLPINIRFNFITNGLVQDITSLNSKL  176

Query  149  FHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            FH+NV+ C NLT +++ I+AP DS NTDGIHIGRS+ + + D+ + TGD
Sbjct  177  FHINVLGCNNLTFSRVNIKAPEDSPNTDGIHIGRSKNINITDSVMSTGD  225



>gb|KDO58458.1| hypothetical protein CISIN_1g045893mg [Citrus sinensis]
Length=327

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  539  AFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFK  360
            A   AW E C +  PST+ + +G Y +G + F GPCKS +T    EG K  AP +L +  
Sbjct  12   AIASAWKEACTSENPSTVVISKGNYMVGSVTFKGPCKSPITLHI-EG-KLKAPVELERLS  69

Query  359  TKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAV  183
            ++DGWI+F  I    +SGG T++GQGSAAW  N C++      C +LPIN+   ++TN+ 
Sbjct  70   SQDGWIVFQDIDGLQVSGGGTFDGQGSAAWAKNDCRKTGK---CNSLPINLRFSSVTNSK  126

Query  182  VKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            ++ + S++SK FH+N++ CKNL+L  I I APA+S NT GIHIGRS GV + DA+IKTGD
Sbjct  127  MQDVTSLNSKLFHINILNCKNLSLQHISINAPANSLNTAGIHIGRSNGVHITDADIKTGD  186



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 125/216 (58%), Gaps = 12/216 (6%)
 Frame = -2

Query  647  ALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGK  468
            AL+FF      +T + +  ++   GA G    D T A   AW E C ATE S + VP G 
Sbjct  12   ALLFF-----ASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGT  66

Query  467  YRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNG  291
            Y L ++   GPCKS++  +        AP D +Q KT DGW+ F  +   TLSG GT++G
Sbjct  67   YVLREVVLEGPCKSSI--EVQVDGTLQAPADPAQMKT-DGWVAFRGVDLLTLSGSGTFDG  123

Query  290  QGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTL  111
            QG  AW  N C    +   C  LPIN+   ++TN +VK I S+DSK FH+NV+ CKNLT 
Sbjct  124  QGKTAWTKNDCNLKTD---CVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTF  180

Query  110  NKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              + I AP DS NTDGIHIGRS G+ + D  IKTGD
Sbjct  181  QHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGD  216



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/216 (45%), Positives = 125/216 (58%), Gaps = 12/216 (6%)
 Frame = -2

Query  647  ALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGK  468
            AL+FF      +T + +  ++   GA G    D T A   AW E C ATE S + VP G 
Sbjct  12   ALLFF-----ASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEASKVLVPAGT  66

Query  467  YRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNG  291
            Y L ++   GPCKS++  +        AP D +Q KT DGW+ F  +   TLSG GT++G
Sbjct  67   YVLREVVLEGPCKSSI--EVQVDGTLQAPADPAQMKT-DGWVAFRGVDLLTLSGSGTFDG  123

Query  290  QGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTL  111
            QG  AW  N C    +   C  LPIN+   ++TN +VK I S+DSK FH+NV+ CKNLT 
Sbjct  124  QGKTAWTKNDCNLKTD---CVTLPINIRFDSVTNGMVKDITSLDSKQFHVNVLNCKNLTF  180

Query  110  NKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              + I AP DS NTDGIHIGRS G+ + D  IKTGD
Sbjct  181  QHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGD  216



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 127/225 (56%), Gaps = 9/225 (4%)
 Frame = -2

Query  674  EMGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEP  495
            EMG  +I  A I     +  +T + +  ++   GA G    D T A   AW E C ATE 
Sbjct  65   EMGKISILPAAIALL--FFASTARSLVCDIAKYGAGGGTSSDITQALVSAWKEACAATEA  122

Query  494  STLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFT  315
            S + VP G Y L ++   GPCKS++           AP D +Q KT DGW+ F  +   T
Sbjct  123  SKVLVPAGTYVLREVVLEGPCKSSIEVQV--DGTLQAPADPAQMKT-DGWVAFRGVDLLT  179

Query  314  LSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMN  138
            LSG GT++GQG  AW  N C    +   C  LPIN+   ++TN +VK I S+DSK FH+N
Sbjct  180  LSGSGTFDGQGKTAWTKNDCNLKTD---CVTLPINIRFDSVTNGMVKDITSLDSKQFHVN  236

Query  137  VIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            V+ CKNLT   + I AP DS NTDGIHIGRS G+ + D  IKTGD
Sbjct  237  VLNCKNLTFQHVTITAPGDSPNTDGIHIGRSTGINIIDTGIKTGD  281



>ref|XP_006845389.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
 gb|ERN07064.1| hypothetical protein AMTR_s00019p00055210 [Amborella trichopoda]
Length=410

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 132/227 (58%), Gaps = 12/227 (5%)
 Frame = -2

Query  659  AIQAALIFFYVAYLVA-------TVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKAT  501
            A+   ++F  +AY+ A       +    E NV   GA  DG  D++ AF  AW   C+  
Sbjct  12   ALLCYVVFIAIAYVAAVEAANGNSSSAGEFNVMQFGAIADGTTDNSEAFGAAWKAACEWK  71

Query  500  EPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKD  321
             PS L +PEG + +G + F GPC SA         K  A TD+S++ + D WI+F  +  
Sbjct  72   GPSRLLIPEGTFLVGPVLFKGPCPSASPMVVQVKGKVKALTDMSKYPS-DEWIVFQYVDG  130

Query  320  FTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFH  144
              ++GG T++GQG++AW++N+C +  +   CK LP ++    +TN  ++GI SVDSK FH
Sbjct  131  LVVTGGGTFDGQGASAWRLNQCPKKAH---CKLLPTSLKFNFITNGEIRGIHSVDSKLFH  187

Query  143  MNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            M +  CKNL +  IKI APADS NTDGIH+G S  +T+  + I TGD
Sbjct  188  MLLFGCKNLNVQSIKISAPADSPNTDGIHVGSSSNITISRSHIGTGD  234



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 120/197 (61%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG  D + A  KAW + C +   ST+ +P G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+FK + GWI F  I  FTLSGG  ++GQG   W   KC    +   
Sbjct  88   VVQGT-VMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWG-RKCP---HYAY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LPIN+    +TN++VK I S DSK FH+N++ CKNL    + I AP +S NTDGIHI
Sbjct  143  CKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 127/227 (56%), Gaps = 11/227 (5%)
 Frame = -2

Query  665  SNAIQAALIFFYVAYLVATV-----QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKAT  501
            S A  ++ ++FY    V  V       V  ++   G  G  D D T AF  AW   C + 
Sbjct  32   SRANSSSRVYFYGGATVPFVWETCPDSVAFSITKYGLIGTEDEDITKAFSIAWKAACSSP  91

Query  500  EPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKD  321
              S L +P G Y L Q+ F GPCK+ +        K  AP D S F  K GWI F  I  
Sbjct  92   SLSQLVIPNGSYILRQVRFEGPCKAPLELQVHGIIK--APEDPSDFIEKAGWITFQRIDH  149

Query  320  FTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFH  144
            FTL G GT++GQGS AW  N C +      C  LPIN+    +TN +V+ I S++SK FH
Sbjct  150  FTLVGNGTFDGQGSTAWSHNDCHKTGE---CNKLPINIRFNFITNGLVQDITSLNSKLFH  206

Query  143  MNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +NV+ C NLT +++KI+AP DS NTDGIHIGRS+ + + D+E+ TGD
Sbjct  207  INVLGCTNLTFDRVKIKAPEDSPNTDGIHIGRSKNINIIDSEMSTGD  253



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 120/197 (61%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG  D + A  KAW + C +   ST+ +P G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARADGHSDISQALLKAWGDSCSSPVASTVMIPNGTYALGQITIGGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+FK + GWI F  I  FTLSGG  ++GQG   W   KC    +   
Sbjct  88   VVQGT-VMAPVDTSRFKAEAGWIAFQQIDQFTLSGGGVFDGQGKTVWG-RKCP---HYAY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LPIN+    +TN++VK I S DSK FH+N++ CKNL    + I AP +S NTDGIHI
Sbjct  143  CKQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLAFYNVAISAPDESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 115/198 (58%), Gaps = 7/198 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GAK  G  D + A   AW E C    PS + +PEG+Y L Q+   GPCK+ V   
Sbjct  30   DVMNFGAKAGGKTDISQALMAAWREACALVSPSKVVIPEGEYVLSQVTLAGPCKAPVEVQ  89

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGS-AAWKINKCKENMNAP  237
                 K  AP D S+F     W+ F  I  FTLSG GT++GQG  AAW  N CK++    
Sbjct  90   VRGNLK--APADPSKFNNVPSWVTFQRIDHFTLSGAGTFDGQGGYAAWAQNDCKQSKK--  145

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C  LPIN+    +TN +V+ I SVDSK FH+N++ CKNLT   I I AP  S NTDGIH
Sbjct  146  -CNKLPINIRFNFVTNGLVRDITSVDSKQFHINLLGCKNLTFANITINAPDQSPNTDGIH  204

Query  56   IGRSEGVTVDDAEIKTGD  3
            IGRS G+ + D+ I TGD
Sbjct  205  IGRSSGIDITDSRISTGD  222



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 120/195 (62%), Gaps = 6/195 (3%)
 Frame = -2

Query  587  VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA  408
            ++     G G  D T +   AW + C +T    + +P G + L ++   GPCK+ V F+ 
Sbjct  27   IENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVLEGPCKAHVEFEV  86

Query  407  AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKENMNAPLCK  228
               A+ +AP +LS+FKT DGW++F  I   T+ GGT++GQG  AW  N C +N N   C+
Sbjct  87   H--ARLLAPPELSRFKT-DGWVVFHNIDGLTMLGGTFDGQGKMAWAQNDCIKNKN---CR  140

Query  227  NLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGR  48
             LP+N+    ++NA++  + SVDSK+FH+ V+ CKN+T     + AP +S NTDGIHIGR
Sbjct  141  MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVNTDGIHIGR  200

Query  47   SEGVTVDDAEIKTGD  3
            S GV + D +IKTGD
Sbjct  201  SLGVNILDTDIKTGD  215



>ref|XP_006447721.1| hypothetical protein CICLE_v10017883mg, partial [Citrus clementina]
 gb|ESR60961.1| hypothetical protein CICLE_v10017883mg, partial [Citrus clementina]
Length=337

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 118/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  539  AFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFK  360
            A   AW E C +   ST+ + +G Y +G + F GPCKS +T    EG K  AP +L +  
Sbjct  59   AIASAWKEACTSENLSTVVISKGNYMVGSVTFKGPCKSPITLHI-EG-KLKAPVELERLS  116

Query  359  TKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAV  183
            ++DGWI+F  I    +SGG T++GQGSAAW  N C++      C +LPIN+   ++TN+ 
Sbjct  117  SQDGWIVFQDIDGLQVSGGGTFDGQGSAAWAKNDCRKTGK---CSSLPINLRFSSVTNSK  173

Query  182  VKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            ++ + S++SK FH+N++ CKNL+L  I I APA+S NT GIHIGRS GV + DA+IKTGD
Sbjct  174  MQDVTSLNSKLFHINILNCKNLSLQHISINAPANSLNTAGIHIGRSNGVHITDADIKTGD  233



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 120/195 (62%), Gaps = 6/195 (3%)
 Frame = -2

Query  587  VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA  408
            ++     G G  D T +   AW + C +T    + +P G + L ++   GPCK+ V F+ 
Sbjct  27   IENYNVTGGGIPDITQSLLDAWKKACASTTRPKVLIPGGTFTLSEVVLEGPCKAHVEFEV  86

Query  407  AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKENMNAPLCK  228
               A+ +AP +LS+FKT DGW++F  I   T+ GGT++GQG  AW  N C +N N   C+
Sbjct  87   H--ARLLAPPELSRFKT-DGWVVFHNIDGLTMLGGTFDGQGKMAWAQNDCIKNKN---CR  140

Query  227  NLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGR  48
             LP+N+    ++NA++  + SVDSK+FH+ V+ CKN+T     + AP +S NTDGIHIGR
Sbjct  141  MLPMNLRFNVVSNAIIHDVTSVDSKYFHVTVLGCKNVTFQHFHVNAPGNSVNTDGIHIGR  200

Query  47   SEGVTVDDAEIKTGD  3
            S GV + D +IKTGD
Sbjct  201  SLGVNILDTDIKTGD  215



>ref|XP_010530386.1| PREDICTED: exopolygalacturonase [Tarenaya hassleriana]
Length=428

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 122/203 (60%), Gaps = 4/203 (2%)
 Frame = -2

Query  608  VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK  429
            +  V VNV + GA+ D   D++ AF  AW++ CKA+    L +P+G Y LG + F GPC+
Sbjct  48   INSVIVNVHSYGARADARTDNSKAFLAAWNKACKASGSVVLVIPKGVYSLGPLRFAGPCR  107

Query  428  SAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKE  252
            +             A TDLS++++  GWI F  I   TL+ GGT++GQG++AW  N C  
Sbjct  108  NVSDITVHLKGHLKAVTDLSKYRSGTGWIEFGWIDGLTLTGGGTFDGQGASAWPFNGCPT  167

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
            + N   CK LP N+    +   V++GI SV+SKFFH+ +++C++    +IKI AP+DS N
Sbjct  168  DFN---CKLLPTNVKFVGMNRTVIRGITSVNSKFFHIALVECRDFKGTRIKISAPSDSPN  224

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDG+HI RS  V    + I TGD
Sbjct  225  TDGVHIERSSNVYFSRSSIATGD  247



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 133/224 (59%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MGS +       F VA+ + T    + +V+  GAK DG  DD+ A  KAW + C AT  S
Sbjct  1    MGSKSFLGTCFLFLVAFSL-TANAADFDVRKYGAKADGKTDDSQAINKAWTDACTATSQS  59

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
            T+ + +  Y +G + F GPCK+ ++   A     +AP +  + K++DGW++F  + + ++
Sbjct  60   TVVIEKRNYLVGPVRFGGPCKAPISIKVA--GTLVAPAEPEKLKSQDGWVVFQNVDNLSV  117

Query  311  SGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
             GG  ++GQG  AW  N   +      C +LPIN+ +  +TN+ ++   S++SK FH+NV
Sbjct  118  FGGXVFDGQGKLAWSRNDFAKTGK---CNSLPINIRITGVTNSHIQDKTSLNSKLFHINV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            I  K+LTL +I I AP +S NTDGIHIGRS  + V DA IKTGD
Sbjct  175  INSKHLTLQRITIDAPQESLNTDGIHIGRSSYINVTDANIKTGD  218



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 124/197 (63%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG+ D + A  KAW + C +   ST+ +P+G Y LGQI   GPCK+ + F 
Sbjct  29   DVTKYGARTDGNSDISQALLKAWGDACSSPVASTVMIPDGTYALGQIIIAGPCKAPINF-  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
              +G   +AP D S+F+ + GWI F  I  FTLSG G ++GQG   W   KC   +++  
Sbjct  88   VVQGT-VMAPVDTSRFRAEAGWITFQQIDQFTLSGDGVFDGQGKIVWG-TKC---LSSAY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPIN+    +TN++VK I S DSK FH+N++ CKNLT   I I AP +S NTDGIHI
Sbjct  143  CNQLPINLRFNFITNSMVKDITSRDSKQFHINLLGCKNLTFYNIVISAPQESLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ + D+ I+TGD
Sbjct  203  GRSSGINITDSTIETGD  219



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 130/221 (59%), Gaps = 10/221 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYL--VATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            + AA + +++ +L  V  VQG   +VK  GAK +G  DD+ A   AW + C A E ST+ 
Sbjct  5    MMAAGVAYHLCFLLLVTQVQGSNFDVKAYGAKANGMTDDSKAINSAWKDACAAKEASTVV  64

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            + +G Y +G + F GPC + VT       K  AP D  + +  D W+ F  ++  T+SGG
Sbjct  65   IAKGNYMVGPLKFEGPCTAPVTVKVQGTLK--APADPKRLR--DDWVAFRNVEGLTVSGG  120

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
              ++GQG+ AW +N C +      C +LP N+    LTN+ ++GI S++SK FHMN++ C
Sbjct  121  GIFDGQGAIAWSVNNCAKTGK---CNSLPTNLQFTKLTNSKIEGITSLNSKLFHMNILNC  177

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             N+T   I I AP +S NTDGIHIGRS  V +  A IKTGD
Sbjct  178  NNVTFQNIVINAPKNSLNTDGIHIGRSTMVNITGATIKTGD  218



>emb|CBI37725.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/197 (46%), Positives = 116/197 (59%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV++ GA+ DG  DD  AF  AW E C +T    L +P+G Y +G I F GPC S  +  
Sbjct  54   NVRSFGAQADGHTDDRRAFTAAWKEACASTGKVKLLIPKGTYMIGPITFAGPCNSVSSLT  113

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A TDLS++    GWI F  +K  TL+GG T++GQG  AW  NKC  N N   
Sbjct  114  G----YLKATTDLSEYGFSAGWIEFGWMKGLTLTGGGTFDGQGVEAWPYNKCPINAN---  166

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    +   VV+GI SV+SKFFH+ +++C N   ++IKI AP +S NTDGIHI
Sbjct  167  CKLLPTNLKFIAMNKTVVRGITSVNSKFFHIALVECNNFKGSQIKISAPENSPNTDGIHI  226

Query  53   GRSEGVTVDDAEIKTGD  3
             RS GV    + I TGD
Sbjct  227  ERSSGVYFSRSLIGTGD  243



>ref|XP_010999531.1| PREDICTED: polygalacturonase-like [Populus euphratica]
Length=326

 Score =   169 bits (428),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K     D T A   AW + C +T+PS
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+           AP D ++    D W+ F  +  FTL
Sbjct  61   KVLIPRGTYWLRKVTIAGPCKAAIKLQV--DGILQAPVDPNKLSGGD-WVNFRYVDQFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C ++ N   CK LP+NM    +TNA+V+ I ++DSK FH+NV
Sbjct  118  SGSGTFDGQGKVAWSKSTCHKDKN---CKGLPMNMRFDFITNALVRDITTLDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     +RAP +S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGD  218



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   171 bits (432),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 125/216 (58%), Gaps = 12/216 (6%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             FY+   V   Q V +++   GAK +GD   T     AW + C A  P+ + VP G + L
Sbjct  12   LFYLFVCVVRSQNV-IDITKLGAKPNGDA--TQGLMAAWKQACAAPAPTKIVVPPGSFLL  68

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL----SGGTYNG  291
              I F GPCK+AVT + A    F AP + +Q K  D W+    I+  T+    +GGT++G
Sbjct  69   NVIKFTGPCKAAVTIEIA--GNFKAPPNPAQMKGSDTWVKIENIQGLTINCLPTGGTFDG  126

Query  290  QGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTL  111
            QG  AWK N C +  +   C NLP N    +LTN+ + GIKS++SK +HM V+ CKN TL
Sbjct  127  QGQMAWKQNNCAKTGS---CNNLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLGCKNFTL  183

Query  110  NKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
                I+AP DS NTDGIHIGRS G+ V  A+I TGD
Sbjct  184  FDTTIQAPKDSLNTDGIHIGRSAGIFVTKAKIGTGD  219



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score =   172 bits (437),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 121/203 (60%), Gaps = 9/203 (4%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
             G  ++V   GAKGDG  DD+AAF  AW++ C A    T+ VP+G Y +  +   GPCK 
Sbjct  128  SGGSLDVVALGAKGDGKTDDSAAFTSAWEKACAAG--GTITVPKGDYLVNSLMLKGPCKG  185

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKE  252
             +T +     K  APT   Q K   GWI    + DFTL+G    ++GQG+AAWK N C +
Sbjct  186  PITMELNGNMK--APTTFDQAKKHCGWIEIMKVADFTLNGNGAIFDGQGAAAWKANDCAK  243

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
                  C NLPIN+    LTNA + GI S +SK FH+N+  C N+TL  I I AP +S N
Sbjct  244  TGK---CNNLPINIRFTGLTNAKIIGITSTNSKLFHINIHGCNNMTLQDIGIDAPPESLN  300

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIGRS GV +  A+IKTGD
Sbjct  301  TDGIHIGRSNGVNLIGAKIKTGD  323



>ref|XP_006845467.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
 gb|ERN07142.1| hypothetical protein AMTR_s00019p00130680 [Amborella trichopoda]
Length=383

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 121/197 (61%), Gaps = 5/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA  DG  D+T AF  AW   C+   PS+L +PEG + +G + F GPC +A    
Sbjct  15   NVMQFGAIADGTKDNTEAFGAAWKAACEWKGPSSLVIPEGTFLVGPVLFKGPCPNASPVV  74

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  A TD+S++ + D WI+F  +    L+GG T++GQG++AW +N+C +  +   
Sbjct  75   VQVKGKVKASTDMSKYPSDD-WIVFQYVDGLLLTGGGTFDGQGASAWSLNQCPKKAH---  130

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++    +TN  ++GI SVDSK FHM +  CKN+ +  IKI APADS NTDGIHI
Sbjct  131  CKLLPTSLKFSFITNGAIRGINSVDSKLFHMLLFGCKNMEVQSIKISAPADSPNTDGIHI  190

Query  53   GRSEGVTVDDAEIKTGD  3
            G S  +T+  ++I TGD
Sbjct  191  GSSSNITISRSQIGTGD  207



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K     D T A   AW + C +T+PS
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALANAWKDACASTKPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+           AP D ++    D W+ F  +  FTL
Sbjct  61   KVLIPRGTYWLRKVTIAGPCKAAIKLQV--DGILQAPVDPNKLSGGD-WVNFRYVDQFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C  + N   CK LP+NM    +TNA+V+ I ++DSK FH+NV
Sbjct  118  SGSGTFDGQGKVAWSRSTCHRDKN---CKGLPMNMRFDYITNALVRDITTLDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     +RAP +S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVRAPRESVNTDGIHIGRSTGIYIIDSKISTGD  218



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 131/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A++ F +  L+A+    + N      K  G  D TAA   AW + C +T+PS
Sbjct  1    MGLKVVSSAIVLFSLLLLLASTAKAQSNGVFDVTKYGGKQDITAALTNAWKDACASTKPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             +++P G Y L Q+   GPCKSA+        K  AP +  QF +   W+ F  I   TL
Sbjct  61   KVRIPSGTYSLRQVTLAGPCKSAIELQVNGILK--APVNPDQF-SGGHWVNFRYIDHLTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG+ AW  + C +N N   C+ LP+N+    +TN +V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGNVAWSKSTCSKNKN---CEGLPMNIRFDFITNGLVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + APA+S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTGD  218



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 8/207 (4%)
 Frame = -2

Query  617  VATVQG-VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            VA V G    +V   GA+ DG  D + A   AW+  C +   S + +P G Y LGQ+   
Sbjct  17   VAEVSGDTYFDVTKYGAQADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIE  76

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKIN  264
            GPCK+ +        +  AP D S+FK + GW+ F  +  FTLSG G ++GQG + W+  
Sbjct  77   GPCKAPINLIVKGTVR--APVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWR-Q  133

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
            KC        C  LPIN+    LTN+++K I S DSK FH+NV++C+N+T  ++ I AP 
Sbjct  134  KCSRTK---YCHQLPINLRFNFLTNSIIKDITSKDSKQFHINVLRCRNITFFQVAITAPE  190

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            DS NTDGIHIGRS GV +  + I+TGD
Sbjct  191  DSQNTDGIHIGRSRGVNITHSTIQTGD  217



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 125/233 (54%), Gaps = 21/233 (9%)
 Frame = -2

Query  659  AIQAALIFFYVAYLVATV----------QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVC  510
            A Q  L  F++ Y +  +           G  +++   GAK +GD   T AF  AW   C
Sbjct  2    APQTILPLFFILYHLLIIAVDAKVPALRHGAVLDITRHGAKPNGDA--TQAFLHAWKVAC  59

Query  509  KATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSM  330
             +T PS + VP G Y L  I   GPCKS VT +      F AP D +QFK +D W+    
Sbjct  60   ASTTPSKVLVPRGSYILHAIKLQGPCKSRVTIEIL--GNFKAPADPAQFKGEDTWVKIER  117

Query  329  IKDFTLSG----GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSV  162
            I   T++     G ++G G  AWK N C +      C +LP N     LTN+V+ GI S+
Sbjct  118  IDGLTITAPKGAGVFDGAGQIAWKQNDCSKTGK---CNSLPYNFRFNFLTNSVINGITSL  174

Query  161  DSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +SK FHM ++ CK L ++ I + APADS NTDGIHIGRS+GV +  A I TGD
Sbjct  175  NSKLFHMAILGCKQLRIHDITVTAPADSLNTDGIHIGRSDGVNITAAHIGTGD  227



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 124/220 (56%), Gaps = 9/220 (4%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGV-EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKV  480
            I AA +F   A       GV +V   T GAK   D   T A  KAW + C +  PS + V
Sbjct  7    ILAAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDI--TQALAKAWTDACASPTPSKVVV  64

Query  479  PEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-  303
            P G Y L +  F GPCK+ +        K  AP D  +    D W+ F  +   T+SGG 
Sbjct  65   PSGTYMLTEASFKGPCKAPIEIQVQ--GKLTAPADGGKLTKPDTWVCFEHVNKLTVSGGG  122

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
            T++GQG+ AWK N C +N +   CK++ INM    +TN+ ++ I S+DSK FH+NV+ C 
Sbjct  123  TFDGQGALAWKKNDCNKNKD---CKSMAINMRFDFVTNSTIQDITSLDSKNFHVNVLGCH  179

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            N+T  ++ + AP +S NTDGIHIGRS G+ + DA I TGD
Sbjct  180  NVTFQRVNVTAPGESINTDGIHIGRSTGINITDAHIGTGD  219



>ref|XP_007043095.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007043096.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98926.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX98927.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=429

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 116/197 (59%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GA+ DG  DD+ AF+ AW + C+AT    L +P G Y +G + F GPC +     
Sbjct  59   NVKSFGARADGLTDDSKAFRAAWKKACQATGEVDLVIPRGTYLVGPVKFAGPCTNVSKIT  118

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A T+LSQ+    GW+ F  ++   L+GG T++GQG+ AW  N+C  + N   
Sbjct  119  VRVKGYLKATTNLSQYGYSAGWVEFKWVEGLILTGGGTFDGQGAKAWPYNRCPTDFN---  175

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+        VV+ I SV+SKFFHM +++CKN   +KIKI APADS NTDGIHI
Sbjct  176  CKLLPTNVKFVGTNRTVVRSITSVNSKFFHMALVECKNFKGSKIKISAPADSPNTDGIHI  235

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  236  ERSSSVHFSRSLIGTGD  252



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 124/215 (58%), Gaps = 8/215 (4%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            L+ F  +   A    V+V V   GAK D   D +     AW E C +T PS + +P+G Y
Sbjct  14   LLLFTTSIPKAQSTVVDV-VAKYGAKADEKTDLSTPLLNAWKEACASTTPSKIVIPKGTY  72

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            RL +    GPCKSA+    +   K  AP D S FK  + W++F+ +   T+SGG  ++GQ
Sbjct  73   RLSRASLDGPCKSAIELQVSGIIK--APADPSAFKDPN-WVVFNHVDHLTISGGGVFDGQ  129

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+A W  N C +N     C  LPIN+    ++NA+V+GI + DSK FH+NV+ C+N T  
Sbjct  130  GAAVWGKNNCAKNK---YCAALPINLRFNYVSNAIVQGITTKDSKQFHVNVLGCRNFTFQ  186

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
               + AP +S NTDGIHIGRS GV V D  IKTGD
Sbjct  187  HFTVSAPENSINTDGIHIGRSNGVKVLDTNIKTGD  221



>ref|XP_010266273.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=428

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 117/197 (59%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAKGDG  DD+ AF +AW   C A+   TL++P+  Y +G + F GPC +  +  
Sbjct  58   NVISYGAKGDGKHDDSQAFAEAWKAACGASGTVTLEIPKATYLVGPVKFSGPCTNVKSIT  117

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL  +   D WI F  +   TL+G GT++GQG+ +W  NKC    N   
Sbjct  118  VDMKGYLKATTDLKMYGKTDDWIEFGWVDGLTLTGDGTFDGQGAESWSFNKCPVTKN---  174

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP N+    +TN VV+GI S++SKFFHM +I CKN   ++I+I AP +S NTDGIHI
Sbjct  175  CQVLPTNVKFVAMTNTVVRGITSLNSKFFHMGLIDCKNFVGSEIRISAPENSPNTDGIHI  234

Query  53   GRSEGVTVDDAEIKTGD  3
             R  GV +  + I TGD
Sbjct  235  ERCTGVEIYHSSIGTGD  251



>emb|CBI28399.3| unnamed protein product [Vitis vinifera]
Length=358

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 119/207 (57%), Gaps = 8/207 (4%)
 Frame = -2

Query  617  VATVQG-VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            VA V G    +V   GA+ DG  D + A   AW+  C +   S + +P G Y LGQ+   
Sbjct  17   VAEVSGDTYFDVTKYGAQADGKTDISQALLTAWEAACASPIASRVVIPAGIYALGQVTIE  76

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKIN  264
            GPCK+ +        +  AP D S+FK + GW+ F  +  FTLSG G ++GQG + W   
Sbjct  77   GPCKAPINLIVKGTVR--APVDTSRFKPQAGWVAFQHLDQFTLSGYGVFDGQGQSVWG-Q  133

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
            KC        C  LPIN+    LTN+++K I S DSK FH+NV+ C+N+T  ++ I AP 
Sbjct  134  KCSR---TKYCHQLPINLRFNFLTNSIIKDITSKDSKQFHINVLGCRNITFFQVAITAPE  190

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            DS NTDGIHIGRS GV +  + I+TGD
Sbjct  191  DSQNTDGIHIGRSRGVNITHSTIQTGD  217



>ref|XP_006371365.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
 gb|ERP49162.1| hypothetical protein POPTR_0019s09490g [Populus trichocarpa]
Length=326

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K     D T A   AW   C +T+PS
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D ++  +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILK--APVDPNKL-SGGHWVNFRYVDQFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C ++ N   CK LP+N+    +TNA+V+ I ++DSK FH+NV
Sbjct  118  SGRGTFDGQGKVAWSKSTCHKDKN---CKGLPMNLRFDFITNALVRDITTLDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     +RAP +S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGD  218



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 112/193 (58%), Gaps = 7/193 (4%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAK DG  D + A   AW + C    PS + +PEG+Y L Q+   GPCK+ +        
Sbjct  35   GAKADGKTDISQALMAAWRKACAVVSPSKVVIPEGEYILSQVTLAGPCKAPLEVQVRGTL  94

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGS-AAWKINKCKENMNAPLCKNL  222
            K  A  D S+F     W+ F  I  FTLSG GT++GQG  AAW  N CK+      C  L
Sbjct  95   K--ATADPSKFNNVPTWVTFQRIDRFTLSGAGTFDGQGGKAAWAQNDCKQ---VGRCNKL  149

Query  221  PINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSE  42
            PIN+    +TN +V+ I SVDSK  H+N++ CKNLT   I + APA S NTDGIHIGRS 
Sbjct  150  PINLRFNAVTNGLVRDITSVDSKQTHINLLSCKNLTFANITVNAPAQSPNTDGIHIGRSS  209

Query  41   GVTVDDAEIKTGD  3
            G+ + D+ I TGD
Sbjct  210  GINITDSRISTGD  222



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   168 bits (425),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 117/202 (58%), Gaps = 8/202 (4%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
            +G   +V   GAK DG  D + A   AW E C +  PS++ VP G Y LGQI F GPCK+
Sbjct  24   EGASFDVTKHGAKADGS-DISQALLAAWKEACASPTPSSVLVPAGTYGLGQICFEGPCKA  82

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKEN  249
             +     EG    AP D   FK   GW+ F  I  FTLSG G ++GQG A W     K+ 
Sbjct  83   PINL-IVEGT-LKAPVDTKNFKADAGWVAFQNIDHFTLSGKGVFDGQGPAVWG----KKC  136

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
              +  C  LPIN+    LTN++V+ + + DSK FH+NV+ CKNL+     + AP +S NT
Sbjct  137  ARSSYCGALPINLKFNFLTNSMVRDVTTKDSKQFHVNVLGCKNLSFYHFTVSAPEESLNT  196

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS G+ + +  IKTGD
Sbjct  197  DGIHIGRSSGINITNTNIKTGD  218



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 122/193 (63%), Gaps = 7/193 (4%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAKGDG  DDTAAF  AW + C AT  ST+ V +G+Y + +I F GPCK  VT +     
Sbjct  36   GAKGDGRTDDTAAFAAAWKQACGATGKSTITVGKGEYLVTRIDFNGPCKGPVTVELLGNL  95

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKENMNAPLCKNL  222
            K  AP ++++ +   GW+ F  + DFTL+G     +GQG+ AWK N C +      C NL
Sbjct  96   K--APAEVTKTEAHGGWVNFGNLVDFTLNGHGSILDGQGALAWKKNDCAKTGK---CNNL  150

Query  221  PINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSE  42
            PIN+    LTN+ ++ I S +SK FHMN++ CKN+TL  I I AP +S NTDGIHIGRS 
Sbjct  151  PINVRFTGLTNSRIRSITSSNSKLFHMNILNCKNITLEDIGIDAPPESLNTDGIHIGRSN  210

Query  41   GVTVDDAEIKTGD  3
            GV +  A ++TGD
Sbjct  211  GVNLLGAHVRTGD  223



>ref|XP_006424158.1| hypothetical protein CICLE_v10030302mg [Citrus clementina]
 gb|ESR37398.1| hypothetical protein CICLE_v10030302mg [Citrus clementina]
Length=358

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 127/220 (58%), Gaps = 15/220 (7%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEV-----NVKTSGAKGDGDCDDTAAFKKAWDEVCK--ATEPSTLKV  480
            F  +   + +V+G++      NVK  GA  DG  DD+ AF  AW E C     E + L  
Sbjct  11   FSLLVLFITSVKGIDATNRVFNVKDFGAAADGIKDDSKAFGTAWREACNWDGIESTVLVT  70

Query  479  PEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-G  303
            P GKY    +   GPCK+ ++F      +  APT LS+   K  WI F  ++ FTLSG G
Sbjct  71   P-GKYLSNFVELEGPCKAPISFQLQGLVQ--APTGLSKLPDKQSWITFQYLRHFTLSGEG  127

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
            T++GQG  AW +N+C +N +      LP +M    L ++ + GIKSV SK+FH+N++ C 
Sbjct  128  TFHGQGETAWPLNQCHKNSDC----QLPTSMRFNFLNDSTITGIKSVGSKYFHINILGCY  183

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            NL +N +KI A ADS NT+GIHIGRS G+ +  + I TGD
Sbjct  184  NLKINDLKITAHADSPNTNGIHIGRSNGIEISHSVIATGD  223



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/218 (43%), Positives = 123/218 (56%), Gaps = 13/218 (6%)
 Frame = -2

Query  635  FYVAYLVATVQGVE------VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPE  474
            F   YL+  ++  E       NV   GAK DG  DD     +AW + C +   ST+ +P 
Sbjct  17   FLCTYLLTCIKNSESAIISNFNVVNYGAKCDGKTDDGKPILEAWKQACNSNIASTVVIPP  76

Query  473  GKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TY  297
            G Y LG + F GPCK+AVT    EG    AP+ L  FK +DGWI+F  I   T+ GG T+
Sbjct  77   GNYILGPVDFQGPCKAAVTV-RVEGY-LRAPSMLDVFKLRDGWIVFRDISGLTIEGGGTF  134

Query  296  NGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNL  117
            +GQG  AWK N C ++ +     ++P N+    +TN  V  I S+DSK FHMN+I+C  +
Sbjct  135  DGQGMIAWKENNCAKSGSC----SMPTNIRFTGITNGEVNNITSLDSKMFHMNIIKCNYM  190

Query  116  TLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            T   I I AP  S NTDGIHIGRS  + +  A I+TGD
Sbjct  191  TFKGITIDAPVSSPNTDGIHIGRSSMINITGATIRTGD  228



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 124/220 (56%), Gaps = 9/220 (4%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGV-EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKV  480
            I AA +F   A       GV +V   T GAK   D   T A  KAW + C +  PS + V
Sbjct  7    ILAAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDI--THALAKAWIDACASPAPSKVVV  64

Query  479  PEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-  303
            P G Y L +  F GPCK+ +        K  AP D  +    D W+ F  +   T+SGG 
Sbjct  65   PSGTYMLTEASFKGPCKAPIEIQVQ--GKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGG  122

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
            T++GQG+ AWK N C +N +   CK++ INM    +TN+ ++ I S+DSK FH+NV+ C 
Sbjct  123  TFDGQGALAWKKNDCNKNKD---CKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCH  179

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            N+T  ++ + AP +S NTDGIHIGRS G+ + DA I TGD
Sbjct  180  NVTFXRVNVTAPXESINTDGIHIGRSTGINITDAHIGTGD  219



>ref|XP_008805455.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=404

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 114/197 (58%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA+G+G  DD+ AF  AW   C +T    L +P G Y L  I F GPCK+  +  
Sbjct  35   NVMNFGARGNGVTDDSQAFLAAWKAACASTGAVNLVIPSGTYFLNPIKFRGPCKNVQSLT  94

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A TDL Q+KT   W+ F  +   TL+GG T+NGQG   W +N C +  N   
Sbjct  95   VQMKGTLKASTDLKQYKTSGVWVEFGWVDGLTLTGGGTFNGQGEVTWPLNTCPKQKN---  151

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK  P ++      N +V GIKSV+SKFFH+ V+ C+N   + IKI APA+S NTDGIH+
Sbjct  152  CKIPPTSLMFVNTNNTIVNGIKSVNSKFFHIGVLGCQNFQGSGIKITAPAESPNTDGIHL  211

Query  53   GRSEGVTVDDAEIKTGD  3
             R+ GV + ++EI TGD
Sbjct  212  ERNSGVNISNSEIATGD  228



>ref|XP_009406303.1| PREDICTED: exopolygalacturonase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=263

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 116/197 (59%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GA GDG  D+T AF+ AW   C A   +T+ +PEG Y LG   F GPCK  +   
Sbjct  7    NVKDYGAAGDGKTDNTKAFETAWSAACAAQGKATIVIPEGAYLLGPTIFKGPCKGIMVMQ  66

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 + +A T L  +     W+ F  I    +SGG  +NGQG++AW  N+CK+  +   
Sbjct  67   VK--GQLLASTHLEDYNQY--WLHFQYINGLVISGGGRFNGQGASAWPYNQCKKTND---  119

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP+N+    +TNA +K I S+DSKFFH++V + +N+  + IKI AP DS NTDGIHI
Sbjct  120  CKPLPMNLVFSFVTNATIKSISSIDSKFFHIHVFESRNIIFDSIKISAPQDSPNTDGIHI  179

Query  53   GRSEGVTVDDAEIKTGD  3
              S  + V ++ I TGD
Sbjct  180  ADSTNIQVANSVIGTGD  196



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K     D T A   AW   C +T+PS
Sbjct  1    MGLEVVSSAIISFSLFLLLASTTQAQSNGVFDVTKYGAGKDITEALTNAWKSACASTKPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D ++  +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILK--APVDPNKL-SGGHWVNFRYVDQFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C ++ N   CK LP+N+    +TNA+V+ I ++DSK FH+NV
Sbjct  118  SGRGTFDGQGKVAWSKSTCHKDKN---CKGLPMNLRFDFITNALVRDITTLDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     +RAP +S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKISTGD  218



>ref|XP_010913888.1| PREDICTED: exopolygalacturonase-like [Elaeis guineensis]
Length=404

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA+ DG  D++ AF  AW   C +T    L +P G Y L  + F GPCK+  +  
Sbjct  35   NVINFGARADGVTDNSQAFLAAWKAACTSTGAVNLVIPSGTYFLNPVQFRGPCKNVQSLT  94

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A TDL+Q+ T   W+ F  +   TL+GG T++GQG   W +N C  + N   
Sbjct  95   VQMQGTLKASTDLNQYATARVWVEFGWVDHLTLTGGGTFDGQGEVTWPLNTCPRDQN---  151

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK  P ++    + N +V  IKSV+SKFFH+ V+ C+N   ++I+I APA+S NTDGIH+
Sbjct  152  CKIPPTSLMFVNMNNTIVNHIKSVNSKFFHIGVLGCQNFQGSRIQITAPAESPNTDGIHL  211

Query  53   GRSEGVTVDDAEIKTGD  3
             R+ GVT+ D+EI TGD
Sbjct  212  ERNSGVTISDSEIATGD  228



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 124/220 (56%), Gaps = 7/220 (3%)
 Frame = -2

Query  659  AIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKV  480
            A+ + L+  +   +      V   V   GAK D   D +     AW E C +T PS + +
Sbjct  8    AVLSILLLLFSTSIPKAQSTVVDVVAKYGAKADEKTDLSTPLLHAWKEACASTTPSKIVI  67

Query  479  PEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-  303
            P+G YRL +    GPCKSA+    +   K  AP D S FK  + W++F+ +   T+SGG 
Sbjct  68   PKGTYRLSRATLDGPCKSAIELQVSGTIK--APADPSAFKDPN-WVVFNHVDHLTISGGG  124

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
             ++GQG+A W  N C +N     C  LPIN+    ++NA+V+GI + DSK FH+NV+ CK
Sbjct  125  VFDGQGAAVWGKNNCAKNK---YCAALPINLRFNFVSNAIVQGITTKDSKQFHVNVLGCK  181

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            N T     + AP +S NTDGIHIGRS G+ + D  IKTGD
Sbjct  182  NFTFQHFTVSAPENSINTDGIHIGRSNGIKILDTNIKTGD  221



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 123/220 (56%), Gaps = 9/220 (4%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGV-EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKV  480
            I AA +F   A       GV +V   T GAK   D   T A  KAW + C +  PS + V
Sbjct  7    ILAAFLFLLSASKTQAEPGVFDVTSATYGAKPGSDI--THALAKAWIDACASPAPSKVVV  64

Query  479  PEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-  303
            P G Y L +  F GPCK+ +        K  AP D  +    D W+ F  +   T+SGG 
Sbjct  65   PSGTYMLTEASFKGPCKAPIEIQVQ--GKLTAPADGGKLTRPDTWVGFDHVNKLTVSGGG  122

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
             ++GQG+ AWK N C +N +   CK++ INM    +TN+ ++ I S+DSK FH+NV+ C 
Sbjct  123  XFDGQGALAWKKNDCNKNKD---CKSIAINMRFNFVTNSTIQDITSLDSKNFHVNVLGCH  179

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            N+T  ++ + AP +S NTDGIHIGRS G+ + DA I TGD
Sbjct  180  NVTFQRVNVTAPGESINTDGIHIGRSTGINITDAHIGTGD  219



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 123/215 (57%), Gaps = 7/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGK  468
            L  F +  +   ++  +V +VK  GA      D + A   AW   C     S + +P  K
Sbjct  8    LTIFVLLSISLKIRAEKVFDVKNFGATPSQKNDISKALLDAWKAACSTPGASRILIPHAK  67

Query  467  YRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQ  288
            Y L  +   GPCK ++          +AP+D S+  ++ GWI F  +   T+SGG  +G+
Sbjct  68   YALRDVLLEGPCKGSMVLQIK--GTLMAPSDPSEHHSQ-GWITFQHVDHLTISGGNLDGR  124

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G  AW  N C+ N+N   CKNLP+N+    +TN +++ + S DSK FHMN+I C+N TL 
Sbjct  125  GKIAWGKNTCRTNVN---CKNLPMNLRFDFVTNTIIEDLTSRDSKNFHMNLIGCQNFTLQ  181

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +IKI AP DSANTDGIHIGRS GV + D++I TGD
Sbjct  182  RIKIIAPGDSANTDGIHIGRSNGVNIIDSKIGTGD  216



>gb|ABY21306.1| pollen allergen Pla o 2 [Platanus orientalis]
Length=378

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 122/203 (60%), Gaps = 10/203 (5%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK-  429
             G   NV   GAKG GD   + A  KAW+  C +  PST+ +P G Y +G++   GPCK 
Sbjct  7    SGGTFNVNDYGAKGSGDI--SQAVMKAWEAACASPGPSTVLIPTGNYIMGEVLLEGPCKG  64

Query  428  SAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKE  252
            S + F      K  AP D+S FK+ +GW++F+ +   T+SG GT++GQG  AW  N C +
Sbjct  65   SKIGFQLDGVVK--APADVSAFKS-EGWVVFNHVDGLTVSGKGTFDGQGQKAWAANNCDK  121

Query  251  NMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSAN  72
            + N   C   P+N+    L NAVV+ I S++SK FH+NV++C N++   + I AP  S N
Sbjct  122  DEN---CNRPPMNIRFNFLKNAVVRDITSMNSKMFHINVLECDNISFQHVTISAPGTSIN  178

Query  71   TDGIHIGRSEGVTVDDAEIKTGD  3
            TDGIHIG S GVT+ D  I TGD
Sbjct  179  TDGIHIGLSRGVTITDTNIATGD  201



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 129/222 (58%), Gaps = 8/222 (4%)
 Frame = -2

Query  662  NAIQAALIFFYVAYLVATVQGVEVNVKTS-GAKGDGDCDDTAAFKKAWDEVCKATEPSTL  486
            N + +  +   +    + VQ    +V    GAK DG  D +  F  AW E C +  PST+
Sbjct  6    NIVPSMFVLLLLFISASKVQSDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTV  65

Query  485  KVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL-S  309
             +P+G Y L ++   GPCK+ +  +        AP D S FK  + W+ F  +++F +  
Sbjct  66   VIPKGTYLLSKVNLEGPCKAPIEINVQ--GTIQAPADPSAFKDPN-WVRFYSVENFKMFG  122

Query  308  GGTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQ  129
            GG ++GQGS A++ N C+   N      LP+N+    LTNA+++ I S DSK FH+NV  
Sbjct  123  GGIFDGQGSIAYEKNTCE---NREFRSKLPVNIRFDFLTNALIQDITSKDSKLFHINVFA  179

Query  128  CKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            CKN+TL ++KI AP +S NTDGIH+G+SEGV +  ++IKTGD
Sbjct  180  CKNITLERLKIEAPDESPNTDGIHMGKSEGVNIIASDIKTGD  221



>ref|XP_002312795.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
 gb|EEE86750.2| hypothetical protein POPTR_0009s17010g [Populus trichocarpa]
Length=419

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 117/197 (59%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GA+ DG  DD+ AF  AW E C+AT    L +P+G Y +G + F GPCK+  +  
Sbjct  53   DVKRFGARADGRTDDSKAFIAAWKEACRATGKVELLIPKGTYLIGPVKFAGPCKNVSSLT  112

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A   LS++ +  GW+ F  ++  TL+GG T++GQG+ AW  N C    N   
Sbjct  113  G----YLKATAKLSRYGSGTGWVEFGWLERLTLTGGGTFDGQGAKAWPYNNC---TNDSK  165

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    +   VV+GI S++SKFFH+ +++CKN    KIKI APADS NTDGIH+
Sbjct  166  CKLLPTNVKFVAMNQTVVQGITSLNSKFFHIALVECKNFKGTKIKISAPADSPNTDGIHV  225

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V +  + I TGD
Sbjct  226  ERSSSVYISQSLIGTGD  242



>ref|XP_009421468.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=367

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 115/197 (58%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GA GDG  D+T AF+ AW   C     +T+ +PEG Y LG   F GPCK  +   
Sbjct  7    NVKDYGAAGDGQTDNTKAFETAWSAACAVQGKATIVIPEGAYLLGPTIFKGPCKGIMVMQ  66

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 + +A T L  +     W+ F  I    +SGG  +NGQG++AW  N+CK+  N   
Sbjct  67   VK--GQLLASTHLEAYNQY--WLHFQYINGLVISGGGRFNGQGASAWPYNQCKKTNN---  119

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP+N+    +TNA +K I S+DSKFFH++V + +N+  + IKI AP DS NTDGIHI
Sbjct  120  CKPLPMNLVFSFVTNATIKSISSIDSKFFHIHVFESRNIIFDSIKISAPQDSPNTDGIHI  179

Query  53   GRSEGVTVDDAEIKTGD  3
              S  + V ++ I TGD
Sbjct  180  ADSTNIEVANSIIGTGD  196



>ref|XP_006299755.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
 gb|EOA32653.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
Length=447

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 131/213 (62%), Gaps = 12/213 (6%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             F V  L  +  G EV  +     G    D T AF KA+   C+A  PS + +P+G++RL
Sbjct  10   IFVVCLLGLSANGHEV-FRIGSPPGS---DITQAFFKAFKAACQAPTPSKVLIPKGQFRL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCK  + F      +     D +  + KD W++F  +  F L+GG T++GQG+
Sbjct  66   GEIIMEGPCKFPIEFTLLGTVQ----ADGNAGQGKDKWVVFRKMNGFKLNGGGTFDGQGT  121

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C +  +   CK LPI++    +TNAV++ I SVDSK FH+NVI  +N+T + +
Sbjct  122  AAWRVNNCHQTKS---CKKLPISLRFDFVTNAVIRDISSVDSKNFHVNVIGARNMTFDNV  178

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+GV++ ++ I TGD
Sbjct  179  KILAPAESPNTDGIHLGRSDGVSIINSRISTGD  211



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/234 (41%), Positives = 130/234 (56%), Gaps = 11/234 (5%)
 Frame = -2

Query  689  QKKKKE---MGSNAIQAALIFFYVAYLVATVQG-VEVNVKTSGAKGDGDCDDTAAFKKAW  522
            Q KK+E   +G     AA+    +   VA V G    +V   GA+ DG  D + A   AW
Sbjct  181  QTKKRETENIGMKLNIAAISLLLLLTSVAEVSGDTYFDVTKYGAQADGKTDISQALLTAW  240

Query  521  DEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWI  342
            +  C +   S + +P G Y LGQ+   GPCK+ +        +  AP D S+FK + GW+
Sbjct  241  EAACASPIVSRVVIPAGIYALGQVTIEGPCKAPINLIVKGTVR--APVDTSRFKPQAGWV  298

Query  341  LFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKS  165
             F  +  FTLSG G ++GQG + W   KC        C  LPIN+    LTN+++K I S
Sbjct  299  AFQHLDQFTLSGYGVFDGQGQSVWG-QKCSR---TKYCNQLPINLRFNFLTNSIIKDITS  354

Query  164  VDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             DSK FH+NV+ C+N+T  ++ I AP DS NTDGIHIGRS GV +  + I+TGD
Sbjct  355  KDSKQFHINVLGCRNITFFQVAITAPEDSQNTDGIHIGRSRGVNITHSTIQTGD  408


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = -2

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +TL  + I A  DS NTDGIH+GRS GV + DA IKTGD
Sbjct  1    MTLQYVTINATRDSLNTDGIHMGRSTGVNISDAIIKTGD  39



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 128/224 (57%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K  G  D T A   AW + C +T PS
Sbjct  1    MGLKVVSSAIISFSLLLLLASTAKAQSNGVFDVTKYGGKEDITEALNNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L Q+   GPCK+A+        K  AP +  QF +   W+ F  I   TL
Sbjct  61   KVLIPSGTYSLRQVTLAGPCKAAIELQVNGILK--APVNPDQF-SGSHWVNFRYIDQLTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG+ AW  + C +N N   C+ LP+N+    +TN +V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGNVAWSKSTCSKNKN---CEGLPMNIRFDFITNGLVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + APA+S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTGD  218



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 124/202 (61%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  V+VK SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GPCK  
Sbjct  67   GAAVDVKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYMVESLEFKGPCKGP  124

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  I DFTL+G    ++GQGS AWK N C + 
Sbjct  125  VTLEL--NGNFKAPATVKTTKPHAGWIDFENIADFTLNGNKAIFDGQGSLAWKANDCAKT  182

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL+ I I AP +S NT
Sbjct  183  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLSDIGIDAPPESLNT  239

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  240  DGIHIGRSNGVNLIGAKIKTGD  261



>ref|XP_006486583.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
 gb|KDO68374.1| hypothetical protein CISIN_1g047315mg [Citrus sinensis]
Length=417

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 4/198 (2%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTF  414
            VNVK  GA+ DG  DD+ AF+ AW E C+ T   TL VP G Y +G I F GPCK+    
Sbjct  46   VNVKDFGARADGRTDDSKAFEAAWKEACETTGAVTLLVPHGTYLIGPIKFAGPCKNVSNI  105

Query  413  DAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAP  237
                    IA T+LS+++   GW+ F  ++  TL+ GGT++G+G+ AW  N C  + N  
Sbjct  106  TVQMKGYLIASTNLSEYRFGAGWVEFGGVEGLTLTGGGTFDGRGAKAWPYNGCPTHFN--  163

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             CK LP N+    +   +V+ I SV+SK FH+ +++CKN   +KIKI APA+S NTDGIH
Sbjct  164  -CKLLPTNVKFVAMKKTIVRRITSVNSKSFHIALVECKNFRGSKIKISAPANSPNTDGIH  222

Query  56   IGRSEGVTVDDAEIKTGD  3
            I RS  V V  + I TGD
Sbjct  223  IERSSSVHVSRSHIGTGD  240



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+ +    + N      K  G  D T A   AW + C +T PS
Sbjct  1    MGLKVVSSAIISFSLLLLLTSTAKAQSNGVFDVTKYGGKEDITEALNNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L Q+   GPCK+A+        K  AP D +QF +   W+ FS +   TL
Sbjct  61   KVHIPSGTYSLRQVTLAGPCKAAIELQVDGILK--APVDPNQF-SGGHWVDFSHVDQLTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQGS AW  + C ++ N   C+  P+N+    +TN  V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGSVAWSKSTCSKDKN---CEGFPMNIRFDFITNGFVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            ++CKNLT     + APA+S NTDGIHIGRS G+ + D++I TGD
Sbjct  175  LECKNLTFQHFTVTAPAESINTDGIHIGRSTGIYIIDSKIGTGD  218



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    +        K   D D T A   AW + C +T PS
Sbjct  1    MGPRVVSSAIISFSLFLLLASTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D +QF +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYSLRKLTLAGPCKAAIELQVDGILK--APVDPNQF-SGGHWVNFRYVDKFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C+++ +   C +LP+N+    +TNA+V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGKVAWSKSTCQKDKD---CDSLPMNIRFDFITNALVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP DS NTDGIH+G+S G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGD  218



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 125/206 (61%), Gaps = 9/206 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A   G  ++VK SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GP
Sbjct  64   AKAGGASLDVKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYLVESLEFKGP  121

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINK  261
            CK  VT +     K  AP  +   K   GWI F  I DFTL+G    ++GQGS AWK N 
Sbjct  122  CKGPVTLELNGNLK--APATVKTSKPHSGWIDFENIADFTLNGNGAIFDGQGSLAWKAND  179

Query  260  CKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPAD  81
            C +      C +LPIN+    LTN+ +K I S +SK FHMN++ CKN+TL  I I AP +
Sbjct  180  CAKTGK---CNSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPE  236

Query  80   SANTDGIHIGRSEGVTVDDAEIKTGD  3
            S NTDGIHIGRS GV +  A+IKTGD
Sbjct  237  SLNTDGIHIGRSNGVNLLGAKIKTGD  262



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +ALI F +  L+++    +        K   D D T A   AW + C +T PS
Sbjct  1    MGLKGVSSALISFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D +QF +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYSLRKLTLAGPCKAAIELQVDGILK--APVDPNQF-SGGHWVNFRYVDKFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C+++ +   C +LP+N+    +TNA+V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGKVAWSKSTCQKDKD---CDSLPMNIRFDFITNALVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP DS NTDGIH+G+S G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGD  218



>ref|XP_008451196.1| PREDICTED: exopolygalacturonase isoform X3 [Cucumis melo]
Length=373

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 118/196 (60%), Gaps = 4/196 (2%)
 Frame = -2

Query  587  VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA  408
            V++ GA+ +G  DD+ AF  AW   C +    T  +P+G Y +G + F GPCK+  +   
Sbjct  4    VRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFSGPCKNVSSLTV  63

Query  407  AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLC  231
                   A T+LS++ +  GWI F  ++  TL+GG T++G+GS AW  N C+++ N   C
Sbjct  64   KMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFNNCRDDYN---C  120

Query  230  KNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIG  51
            K LP N+    L N VV+ I S++SKFFH+ ++QCK    +K+KI AP +S NTDGIHI 
Sbjct  121  KLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSPNTDGIHID  180

Query  50   RSEGVTVDDAEIKTGD  3
            RS  V    + I+TGD
Sbjct  181  RSSNVHFSLSHIQTGD  196



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 115/189 (61%), Gaps = 6/189 (3%)
 Frame = -2

Query  566  GDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFI  387
            G  + D T A  KAW + C +T PSTL VP+G ++     F GPCK+ + F         
Sbjct  36   GKPNSDITQALSKAWTDACASTSPSTLVVPKGTFKFLGTTFKGPCKAPIAFQLQ--GILQ  93

Query  386  APTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINM  210
            AP D +Q   KD WI F  I   T+SGG T++GQG+ AWK N C +N N   CK++ IN+
Sbjct  94   APVDGNQLPKKDTWISFDHIDRLTISGGGTFDGQGAIAWKQNDCHKNKN---CKSIAINL  150

Query  209  NLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTV  30
                +TN+ ++ I + DSK FH+NV+ C N+  +   + AP +S NTDGIHIGRS G+++
Sbjct  151  RFNFITNSRIEYITTKDSKNFHVNVLGCTNVAFHHFTVSAPKESINTDGIHIGRSTGISI  210

Query  29   DDAEIKTGD  3
             D+ IKTGD
Sbjct  211  IDSTIKTGD  219



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 129/222 (58%), Gaps = 8/222 (4%)
 Frame = -2

Query  662  NAIQAALIFFYVAYLVATVQGVEVNVKTS-GAKGDGDCDDTAAFKKAWDEVCKATEPSTL  486
            N + +  +   +    + VQ    +V    GAK DG  D +  F  AW E C +  PST+
Sbjct  6    NIVPSMFVLLLLFISASKVQPDAFDVVAKFGAKADGKTDLSKPFLDAWKEACASVTPSTV  65

Query  485  KVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL-S  309
             +P+G Y L ++   GPCK+ +  +        AP D S FK  + W+ F  +++F +  
Sbjct  66   VIPKGTYLLSKVNLEGPCKAPIEINVQ--GTIQAPADPSAFKDPN-WVRFYSVENFKMFG  122

Query  308  GGTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQ  129
            GG ++GQGS A++ N C+   N      LP+N+    +TNA+++ I S DSK FH+NV  
Sbjct  123  GGIFDGQGSIAYEKNTCE---NREFRSKLPVNIRFDFVTNALIQDITSKDSKLFHINVFA  179

Query  128  CKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            CKN+TL ++KI AP +S NTDGIH+G+SEGV +  ++IKTGD
Sbjct  180  CKNITLERLKIEAPDESPNTDGIHMGKSEGVNIIASDIKTGD  221



>ref|XP_009333810.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GA+ DG  DD+ AF  AW E C++T    L +P+G Y +G + F GPC +  + +
Sbjct  50   NVKSFGARADGRTDDSDAFTAAWKEACQSTGRVHLIIPKGTYTIGPLRFSGPCVNVTSLN  109

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL ++ +  GWI F+ +K  TL+ GGT++G+G+ AW  NKC  N N   
Sbjct  110  FRVKGYLKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCVTNSN---  166

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L   V++G+ SV+SKFFH+ +++C N   +++KI AP  S NTDGIHI
Sbjct  167  CKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHI  226

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  227  ERSSSVYFSSSRIATGD  243



>ref|XP_008451195.1| PREDICTED: exopolygalacturonase isoform X2 [Cucumis melo]
Length=401

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V++ GA+ +G  DD+ AF  AW   C +    T  +P+G Y +G + F GPCK+  +  
Sbjct  31   SVRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFSGPCKNVSSLT  90

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A T+LS++ +  GWI F  ++  TL+GG T++G+GS AW  N C+++ N   
Sbjct  91   VKMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFNNCRDDYN---  147

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L N VV+ I S++SKFFH+ ++QCK    +K+KI AP +S NTDGIHI
Sbjct  148  CKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSPNTDGIHI  207

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I+TGD
Sbjct  208  DRSSNVHFSLSHIQTGD  224



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   164 bits (414),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 125/206 (61%), Gaps = 9/206 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A   G  +++K SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GP
Sbjct  68   AKAGGASLDIKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYLVESLEFKGP  125

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINK  261
            CK  VT +     K  AP  +   K   GWI F  I DFTL+G    ++GQGS AWK N 
Sbjct  126  CKGPVTLELNGNLK--APATVKTSKPHSGWIDFENIADFTLNGNGAIFDGQGSLAWKAND  183

Query  260  CKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPAD  81
            C +      C +LPIN+    LTN+ +K I S +SK FHMN++ CKN+TL  I I AP +
Sbjct  184  CAKTGK---CNSLPINIRFTGLTNSKIKSITSTNSKLFHMNILNCKNITLEDIGIDAPPE  240

Query  80   SANTDGIHIGRSEGVTVDDAEIKTGD  3
            S NTDGIHIGRS GV +  A+IKTGD
Sbjct  241  SLNTDGIHIGRSNGVNLLGAKIKTGD  266



>gb|EMT33862.1| putative Exopolygalacturonase [Aegilops tauschii]
Length=404

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 119/192 (62%), Gaps = 6/192 (3%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GA  DG+ DD+ AF +AW + C +     + VP+G+YRL  + F GPCK  +    A   
Sbjct  34   GAIADGETDDSKAFIRAWMKACASPGRPAVVVPKGEYRLQPVVFRGPCKGYMQVRLA--G  91

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLP  219
               AP DL+ F+    WI F+ I    ++GG T++G+G+++W +N+C  N N   CK LP
Sbjct  92   DLRAPDDLAAFRGSHEWINFASIDGLLVTGGGTFDGRGASSWHLNQCPTNPN---CKPLP  148

Query  218  INMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEG  39
            +++ LG + N  + G+ S+DSKFFH+ +I  +N++++++ IRAP DS NTDG+HI  S  
Sbjct  149  VSIKLGRVRNVTITGVTSLDSKFFHVIIIGSQNVSIHRVTIRAPRDSPNTDGVHIQGSSN  208

Query  38   VTVDDAEIKTGD  3
            V + D  I TGD
Sbjct  209  VRITDTAIATGD  220



>ref|XP_008451194.1| PREDICTED: exopolygalacturonase isoform X1 [Cucumis melo]
Length=417

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V++ GA+ +G  DD+ AF  AW   C +    T  +P+G Y +G + F GPCK+  +  
Sbjct  47   SVRSFGARANGLTDDSNAFLAAWRTACDSAGVVTFLIPKGTYLVGPVKFSGPCKNVSSLT  106

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A T+LS++ +  GWI F  ++  TL+GG T++G+GS AW  N C+++ N   
Sbjct  107  VKMKGYLKASTNLSKYGSGAGWIEFRWMEGLTLTGGGTFDGRGSEAWPFNNCRDDYN---  163

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L N VV+ I S++SKFFH+ ++QCK    +K+KI AP +S NTDGIHI
Sbjct  164  CKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKGFIGSKLKISAPENSPNTDGIHI  223

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I+TGD
Sbjct  224  DRSSNVHFSLSHIQTGD  240



>ref|XP_010270548.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=423

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 121/207 (58%), Gaps = 5/207 (2%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            L   VQ    NV + GA+GDG  DD+ AF  AW+  C ++   TL +P+  YRLG I F 
Sbjct  40   LSGEVQSNIFNVISYGARGDGRIDDSQAFNAAWEAACGSSGSVTLLIPKATYRLGPIKFS  99

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPC    +          A T LS+F T   WI    +   TL+GG T++GQG  AW+ N
Sbjct  100  GPCHHVTSITVDMQGYLKALTQLSKFGTSP-WIEIGWVDRLTLTGGGTFDGQGVGAWRFN  158

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
            KC  +M+   C+ LP N+   + TN VV+GI S++SK +H+++  C+N   + IKI AP+
Sbjct  159  KCPVDMD---CEYLPSNVKFISTTNTVVRGITSLNSKSYHLSLANCRNFHGSAIKISAPS  215

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S +TDG+HI  S GVT+  + I TGD
Sbjct  216  NSPDTDGVHIEHSTGVTITQSVIGTGD  242



>ref|XP_009341510.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=420

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GA+ DG  DD+ AF  AW E C++T    L +P+G Y +G + F GPC +  + +
Sbjct  50   NVKSFGARADGRTDDSDAFTAAWKEACQSTGRVHLIIPKGTYTIGPLRFSGPCVNVTSLN  109

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL ++ +  GWI F+ +K  TL+ GGT++G+G+ AW  NKC  N N   
Sbjct  110  FRVKGYVKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCVTNSN---  166

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L   V++G+ SV+SKFFH+ +++C N   +++KI AP  S NTDGIHI
Sbjct  167  CKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHI  226

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  227  ERSSSVYFSSSRIATGD  243



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 129/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +ALI F +  L+++    +        K   D D T A   AW + C +T PS
Sbjct  1    MGLKGVSSALISFSIFLLLSSTAKAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D +QF +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYSLRKLTLAGPCKAAIELQVDGILK--APVDPNQF-SGGHWVNFRYVDKFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C+++ +   C +LP+N+    +TNA+V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGKLAWSKSTCQKDKD---CDSLPMNIRFDFITNALVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP DS NTDGIH+G+S G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGD  218



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 123/202 (61%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  ++VK SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GPCK  
Sbjct  68   GASLDVKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYLVESLEFKGPCKGP  125

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  + DFTL+G    ++GQGS AWK N C + 
Sbjct  126  VTLEL--NGNFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKT  183

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL  I I AP +S NT
Sbjct  184  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDISIDAPPESLNT  240

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  241  DGIHIGRSNGVNLIGAKIKTGD  262



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/224 (39%), Positives = 130/224 (58%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    +        K   D D T A   AW + C +T PS
Sbjct  1    MGLKVVSSAIISFSLFLLLASTAKAQSKGVFDVTKYGSDKDITEALTNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L ++   GPCK+A+        K  AP D +QF +   W+ F  +  FTL
Sbjct  61   KVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLK--APVDPNQF-SGGHWVNFGHVDKFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG AAW  + C+++ +   C +LP+N+    +TNA+V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGKAAWSKSTCQKDKD---CDSLPMNLRFDFITNALVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP +S NTDGIH+G+S G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDSKIGTGD  218



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 120/205 (59%), Gaps = 7/205 (3%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            +T+      V+   AKG G  D T +   AW + C +T  + + +  G + L ++   GP
Sbjct  19   STINAQVFQVENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGP  78

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKC  258
            CK+ V F+     +  AP D S+FKT DGW++F  I   T+SGG T++GQG  AW  N C
Sbjct  79   CKAHVEFEIR--GRLQAPADPSRFKT-DGWVVFQRIDGLTVSGGGTFDGQGKIAWGQNDC  135

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
             +N N   C+ LP N+    ++NA++  + ++DSK FH+NV+  KNLT     + AP DS
Sbjct  136  DKNTN---CRTLPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDS  192

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIHIGRS GV + D  IKTGD
Sbjct  193  VNTDGIHIGRSLGVNILDTNIKTGD  217



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 127/224 (57%), Gaps = 10/224 (4%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG N + +     +  +L+ ++   + +V +S   G  + D +    KAW + C +T PS
Sbjct  1    MGHNLVMS----IFPIFLLLSIAYADFDVTSSKYGGKPNSDISQPLAKAWSDACASTSPS  56

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + VP+G ++L    F GPCK  + F         AP D +Q    D WI F+ ++  TL
Sbjct  57   RIIVPKGTFQLKGASFKGPCKGPIEFQV--DGTLQAPQDGAQLIKADTWIEFANLERLTL  114

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
             G GT++GQG  AWK N C +N   P C ++ IN+   ++ +++VK + S++SK FH+NV
Sbjct  115  MGTGTFDGQGQKAWKENDCNKN---PKCSSIAINLRFNSVKHSLVKDVTSLNSKNFHVNV  171

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + C+ LT     ++AP DS NTDGIHIGRS G+ + D  I TGD
Sbjct  172  LGCEQLTFQHFTVKAPGDSINTDGIHIGRSTGINITDTNIGTGD  215



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 123/202 (61%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  V+VK SGAKGD   DD+AAF  AW E       ST+ VP+G+Y +  + F GPCK  
Sbjct  67   GAAVDVKASGAKGDSKTDDSAAFAAAWKE--ACAAGSTITVPKGEYMVESLEFKGPCKGP  124

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  I DFTL+G    ++GQGS AWK N C + 
Sbjct  125  VTLEL--NGNFKAPATVKTTKPHAGWIDFENIADFTLNGNKAIFDGQGSLAWKANDCAKT  182

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL+ I I AP +S NT
Sbjct  183  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLSDIGIDAPPESLNT  239

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  240  DGIHIGRSNGVNLIGAKIKTGD  261



>ref|XP_011000860.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=428

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 116/197 (59%), Gaps = 5/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +VK  GA+ DG  DD+ AF  AW E C AT    L +P+G Y +G + F GPCK+  +  
Sbjct  58   DVKRFGARADGRTDDSKAFIAAWKEACGATGKVKLLIPKGMYLIGPVKFAGPCKNVSSLT  117

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A   LS++ +  GW+ F  ++  TL+GG T++GQG+ AW  N C    N   
Sbjct  118  VYMKGYLKATAKLSRYGSGTGWVEFGWLERLTLTGGGTFDGQGAKAWPYN-C---TNDSK  173

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    +   VV+GI S++SKFFH+ +++CKN    KIKI APADS NTDGIH+
Sbjct  174  CKLLPTNVKFVAMNQTVVQGITSLNSKFFHIALVECKNFKGTKIKISAPADSPNTDGIHV  233

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V +  + I TGD
Sbjct  234  ERSSSVYISQSLIGTGD  250



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 114/184 (62%), Gaps = 6/184 (3%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A   AW E C +  PST+ VP+G + +G I   GPCKS++        K  AP D 
Sbjct  1    DSTQALTTAWKEACASASPSTILVPKGNFAVGLITLEGPCKSSIGLQLQGTLK--APADP  58

Query  371  SQFKTKDGWILFSMIKDFTL-SGGTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            S+ K   GWI  + I   T+  GG ++GQG +AW  N C +N   P+CK L +N+ L  +
Sbjct  59   SKIKGL-GWINLNKIDLLTIFGGGVFDGQGKSAWVQNDCHKN--GPICKTLSMNLRLYAV  115

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
            TN++++ + ++DSK FH+NVI CKNLT  + KI A   S NTDGIHIGRS+GV + + EI
Sbjct  116  TNSILRDVTTLDSKNFHVNVIGCKNLTFERFKISAAETSINTDGIHIGRSDGVNIINTEI  175

Query  14   KTGD  3
            KTGD
Sbjct  176  KTGD  179



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 123/202 (61%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  ++VK SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GPCK  
Sbjct  68   GASLDVKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYLVESLEFKGPCKGP  125

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  + DFTL+G    ++GQGS AWK N C + 
Sbjct  126  VTLEL--NGNFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKT  183

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL  I I AP +S NT
Sbjct  184  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNT  240

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  241  DGIHIGRSNGVNLIGAKIKTGD  262



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 123/202 (61%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  ++VK SGAKGDG  DD+AAF  AW E       ST+ VP+G+Y +  + F GPCK  
Sbjct  68   GASLDVKASGAKGDGKTDDSAAFAAAWKE--ACAAGSTITVPKGEYLVESLEFKGPCKGP  125

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  + DFTL+G    ++GQGS AWK N C + 
Sbjct  126  VTLEL--NGNFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKT  183

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL  I I AP +S NT
Sbjct  184  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNT  240

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  241  DGIHIGRSNGVNLIGAKIKTGD  262



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 122/202 (60%), Gaps = 9/202 (4%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA  423
            G  ++VK SGAKGDG  DD+AAF  A  E       ST+ VP+G+Y +  + F GPCK  
Sbjct  68   GASLDVKASGAKGDGKTDDSAAFAAARKE--ACAAGSTITVPKGEYLVESLEFKGPCKGP  125

Query  422  VTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINKCKEN  249
            VT +      F AP  +   K   GWI F  + DFTL+G    ++GQGS AWK N C + 
Sbjct  126  VTLEL--NGNFKAPATVKTTKPHAGWIDFENLADFTLNGNKAIFDGQGSLAWKANDCAKT  183

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C +LPIN+    LTN+ +  I S +SK FHMN++ CKN+TL  I I AP +S NT
Sbjct  184  GK---CNSLPINIRFTGLTNSKINSITSTNSKLFHMNILNCKNITLTDIGIDAPPESLNT  240

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIGRS GV +  A+IKTGD
Sbjct  241  DGIHIGRSNGVNLIGAKIKTGD  262



>ref|XP_009134997.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 121/207 (58%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            LV  + G   N +     G    D TAA  KA+   C+A  PS + +P+G ++LG+I   
Sbjct  11   LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS V F      K     D    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPVEFTLQGNVK----ADGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K I S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKISTGD  210



>ref|XP_009387205.1| PREDICTED: exopolygalacturonase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=256

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GA GDG  D+T AF+ AW   C     +T+ +PEG Y LG   F GPCK  +   
Sbjct  7    NVKDYGATGDGQTDNTKAFEAAWSAACTVEGRTTIVIPEGAYLLGPTIFRGPCKGIMVMQ  66

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 + +A T L  +K  + W+ F  I    +SGG  ++GQG++AW  N+CK+ +N   
Sbjct  67   VK--GQLLASTHLEAYK--ENWLDFQYINGLVISGGGKFDGQGASAWPYNQCKKILN---  119

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP  +    +TNA +  I  +DSKFFH++V + +N+T + I+I AP DS NTDGIHI
Sbjct  120  CKPLPKTLVFNFVTNATISSINFIDSKFFHVHVFKSRNITFDSIRISAPGDSPNTDGIHI  179

Query  53   GRSEGVTVDDAEIKTGD  3
              S  + V ++ I TGD
Sbjct  180  ADSTNIQVANSVIGTGD  196



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 113/197 (57%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA+ DG+ D + A  KAW + C +   ST+  P+G + LGQI   GPCK  + F 
Sbjct  29   DVTKYGARADGNTDISQALLKAWGDACSSPVASTVMTPDGXHALGQITIGGPCKDPINFI  88

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  A  D S+FK   GWI F  I  FTLSGG  ++GQG   W   KC     +  
Sbjct  89   VQGSVK--ALMDTSRFKAXAGWIAFRQIDQFTLSGGGVFDGQGKTVWG-TKCPS---SAY  142

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPIN+    +TN++VK I S DS  FH+N++ CKNLT   + I AP +  NTDGIHI
Sbjct  143  CNQLPINLRFNFITNSMVKNITSRDSNQFHINLLGCKNLTFYNVAISAPEERLNTDGIHI  202

Query  53   GRSEGVTVDDAEIKTGD  3
            GRS G+ +  + I+TGD
Sbjct  203  GRSLGINITYSTIETGD  219



>ref|XP_008357338.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
 ref|XP_008357339.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=421

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 117/197 (59%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GA+ DG  DD+ AF  AW E C++     L +P+G Y +G + F GPC +  + +
Sbjct  51   NVKSFGARADGRTDDSDAFTAAWKEACQSIGRVHLIIPKGTYTIGPLRFSGPCVNVTSLN  110

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL ++ +  GWI F+ +K  TL+ GGT++G+G+ AW  NKC  N N   
Sbjct  111  FRVKGYLKATTDLRKYGSGSGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCITNSN---  167

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L   V++G+ SV+SKFFH+ +++C N   +++KI AP  S NTDGIHI
Sbjct  168  CKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHI  227

Query  53   GRSEGVTVDDAEIKTGD  3
             RS       + I TGD
Sbjct  228  ERSSSXYFSSSRIATGD  244



>ref|XP_008377875.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=421

 Score =   161 bits (408),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GA+ DG  DD+ AF   W E C++T    L +P+G Y +G + F GPC +  + +
Sbjct  51   NVKSFGARADGRTDDSDAFTATWKEACQSTGRVHLIIPKGTYTIGPLKFSGPCVNVTSLN  110

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A TDL ++ +  GWI F+ +K  TL+GG T++G+G+ AW  NKC  N N   
Sbjct  111  FRVKGYLKATTDLRKYGSGGGWIEFAWMKGLTLTGGGTFDGRGAHAWPHNKCITNSN---  167

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L   V++G+ SV+SKFFH+ +++C N   +++KI AP  S NTDGIHI
Sbjct  168  CKLLPTNLKFVALNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHI  227

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  228  ERSSSVYFSSSRIATGD  244



>emb|CDX90415.1| BnaA03g43660D [Brassica napus]
Length=412

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 127/224 (57%), Gaps = 12/224 (5%)
 Frame = -2

Query  647  ALIFFYVAY--LVATVQG-----VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST  489
             L FF++A       V+G     + V+V++ GA+ +   D+T AF  AWD  CK++  S 
Sbjct  16   VLFFFFMALSSYSFVVRGDKSSVLIVDVRSFGARANDHRDNTKAFVAAWDMACKSSSSSV  75

Query  488  -LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             L +P G++ +G I F GPC +             A TDLS++++  GWI F  I   TL
Sbjct  76   DLIIPRGEFHVGPIRFSGPCTNVTHLTVRVKGHLKASTDLSKYRSGGGWIEFGWINGLTL  135

Query  311  SGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            +GG T++GQG+ AW  N C  + +   CK LP ++    +   +V+ I SV+SKFFHM +
Sbjct  136  TGGGTFDGQGALAWPFNNCITDSH---CKLLPTSLKFVGMNRTIVRRISSVNSKFFHMAL  192

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +QC++    ++ I AP+DS NTDGIHI RS  V    + I TGD
Sbjct  193  VQCRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGD  236



>gb|AAM74219.1|AF518563_1 putative pollen polygalacturonase [Brassica oleracea]
Length=397

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            LV  + G   N +     G    D TAA  KA+   C+A  PS + +P+G ++LG+I   
Sbjct  11   LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS V F      K     D    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPVEFTLQGNVK----ADGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K + S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKISTGD  210



>gb|AAP42648.1| polygalacturonase [Brassica napus]
Length=397

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 121/207 (58%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            LV  + G   N +     G    D TAA  KA+   C+A  PS + +P+G ++LG+I   
Sbjct  11   LVLCLLGYSANAEVFTVGGPPGSDITAALLKAFTSACQAPAPSQVLIPKGDFKLGEIAMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS V F      K     D    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPVEFTLQGNVK----ADGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K + S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKISTGD  210



>ref|XP_011015579.1| PREDICTED: exopolygalacturonase clone GBGE184, partial [Populus 
euphratica]
Length=494

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 119/198 (60%), Gaps = 8/198 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS-AVTF  414
            +V   GAK D   D+  AF + W   C +  P+ + +P G +    + F GPCKS  + F
Sbjct  132  DVTKHGAKADDKTDNAQAFIQTWRAACDSGVPAKVVIPGGTFLTSPVVFQGPCKSKPIVF  191

Query  413  DAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAP  237
            +     K  A TDLS++ ++  WILF +I   TL+GG T++GQGSA WK N C EN    
Sbjct  192  EVQGNVK--ATTDLSEYSSEQ-WILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHENKQ--  246

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             C+ LP ++ L  + NA V  I SVDSK+FHM+V  C  ++++ I + APA+S NTDGIH
Sbjct  247  -CQALPSSIKLSKVNNAFVHEISSVDSKYFHMHVTSCHGISIHNINLTAPANSPNTDGIH  305

Query  56   IGRSEGVTVDDAEIKTGD  3
            I  S+GV V  ++I TGD
Sbjct  306  ISHSDGVQVTSSKIGTGD  323



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 123/207 (59%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            LV  + G   N +   A G  + D TAA  KA+   C+A  PS + +P+G ++LG+    
Sbjct  11   LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS + F      K    TD    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPIEFTLQGNVK----TDGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K + S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDVTSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKIATGD  210



>ref|XP_002301488.2| hypothetical protein POPTR_0002s20330g [Populus trichocarpa]
 gb|EEE80761.2| hypothetical protein POPTR_0002s20330g [Populus trichocarpa]
Length=414

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 120/199 (60%), Gaps = 9/199 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA--VT  417
            +V   GAK D   D+  AF + W   C +  P+ + +P G +    + F GPCKS   + 
Sbjct  47   DVTKHGAKADDKTDNAEAFIQTWRAACDSGAPAKMVIPGGTFLTSPVVFQGPCKSTEPIV  106

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
            F+     K  A TDLS++ ++  WILF +I   TL+GG T++GQGSA WK N C +N   
Sbjct  107  FEVQGNVK--ATTDLSEYSSEQ-WILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHQNKE-  162

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              C+ LP ++ L  + NA V  I SVDSK+FHM+V  C +++++ I + APA+S NTDGI
Sbjct  163  --CQPLPSSIKLSKVKNAFVHEISSVDSKYFHMHVTSCNSISIHNINLTAPANSPNTDGI  220

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI  S+GV V  ++I TGD
Sbjct  221  HISHSDGVHVTSSKIGTGD  239



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 121/215 (56%), Gaps = 11/215 (5%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            ++F  VA  ++  Q  +V    + AK     D T A  K W + C     S + +P+G +
Sbjct  11   VLFMLVASNLSNAQVFDVTKNGANAK----VDITQALLKTWKQACATKSRSQVLIPKGTF  66

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            ++ Q  F GPCK+ + F+       +AP     FK  D WI F  I   T++GG T+NGQ
Sbjct  67   KVSQATFQGPCKAPIEFNLQ--GTLLAPAVDGNFKGGDSWISFEHIDSLTVTGGGTFNGQ  124

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G  AW     K   ++  C NLPIN+    LTN+VV+ + S+DSK FH+NV+ CKN+T  
Sbjct  125  GKTAWG----KTCTSSQYCGNLPINVRFNFLTNSVVQYVTSLDSKQFHVNVLGCKNITFQ  180

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              K+ AP DS NTDGIHIGRS  V V D+ I+TGD
Sbjct  181  HFKVSAPGDSLNTDGIHIGRSTDVKVLDSNIQTGD  215



>ref|XP_004499458.1| PREDICTED: exopolygalacturonase-like [Cicer arietinum]
Length=459

 Score =   161 bits (408),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 124/221 (56%), Gaps = 11/221 (5%)
 Frame = -2

Query  650  AALIFFYVAYLV----ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            AA I F + +LV    A +Q    NV   GA  D   D++ AF KAW + CKA    T+ 
Sbjct  2    AAKILFSLCFLVWISEAHIQNKIFNVMDYGAIADEKTDNSVAFLKAWSDACKAYGKVTML  61

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-  306
            +P+G Y L ++ F GPC     F   EG    AP D   FK+ D WI F  IK+  +SG 
Sbjct  62   IPQGTYLLKEVIFSGPCNGWTIF-KIEGV-LKAPIDPYSFKS-DSWINFRYIKNLMVSGP  118

Query  305  GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
            GT +GQGS AW +N C+ N   P C+ LP  M    +TN  V  ++S++SK  H  +  C
Sbjct  119  GTLDGQGSYAWSLNDCQNN---PKCRPLPTTMTFDFVTNGYVHHLRSINSKQGHFLLFAC  175

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +N+T  K++I AP+DS NTDGI IG+S G+ +    I TGD
Sbjct  176  QNMTFTKLRISAPSDSPNTDGIKIGKSNGINITSVYIGTGD  216



>ref|XP_002301489.1| Exopolygalacturonase clone GBGE184 precursor family protein [Populus 
trichocarpa]
 gb|EEE80762.1| Exopolygalacturonase clone GBGE184 precursor family protein [Populus 
trichocarpa]
Length=413

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 120/199 (60%), Gaps = 9/199 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSA--VT  417
            +V   GAK D   D+  AF + W   C +  P+ + +P G +    + F GPCKS   + 
Sbjct  47   DVTKHGAKADDKTDNAEAFIQTWRAACDSGAPAKMVIPGGTFLTSPVVFQGPCKSTEPIV  106

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
            F+     K  A TDLS++ ++  WILF +I   TL+GG T++GQGSA WK N C +N   
Sbjct  107  FEVQGNVK--ATTDLSEYSSEQ-WILFEIIDGLTLNGGGTFDGQGSAVWKYNDCHQNKE-  162

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              C+ LP ++ L  + NA V  I SVDSK+FHM+V  C +++++ I + APA+S NTDGI
Sbjct  163  --CQPLPSSIKLSKVKNAFVHEISSVDSKYFHMHVTSCNSISIHNINLTAPANSPNTDGI  220

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI  S+GV V  ++I TGD
Sbjct  221  HISHSDGVHVTSSKIGTGD  239



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 114/199 (57%), Gaps = 8/199 (4%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
            +V   T GAK   D   + A  KAW + C +   S + VP G Y+L +  F GPCK+ + 
Sbjct  28   DVTSATYGAKPGSDV--STALAKAWSDACASPSASKVVVPSGTYKLKEANFRGPCKAPIE  85

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                      AP D SQ    D W+ F  I   TLSGG T++GQG+ +W  N C +N N 
Sbjct  86   MQVQ--GTLQAPADASQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKN-  142

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK +P+N+    LTN+ V+ I S++SKFFHM+V +C + T  ++ I AP DS NTDGI
Sbjct  143  --CKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGI  200

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HIG S G+ +  A+I TGD
Sbjct  201  HIGASTGINITHAKIGTGD  219



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 129/213 (61%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F   A+ V  + G+  N K         CD T A  KA++E C+    ST+ +P+G+Y+L
Sbjct  6    FGVSAFFVFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPKGEYKL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I  +GPCK+ +   A +G       D +   ++  WI F  I  F L+GG  ++G+G+
Sbjct  66   GEIEMMGPCKAPIRI-ALQGT---VKADGNAVHSEK-WIAFRNIDGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C        CK LPI++    +TNA ++GI S+D+K FH+NVI  KN+T  ++
Sbjct  121  AAWRVNNCHHTWK---CKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  178  KIVAPAESPNTDGIHVGRSDGIKIINSFISTGD  210



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 127/224 (57%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    + N      K DG  D T A   AW + C +T PS
Sbjct  1    MGLKVVSSAIISFSLLLLLASTAKAQSNGVLDVTKYDGKEDITEALNNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +P G Y L Q+   GPCK+A+        K  AP +  QF +   W+ F  +   TL
Sbjct  61   KVLIPSGTYSLRQVTLAGPCKAAIELQVDGILK--APVNPDQF-SGGSWVDFRHVDQLTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG+ AW  + C ++ N   C+ LP+N+    +TN +V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGNVAWSKSTCNKDKN---CEGLPMNIRFDFITNGLVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP +S NTDGIHIG+S G+ + D+ I TGD
Sbjct  175  LGCKNLTFQHFTMTAPGESINTDGIHIGQSTGIYIIDSNIGTGD  218



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 113/192 (59%), Gaps = 8/192 (4%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAK + D   T A   AW + C +T PS + VP+G Y+L +  F GPCK+ +        
Sbjct  28   GAKPNSDI--TQAIANAWKDACASTMPSKVIVPKGIYKLKEANFNGPCKAPIELQVC--G  83

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLP  219
               A  D +Q    D WI+FS +  FTLSG G ++GQG  AWK N C +N   P C ++ 
Sbjct  84   TLQASPDGAQLSKPDTWIMFSYLDRFTLSGTGIFDGQGQQAWKANDCHKN---PKCSSIA  140

Query  218  INMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEG  39
            INM   ++ N++V+ + S++SK FH+NV+ C+ LT     + AP  S NTDGIHIGRS G
Sbjct  141  INMRFHSVKNSLVRDVSSLNSKNFHVNVLGCERLTFQHFTVTAPETSVNTDGIHIGRSTG  200

Query  38   VTVDDAEIKTGD  3
            + + D+ I TGD
Sbjct  201  INITDSNISTGD  212



>ref|XP_007050989.1| Polygalacturonase 4, putative [Theobroma cacao]
 gb|EOX95146.1| Polygalacturonase 4, putative [Theobroma cacao]
Length=424

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 116/197 (59%), Gaps = 5/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V T GAK DG  D+   F KAW   C A+ P+TL +P G Y  GQ+ F GPCKS+    
Sbjct  53   DVMTYGAKADGKTDNFEPFVKAWKAACSASAPATLVIPRGTYLTGQVVFQGPCKSSNPVT  112

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
                    A TD+S++ T + WILF +I    ++G GT +GQG++ W  N C  N     
Sbjct  113  VKIEGTIKATTDISEYPTAE-WILFELIDGLIITGSGTIDGQGASVWGYNDCSHNSG---  168

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP+++    + N+VV GI SV++K FHM + +  N+T++ + I APA S NTDGIHI
Sbjct  169  CQLLPVSIKFHRVNNSVVNGISSVNAKSFHMFITRSANITVHDLNITAPAKSPNTDGIHI  228

Query  53   GRSEGVTVDDAEIKTGD  3
              S  V + ++ I TGD
Sbjct  229  SSSSFVNITNSNIGTGD  245



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 123/202 (61%), Gaps = 10/202 (5%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK-S  426
            G   NV   GAKG GD   + A  KAW   C +  PST+ +P+G Y +G++   GPCK S
Sbjct  7    GSVFNVNDYGAKGAGDI--SQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGS  64

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKEN  249
             + F      K  AP D S+FK+ DGW+ F  I   T+SG GT +GQG  AW  N C +N
Sbjct  65   KIGFQIDGVVK--APADPSKFKS-DGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKN  121

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
               P CK+  +N+    L +A+V+ I S++SK FH+NV++C+++T   + + AP  S NT
Sbjct  122  ---PNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINT  178

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIH+G S+GVT+ + +I TGD
Sbjct  179  DGIHVGISKGVTITNTKIATGD  200



>ref|XP_006414139.1| hypothetical protein EUTSA_v10027030mg, partial [Eutrema salsugineum]
 gb|ESQ55592.1| hypothetical protein EUTSA_v10027030mg, partial [Eutrema salsugineum]
Length=393

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 118/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            VNV + GA+ +   D T AF+ AWD+ CK++  S  L +P G++ +G + F GPC +   
Sbjct  12   VNVHSFGARANDHRDHTKAFEAAWDKACKSSSSSVDLIIPRGEFSVGPLRFSGPCTNVSN  71

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   +  A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + N 
Sbjct  72   LTV----RVKASTDLSKYRSGGGWIEFRWINGLTLTGGGTFDGQGAVAWPFNNCTTDSN-  126

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFHM +++C++    ++ I AP+DS NTDGI
Sbjct  127  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHMALVECRDFKGTRLNITAPSDSPNTDGI  184

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  185  HIERSSNVYFSRSHIATGD  203



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 122/207 (59%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
            LV  + G   N +   A G  + D TAA  KA+   C+A  PS + +P+G ++LG+    
Sbjct  11   LVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS + F      K     D    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPIEFTLQGNVK----ADGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K I S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKIATGD  210



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 121/215 (56%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            +  F +    A  Q   ++V ++   G  D D T A +KAW + C +T PS + VP+G +
Sbjct  11   MFVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTF  70

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            +     F GPCK+A+ F         AP D SQ    D WI F  +   TLSGG T++GQ
Sbjct  71   KFVGTTFKGPCKAAIEFQLQ--GTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+ +WK N C +N     CK+  IN+    LTN+ +  + S DSK FH+N+++C+ + +N
Sbjct  129  GALSWKNNDCNKNRQ---CKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEIN  185

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
               + AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  186  GFTVSAPKESMNTDGIHIGRSTGINITDTTIGTGD  220



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/196 (43%), Positives = 117/196 (60%), Gaps = 7/196 (4%)
 Frame = -2

Query  587  VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA  408
            V+   AKG G  D T +   AW + C +T  + + +  G + L ++   GPCK+ V F+ 
Sbjct  61   VENYSAKGGGIPDITQSLLGAWKKACASTTRAKVFIAGGTFALSEVVLEGPCKAHVEFEI  120

Query  407  AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLC  231
                +  AP D S+FKT DGW++F  I   T+SGG T++GQG  AW  N C +N N   C
Sbjct  121  R--GRLQAPADPSRFKT-DGWVVFQRIDGLTVSGGGTFDGQGKIAWGQNDCDKNTN---C  174

Query  230  KNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIG  51
            + LP N+    ++NA++  + ++DSK FH+NV+  KNLT     + AP DS NTDGIHIG
Sbjct  175  RTLPTNLRFNFVSNAIIHNVTTLDSKNFHVNVLGAKNLTFENFHVNAPGDSVNTDGIHIG  234

Query  50   RSEGVTVDDAEIKTGD  3
            RS GV + D  IKTGD
Sbjct  235  RSLGVNILDTNIKTGD  250



>ref|XP_010439893.1| PREDICTED: exopolygalacturonase [Camelina sativa]
Length=418

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/231 (38%), Positives = 130/231 (56%), Gaps = 24/231 (10%)
 Frame = -2

Query  644  LIFF--YVAYLVATVQGVE-------------VNVKTSGAKGDGDCDDTAAFKKAWDEVC  510
            LIFF  +++ L ++V G               VNV++ GA+ +   D T AF  AWD+ C
Sbjct  7    LIFFLIFISTLSSSVAGTLSLRNRVDKSSVSFVNVRSFGARANDHRDHTKAFVAAWDKAC  66

Query  509  KATEPST-LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFS  333
            K++  S  L +P G++ +G + F GPC +          +  A TDLS++++  GWI F 
Sbjct  67   KSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSNLTV----RVKASTDLSKYRSGGGWIEFG  122

Query  332  MIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDS  156
             I   TL+GG T++GQG+ AW  N C  + N   CK LP ++    +   VV+ I SV+S
Sbjct  123  WINGLTLTGGGTFDGQGALAWPFNNCTSDSN---CKLLPTSLKFVGMNRTVVRRISSVNS  179

Query  155  KFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KFFH+ +++C++    ++ I AP+DS NTDGIHI RS  V    + I TGD
Sbjct  180  KFFHIAIVECRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGD  230



>gb|KGN43365.1| hypothetical protein Csa_7G027810 [Cucumis sativus]
Length=439

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V++ GA+ +G  DD+ AF  AW   C +    T  +P+G Y +G + F GPCK+  +  
Sbjct  69   SVRSFGARANGLTDDSNAFLAAWRMACDSAGVVTFLIPKGTYLVGPVIFSGPCKNVSSLT  128

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A T+LS++ +  GWI F  ++  TL+GG T++G+G+ AW  N C+++ N   
Sbjct  129  VKMEGYLKASTNLSKYGSGAGWIEFRWMEGLTLNGGGTFDGRGAEAWPFNNCRDDYN---  185

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP N+    L N VV+ I S++SKFFH+ ++QCK    +++KI AP +S NTDGIHI
Sbjct  186  CKLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKRFVGSELKISAPENSPNTDGIHI  245

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  +    + I+TGD
Sbjct  246  DRSSNIHFSLSHIQTGD  262



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 113/184 (61%), Gaps = 7/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A   AW   C +T+PS + +P G Y L ++   GPCK+A+        K  AP D 
Sbjct  82   DITEALTNAWKSACASTKPSKVLIPSGTYWLRKVTLAGPCKAAIKLQVDGILK--APVDP  139

Query  371  SQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            ++  +   W+ F  +  FTLSG GT++GQG  AW  + C ++ N   CK LP+N+    +
Sbjct  140  NKL-SGGHWVNFRYVDQFTLSGRGTFDGQGKVAWSKSTCHKDKN---CKGLPMNLRFDFI  195

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
            TNA+V+ I ++DSK FH+NV+ CKNLT     +RAP +S NTDGIHIGRS G+ + D++I
Sbjct  196  TNALVRDITTLDSKNFHVNVLGCKNLTFQHFTVRAPGESVNTDGIHIGRSTGIYIIDSKI  255

Query  14   KTGD  3
             TGD
Sbjct  256  STGD  259



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 127/224 (57%), Gaps = 7/224 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPS  492
            MG   + +A+I F +  L+A+    +        K   D D T A   AW + C +T PS
Sbjct  1    MGLKVVSSAIISFSLFLLLASTANAQSKGVFDVTKYGADKDITEALTNAWKDACASTNPS  60

Query  491  TLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL  312
             + +  G Y L ++   GPCK+A+           AP D +QF +   W+ F  +  FTL
Sbjct  61   KVLISSGTYSLRKLTLAGPCKAAIELQV--DGILQAPVDPNQF-SGGHWVNFRYVDKFTL  117

Query  311  SG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
            SG GT++GQG  AW  + C+++ +   C +LP+N+    +TNA+V+ I + DSK FH+NV
Sbjct  118  SGSGTFDGQGKVAWSKSTCQKDKD---CDSLPMNIRFDFITNALVRDITTRDSKNFHVNV  174

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKNLT     + AP DS NTDGIH+G+S G+ + D++I TGD
Sbjct  175  LGCKNLTFQHFTVSAPGDSVNTDGIHVGQSTGIYIIDSKIGTGD  218



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 118/184 (64%), Gaps = 8/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A  KA+   C+ T PS + +P+G+++L +I   GPCK+ V          +A  D 
Sbjct  48   DITQALLKAFTAACQCTTPSRVVIPKGEFKLCEIIMTGPCKAPVEITLL--GTLLA--DG  103

Query  371  SQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            S    KD W++F  I  F L+GG T++G+GSAAW++N C +  N   CK LPI++    +
Sbjct  104  SNIHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVNNCHKTSN---CKKLPISLRFDFV  160

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
            TNA ++ I SVDSK FH+NVI   N+T + +KI APA+S NTDGIH+GRS+GV++ ++ I
Sbjct  161  TNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESPNTDGIHLGRSDGVSIINSRI  220

Query  14   KTGD  3
             TGD
Sbjct  221  STGD  224



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 129/213 (61%), Gaps = 10/213 (5%)
 Frame = -2

Query  635  FYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             +  YL++     EV +++  G    G  D T AF++A+   C++  PS++ +P+G Y+L
Sbjct  10   LFALYLLSFSANAEVFDIRKFGHVSVGS-DITQAFRQAFQAACQSPRPSSVVIPKGTYKL  68

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I  +GPCK+ V        +     + +     + W++F  I  F L+GG  ++GQG+
Sbjct  69   GEINMIGPCKAPVEVTVNGHLQ----ANGNALAGHEKWVVFRYINGFKLNGGGIFDGQGN  124

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAWK N C +N N   CK LPI++    + N  V+ I S+D+K FH+NV+ CKN T + +
Sbjct  125  AAWKSNDCHKNNN---CKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNFTFDNV  181

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI+APA+S NTDGIH+GRS+GV +  + I TGD
Sbjct  182  KIKAPAESPNTDGIHLGRSDGVNILRSFISTGD  214



>emb|CDY01524.1| BnaC07g35140D [Brassica napus]
Length=405

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 129/223 (58%), Gaps = 12/223 (5%)
 Frame = -2

Query  644  LIFFYVA-----YLVATVQG--VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-  489
            ++FF++A     ++V   +   + V+V++ GA+ +   D+T AF  AWD+ C ++  S  
Sbjct  11   VLFFFIASSSYSFVVPGDKSSVLTVDVRSFGARANDHRDNTKAFVAAWDKACTSSSSSVD  70

Query  488  LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS  309
            L +P G++ +G + F GPC +             A TDLS++++  GWI F  I   TL+
Sbjct  71   LIIPRGEFHVGPLRFSGPCTNVTHLTVRVKGHLKASTDLSKYRSGGGWIEFGWINGLTLT  130

Query  308  GG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVI  132
            GG T++GQG+ AW  N C  + +   CK LP ++    +   VV+ I SV+SKFFH+ ++
Sbjct  131  GGGTFDGQGALAWPFNNCTTDSH---CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALV  187

Query  131  QCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            QC++    ++ I AP+DS NTDGIHI RS  V    + I TGD
Sbjct  188  QCRDFKGTRLNITAPSDSPNTDGIHIERSSNVYFSRSHIATGD  230



>ref|XP_010489712.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=352

 Score =   157 bits (396),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 118/184 (64%), Gaps = 8/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T    KA+   C+ T PS + +P+G+++L +I   GPCK+ +  +       +A  D 
Sbjct  35   DITQELLKAFTAACQCTTPSRVVIPKGEFKLCEIIMTGPCKAPIEINLL--GTLLA--DG  90

Query  371  SQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            S    KD W++F  I  F L+G GT++G+GSAAW++N C +  N   CK LPI++    +
Sbjct  91   SNIHGKDKWVVFRKINGFKLNGAGTFDGEGSAAWRVNNCHKTSN---CKKLPISLRFDFV  147

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
            TNA ++ I SVDSK FH+NVI   N+T + +KI APA+S NTDGIH+GRS+GV++ ++ I
Sbjct  148  TNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESPNTDGIHLGRSDGVSIINSRI  207

Query  14   KTGD  3
             TGD
Sbjct  208  STGD  211



>ref|XP_009398783.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=404

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 115/197 (58%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GAK +G  DD+ AF  AWD  CK++    + VP G Y L  + F GPC+   T +
Sbjct  35   NVKDFGAKANGMTDDSKAFLAAWDAACKSSGKVKILVPSGTYLLNPVKFSGPCRDVQTLE  94

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL++F   +GW+ F  +   T++ GGT++GQG+  W  NKC +  N   
Sbjct  95   FMLQGTLKATTDLNKFGDGEGWVQFGRVDGLTVTGGGTFDGQGAVTWPYNKCPKEKN---  151

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++      N +VK I S++SKFFHM ++ C N   + I I APA S NTDGIH+
Sbjct  152  CKVLPTSVKFVNTNNTIVKDITSLNSKFFHMALLGCHNFKGSGITITAPATSPNTDGIHL  211

Query  53   GRSEGVTVDDAEIKTGD  3
              + GVT+  ++I+TGD
Sbjct  212  EGNSGVTIASSKIRTGD  228



>ref|XP_009411633.1| PREDICTED: exopolygalacturonase-like [Musa acuminata subsp. malaccensis]
Length=406

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 124/231 (54%), Gaps = 20/231 (9%)
 Frame = -2

Query  644  LIFFYVAYL---VATVQGVEVNV-------------KTSGAKGDGDCDDTAAFKKAWDEV  513
            L+  Y+  +   +ATV G   NV             K  GA+G+G  DDT AF  AWD  
Sbjct  3    LVLLYLCIICHGMATVDGARTNVSGGKPKSSGTFNVKEYGARGNGRSDDTKAFLAAWDAA  62

Query  512  CKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFS  333
            CK++    + +P G Y L  I F GPC+   +          A TDL ++    GW+ F 
Sbjct  63   CKSSGQVKILIPSGTYFLNPIEFNGPCRDVQSLKFQMQGTLRATTDLRKYGNGKGWVEFR  122

Query  332  MIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDS  156
             +   T++ GGT++GQG+ +W  NKC ++ N   CK LP ++      + VV+GI S++S
Sbjct  123  HVDGLTVTGGGTFDGQGAVSWPFNKCPKDKN---CKVLPTSVKFVNTKDTVVRGITSLNS  179

Query  155  KFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KFFHM ++ C N   + I I AP  S NTDGIH+  S GVT+  +++ TGD
Sbjct  180  KFFHMALLGCHNFKGSGITISAPGTSPNTDGIHLEGSTGVTISGSKVATGD  230



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 128/213 (60%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F   A+ +  + G+  N K         CD T A  KA++E C+    ST+ +P+G+Y+L
Sbjct  6    FGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNEACQFPTKSTVLIPKGEYKL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCK+ +   A +G       D +   ++  WI F  I  F L+GG  ++G+G+
Sbjct  66   GEIEMTGPCKAPIRI-ALQGT---VKADGNAVHSEK-WIAFRNIDGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C        CK LPI++    +TNA ++GI S+D+K FH+NVI  KN+T  ++
Sbjct  121  AAWRVNNCHHTWK---CKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  178  KIVAPAESPNTDGIHVGRSDGIKIINSFISTGD  210



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 122/214 (57%), Gaps = 8/214 (4%)
 Frame = -2

Query  635  FYVAYLVAT--VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            F + +LV T   Q    +V   GAK D + D + A   A+ E C +  PS + +P+G Y 
Sbjct  11   FALVFLVYTGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKGIYL  70

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            + Q+   G CK+ +       A   AP + SQ K    W+  + I  FTLSGG  ++GQG
Sbjct  71   MNQVRLEGNCKAPIELQIQ--ATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
               W  N CK   N+  C  LP N++   LTN++++ I S+DSK FH+NV+ CKNLT   
Sbjct  129  EQGWAQNDCK---NSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIG  185

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + I+APA S NTDGIH+ RS GV + ++EI TGD
Sbjct  186  VNIKAPAQSLNTDGIHVARSRGVNITNSEIGTGD  219



>ref|XP_008660316.1| PREDICTED: exopolygalacturonase-like [Zea mays]
 tpg|DAA46953.1| TPA: hypothetical protein ZEAMMB73_391654 [Zea mays]
Length=390

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 124/220 (56%), Gaps = 10/220 (5%)
 Frame = -2

Query  653  QAALIFFYVAYLVA--TVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKV  480
            +  L+   VA  V+   V    +NVK  GA G+G  DDT     AW   C +   +T+ V
Sbjct  4    RPRLLLVVVAIFVSISAVAAAVINVKNYGAHGNGVNDDTKPLMAAWKAACGSAGAATMVV  63

Query  479  PEGKYRLGQIGFLGPCK-SAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            P G Y +G + F GPCK S +TF      K  A TDL +F   + WI F  +   T++GG
Sbjct  64   PPGTYYIGPVQFHGPCKASTLTFQLQGTLK--AATDLKRFG--NDWIEFGWVNGLTVAGG  119

Query  302  TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCK  123
              +GQG+A+W  NKC    +   CK LP ++      N VV+ + SV+ KFFHM ++  K
Sbjct  120  VIDGQGAASWPFNKCPIRKD---CKVLPTSVLFVNNQNTVVRDVTSVNPKFFHMALLSVK  176

Query  122  NLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            N+ ++ +KI AP++S NTDGIHI RS G+++ D  I TGD
Sbjct  177  NIRMSGLKISAPSNSPNTDGIHIERSSGISIMDTHISTGD  216



>ref|XP_004144956.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004153273.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004161029.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=406

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 119/196 (61%), Gaps = 8/196 (4%)
 Frame = -2

Query  587  VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA  408
            V++ GA+ +G  DD+ AF  AW   C +    T  +P+G Y +G + F GPCK+  +   
Sbjct  49   VRSFGARANGLTDDSNAFLAAWRMACDSAGVVTFLIPKGTYLVGPVIFSGPCKNVSSLTV  108

Query  407  AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLC  231
                K  A T+LS++ +  GWI F  ++  TL+GG T++G+G+ AW  N C+++ N   C
Sbjct  109  ----KMEASTNLSKYGSGAGWIEFRWMEGLTLNGGGTFDGRGAEAWPFNNCRDDYN---C  161

Query  230  KNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIG  51
            K LP N+    L N VV+ I S++SKFFH+ ++QCK    +++KI AP +S NTDGIHI 
Sbjct  162  KLLPTNLKFVALNNTVVQHITSLNSKFFHLALVQCKRFVGSELKISAPENSPNTDGIHID  221

Query  50   RSEGVTVDDAEIKTGD  3
            RS  +    + I+TGD
Sbjct  222  RSSNIHFSLSHIQTGD  237



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 121/207 (58%), Gaps = 8/207 (4%)
 Frame = -2

Query  620  LVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFL  441
             V  + G   N +   A G  + D TAA  KA+   C+A  PS + +P+G ++LG+    
Sbjct  11   FVLCLLGYSANAEVFTAGGPPNSDITAAVLKAFTSACQAPAPSQVLIPKGDFKLGETVMT  70

Query  440  GPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKIN  264
            GPCKS + F      K     D    + KD W++F  I  F L+GG T++G+G+AAWK N
Sbjct  71   GPCKSPIEFTLQGNVK----ADGGSTQGKDRWVVFEKINGFKLNGGGTFDGEGNAAWKAN  126

Query  263  KCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPA  84
             C +      CK LPI++    + NA +K I S+D+K FH NVI  KN+T + IKI APA
Sbjct  127  NCHKTFE---CKKLPISVRFDFVDNAEIKDITSLDAKNFHFNVISGKNMTFDNIKIIAPA  183

Query  83   DSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +S NTDGIH+GR EGV + + +I TGD
Sbjct  184  ESPNTDGIHLGRCEGVKILNTKIATGD  210



>ref|XP_004292314.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=416

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 119/197 (60%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK+ GAK DG  DD+ AF  AW E C++     L +P GKY +G + F GPC++     
Sbjct  50   NVKSFGAKADGQTDDSKAFTAAWKEACQSKGRVHLIIPRGKYMVGPLKFSGPCRNV----  105

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
            +A   +  A T+LS+++   GWI F+  K  TL+GG T++GQG+ AW  NKC ++ N   
Sbjct  106  SALNLRMNATTELSKYEFGGGWIQFAWTKGLTLTGGGTFDGQGAKAWPHNKCSKDSN---  162

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++    +   V++GI SV+S FFH+ V+ C     +K+KI+AP  S NTDGIHI
Sbjct  163  CKLLPTSLKFIGMNKTVIRGISSVNSMFFHIAVVDCHYFKGSKLKIQAPETSPNTDGIHI  222

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  223  ERSSSVYFSSSHIATGD  239



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 121/215 (56%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            +  F +    A  Q   ++V ++   G  D D T A +KAW + C +T PS + VP+G +
Sbjct  11   MFVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTF  70

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            +     F GPCK+A+ F         AP D SQ    D WI F  +   TLSGG T++GQ
Sbjct  71   KFVGTTFKGPCKAAIEFQLQ--GTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+ +WK N C +N     CK+  IN+    LTN+ +  + S DSK FH+N+++C+ + +N
Sbjct  129  GALSWKNNDCNKNRQ---CKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLLKCEKVEIN  185

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
               + AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  186  GFTVSAPKESMNTDGIHIGRSTGIDIIDTTIGTGD  220



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 121/213 (57%), Gaps = 6/213 (3%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            IF  +++L         +VK+ GA      D + A   AW   C     S + +PE KY 
Sbjct  10   IFVLLSFLFNIRAEKVFDVKSFGATPSQKNDISKALLAAWKAACSTPGASRILIPEAKYA  69

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGS  282
            L  +   GPCK ++          +AP D S+  ++ GWI F  +   T+SGG  +G+G 
Sbjct  70   LRDVLLEGPCKGSMVLQIK--GTLMAPADPSEHHSQ-GWITFQHVDHLTISGGNLDGRGK  126

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
             AW  N C+ N+N   CKNLP+N+    +TN +V+ + S DSK FHMN+I C+N TL +I
Sbjct  127  IAWGKNTCRTNVN---CKNLPMNLRFDFVTNTIVENLTSRDSKNFHMNLIGCQNFTLQRI  183

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI AP DSANTDGIHIGRS  V + D++I TGD
Sbjct  184  KIIAPGDSANTDGIHIGRSNEVNIIDSKIGTGD  216



>ref|XP_002444237.1| hypothetical protein SORBIDRAFT_07g016970 [Sorghum bicolor]
 gb|EES13732.1| hypothetical protein SORBIDRAFT_07g016970 [Sorghum bicolor]
Length=391

 Score =   157 bits (396),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 119/201 (59%), Gaps = 7/201 (3%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK-S  426
            G  +NVK  GA G+G  DD+     AW   C +    T+ V  G Y +G + F GPCK S
Sbjct  23   GTVINVKNYGAHGNGANDDSKPLMAAWKAACGSAGAVTMVVTPGTYYIGPVQFHGPCKAS  82

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKENM  246
            ++TF   +G+   A TDLS+F   + WI F  +   T++GGT +GQG+A+W  NKC    
Sbjct  83   SLTFQL-QGSTLKAATDLSKFG--NDWIEFGWVNGLTVTGGTIDGQGAASWPFNKCPVRK  139

Query  245  NAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTD  66
            +   CK LP ++      N VV+ + SV+ KFFHM ++  KN+ ++ +KI AP++S NTD
Sbjct  140  D---CKVLPTSVLFVNNQNTVVRDVTSVNPKFFHMALLTVKNIRMSGLKISAPSNSPNTD  196

Query  65   GIHIGRSEGVTVDDAEIKTGD  3
            GIHI RS G+ + D  I TGD
Sbjct  197  GIHIERSSGIQITDTRISTGD  217



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 121/221 (55%), Gaps = 8/221 (4%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGVEVNVKTSGAK--GDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            +++ L  F    LV+T          + AK  G  + D + AF KAW + C +T  S + 
Sbjct  5    LKSILPMFVFMLLVSTSNAKSSIYDVTSAKYGGKANSDISQAFSKAWTDACASTLASKIV  64

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP G Y+     F GPCK+ +           AP D S+    D W+ F  I   TLSGG
Sbjct  65   VPRGTYKFVGATFKGPCKAPIEIQLQ--GTLQAPADGSKLPKADTWVGFERIDGLTLSGG  122

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++GQG+ AWK N C +N N   CK++ IN+    +TN++++ I + DSK FH+NV+ C
Sbjct  123  GTFDGQGATAWKQNDCNKNKN---CKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVLGC  179

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             N+      + AP +S NTDGIHIGRS G+ + D+ I TGD
Sbjct  180  NNVVFQHFTVSAPKESMNTDGIHIGRSTGINITDSTIGTGD  220



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 112/199 (56%), Gaps = 8/199 (4%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
            +V   T GAK   D   + A  KAW + C +   S + VP G Y L +  F GPCK+ + 
Sbjct  28   DVTSATYGAKPGSDV--STALAKAWSDACASPSASKVVVPSGTYNLKEANFRGPCKAPIE  85

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                      AP D  Q    D W+ F  I   TLSGG T++GQG+ +W  N C +N N 
Sbjct  86   MQVQ--GTLQAPADAGQLTRPDTWVGFQYIDMLTLSGGGTFDGQGALSWNQNDCHKNKN-  142

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK +P+N+    LTN+ V+ I S++SKFFHM+V +C + T  ++ I AP DS NTDGI
Sbjct  143  --CKPIPVNLRFEFLTNSKVQDITSLNSKFFHMHVFRCNHTTFQQLTITAPDDSRNTDGI  200

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HIG S G+ +  A+I TGD
Sbjct  201  HIGASTGINITHAKIGTGD  219



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 114/199 (57%), Gaps = 8/199 (4%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
            +V  +T  AK   D   T A  KAW + C +   S + VP G Y+L +  F GPCK+ + 
Sbjct  28   DVTSETYSAKPGSDV--TKALAKAWSDACASPSASKVVVPSGTYKLKEATFRGPCKAPIE  85

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                      AP +  QF   D W+ F  I  FTLSGG T++GQG+  W  N C +N N 
Sbjct  86   MQVR--GTLQAPANAGQFTRPDTWVGFQYIDKFTLSGGGTFDGQGALVWGQNDCHKNKN-  142

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK +PIN+    +TN+ V+ I S++SK FHM+V +CK+ T   + I AP +S NTDGI
Sbjct  143  --CKPIPINLRFEFITNSRVQDITSLNSKNFHMHVFRCKHTTFQHLTITAPEESRNTDGI  200

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HIG S G+ +  A+I+TGD
Sbjct  201  HIGASTGINITHAKIRTGD  219



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 124/223 (56%), Gaps = 13/223 (6%)
 Frame = -2

Query  656  IQAALIFFYVAYL----VATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST  489
            I  A +  ++A +      T  GV  +V   GA  +GD   + A   A+ E C AT PST
Sbjct  6    ISFAFLLLFLARIGDAQPTTSPGV-FDVTKYGATTNGDI--SKAVLDAFKEACAATSPST  62

Query  488  LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS  309
            + +P+G Y++ Q+   GPCK+ V       A   AP+D  Q      W+  + I  FTLS
Sbjct  63   IVIPKGTYQMNQVKLQGPCKAPVELQVQ--AILKAPSDPKQLNADVEWLTVNYIDRFTLS  120

Query  308  GG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVI  132
            GG  ++GQG  AW  N CK++ +   C NLP N++   LTN+ ++ I S DSK FH+NV 
Sbjct  121  GGGVFDGQGKQAWDQNNCKDSKS---CSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVN  177

Query  131  QCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             CKNLT  ++ I AP +S NTDGIH+ RS  V + D  I TGD
Sbjct  178  GCKNLTFIRVNITAPPESINTDGIHVARSSNVNITDCVIGTGD  220



>ref|XP_008229865.1| PREDICTED: polygalacturonase [Prunus mume]
Length=352

 Score =   155 bits (393),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 120/215 (56%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            +  F +    A  Q   ++V ++   G  D D T A +KAW + C +T PS + VP+G +
Sbjct  11   MFVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTF  70

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            +     F GPCK+A+ F         AP D SQ    D WI F  +   TLSGG T++GQ
Sbjct  71   KFVGTTFKGPCKAAIEFQLQ--GTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+ +WK N C +N     CK+  IN+    LTN+ +  + S DSK FH+N+ +C+ + +N
Sbjct  129  GALSWKNNDCNKNRQ---CKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEIN  185

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
               + AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  186  GFTVSAPKESMNTDGIHIGRSTGIDIIDTTIGTGD  220



>ref|XP_009136909.1| PREDICTED: exopolygalacturonase [Brassica rapa]
Length=424

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 118/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            V+V++ GA+ +   D+T AF  AWD  CK++  S  L +P G++ +G I F GPC +   
Sbjct  42   VDVRSFGARANDHRDNTKAFVAAWDMACKSSSSSVDLIIPRGEFHVGPIRFSGPCTNVTH  101

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   +  A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + + 
Sbjct  102  LTV----RVKASTDLSKYRSGGGWIEFGWINGLTLTGGGTFDGQGALAWPFNNCITDSH-  156

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   +V+ I SV+SKFFHM ++QC++    ++ I AP+DS NTDGI
Sbjct  157  --CKLLPTSLKFVGMNRTIVRRISSVNSKFFHMALVQCRDFKGTRLNITAPSDSPNTDGI  214

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  215  HIERSSNVYFSRSHIATGD  233



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 116/214 (54%), Gaps = 8/214 (4%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            +F  +    AT Q    ++   GA  +GD   T A   AW + C +T PS + +  G Y 
Sbjct  12   LFLLLVSSSATAQFGVFDISKYGAVPNGDI--TEALTNAWSDACASTTPSKVVIARGIYN  69

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQG  285
            L QI F GPC + +        K  AP D +Q      WI F+ I   TLSG GT++GQG
Sbjct  70   LKQIEFKGPCMAPIEVQVDGTIK--APQDPNQLNGDAQWIKFTYINFLTLSGAGTFDGQG  127

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
            + AW  N C +N +   CK L +N   G L N +V+ I S DSK+FH+NV+ C N+T   
Sbjct  128  ANAWTQNNCAKNKS---CKKLSMNFGFGFLNNTIVRDITSKDSKYFHVNVLGCNNITFTN  184

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              I APA S NTDGIHIGRS  V +D+  I TGD
Sbjct  185  FNIVAPATSPNTDGIHIGRSTLVNIDNTNIATGD  218



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/223 (39%), Positives = 123/223 (55%), Gaps = 12/223 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQG----VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST  489
            +++ L  F    LV+T        +V   T G K + D   + AF KAW + C +T  S 
Sbjct  5    LKSILPMFVFLLLVSTSNAKSSIYDVTSATYGGKANSDI--SQAFSKAWTDACASTLASK  62

Query  488  LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS  309
            + VP G Y+     F GPCK+ +           AP D S+    D W+ F  I   TLS
Sbjct  63   IVVPRGTYKFVGATFKGPCKAPIEIQLQ--GTLQAPVDGSKLSKADTWVGFERIDGLTLS  120

Query  308  GG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVI  132
            GG T++GQG+ AWK N C +N N   CK++ IN+    +TN++++ I + DSK FH+NV+
Sbjct  121  GGGTFDGQGATAWKQNDCNKNKN---CKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVL  177

Query  131  QCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             C N+   +  + AP +S NTDGIHIGRS G+ + D+ I TGD
Sbjct  178  GCNNVAFQRFTVSAPKESMNTDGIHIGRSTGINITDSIIGTGD  220



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 128/219 (58%), Gaps = 13/219 (6%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVP  477
            +  AL+  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P
Sbjct  7    VHFALVLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLSAFKEACQSTSPSTIVIP  63

Query  476  EGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-T  300
            +G + + Q+   GPCKS +       A   AP+D SQ K  + W+  + I  FT+SGG  
Sbjct  64   KGTFTMNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKIDQFTMSGGGI  120

Query  299  YNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKN  120
             +GQ +AAW+   CK   N+  C  LP N++  +LTN+ +K I ++DSK FH+NV QCKN
Sbjct  121  LDGQAAAAWE---CK---NSKKCNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKN  174

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            LT  +  + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  175  LTFIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  213



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 125/213 (59%), Gaps = 8/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F    + V  + G+  N K          D T A  KA+ E C+A   ST+ +P+G+Y+L
Sbjct  5    FGVSVFFVFCLVGLSANAKVFNIGSPPGSDITKALLKAFTEACQAPTKSTVMIPKGEYKL  64

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCK+ +   A +G       D +    K+ W+ F  I  F L+GG  ++G+G+
Sbjct  65   GEIEMTGPCKAPIRI-ALQGT---VKADGNLINGKEKWVAFRNIDGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
             AW+ N C +  N   CK LPI++    +TNA ++GI S+D+K FH+NVI  KN+T   +
Sbjct  121  NAWRSNNCHKTFN---CKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEDV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  178  KIVAPAESPNTDGIHVGRSDGIRIINSFISTGD  210



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 120/221 (54%), Gaps = 8/221 (4%)
 Frame = -2

Query  656  IQAALIFFYVAYLVAT--VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            ++  L  F    LV+T   Q    +V ++   G  + D T A  KAW + C +T  S + 
Sbjct  5    LKNILPMFVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSASKIV  64

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP G Y+     F GPCK+ + F         AP D SQ    D WI F  I   TLSGG
Sbjct  65   VPSGTYKFVGATFKGPCKAPIEFQLQ--GTLQAPEDGSQLPKADTWIGFERIDGLTLSGG  122

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++G G+ AWK N C +N N   CK++ IN+    +TN++++ I + DSK FH+N++ C
Sbjct  123  GTFDGLGATAWKQNDCNKNKN---CKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGC  179

Query  125  KNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             N+      + AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  180  NNVAFQHFTVSAPKESINTDGIHIGRSTGINITDTTIGTGD  220



>ref|XP_010434565.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=418

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 118/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            VNV++ GA+ +   D T AF  AWD+ CK++  S  L +P G++ +G + F GPC +   
Sbjct  39   VNVRSFGARANDHRDHTKAFVAAWDKACKSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSN  98

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   +  A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + N 
Sbjct  99   LTV----RVKASTDLSKYRSGGGWIEFGWINGLTLTGGGTFDGQGALAWPFNNCTSDSN-  153

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFH+ +++C++    ++ I AP+DS NTDGI
Sbjct  154  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGI  211

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  212  HIERSSNVYFSRSHIATGD  230



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 120/215 (56%), Gaps = 6/215 (3%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            +  F +    A  Q   ++V ++   G  D D T A +KAW + C +T PS + VP+G +
Sbjct  11   MFVFLLLASTAKAQSAALDVTSAKYGGKPDSDITQALEKAWTDACASTAPSKIVVPKGTF  70

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            +     F GPCK+A+ F         AP D SQ    D WI F  +   TLSGG T++GQ
Sbjct  71   KFVGTTFKGPCKAAIEFQLQ--GTLQAPADGSQLPKDDTWIGFDHVDGLTLSGGGTFDGQ  128

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+ +WK N C +N     CK+  IN+    LTN+ +  + S DSK FH+N+ +C+ + +N
Sbjct  129  GALSWKNNDCNKNRQ---CKSKHINLRFHFLTNSKILDVTSKDSKNFHVNLQKCEKVEIN  185

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
               I AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  186  GFTISAPKESMNTDGIHIGRSTGIDIIDTTIGTGD  220



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 128/213 (60%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F   A+ V  + G+  N K          D T A  KA++E C+    ST+ +P+G+Y+L
Sbjct  6    FGVSAFFVFCLLGLSANAKVFNIGSPPGSDITNALLKAFNEACQFPTKSTVLIPKGEYKL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I  +GPCK+ +   A +G       D      K+ W+ F  I  F L+GG  ++G+G+
Sbjct  66   GEIVMMGPCKAPIRI-ALQGT---VKAD-GNANGKEKWVAFRNIDGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C +  N   CK LPI++    +TNA ++GI S+D+K FH+NVI  KN+T   +
Sbjct  121  AAWRVNNCHKTFN---CKKLPISIRFDFVTNAKIRGITSLDAKNFHINVIGAKNMTFEDV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  178  KIIAPAESPNTDGIHVGRSDGIKIINSFISTGD  210



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/213 (39%), Positives = 124/213 (58%), Gaps = 8/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F     LV  + G+  N +          D T A  KA+   C++T PS + +P+G+++L
Sbjct  5    FAVSTILVLCLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSTSPSKVVIPKGEFKL  64

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCK+ V        K     D +    KD W++F  I  F L+GG  ++G+G+
Sbjct  65   GEIEMRGPCKAPVEITLQGTVK----ADGNTNHGKDKWVVFGNINGFKLNGGGAFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C +      CK LPI++    + NA +K I S+D+K FH+NV+  KN+T++ I
Sbjct  121  AAWRVNNCHKTFE---CKKLPISVRFDFVENAEIKDISSIDAKNFHINVLGAKNMTMDNI  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI AP DS NTDGIH+GRS+GV + ++ I TGD
Sbjct  178  KITAPEDSPNTDGIHLGRSDGVKILNSFISTGD  210



>dbj|BAK05779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=412

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/233 (35%), Positives = 135/233 (58%), Gaps = 13/233 (6%)
 Frame = -2

Query  686  KKKKEMGSNAIQAALIFFYVAY---LVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWD  519
            +++ +M   A     +FF ++    L     G +V +V   GA  DG+ DD+ AF +AW 
Sbjct  6    RRRSDM---AFPLVALFFMISARWCLEVAHAGRQVFDVMDFGAIADGETDDSKAFIRAWM  62

Query  518  EVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWIL  339
            + C +   + + +P+G+YRL  + F GPCK  +    A      AP DL+ F+    WI 
Sbjct  63   KACASPGRAAVVIPKGEYRLQPVVFRGPCKGYMEVRLA--GVLRAPDDLAAFRGSHEWIN  120

Query  338  FSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSV  162
            F+ I    ++GG T++G+G ++W +N+C  N N   CK LP+++ LG + N  +  + S+
Sbjct  121  FASIDGLLVTGGGTFDGRGESSWHLNECPTNPN---CKPLPVSIKLGRVRNVTITAVTSL  177

Query  161  DSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +SKFFH+ +I  ++++++++ IRAP DS NTDG+HI  S  V + D  I TGD
Sbjct  178  NSKFFHVIIIGSQDVSIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAIATGD  230



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 127/219 (58%), Gaps = 13/219 (6%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVP  477
            +  AL+  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P
Sbjct  7    VHFALVLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLNAFKEACQSTSPSTIVIP  63

Query  476  EGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-T  300
            +G + + Q+   GPCKS +       A   AP+D SQ K  + W+  + +  FT+SGG  
Sbjct  64   KGTFTMNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKLDQFTMSGGGI  120

Query  299  YNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKN  120
             +GQ +AAW+  + K+      C  LP N++  +LTN+ +K I ++DSK FH+NV QCKN
Sbjct  121  LDGQAAAAWECKQSKK------CNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKN  174

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            LT  +  + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  175  LTFIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  213



>gb|EAZ14447.1| hypothetical protein OsJ_04368 [Oryza sativa Japonica Group]
Length=408

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 116/202 (57%), Gaps = 7/202 (3%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS-  426
            G   +V   GA+GDG  D T  F +AW + C++  P+T+ VP G+Y LG+  F+GPC S 
Sbjct  26   GAVYSVVRYGARGDGASDSTRPFLRAWADACRSPRPATVYVPPGRYLLGRATFVGPCSSR  85

Query  425  AVTFDAAEGAKFIAPTDLS-QFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKEN  249
            AV F  A     +AP   +    T   WI F  +   T+SGGT +G+G A W    CK+ 
Sbjct  86   AVAFSTA--GTVVAPAGYAWDGATAGQWITFESVVGLTVSGGTLDGRGEALWA---CKKQ  140

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C     ++ +    N VV+G++SV S+ FH+ V+Q + +T+ ++ + APADS NT
Sbjct  141  QPRGHCPTGASSLTISNARNVVVEGVRSVSSELFHVVVLQSRGVTVRRVTVEAPADSPNT  200

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHI +S  V V DA I+TGD
Sbjct  201  DGIHIHKSTNVAVYDAAIRTGD  222



>ref|XP_006442242.1| hypothetical protein CICLE_v10023493mg [Citrus clementina]
 gb|ESR55482.1| hypothetical protein CICLE_v10023493mg [Citrus clementina]
Length=396

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/225 (38%), Positives = 129/225 (57%), Gaps = 7/225 (3%)
 Frame = -2

Query  671  MGSNAIQAALIFFYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEP  495
            M S+ +   L+F   A +     G+++ +V   GA GDG  D+T AF +AW++ CK    
Sbjct  1    MPSSRVLLFLMFLGFAVVTKVQGGIKIFDVTKYGAIGDGRIDNTKAFLRAWNDACKWDGN  60

Query  494  STLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFT  315
            S + +P G + LG + F GPCK +  F      +  AP+DL +    D WI F  +    
Sbjct  61   SGVLIPRGTFLLGTVTFTGPCKKSTAFQIKGVIR--APSDLKRMSNPDQWIGFRYVDRLL  118

Query  314  LSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMN  138
            ++G GT +GQG++AW  N C E+   P C +LPI+M    +TN+ + GI SV+SK  H++
Sbjct  119  VNGRGTVDGQGASAWSFNSCAED---PNCPSLPISMVFNFVTNSRISGITSVNSKNAHIS  175

Query  137  VIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +  C  ++++ IKI AP  S NTDGI IG S+G+ +  + I TGD
Sbjct  176  LYGCHKVSIDNIKITAPYQSPNTDGIKIGDSKGIKITHSSIGTGD  220



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 128/218 (59%), Gaps = 20/218 (9%)
 Frame = -2

Query  635  FYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             +  YL++     EV +++  G    G  D T A ++A+   C+   PS++ +P+G Y+L
Sbjct  10   LFALYLLSFSANAEVFDIRKFGTASVGS-DITQALRQAFQAACQNPRPSSVVIPKGTYKL  68

Query  458  GQIGFLGPCKSAVTFDA-----AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTY  297
            G+I  +GPCK+ V         A G   +          ++ W++F  I  F L+G G +
Sbjct  69   GEIDMVGPCKAPVEVTVNGHLQANGNALVG---------REKWVVFRYINGFKLNGAGIF  119

Query  296  NGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNL  117
            +GQG+AAWK N C +N N   CK LPI++    + N  V+ I S+D+K FH+NV+ CKN 
Sbjct  120  DGQGNAAWKSNDCHKNNN---CKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNF  176

Query  116  TLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            T + +KI+APA+S NTDGIH+GRS+GV +  + I TGD
Sbjct  177  TFDNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGD  214



>ref|XP_002438528.1| hypothetical protein SORBIDRAFT_10g021590 [Sorghum bicolor]
 gb|EER89895.1| hypothetical protein SORBIDRAFT_10g021590 [Sorghum bicolor]
Length=422

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 106/192 (55%), Gaps = 8/192 (4%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAKGDG  D T A  +AW   C    P TL +P+G Y  G + F GPCK +VT       
Sbjct  61   GAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPCKGSVTIQLD--G  118

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLP  219
              +  TDLS +KT   WI    + +  +SG GT +GQG   W  NKC +  +   CK LP
Sbjct  119  NLLGTTDLSAYKTN--WIEIEHVDNLVISGKGTLDGQGKQVWDNNKCAQKYD---CKILP  173

Query  218  INMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEG  39
              + L    NA V GI  ++SKFFHMNV QCK +T+  + + AP DS NTDGIHIG S  
Sbjct  174  NTLVLDFCNNATVSGITLLNSKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSSK  233

Query  38   VTVDDAEIKTGD  3
            VT+    I  GD
Sbjct  234  VTITGTTIGVGD  245



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 127/219 (58%), Gaps = 13/219 (6%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVP  477
            +  AL+  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P
Sbjct  7    VHFALVLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLNAFKEACQSTSPSTIVIP  63

Query  476  EGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-T  300
            +G + + Q+   GPCKS +       A   AP+D SQ K  + W+  + +  FT+SGG  
Sbjct  64   KGTFTMNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKLDQFTMSGGGI  120

Query  299  YNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKN  120
             +GQ +AAW+  + K+      C  LP N++  +LTN+ +K I ++DSK FH+NV QCKN
Sbjct  121  LDGQAAAAWECKQSKK------CNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKN  174

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            LT  +  + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  175  LTFIRFNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  213



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 115/186 (62%), Gaps = 7/186 (4%)
 Frame = -2

Query  557  DCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPT  378
            D D T A   AW + C +T PS + +P G Y L ++   GPCK+A+        K  AP 
Sbjct  19   DKDITEALTNAWKDACASTNPSKVLIPSGTYSLRKLTLAGPCKAAIELQVDGMLK--APV  76

Query  377  DLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLG  201
            D +QF +   W+ F  +  FTLSG GT++GQG AAW  + C+++ +   C +LP+N+   
Sbjct  77   DPNQF-SGGHWVNFGHVDKFTLSGSGTFDGQGKAAWSKSTCQKDKD---CDSLPMNLRFD  132

Query  200  TLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDA  21
             +TNA+V+ I + DSK FH+NV+ CKNLT     + AP +S NTDGIH+G+S G+ + D+
Sbjct  133  FITNALVRDITTRDSKNFHVNVLGCKNLTFQHFTVSAPGESVNTDGIHVGQSTGIYIIDS  192

Query  20   EIKTGD  3
            +I TGD
Sbjct  193  KIGTGD  198



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 125/221 (57%), Gaps = 11/221 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLV--ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLK  483
            + A L+ F +A  +  A   GV  NV   GA  DG  D++ AF+ AW E C     ST+ 
Sbjct  11   VLAILVLFTLAQNIINAAPNGV-FNVIDFGAVADGIRDNSKAFENAWREACNWNTYSTVL  69

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG  303
            VP GKY +  + F GPCK+ ++F        +AP  LS+   K+ WI F  ++ FTL+GG
Sbjct  70   VPPGKYLVTSVVFKGPCKAPISFQLQ--GLILAPPGLSKLADKESWITFESLRSFTLTGG  127

Query  302  -TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQC  126
             T++GQG  AW  N+C +N N      LPI++    L ++ + G++SVDSKFFH+N++ C
Sbjct  128  GTFHGQGRTAWPENQCHKNSNC----QLPISIRFNKLNDSTITGVQSVDSKFFHINILGC  183

Query  125  KNLTLNKIKIRAPADSANTDGIHIGR-SEGVTVDDAEIKTG  6
             NL LNKI I AP D+   D + +G  S+ V V D     G
Sbjct  184  YNLKLNKINISAPDDTTGDDCVSLGDGSQNVLVSDVSCGPG  224



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 126/213 (59%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F   A+ V  + G+  N K          D T A  KA++E C+    ST+ +P+G+Y+L
Sbjct  6    FGVSAFFVFCLLGLSANAKIFNINSPPGSDITNALLKAFNEACQFPTKSTVMIPKGEYKL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I  +GPCK+ +        K     +      K+ W+ F  I  F L+GG  ++G+G+
Sbjct  66   GEIVMMGPCKAPIRIALLGTVKADGNAN-----GKEKWVAFRNINGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C +  N   CK LPI++    +T+A ++GI S+D+K FH+NVI  KN+T   +
Sbjct  121  AAWRVNNCHKTFN---CKKLPISIRFDFVTDAKIRGITSLDAKHFHINVIGAKNVTFEDV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  178  KIIAPAESPNTDGIHVGRSDGIKIINSFISTGD  210



>gb|KFK28496.1| hypothetical protein AALP_AA7G003400 [Arabis alpina]
Length=426

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 115/199 (58%), Gaps = 5/199 (3%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTL-KVPEGKYRLGQIGFLGPCKSAVT  417
            VNV + GA+ +   D T AF  AWD+ CK++  S L  +P G++ +G + F GPC +   
Sbjct  52   VNVISFGARANNQKDQTKAFVAAWDKACKSSSRSVLFIIPRGEFYVGPLRFSGPCTNVTN  111

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                      A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + N 
Sbjct  112  LTVQVEGHLKASTDLSKYRSGSGWIEFGWINGLTLTGGGTFDGQGALAWPYNNCASDHN-  170

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFH+ +++C++    ++ I AP+ S NTDGI
Sbjct  171  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSYSPNTDGI  228

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  229  HIERSSNVYFSRSRIATGD  247



>ref|XP_008462134.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=508

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 122/205 (60%), Gaps = 14/205 (7%)
 Frame = -2

Query  611  TVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            T+QG  + +V T GAK + D   T A   AW E C +T PSTL +P+G Y+L Q    GP
Sbjct  18   TIQGQSIFDVTTYGAKPNTDI--TQALANAWTEACASTTPSTLLIPKGVYQLSQSNLKGP  75

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTK-DGWILFSMIKDFTLSG-GTYNGQGSAAWKINK  261
            CKS       EG    AP       TK DG +LF+ I    LSG G ++GQG + W+ N 
Sbjct  76   CKSVPIQVQVEGT-LQAP-----IHTKGDGLVLFTYIDQLILSGSGVFDGQGKSGWEKNN  129

Query  260  CKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPAD  81
            C +N    +C  LP+N+   ++TN++VK I S+DS +FH+N++ CKN+TL  + I A  +
Sbjct  130  CHKN---KICTKLPMNVRFSSITNSIVKDITSLDSNYFHINLLSCKNVTLQNVTIIASEN  186

Query  80   SANTDGIHIGRSEGVTVDDAEIKTG  6
            S NTDG+H+ RSE + + + +I TG
Sbjct  187  SPNTDGVHVSRSEEINILNTQISTG  211



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 114/197 (58%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V   GA  +GD   + A   A+ E C AT PST+ +P+G Y++ Q+   GPCK+ V   
Sbjct  31   DVTKYGATTNGDI--SKAVLDAFKEACAATSPSTIVIPKGTYQMNQVKLQGPCKAPVELQ  88

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                A   AP+D  Q      W+  + I  FTLSGG  ++GQG  AW  N CK++ +   
Sbjct  89   VQ--AILKAPSDPKQLSADIEWLTVNYIDRFTLSGGGVFDGQGKQAWGQNNCKDSKS---  143

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C NLP N++   LTN+ ++ I S DSK FH+NV  CKNLT  ++ I AP +S NTDGIH+
Sbjct  144  CSNLPNNLSFNFLTNSTIQDITSQDSKLFHINVNGCKNLTFIRVNITAPQESINTDGIHV  203

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V + D  I TGD
Sbjct  204  ARSSNVNITDCVIGTGD  220



>ref|NP_001045053.1| Os01g0891100 [Oryza sativa Japonica Group]
 dbj|BAB90184.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF06967.1| Os01g0891100 [Oryza sativa Japonica Group]
 gb|EAY76790.1| hypothetical protein OsI_04747 [Oryza sativa Indica Group]
Length=408

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 116/202 (57%), Gaps = 7/202 (3%)
 Frame = -2

Query  602  GVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS-  426
            G   +V   GA+GDG  D T  F +AW + C++  P+T+ VP G+Y LG+  F+GPC S 
Sbjct  26   GAVYSVVRYGARGDGASDSTRPFLRAWADACRSPRPATVYVPPGRYLLGRATFVGPCSSR  85

Query  425  AVTFDAAEGAKFIAPTDLS-QFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKEN  249
            AV F  A     +AP   +    T   WI F  +   T+SGGT +G+G A W    CK+ 
Sbjct  86   AVAFSIA--GTVVAPAGYAWDGATAGQWITFESVVGLTVSGGTLDGRGDALWA---CKKQ  140

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
                 C     ++ +    N VV+G++SV S+ FH+ V+Q + +T+ ++ + APADS NT
Sbjct  141  QPRGHCPTGASSLTISNARNVVVEGVRSVSSELFHVVVLQSRGVTVRRVTVEAPADSPNT  200

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHI +S  V V DA I+TGD
Sbjct  201  DGIHIHKSTNVAVYDAAIRTGD  222



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVE---VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPE  474
            +  F    L+A++ G +   ++V++ GAKGDG  D + A   AW   C + +PST+ +P 
Sbjct  7    ITLFSSWLLLASIVGAQSRPLDVRSFGAKGDGVSDISQALLSAWKAACNSPKPSTIVIPR  66

Query  473  GKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDG-WILFSMIKDFTLSG-GT  300
            G + L Q    GPCK+ +        K  AP + +  K  DG W+    +  FTLSG GT
Sbjct  67   GTFGLLQATLEGPCKAPIELQVQGTLK--APQNPNLIK--DGEWVTIQYLDHFTLSGSGT  122

Query  299  YNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKN  120
            ++GQG+ AW  N C +   A  C  LP N +   L N+++ GI S++SK FHMN++ C N
Sbjct  123  FDGQGARAWAQNDCAK---ASDCSKLPNNFSFNFLNNSIISGIASLNSKLFHMNILGCNN  179

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            +TL+++ I AP  S NTDGIH+GRS GV + D+ I TGD
Sbjct  180  VTLSRLTITAPGTSLNTDGIHVGRSSGVNITDSTIGTGD  218



>ref|XP_004974598.1| PREDICTED: exopolygalacturonase-like [Setaria italica]
Length=388

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 8/198 (4%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK-SAVT  417
            VNVK  GAKG+G  DDT     AW   C      T+ VP G Y LG + F GPCK S +T
Sbjct  24   VNVKNYGAKGNGVNDDTKPLMTAWKAACATAGAVTMVVPAGTYYLGPVQFHGPCKASTLT  83

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKENMNAP  237
            F      K  A TDL +F   + WI F  +   T++GG  +GQG+A+W  NKC    +  
Sbjct  84   FQLQGTLK--AATDLKRFG--NDWIEFGWVNGLTVAGGVIDGQGAASWPFNKCPVRKD--  137

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             CK LP ++      N VV+ + SV+ KFFH+ ++  KN+ ++ +KI AP++S NTDGIH
Sbjct  138  -CKVLPTSVLFVNNQNTVVRDLTSVNPKFFHIALLSVKNIKMSGLKITAPSNSPNTDGIH  196

Query  56   IGRSEGVTVDDAEIKTGD  3
            I RS GV++ D  I TGD
Sbjct  197  IERSAGVSITDTHIATGD  214



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 119/189 (63%), Gaps = 17/189 (9%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA-----AEGAKFI  387
            D T A  KA+   C+ T PS + +P+G+++L +I   GPCK+ +  +      A+G+   
Sbjct  35   DITQALLKAFTAACQCTAPSRVVIPKGEFKLCEIIMTGPCKAPIEINLLGTLLADGSNI-  93

Query  386  APTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINM  210
                      KD W++F  I  F L+GG T++G+GSAAW++N C +  N   CK LPI++
Sbjct  94   -------HHGKDKWVVFRKINGFKLNGGGTFDGEGSAAWRVNNCHKTSN---CKKLPISI  143

Query  209  NLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTV  30
                +TNA ++ I SVDSK FH+NVI   N+T + +KI APA+S NTDGIH+GRS+GV++
Sbjct  144  RFDFVTNAEIRDISSVDSKNFHVNVIGAMNMTFDNVKILAPAESPNTDGIHLGRSDGVSI  203

Query  29   DDAEIKTGD  3
             ++ I TGD
Sbjct  204  INSRISTGD  212



>ref|XP_004514023.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=390

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 112/205 (55%), Gaps = 9/205 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
             T Q    N++  GA    + D T A K AW E C++   S + VP G+Y+L QI   GP
Sbjct  21   VTAQPGVFNIRKYGAP---NGDITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGP  77

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK+ +  +        AP +      +D WI F  I  FTLSG GT++GQG  AWK N C
Sbjct  78   CKAPI--EVKVNGIIQAPKNPFHLNGQDQWIRFQYINFFTLSGKGTFDGQGEMAWKQNDC  135

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
              N N   CK L +N     L N+V+K I S DSK+FH NV  C N+T     I AP  S
Sbjct  136  GRNTN---CKRLAMNFGFAFLNNSVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESS  192

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIHIG+S  V + +++I +GD
Sbjct  193  PNTDGIHIGKSSRVKISNSKIGSGD  217



>ref|XP_008803528.1| PREDICTED: exopolygalacturonase-like [Phoenix dactylifera]
Length=398

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 127/223 (57%), Gaps = 13/223 (6%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEV---------NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST  489
            + FY++ +  ++   E          NV   GA+ +G  DD+ AF  AW   C A     
Sbjct  3    LLFYLSLICFSIGNAEARKSSSSRNFNVLHYGARANGITDDSKAFMAAWKAACAAVGAVK  62

Query  488  LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS  309
            L++P G Y +G   F GPCK+  +          A TDLS++ T D W+ F+ +   TL+
Sbjct  63   LQIPAGTYLIGPTKFAGPCKNVRSLTVNMKGHLKATTDLSKYVTGDDWVEFAWVDMLTLT  122

Query  308  GG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVI  132
            GG T++GQG+A+W  NKC  N N   CK LP ++     +N VV+ IKS++SKFFH+ ++
Sbjct  123  GGGTFDGQGAASWPYNKCPTNKN---CKLLPTSVKFIATSNTVVENIKSLNSKFFHIALV  179

Query  131  QCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             CKN     IKI AP++S NTDGIHI RS GVT+  + I TGD
Sbjct  180  GCKNFWGKNIKITAPSNSPNTDGIHIERSTGVTIYRSVIGTGD  222



>ref|NP_193552.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 emb|CAB78820.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AEE84007.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=414

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 118/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            V+V++ GA+ +   D T AF  AWD+ CK++  S  L +P G++ +G + F GPC +   
Sbjct  35   VDVRSFGARANDHRDHTKAFVAAWDKACKSSSSSVNLIIPRGEFSVGSLRFSGPCTNVSN  94

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   +  A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + N 
Sbjct  95   LTV----RVKASTDLSKYRSGGGWIQFGWINGLTLTGGGTFDGQGALAWPFNNCTSDSN-  149

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFH+ +++C++    ++ I AP+DS NTDGI
Sbjct  150  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGI  207

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  208  HIERSSNVYFSRSHIATGD  226



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/205 (42%), Positives = 111/205 (54%), Gaps = 9/205 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
             T Q    N++  GA      D T A K AW E C++   S + VP G+Y+L QI   GP
Sbjct  21   VTAQPGVFNIRKYGAPNG---DITNALKNAWKEACESRSRSKVVVPSGRYKLQQIDLEGP  77

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK+ +  +        AP +      +D WI F  I  FTLSG GT++GQG  AWK N C
Sbjct  78   CKAPI--EVKVNGIIQAPKNPFHLNGQDQWIRFQYINFFTLSGKGTFDGQGEMAWKQNDC  135

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
              N N   CK L +N     L N+V+K I S DSK+FH NV  C N+T     I AP  S
Sbjct  136  GRNTN---CKRLAMNFGFAFLNNSVIKDINSKDSKYFHANVFGCNNVTFTNFNINAPESS  192

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIHIG+S  V + +++I +GD
Sbjct  193  PNTDGIHIGKSSRVKISNSKIGSGD  217



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 117/217 (54%), Gaps = 8/217 (4%)
 Frame = -2

Query  644  LIFFYVAYLVAT--VQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEG  471
            L  F    LV+T   Q    +V ++   G  + D T A  KAW + C +T    + VP G
Sbjct  9    LPMFVSLLLVSTSNAQSGVYDVTSANYGGKANSDITQALSKAWTDACASTSAGKIVVPSG  68

Query  470  KYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYN  294
             Y+     F GPCK+ + F         AP D SQ    D WI F  I   TLSGG T++
Sbjct  69   TYKFVGATFKGPCKAPIEFQLQ--GTLQAPEDGSQLPKADTWIGFERIDGLTLSGGGTFD  126

Query  293  GQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLT  114
            G G+ AWK N C +N N   CK++ IN+    +TN++++ I + DSK FH+N++ C N+ 
Sbjct  127  GLGATAWKQNDCNKNKN---CKSIAINLRFNFVTNSIIRDITTKDSKNFHVNLLGCNNVA  183

Query  113  LNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
                 + AP +S NTDGIHIGRS G+ + D  I TGD
Sbjct  184  FQHFTVSAPKESINTDGIHIGRSTGINITDTTIGTGD  220



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 127/218 (58%), Gaps = 20/218 (9%)
 Frame = -2

Query  635  FYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             +  YL +     EV +++  G    G  D T A ++A+   C+   PS++ +P+G Y+L
Sbjct  10   LFALYLFSFWANAEVFDIRKFGTASVGS-DITQALRQAFQAACQNPRPSSVVIPKGTYKL  68

Query  458  GQIGFLGPCKSAVTFDA-----AEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTY  297
            G+I  +GPCK+ V         A G   +          ++ W++F  I  F L+G G +
Sbjct  69   GEIDMVGPCKAPVEVTVNGHLQANGNALVG---------REKWVVFRYINGFKLNGAGIF  119

Query  296  NGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNL  117
            +GQG+AAWK N C +N N   CK LPI++    + N  V+ I S+D+K FH+NV+ CKN 
Sbjct  120  DGQGNAAWKSNDCHKNNN---CKKLPISIRFDFVLNGEVRDITSLDAKNFHVNVLGCKNF  176

Query  116  TLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            T + +KI+APA+S NTDGIH+GRS+GV +  + I TGD
Sbjct  177  TFDNVKIKAPAESPNTDGIHLGRSDGVNILRSFISTGD  214



>ref|XP_010259722.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=477

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 120/205 (59%), Gaps = 5/205 (2%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A  +G+  NVK  GAK DG  D+T AF + W   C + + + + +PEG YR+G + F GP
Sbjct  94   AKPRGIIFNVKLFGAKPDGRKDNTQAFMRTWVAACNSKDQARVLIPEGIYRIGPVIFQGP  153

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKC  258
            C S             A  D+S++ + + W+ F  +    L+GG T++GQG A W+ N C
Sbjct  154  CNSPDPIIVQVKGTVKATDDISEYPSPE-WVSFEKLDGVILTGGGTFDGQGQAVWQYNDC  212

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
              N     C+ LP ++ L +++NA+++ IKS++SK FH+ +   KN+ +  + I AP DS
Sbjct  213  SSNA---YCQLLPTSIKLSSVSNAIIRRIKSINSKSFHIGITNGKNIKVRSVDIVAPEDS  269

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIHI RS GV++  A I TGD
Sbjct  270  PNTDGIHISRSFGVSISKAVIGTGD  294



>ref|XP_006285299.1| hypothetical protein CARUB_v10006680mg [Capsella rubella]
 gb|EOA18197.1| hypothetical protein CARUB_v10006680mg [Capsella rubella]
Length=420

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 117/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            VNV++ GA+ +   D T AF  AWD+ CK+   S  L +P G++ +G + F GPC +  +
Sbjct  41   VNVRSFGARANDHKDHTKAFVAAWDKACKSYSSSVHLIIPRGEFSVGPLRFSGPCTNVSS  100

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                  A     TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  + N 
Sbjct  101  LTVLVKAS----TDLSKYRSGGGWIQFGWINGLTLTGGGTFDGQGALAWPFNNCTSDSN-  155

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFH+ +++C++    ++ I AP+DS NTDGI
Sbjct  156  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGI  213

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  214  HIERSSNVYFSRSHIATGD  232



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 114/195 (58%), Gaps = 11/195 (6%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAK +GD   T     AW + C A  P+ + VP G Y L  I F GPCKS VT + A   
Sbjct  42   GAKPNGDA--TQGLVAAWKQACAAAAPTKILVPAGDYMLNAIKFTGPCKSPVTIEIA--G  97

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTL----SGGTYNGQGSAAWKINKCKENMNAPLCK  228
             F AP D +Q K +D W+    I+  T+    +GGT++GQG  AWK N C +      C 
Sbjct  98   NFKAPADPAQMKGEDTWVKIENIQGLTVNCLPTGGTFDGQGQMAWKQNNCAKTGT---CD  154

Query  227  NLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGR  48
            NLP N    +LTN+ + GIKS++SK +HM V+ CKN TL    I AP DS NTDGIHIGR
Sbjct  155  NLPYNFRFNSLTNSKISGIKSLNSKLYHMGVLSCKNFTLFDTTIEAPKDSLNTDGIHIGR  214

Query  47   SEGVTVDDAEIKTGD  3
            S G+ V  A+I TGD
Sbjct  215  SAGIFVTKAKIGTGD  229



>gb|KEH33414.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=395

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 110/197 (56%), Gaps = 8/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA  DG  D+  AF KAW + C +    TL +P+G Y + Q+ F GPCK +  F 
Sbjct  28   NVLNYGAIADGKTDNKEAFLKAWSDACNSNGKVTLLIPKGTYMVKQVIFSGPCKGSTNFK  87

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
                 K  AP D   F   D WI F  + +  + G GT +GQGS+AW +N CK N   P 
Sbjct  88   IQGTLK--APID--PFFATDKWINFQYVNNLVVGGPGTLDGQGSSAWSVNDCKNN---PN  140

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LPI+M    +TN  +  ++S +SK  H  +  C+N+   KI+I AP DS NTDGI I
Sbjct  141  CPRLPISMTFDFVTNGTIHHLRSFNSKGAHFKLFACENMIFTKIRISAPGDSPNTDGIKI  200

Query  53   GRSEGVTVDDAEIKTGD  3
            G+S G+T+  A I TGD
Sbjct  201  GKSNGITIKSASIGTGD  217



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 122/214 (57%), Gaps = 8/214 (4%)
 Frame = -2

Query  635  FYVAYLV--ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            F + +LV     Q    +V   GAK D + D + A   A+ E C +  PS + +P+G Y 
Sbjct  11   FALLFLVHIGESQPAVFDVTKFGAKPDSNEDISKALLSAFKEACNSKIPSKVVIPKGTYL  70

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            + Q+   G CK+ +  +    A   AP + SQ K    W+  + I  FTLSGG  ++GQG
Sbjct  71   MNQVRLEGNCKAPIELEIQ--ATLKAPPNPSQLKKDMEWLTINHIDHFTLSGGGIFDGQG  128

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
               W  N CK   N+  C  LP N++   LTN++++ I S+DSK FH+NV+ CKNLT   
Sbjct  129  EQGWAQNDCK---NSESCGKLPNNLSFNFLTNSIIRDITSLDSKLFHINVLGCKNLTFIG  185

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + I+APA S NTDGIH+ RS G+ + +++I TGD
Sbjct  186  VNIKAPAQSLNTDGIHVARSRGLNITNSQIGTGD  219



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 121/213 (57%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F     LV  + G   N +     G    D T A  KA+   C+A  PS + +P+G+Y+L
Sbjct  5    FGISTILVLCLLGYSANAEVFRVPGAPGSDITQALLKAFTSACQAPAPSQVLIPKGEYKL  64

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCKS V        K          + K+ W++F  I  F L+GG  ++G+G+
Sbjct  65   GEIAMTGPCKSPVEITLQGTVKADG-----NMQGKERWVVFEKINGFKLNGGGIFDGEGN  119

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW+ N C +      CK LPI++    + NA ++ I S+DSK FH+NVI  KN+T + I
Sbjct  120  AAWRTNNCHKTFE---CKKLPISLRFDFVDNADIRDITSMDSKNFHINVISGKNMTFDNI  176

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGIH+GR +GV + +++I TGD
Sbjct  177  KISAPAESPNTDGIHLGRCDGVKILNSKIATGD  209



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 124/199 (62%), Gaps = 10/199 (5%)
 Frame = -2

Query  596  EVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVT  417
            +V+V   GAK + D   + A + AW E C AT PS + +P+G Y+L  +   GPCK+A+ 
Sbjct  23   DVDVTKHGAKQNADI--SQALRDAWKEACAATTPSKVLIPQGTYQLSPVTMEGPCKAAIE  80

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   K +  TD +  K    W+ F+ I+  T+SGG T++GQG+ A   ++C+++   
Sbjct  81   LQVKGTLKAL--TDPANVKDAGSWVSFNKIEHLTVSGGGTFDGQGAVAP--SECEKD---  133

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK  PIN++   +TN+VV+ + S++SK FH+NVI  KN T  ++ + AP +S NTDGI
Sbjct  134  DYCKKRPINLSFNAITNSVVQDVTSLNSKQFHINVIGAKNFTFQRVTVTAPEESLNTDGI  193

Query  59   HIGRSEGVTVDDAEIKTGD  3
            H+GRS GVT+ D++I TGD
Sbjct  194  HVGRSSGVTITDSKIGTGD  212



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 112/200 (56%), Gaps = 10/200 (5%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            ++ T GAK D D   T AF  +W   C + +PS + VP G Y LG I   GPC++    +
Sbjct  37   DITTKGAKPDADV--TQAFLDSWTAACASVKPSKVLVPAGNYILGAIKLKGPCQTPTVIE  94

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTL----SGGTYNGQGSAAWKINKCKENMN  243
                  F AP D++ F  +D W     +    L     GG ++GQG AAWK+N+C +N N
Sbjct  95   IL--GNFKAPPDVAAFNKEDTWFKVEYVDSLILITGKGGGVFDGQGQAAWKLNECTKNAN  152

Query  242  APLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDG  63
                 +LP N     +TN+ V G+ S++SK +H  ++ CK L ++ I I APADS NTDG
Sbjct  153  CGF--DLPYNFRFNFVTNSKVSGLTSINSKLYHFALLGCKQLEMSDITITAPADSPNTDG  210

Query  62   IHIGRSEGVTVDDAEIKTGD  3
            IHIGRS+GV V    I TGD
Sbjct  211  IHIGRSDGVIVRGFTIGTGD  230



>gb|AIL01320.1| group 13 allergen Sor h 13.01 [Sorghum halepense]
Length=422

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 107/192 (56%), Gaps = 8/192 (4%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GAKGDG  D T A  +AW   C    P TL +P+G Y  G + F GPCK +VT       
Sbjct  61   GAKGDGKTDSTKALNEAWAAACGKEGPQTLMIPKGDYLTGPLNFSGPCKGSVTIQLD--G  118

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLP  219
              +  TDLS +KT   WI    + +  +SG GT +GQG   W  NKC +  +   CK LP
Sbjct  119  NLLGTTDLSAYKTN--WIEIEHVDNLVISGKGTLDGQGKQVWDNNKCAQKYD---CKILP  173

Query  218  INMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEG  39
             ++ L  + N  V GI  +++KFFHMNV QCK +T+  + + AP DS NTDGIHIG S  
Sbjct  174  NSLVLDYVNNGEVSGITLLNAKFFHMNVFQCKGVTIKDVTVTAPGDSPNTDGIHIGDSSK  233

Query  38   VTVDDAEIKTGD  3
            VT+    I  GD
Sbjct  234  VTITGTTIGVGD  245



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 120/206 (58%), Gaps = 9/206 (4%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A   G   +VK  GAKGDG  DD AAF  AW          T+ VP+G+Y +  + F GP
Sbjct  68   AKAGGASSDVKALGAKGDGKTDDCAAFGAAWKA--ACAAGGTIIVPKGEYLVEALEFKGP  125

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG--GTYNGQGSAAWKINK  261
            CK  VT +     K  AP  +   K   GW+ F  I DFTL+G    ++GQG+ AWK N 
Sbjct  126  CKGPVTMELNGNLK--APAAVKSTKPHSGWVDFENIADFTLNGNKAIFDGQGALAWKAND  183

Query  260  CKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPAD  81
            C +      C +LPIN+    LTN+ +K I S +SK FH+N++ CKN+TL  I I AP +
Sbjct  184  CAKTGK---CNSLPINIRFTGLTNSKIKSITSTNSKLFHINILNCKNITLEDIGINAPPE  240

Query  80   SANTDGIHIGRSEGVTVDDAEIKTGD  3
            S NTDGIHIGRS GV +  A+IKTGD
Sbjct  241  SLNTDGIHIGRSNGVNILGAKIKTGD  266



>ref|XP_004134494.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004162214.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 gb|KGN57136.1| hypothetical protein Csa_3G164550 [Cucumis sativus]
Length=424

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAK DG  D++ +F K W   C +   + + +P G + + QI F GPC S     
Sbjct  53   NVLSFGAKPDGKTDNSESFMKTWVAACHSKGAARVVIPRGTFLINQIAFAGPCASTSPII  112

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
                A      D+S + + D WILF  I    ++G G  +GQGSA W+ N C  N   P 
Sbjct  113  VQIDATLKGGVDISNYFS-DEWILFEKINGLIVTGRGALDGQGSAVWEYNDCGMN---PN  168

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP+N+ L  +T+ +VKGI SV+SK FHM V  C+N+ L K+ + AP DS NTDGIH+
Sbjct  169  CQKLPVNLKLNNITHGLVKGISSVNSKGFHMFVTNCENVRLRKLHLTAPEDSPNTDGIHL  228

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  + +  + I TGD
Sbjct  229  SRSNNIKISRSVIATGD  245



>ref|XP_010449495.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=418

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 117/199 (59%), Gaps = 9/199 (5%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST-LKVPEGKYRLGQIGFLGPCKSAVT  417
            VNV++ GA+ +   D T AF  AWD+ CK++  S  L +P G++ +G + F GPC +   
Sbjct  39   VNVRSFGARANDHRDHTKAFLAAWDKACKSSSSSVHLIIPRGEFSVGPLRFSGPCTNVSN  98

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNA  240
                   +  A TDLS++++  GWI F  I   TL+GG T++GQG+ AW  N C  +   
Sbjct  99   LTV----RVKASTDLSKYRSGGGWINFEWINGLTLTGGGTFDGQGALAWPFNNCTSDSK-  153

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++    +   VV+ I SV+SKFFH+ +++C++    ++ I AP+DS NTDGI
Sbjct  154  --CKLLPTSLKFVGMNRTVVRRISSVNSKFFHIALVECRDFKGTRLNITAPSDSPNTDGI  211

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS  V    + I TGD
Sbjct  212  HIERSSNVYFSRSHIATGD  230



>ref|XP_010251320.1| PREDICTED: exopolygalacturonase-like [Nelumbo nucifera]
Length=399

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 111/192 (58%), Gaps = 5/192 (3%)
 Frame = -2

Query  575  GAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGA  396
            GA+GDG  DD+ AF  AW   C+++    + +P+  Y +G + F GPC    +       
Sbjct  34   GARGDGVHDDSKAFLAAWKAACESSGAVKVLIPKANYMVGPVKFYGPCDKVKSITVYMKG  93

Query  395  KFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLP  219
               A TDL  + T D WI F  ++  TL+GG T++GQG+A+W  N C+   N   C+ LP
Sbjct  94   YLKATTDLKDYGTYD-WITFGFVEGLTLTGGGTFDGQGAASWSFNSCRLKKN---CQVLP  149

Query  218  INMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEG  39
             N+   +L + VV+GI S++SKFFHM ++ C N     +KI AP  S NTDGIHI RS  
Sbjct  150  TNLKFVSLNDTVVRGITSLNSKFFHMGLVDCNNFMGRDLKITAPETSPNTDGIHIERSTT  209

Query  38   VTVDDAEIKTGD  3
            V+V  + I TGD
Sbjct  210  VSVYSSIIGTGD  221



>ref|XP_008226319.1| PREDICTED: exopolygalacturonase [Prunus mume]
Length=394

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 115/197 (58%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA G G  D++ AF KAW + C+    S + VP+G ++L  + F GPC   + F 
Sbjct  27   NVMDYGAVGGGRTDNSKAFLKAWSDACQWNGKSRVVVPQGTFKLYPVIFSGPCNGPIAFV  86

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                 K  A TD S F +   WI F  + + T+SGG T +GQG++AW +N C+ N   P 
Sbjct  87   IRGTLK--ATTDPSSF-SAHSWINFRYVDELTVSGGGTLDGQGASAWHLNNCRSN---PQ  140

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LPI+M+   +TNA+V+ +KS DSK  H  V  C N+   KI+I APADS NTDGI I
Sbjct  141  CQALPISMSFDFVTNAIVQRVKSYDSKNAHFKVFGCHNMDFRKIRISAPADSPNTDGIKI  200

Query  53   GRSEGVTVDDAEIKTGD  3
            G S  + +  + I TGD
Sbjct  201  GNSYRIRIARSRIATGD  217



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 123/213 (58%), Gaps = 8/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F     L+  + G+  N            D T A  KA+   C+   PS + +P+G+++L
Sbjct  5    FGVSTILIICLLGISANAAVFPIGSPSGSDITQALLKAFTAACQCPSPSKVVIPKGEFKL  64

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I   GPCK+ +        K     D +  + KD W++F  I  F L+GG  ++G+G+
Sbjct  65   GEIEMRGPCKAPIEITIQGTVK----ADGNAIQGKDKWVVFGNINGFKLNGGGAFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            A+W++N C +     LCK LPI++    + N+ ++ I S+D+K FH+NV+  KN+T+N I
Sbjct  121  ASWRVNNCHKTF---LCKKLPISIRFDFVLNSEIRDISSIDAKNFHINVLGAKNMTMNNI  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI AP DS NTDGIH+GRS+GV + ++ I TGD
Sbjct  178  KIIAPEDSPNTDGIHLGRSDGVKILNSFISTGD  210



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 116/182 (64%), Gaps = 8/182 (4%)
 Frame = -2

Query  545  TAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQ  366
            T A  KA+   C++  PS + +PEG+++LG+I   GPCK+ V        K     D + 
Sbjct  36   TQALLKAFTSACQSPSPSKVVIPEGEFKLGEIEMRGPCKAPVEITLQGTVK----ADGNA  91

Query  365  FKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTN  189
             + K+ W++F  I  F L+GG  ++G+G+AAW++N C +  N   CK LPI++    + N
Sbjct  92   IQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFN---CKKLPISIRFDFVEN  148

Query  188  AVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKT  9
            A +K I S+D+K FH+NV+  KN+T++ IKI AP DS NTDGIH+GRS+GV + ++ I T
Sbjct  149  AEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNTDGIHLGRSDGVKILNSFIST  208

Query  8    GD  3
            GD
Sbjct  209  GD  210



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 121/223 (54%), Gaps = 12/223 (5%)
 Frame = -2

Query  656  IQAALIFFYVAYLVATVQG----VEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPST  489
            +++ L  F    LV+T        +V   T G K + D   +  F KAW + C +T  S 
Sbjct  5    LKSILPIFVFLLLVSTSNAKSSIYDVTSATYGGKANSDI--SRPFSKAWTDACASTLASK  62

Query  488  LKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS  309
            + VP G Y+     F GPCK+ +           AP D S+    D W+ F  I   TLS
Sbjct  63   IVVPRGTYKFVGATFKGPCKAPIEIQLQ--GTLQAPVDGSKLSKADTWVGFERIDGLTLS  120

Query  308  GG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVI  132
            GG T++GQG+ AWK N C +N N   CK++ IN+    +TN++++ I + DSK FH+NV+
Sbjct  121  GGGTFDGQGATAWKQNDCNKNKN---CKSIAINLRFNFVTNSIIRDITTKDSKNFHVNVL  177

Query  131  QCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             C N+      + AP +S NTDGIHIGRS G+ + D+ I TGD
Sbjct  178  GCNNVAFQHFTVSAPKESMNTDGIHIGRSTGINITDSIIGTGD  220



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 116/182 (64%), Gaps = 8/182 (4%)
 Frame = -2

Query  545  TAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQ  366
            T A  KA+   C++  PS + +P+G+++LG+I   GPCK+ V        K     D + 
Sbjct  36   TQALLKAFTSACQSPSPSKVVIPKGEFKLGEIEMRGPCKAPVEITLQGTVK----ADGNA  91

Query  365  FKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTN  189
             + K+ W++F  I  F L+GG  ++G+G+AAW++N C +  N   CK LPI++    + N
Sbjct  92   IQGKEKWVVFGNINGFKLNGGGAFDGEGNAAWRVNNCHKTFN---CKKLPISIRFDFVEN  148

Query  188  AVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKT  9
            A +K I S+D+K FH+NV+  KN+T++ IKI AP DS NTDGIH+GRS+GV + D+ I T
Sbjct  149  AEIKDISSIDAKNFHINVLGAKNMTMSNIKITAPEDSPNTDGIHLGRSDGVKILDSFIST  208

Query  8    GD  3
            GD
Sbjct  209  GD  210



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 128/213 (60%), Gaps = 9/213 (4%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
            F   A+ +  + G+  N K         CD T A  KA+++ C+    ST+ +P+G+Y+L
Sbjct  6    FGVSAFFIFCLLGLSANAKVFNIGSKPGCDITKALLKAFNQACQFPTKSTVLIPKGEYKL  65

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G+I  +GPCK+ +   A +G       D +   ++  WI F  I  F L+GG  ++G+G+
Sbjct  66   GEIEMMGPCKAPIRI-ALQGT---VKADGNAVHSEK-WIAFHNIDGFKLNGGGVFDGEGN  120

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            AAW++N C        CK LPI++    +TNA ++GI S+D+K FH+NVI  KN+T  ++
Sbjct  121  AAWRVNNCHHTWK---CKKLPISIRFDFVTNAKIRGITSLDAKHFHINVIGAKNMTFEEV  177

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            KI APA+S NTDGI +GRS+G+ + ++ I TGD
Sbjct  178  KIVAPAESPNTDGILVGRSDGIKIINSFISTGD  210



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 124/217 (57%), Gaps = 13/217 (6%)
 Frame = -2

Query  650  AALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEG  471
             A   F    L  +   V + + +S        D T A  KA+   C++  PS + +P+G
Sbjct  6    GAFTVFIFCLLGFSANAVYITIGSSPGS-----DITQALLKAFTTACQSPTPSRVVIPKG  60

Query  470  KYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYN  294
            +++LG+I   GPCK+ V        K     D +  + KD WI+F  I  F L+GG  ++
Sbjct  61   EFKLGEIQMRGPCKAPVEITIQGTVK----ADGNAIQGKDTWIVFGNINGFKLNGGGAFD  116

Query  293  GQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLT  114
            G+G+AAW++N C +  N   CK LPI++    + NA +K I S+D+K FH+NV+  KN+T
Sbjct  117  GEGNAAWRVNNCHQTFN---CKKLPISIRFDFVENAEIKDISSIDAKNFHINVLGAKNMT  173

Query  113  LNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            ++ I I AP DS NTDGIH+GRS+GV + +  I TGD
Sbjct  174  MDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTGD  210



>ref|XP_003544285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=386

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/202 (40%), Positives = 117/202 (58%), Gaps = 8/202 (4%)
 Frame = -2

Query  605  QGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKS  426
            Q    +++  G   +GD   T A +KAW + C +T PS + +P  KY+L QI F+GPCK+
Sbjct  17   QASLFDIRKYGVVPNGDI--TMALQKAWRDACVSTTPSKVVIPSNKYKLRQIDFMGPCKA  74

Query  425  AVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKEN  249
             +        K  AP +      ++ W+ F  I   TLSG GT++G+G  AWK N C  N
Sbjct  75   PIEILVNGIIK--APKNPFDVSGQNQWVRFGYINFLTLSGNGTFHGRGKMAWKQNNCSTN  132

Query  248  MNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANT  69
             N   CK L +N   G + N+V+  I S DSK+FH+NV  CKN++    ++ +PA S NT
Sbjct  133  KN---CKKLAMNFGFGFVNNSVIHDITSKDSKYFHVNVFGCKNISFTNFRVSSPAYSPNT  189

Query  68   DGIHIGRSEGVTVDDAEIKTGD  3
            DGIHIG+S  V + +++I TGD
Sbjct  190  DGIHIGKSTQVKITNSKIDTGD  211



>ref|XP_008438909.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=424

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV + GAK DG  D+T +F K W   C +   + + +P G + + Q+ F GPC S     
Sbjct  53   NVLSFGAKPDGKTDNTESFMKTWVAACHSKGAARVVIPSGTFLINQVAFAGPCASTSPIV  112

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPL  234
                A      D+S + + D WILF  I    ++G GT +GQGSA W+ N C  N   P 
Sbjct  113  VQIDATLKGGIDISNYFS-DEWILFEKINGLIVTGRGTLDGQGSAVWEYNDCGMN---PN  168

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP+N+ L  +T+ +VKGI SV+SK FHM +  C+N+ L K+ I AP  S NTDGIH+
Sbjct  169  CQKLPVNLKLSGITHGLVKGISSVNSKGFHMFITNCENVRLRKLHITAPETSPNTDGIHV  228

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V +  + I TGD
Sbjct  229  SRSNNVKISRSVIATGD  245



>ref|XP_010548799.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Tarenaya 
hassleriana]
Length=214

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 113/185 (61%), Gaps = 18/185 (10%)
 Frame = -2

Query  539  AFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDA-----AEGAKFIAPTD  375
            A ++A+   C+   PS++ +P+G Y+LG+I  +GPCK+ V         A G   +    
Sbjct  3    ALRQAFQAACQNPRPSSVVIPKGTYKLGEIDMVGPCKAPVEVTVNGHLQANGNALVG---  59

Query  374  LSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGT  198
                  ++ W++F  I  F L+G G ++GQG+AAWK N C +N N   CK LPI++    
Sbjct  60   ------REKWVVFRYINGFKLNGAGIFDGQGNAAWKSNDCHKNNN---CKKLPISIRFDF  110

Query  197  LTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAE  18
            + N  V+ I S+D+K FH+NV+ CKN T + +KI+APA+S N DGIH+GRS+GV +  + 
Sbjct  111  VLNGEVRDITSLDAKNFHVNVLGCKNFTFDNVKIKAPAESPNXDGIHLGRSDGVNILRSF  170

Query  17   IKTGD  3
            I TGD
Sbjct  171  ISTGD  175



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 122/213 (57%), Gaps = 7/213 (3%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             F + +L +T    E  V      GD + D + AFK AW++ C +T PS + +P G Y L
Sbjct  10   IFLLLFLTSTDVKAENVVFDVTKYGDEE-DISKAFKSAWEDACASTSPSKVLIPRGTYLL  68

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G +   GPCK+A+        K  AP D+ +F+    WI  + +  FTL+GG T++GQG 
Sbjct  69   GPVIISGPCKAAIELQVK--GKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQGK  126

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            +A   N C ++ +   CK  P+++    +TN +V  I S DSK+FH +++ CKNLT    
Sbjct  127  SASNQNNCGKDKH---CKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHF  183

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             I A  +S NTDGIHIGRS+ + + D++I TGD
Sbjct  184  TITAHDESLNTDGIHIGRSKDIKIIDSDIGTGD  216



>ref|XP_008649075.1| PREDICTED: exopolygalacturonase-like [Zea mays]
 gb|AFW76321.1| zea m 13 allergen [Zea mays]
Length=410

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 115/205 (56%), Gaps = 6/205 (3%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A+  G   ++   GA G+G  D T A ++AW   C  T   T+ +P+G + +GQ+ F GP
Sbjct  34   ASGPGGSFDITKLGASGNGKTDSTKAVQEAWASACGGTGKQTILIPKGDFLVGQLNFTGP  93

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK  VT         +A TDLSQ+K    WI    + +  ++G G  +GQG A W  N C
Sbjct  94   CKGDVTIQVD--GNLLATTDLSQYKEHGNWIEILRVDNLVITGKGNLDGQGPAVWSKNSC  151

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
             +  +   CK LP ++ +  + N  V GI  ++SKFFHMN+ QCKN+ +  + + AP DS
Sbjct  152  TKKYD---CKILPNSLVMDFVNNGEVSGITLLNSKFFHMNMYQCKNMLIKDVTVTAPGDS  208

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIH+G S G+T+ +  I  GD
Sbjct  209  PNTDGIHMGDSSGITITNTVIGVGD  233



>ref|XP_010472056.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=405

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/197 (40%), Positives = 118/197 (60%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V++ GA+GDG  D+  AF KAW E C+    S + VP G + LG + F GPCKS ++F 
Sbjct  37   DVRSYGARGDGKTDNAMAFTKAWKEACEWNGFSRVYVPFGTFYLGGVIFTGPCKSRISFI  96

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                   +AP + +  K ++ WI+F  +   T+SGG   +GQGS +W +N C+E    P 
Sbjct  97   IK--GTLLAPKEANAIK-EETWIIFRYVDYLTVSGGGILDGQGSYSWPLNNCRE---TPN  150

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP+NM    +  + +  I+S++SK  H+N    +N  ++++ IRAP DS NTDGI I
Sbjct  151  CRALPMNMGFQFVRFSRISHIRSINSKMGHLNFFGVQNFDISRMSIRAPGDSPNTDGIKI  210

Query  53   GRSEGVTVDDAEIKTGD  3
            G S  + +DD +I TGD
Sbjct  211  GLSSNMKIDDVDIGTGD  227



>ref|XP_010419249.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=259

 Score =   150 bits (378),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 118/197 (60%), Gaps = 7/197 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V++ GA+GDG  D+  AF KAW E C+      + VP G + LG + F GPCKS ++F 
Sbjct  37   DVRSYGARGDGKTDNAMAFTKAWKEACEWKGFPRVYVPFGTFYLGGVIFTGPCKSRISFI  96

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                   +AP + +  K ++ WI+F  +   T+SGG   +GQGS +W +N C++N N   
Sbjct  97   IK--GTLLAPKEANAIK-EETWIIFRYVDYLTVSGGGILDGQGSYSWPLNNCRQNSN---  150

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP+NM    +  + +  I+S++SK  H+N    +N  ++++ IR+P DS NTDGI I
Sbjct  151  CRALPMNMGFQFVRFSRISHIRSINSKMGHLNFFGVQNFNISRMSIRSPGDSPNTDGIKI  210

Query  53   GRSEGVTVDDAEIKTGD  3
            G S  + +D+ +I TGD
Sbjct  211  GLSSNMKIDNVDIGTGD  227



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/217 (38%), Positives = 124/217 (57%), Gaps = 13/217 (6%)
 Frame = -2

Query  650  AALIFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEG  471
             A   F    L  +   V + + +S        D T A  KA+   C++  PS + +P+G
Sbjct  6    GAFTVFIFCLLGFSANAVYITIGSSPGS-----DITQALLKAFTTACQSPTPSRVVIPKG  60

Query  470  KYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYN  294
            +++LG+I   GPCK+ V        K     D +  + KD WI+F  I  F L+GG  ++
Sbjct  61   EFKLGEIQMRGPCKAPVEITIQGTVK----ADGNAIQGKDTWIVFGNINGFKLNGGGAFD  116

Query  293  GQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLT  114
            G+G+AAW++N C +  N   CK LPI++    + NA ++ I S+D+K FH+NV+  KN+T
Sbjct  117  GEGNAAWRVNNCHQTFN---CKKLPISIRFDFVENAEIRDISSIDAKNFHINVLGAKNMT  173

Query  113  LNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            ++ I I AP DS NTDGIH+GRS+GV + +  I TGD
Sbjct  174  MDHINIIAPKDSPNTDGIHLGRSDGVKILNTFISTGD  210



>ref|NP_001061556.1| Os08g0327200 [Oryza sativa Japonica Group]
 dbj|BAD03446.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF23470.1| Os08g0327200 [Oryza sativa Japonica Group]
 dbj|BAG91612.1| unnamed protein product [Oryza sativa Japonica Group]
Length=407

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 110/199 (55%), Gaps = 8/199 (4%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV+  GAKG+G  DD+ A   AW   C AT   TL +P G Y +G + F GPC  A T  
Sbjct  40   NVRNYGAKGNGQTDDSKALMTAWKAACAATGAVTLVLPPGTYYIGPVQFHGPCSKATTMT  99

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG---GTYNGQGSAAWKINKCKENMNA  240
                    A TDL +F   + W+ F  +    +SG     ++GQG+A+W  NKC    + 
Sbjct  100  FLMQGTLKAATDLKRFG--NDWVEFGWVNHLIVSGQNGAAFDGQGAASWPFNKCPIRKD-  156

Query  239  PLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGI  60
              CK LP ++      N VV+ + SV+SKFFHM ++QC    ++ +KI AP  S NTDGI
Sbjct  157  --CKVLPTSVLFVNNKNMVVQNVASVNSKFFHMALLQCSGAKISGVKISAPESSPNTDGI  214

Query  59   HIGRSEGVTVDDAEIKTGD  3
            HI RS GV++ D  I TGD
Sbjct  215  HIERSNGVSIADTTIATGD  233



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 122/213 (57%), Gaps = 7/213 (3%)
 Frame = -2

Query  638  FFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRL  459
             F + +L +T    E  V      GD + D + AFK AW++ C +T PS + +P G Y L
Sbjct  10   IFLLLFLSSTDVKAENVVFDVTKYGDEE-DISKAFKSAWEDACASTSPSKVLIPRGTYLL  68

Query  458  GQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGS  282
            G +   GPCK+A+        K  AP D+ +F+    WI  + +  FTL+GG T++GQG 
Sbjct  69   GPVIISGPCKAAIELQVK--GKLQAPVDMREFEGFSSWITLNYVDQFTLTGGGTFDGQGK  126

Query  281  AAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKI  102
            +A   N C ++ +   CK  P+++    +TN +V  I S DSK+FH +++ CKNLT    
Sbjct  127  SASNQNNCGKDKH---CKLPPVSLKFNFITNGIVHDITSTDSKYFHAHLLGCKNLTFQHF  183

Query  101  KIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             I A  +S NTDGIHIGRS+ + + D++I TGD
Sbjct  184  TITAHDESLNTDGIHIGRSKDIKIIDSDIGTGD  216



>sp|P35338.1|PGLR2_MAIZE RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase; 
Flags: Precursor [Zea mays]
 emb|CAA45751.1| polygalacturonase [Zea mays]
Length=410

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 115/205 (56%), Gaps = 6/205 (3%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A+  G   ++   GA G+G  D T A ++AW   C  T   T+ +P+G + +GQ+ F GP
Sbjct  34   ASGPGGSFDITKLGASGNGKTDSTKAVQEAWASACGGTGKQTILIPKGDFLVGQLNFTGP  93

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK  VT         +A TDLSQ+K    WI    + +  ++G G  +GQG A W  N C
Sbjct  94   CKGDVTIQVD--GNLLATTDLSQYKEHGNWIEILRVDNLVITGKGNLDGQGPAVWSKNSC  151

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
             +  +   CK LP ++ +  + N  V G+  ++SKFFHMN+ QCKN+ +  + + AP DS
Sbjct  152  TKKYD---CKILPNSLVMDFVNNGEVSGVTLLNSKFFHMNMYQCKNMLIKDVTVTAPGDS  208

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIH+G S G+T+ +  I  GD
Sbjct  209  PNTDGIHMGDSSGITITNTVIGVGD  233



>ref|XP_002884669.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60928.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 118/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A  +A+   C+A  PS + +P+G++RLG+I   GPCKS V          +A  D 
Sbjct  34   DITQALLRAFTSACQAPTPSKVVIPKGQFRLGEIMMSGPCKSPVEITLL--GTVLA--DG  89

Query  371  SQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPI-NMNLGT  198
            +    K+ W++F  +  F L+GG T++G+G+AAW++N C +      CK LPI ++    
Sbjct  90   NSIHGKEKWVVFQRMDGFRLNGGGTFDGEGNAAWRVNNCHKTFE---CKKLPIVSIRFDF  146

Query  197  LTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAE  18
            +TNA ++ I S+D+K FH+NVI  KN+T N +KI APA+S NTDGIH+GRS GV++ ++ 
Sbjct  147  VTNAEIRDISSIDAKNFHINVIGAKNMTFNNVKIMAPAESPNTDGIHLGRSVGVSIINSR  206

Query  17   IKTGD  3
            I TGD
Sbjct  207  IATGD  211



>ref|XP_008649074.1| PREDICTED: exopolygalacturonase [Zea mays]
 gb|AFW76322.1| exopolygalacturonase8 [Zea mays]
Length=410

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 115/205 (56%), Gaps = 6/205 (3%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A+  G   ++   GA G+G  D T A ++AW   C  T   T+ +P+G + +GQ+ F GP
Sbjct  34   ASGPGGSFDITKLGASGNGKTDSTKAVQEAWASACGGTGKQTILIPKGDFLVGQLNFTGP  93

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK  VT         +A TDLSQ+K    WI    + +  ++G G  +GQG A W  N C
Sbjct  94   CKGDVTIQVD--GNLLATTDLSQYKEHGNWIEILRVDNLVITGKGNLDGQGPAVWSKNSC  151

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
             +  +   CK LP ++ +  + N  V G+  ++SKFFHMN+ QCKN+ +  + + AP DS
Sbjct  152  TKKYD---CKILPNSLVMDFVNNGEVSGVTLLNSKFFHMNMYQCKNMLIKDVTVTAPGDS  208

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIH+G S G+T+ +  I  GD
Sbjct  209  PNTDGIHMGDSSGITITNTVIGVGD  233



>ref|XP_003560585.2| PREDICTED: exopolygalacturonase-like [Brachypodium distachyon]
Length=404

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/219 (37%), Positives = 124/219 (57%), Gaps = 9/219 (4%)
 Frame = -2

Query  647  ALIFFYVAYLVATVQ--GVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVP  477
            AL+F   A     V   G +V +V   GA  DG  DD+ AF +AW + C A     + VP
Sbjct  7    ALLFLVTARWCLEVAHAGRQVFDVTDFGAVADGQTDDSKAFLRAWMKACAAPGRPAVVVP  66

Query  476  EGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-T  300
            +G+YRL  + F GPCK  +    A      AP DL+ F+    W+ F+ I    ++GG T
Sbjct  67   KGEYRLHPVVFRGPCKGYMELRLA--GVLRAPDDLAAFRGSHEWVNFAGIDGLLVTGGGT  124

Query  299  YNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKN  120
            ++G+G+++W +N C      P C  LP+++ LG + N  +  + S+DSKFFH+ +I  ++
Sbjct  125  FDGRGASSWHLNDCPRK---PDCTPLPVSIKLGRVRNVTITEVTSLDSKFFHVIIIGSQD  181

Query  119  LTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + ++++ IRAP DS NTDG+HI  S  V + D  + TGD
Sbjct  182  VAIHRVTIRAPRDSPNTDGVHIQGSSNVRITDTAVATGD  220



>emb|CDP06168.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 127/216 (59%), Gaps = 8/216 (4%)
 Frame = -2

Query  644  LIFFYVAYLVATVQGVEV-NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGK  468
            +IF ++    +T+   ++ NV   GA+ DG  DD+ AF +AW++ C+    S + +P G 
Sbjct  13   IIFLFITADASTILPHKIFNVDNYGARADGSTDDSQAFLRAWNDACQWRGRSKVLIPLGN  72

Query  467  YRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTY-NG  291
            Y L  + F+GPC   + F      +  APT+ + F T + WI F  + + TL GG Y +G
Sbjct  73   YMLNSVTFVGPCNGEMIFVIKGTLR--APTNPALFFT-NTWIGFRYVDNLTLEGGGYLDG  129

Query  290  QGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTL  111
            QG+AAW  N C +N+    C  LPI++ L  +TN+ ++ ++S++SK  H+N+  C N+ +
Sbjct  130  QGAAAWPHNDCSKNIG---CLPLPISLRLDFITNSRIQKLRSINSKNAHVNLFACNNINI  186

Query  110  NKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + +++ AP +S NTDGIHIG S  + +    I TGD
Sbjct  187  SHVRLSAPGNSPNTDGIHIGFSNNIKISSVNIGTGD  222



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 124/214 (58%), Gaps = 13/214 (6%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            +  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P+G + 
Sbjct  1    VLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLNAFKEACQSTSPSTIVIPKGTFT  57

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            + Q+   GPCKS +       A   AP+D SQ K  + W+  + +  FT+SGG   +GQ 
Sbjct  58   MNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKLDQFTMSGGGILDGQA  114

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
            +AAW+  + K+      C  LP N++  +LTN+ VK I ++DSK FH+NV QCKNLT  +
Sbjct  115  AAAWECKQSKK------CNKLPNNLSFNSLTNSTVKDITTLDSKSFHVNVNQCKNLTFIR  168

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  169  FNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  202



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A  KA+   C++  PS + +P+G+++LG+I   GPCK+ V        K     D 
Sbjct  34   DITQALVKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGTVK----ADG  89

Query  371  SQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            +  + KD WI+F  I  F L+GG  ++G+G+AAW++N C +  N   CK LPI++    +
Sbjct  90   NAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFN---CKKLPISIRFDFV  146

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
             NA ++ I S+D+K FH+NV+  KN+T++ I I AP DS NTDGIH+GRS+GV + +  I
Sbjct  147  ENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFI  206

Query  14   KTGD  3
             TGD
Sbjct  207  STGD  210



>ref|XP_002437842.1| hypothetical protein SORBIDRAFT_10g003580 [Sorghum bicolor]
 gb|EER89209.1| hypothetical protein SORBIDRAFT_10g003580 [Sorghum bicolor]
Length=395

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 116/198 (59%), Gaps = 8/198 (4%)
 Frame = -2

Query  593  VNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCK-SAVT  417
            V+VK  GAKG+G  DDT     AW   C +    T+ +  G Y +G + F GPC  S +T
Sbjct  31   VDVKHYGAKGNGVDDDTKPLMTAWKAACGSAGAVTMLLSPGTYYIGPVQFHGPCNASTLT  90

Query  416  FDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGGTYNGQGSAAWKINKCKENMNAP  237
            F      K  A TDLS+F+  + WI F  +   T++GG  +GQG+A+W  N+C    +  
Sbjct  91   FQLQGTLK--ADTDLSRFR--NDWIEFGWVTGLTVAGGVIDGQGAASWPFNQCPFRKD--  144

Query  236  LCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIH  57
             CK LP ++      N  V+G+ SV+ KFFHM ++Q + + ++ ++I APA S NTDGIH
Sbjct  145  -CKVLPTSVRFVNTRNTAVRGVTSVNPKFFHMALLQARGVRMSGLRISAPAGSPNTDGIH  203

Query  56   IGRSEGVTVDDAEIKTGD  3
            I RS GV++ DA I TGD
Sbjct  204  IERSAGVSITDARIGTGD  221



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A  KA+   C++  PS + +P+G+++LG+I   GPCK+ V        K     D 
Sbjct  34   DITQALLKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGTVK----ADG  89

Query  371  SQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            +  + KD WI+F  I  F L+GG  ++G+G+AAW++N C +  N   CK LPI++    +
Sbjct  90   NAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFN---CKKLPISIRFDFV  146

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
             NA ++ I S+D+K FH+NV+  KN+T++ I I AP DS NTDGIH+GRS+GV + +  I
Sbjct  147  ENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFI  206

Query  14   KTGD  3
             TGD
Sbjct  207  STGD  210



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 129/215 (60%), Gaps = 10/215 (5%)
 Frame = -2

Query  641  IFFYVAYL-VATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKY  465
            + F ++ L V  + G+  N K          D T+A  K ++E C+    +T+ +P+G+Y
Sbjct  3    VHFGISTLFVFCLLGLSANAKVFKITSPTGSDITSALLKTFNEACQFPTKATVMIPKGEY  62

Query  464  RLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQ  288
            +LG+I  +GPCK+ +   A +G       D    K KD W+ F  I  F L+GG  ++G+
Sbjct  63   KLGEIEMVGPCKAPIRI-ALQGT---VKAD-GNIKGKDFWVAFKKINGFKLNGGGVFDGE  117

Query  287  GSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLN  108
            G+AAW++N C +      CK LPI++    +T+A ++GI S+DSK FH+NVI  KN+T  
Sbjct  118  GNAAWRVNNCHKTFE---CKKLPISVRFDFVTDAKIRGITSLDSKNFHINVIGAKNMTFE  174

Query  107  KIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
             IKI APA S NTDGIH+GRS+G+ + ++ I TGD
Sbjct  175  DIKIVAPAGSPNTDGIHVGRSDGIKIINSFISTGD  209



>ref|XP_006444403.1| hypothetical protein CICLE_v10023712mg [Citrus clementina]
 gb|ESR57643.1| hypothetical protein CICLE_v10023712mg [Citrus clementina]
Length=407

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 129/222 (58%), Gaps = 10/222 (5%)
 Frame = -2

Query  647  ALIFFYVAYLVATVQGVEVN------VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTL  486
            A++   + +L + VQG E N      V   GA+ +GD ++  AF + W + C +  P+ +
Sbjct  11   AVLLLGLTFLSSVVQGAEPNYSLYFDVTKFGAEANGDKNNAQAFTETWAKACGSGAPAKV  70

Query  485  KVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG  306
             +P G +  G + F GPCKSA+T +     K  A TDL ++   D WILF  I    L+G
Sbjct  71   LIPSGTFLTGPVVFSGPCKSAITVEVRGIVK--ATTDLKEYADGD-WILFENIDGLLLTG  127

Query  305  G-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQ  129
            G T++GQG+A+WK+       +A  C  LPI++    + N+VV GI S++SK FH+ ++ 
Sbjct  128  GGTFDGQGAASWKLKDSNPQHSATKCDLLPISIKFNHVNNSVVTGINSLNSKGFHILLVF  187

Query  128  CKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            C+N T + + I AP +S NTDGIH+  S  V + +++I TGD
Sbjct  188  CQNFTASNLNITAPDESPNTDGIHLSLSSFVNITNSKIGTGD  229



>ref|XP_006480116.1| PREDICTED: exopolygalacturonase clone GBGE184-like [Citrus sinensis]
 gb|KDO87149.1| hypothetical protein CISIN_1g043757mg [Citrus sinensis]
Length=407

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 129/222 (58%), Gaps = 10/222 (5%)
 Frame = -2

Query  647  ALIFFYVAYLVATVQGVEVN------VKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTL  486
            A++   + +L + VQG E N      V   GA+ +GD ++  AF + W + C +  P+ +
Sbjct  11   AVLLLGLTFLSSVVQGAEPNYSLYFDVTKFGAEANGDKNNAQAFTETWAKACGSGAPAKV  70

Query  485  KVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG  306
             +P G +  G + F GPCKSA+T +     K  A TDL ++   D WILF  I    L+G
Sbjct  71   LIPSGTFLTGPVVFSGPCKSAITVEVRGIVK--ATTDLKEYADGD-WILFENIDGLLLTG  127

Query  305  G-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQ  129
            G T++GQG+A+WK+       +A  C  LPI++    + N+VV GI S++SK FH+ ++ 
Sbjct  128  GGTFDGQGAASWKLKDSNPQHSATKCDLLPISIKFNHVNNSVVTGINSLNSKGFHILLVF  187

Query  128  CKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            C+N T + + I AP +S NTDGIH+  S  V + +++I TGD
Sbjct  188  CQNFTASNLNITAPDESPNTDGIHLSLSSLVNITNSKIGTGD  229



>gb|AHL24657.1| Sal k 6.01 allergen, partial [Salsola kali]
Length=381

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 106/164 (65%), Gaps = 9/164 (5%)
 Frame = -2

Query  482  VPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS--  309
            VP G++ L  +   GPCK+ +T + A    F AP D++Q K +D W+    ++  T++  
Sbjct  39   VPAGEFLLNAVKLQGPCKAPLTIEIA--GNFKAPADVAQMKGEDTWVKIENVQGLTITCL  96

Query  308  --GGTYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNV  135
              GGT++GQG AAWK NKC +   + +C +LP N    TLTNA + GIKS++SK +HM V
Sbjct  97   PTGGTFDGQGQAAWKQNKCAQ---SGMCNSLPYNFRFNTLTNAQISGIKSLNSKLYHMGV  153

Query  134  IQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            + CKN+TL  + I AP DS NTDG+HIGRS GV   +++I TGD
Sbjct  154  MGCKNITLTGLTIDAPKDSLNTDGMHIGRSNGVHATNSKIGTGD  197



>ref|XP_006838947.1| hypothetical protein AMTR_s00002p00270640 [Amborella trichopoda]
 gb|ERN01516.1| hypothetical protein AMTR_s00002p00270640 [Amborella trichopoda]
Length=382

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 107/197 (54%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NVK  GAK     +DT AF   W   C +   +T  VPEG Y  G + F+GPCK+     
Sbjct  3    NVKDFGAKASPQNEDTQAFLDTWKAACSSGGEATFYVPEGTYYTGALSFIGPCKNLTRMT  62

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLS-GGTYNGQGSAAWKINKCKENMNAPL  234
                    A TDL +F     WI+F  + D T++ GG ++GQG+A+W  NKC    N   
Sbjct  63   FTVKGTLKAFTDLGKFAKDGAWIMFGWVNDLTVNGGGVFDGQGTASWGKNKCG---NQKY  119

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C  LP ++      N V++ + S++SKFFH+ V+Q  N  +  + + AP DS NTDGIHI
Sbjct  120  CNLLPTSLKFHASKNVVLQDVTSLNSKFFHIAVLQSTNFKVTGVTVTAPGDSPNTDGIHI  179

Query  53   GRSEGVTVDDAEIKTGD  3
             RS GVT+    I TGD
Sbjct  180  ERSVGVTISHTNIGTGD  196



>ref|XP_002437276.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor]
 gb|EER88643.1| hypothetical protein SORBIDRAFT_10g024020 [Sorghum bicolor]
Length=404

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 113/197 (57%), Gaps = 6/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA  DG  DD+ AF +AW + C     + + VP G Y L  + F GPCK  +   
Sbjct  33   NVSDFGAVADGRTDDSEAFLRAWTKACATPGRAAVVVPRGDYLLHPLVFRGPCKGYMEVH  92

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
             A      AP  L+ F+    W+ FS I    ++GG T++G+G+ AW +N+C +  +   
Sbjct  93   VA--GVLRAPPGLAAFRGCREWVHFSSIDGLLVTGGGTFDGRGATAWPLNQCPQKRD---  147

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++ LG + NA + G+ S+DSKFFH+ V+   ++ ++++ IRAP  S NTDG+HI
Sbjct  148  CKLLPTSIKLGLVRNATITGVTSLDSKFFHVTVVGSHDVAIHRVSIRAPRSSPNTDGVHI  207

Query  53   GRSEGVTVDDAEIKTGD  3
              S  V V D+ + TGD
Sbjct  208  QGSSNVRVTDSAVATGD  224



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 115/184 (63%), Gaps = 8/184 (4%)
 Frame = -2

Query  551  DDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFDAAEGAKFIAPTDL  372
            D T A  KA+   C++  PS + +P+G+++LG+I   GPCK+ V        K     D 
Sbjct  34   DITQALVKAFTTACQSPTPSRVVIPKGEFKLGEIQMRGPCKAPVEITIQGTVK----ADG  89

Query  371  SQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPLCKNLPINMNLGTL  195
            +  + KD WI+F  I  F L+GG  ++G+G+AAW++N C +  N   CK LPI++    +
Sbjct  90   NAIQGKDTWIVFGNINGFKLNGGGAFDGEGNAAWRVNNCHQTFN---CKKLPISVRFDFV  146

Query  194  TNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHIGRSEGVTVDDAEI  15
             NA ++ I S+D+K FH+NV+  KN+T++ I I AP DS NTDGIH+GRS+GV + +  I
Sbjct  147  ENAEIRDISSIDAKNFHINVLGAKNMTMDHINIIAPKDSPNTDGIHLGRSDGVKILNTFI  206

Query  14   KTGD  3
             TGD
Sbjct  207  STGD  210



>ref|XP_008235914.1| PREDICTED: exopolygalacturonase [Prunus mume]
Length=551

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 115/197 (58%), Gaps = 4/197 (2%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            +V + GA+ DG  DD+ AF  AW E C++T    + +P+G Y +G + F GPC +  +  
Sbjct  181  DVMSFGARADGRTDDSNAFMAAWKEACQSTGRVHITIPKGTYIIGPLKFSGPCLNVSSLT  240

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
                    A TDL ++    GW+ F+ ++  TL+GG T++GQG+ AW  NKC  +     
Sbjct  241  LRVKGYLKATTDLRKYGFGGGWLEFAWMEGLTLTGGGTFDGQGARAWPHNKCPTDSK---  297

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            CK LP ++    +   V++G+ SV+SKFFH+ +++C N   +++KI AP  S NTDGIHI
Sbjct  298  CKLLPTSLKFVAMNKTVIRGLTSVNSKFFHIALVECHNFKGSRLKISAPETSPNTDGIHI  357

Query  53   GRSEGVTVDDAEIKTGD  3
             RS  V    + I TGD
Sbjct  358  ERSSSVYFSLSHIATGD  374



>ref|NP_001152243.1| polygalacturonase precursor [Zea mays]
 gb|ACG46572.1| polygalacturonase precursor [Zea mays]
 gb|AFW76315.1| polygalacturonase [Zea mays]
Length=403

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/197 (39%), Positives = 112/197 (57%), Gaps = 6/197 (3%)
 Frame = -2

Query  590  NVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGPCKSAVTFD  411
            NV   GA  DG  DD+ AF +AW E C       + VP G Y L  + F GPC+  V   
Sbjct  31   NVSDFGAVADGRTDDSEAFLRAWTEACATPGRPAVVVPRGDYLLHPLVFRGPCRGYVEVH  90

Query  410  AAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQGSAAWKINKCKENMNAPL  234
               G    AP  L+ F+    W+ FS I    ++GG T++G+G+ AW +N+C +  +   
Sbjct  91   V--GGVLRAPPGLAAFRGCREWVHFSSIDGLLVTGGGTFDGRGATAWPLNECPQKRD---  145

Query  233  CKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADSANTDGIHI  54
            C+ LP ++ LG + NA + G+ S+DSKFFH+ V+  +++ ++ + IRAP  S NTDG+HI
Sbjct  146  CRLLPTSIKLGLVRNATITGVTSLDSKFFHVAVVGSQDVRIHGVSIRAPRSSPNTDGVHI  205

Query  53   GRSEGVTVDDAEIKTGD  3
              S  V V D+ + TGD
Sbjct  206  QGSSNVRVTDSAVATGD  222



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 128/214 (60%), Gaps = 9/214 (4%)
 Frame = -2

Query  638  FFYVAYL-VATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            +F V+ + +  + G+  N +          D T A  KA+   C+++ PS + +P+G+++
Sbjct  4    YFGVSTIFIICLLGISANAEVFTIGSSSGSDITQALLKAFTSACQSSSPSKVVIPKGEFK  63

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            LG+I   GPCK+ +        K     D +  + K+ W++F  I  F L+GG  ++G+G
Sbjct  64   LGEIEMRGPCKAPIEVTLQGTVK----ADGNAIQGKEKWVVFGNIDGFKLNGGGAFDGEG  119

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
            +AAW++N C +      CK LPI++    + N+ ++ I S+D+K FH+NV+  KN+T+N 
Sbjct  120  NAAWRVNNCHKTFE---CKKLPISIRFDFILNSEIRDISSIDAKNFHINVLGAKNMTMNN  176

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
            IKI AP DS NTDGIH+GRS+GV + ++ I TGD
Sbjct  177  IKIVAPEDSPNTDGIHLGRSDGVKILNSFISTGD  210



>emb|CAA44248.1| polygalacturonase [Zea mays]
 emb|CAA47234.1| polygalacturonase [Zea mays]
Length=306

 Score =   150 bits (378),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 115/205 (56%), Gaps = 6/205 (3%)
 Frame = -2

Query  614  ATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYRLGQIGFLGP  435
            A+  G   ++   GA G+G  D T A ++AW   C  T   T+ +P+G + +GQ+ F GP
Sbjct  34   ASGPGGSFDITKLGASGNGKTDSTKAVQEAWASACGGTGKQTILIPKGDFLVGQLNFTGP  93

Query  434  CKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSG-GTYNGQGSAAWKINKC  258
            CK  VT         +A TDLSQ+K    WI    + +  ++G G  +GQG A W  N C
Sbjct  94   CKGDVTIQVD--GNLLATTDLSQYKDHGNWIEILRVDNLVITGKGNLDGQGPAVWSKNSC  151

Query  257  KENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNKIKIRAPADS  78
             +  +   CK LP ++ +  + N  V G+  ++SKFFHMN+ +CK++ +  + + AP DS
Sbjct  152  TKKYD---CKILPNSLVMDFVNNGEVSGVTLLNSKFFHMNMYRCKDMLIKDVTVTAPGDS  208

Query  77   ANTDGIHIGRSEGVTVDDAEIKTGD  3
             NTDGIH+G S G+T+ +  I  GD
Sbjct  209  PNTDGIHMGDSSGITITNTVIGVGD  233



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 124/214 (58%), Gaps = 13/214 (6%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            +  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P+G + 
Sbjct  1    VLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLNAFKEACQSTSPSTIVIPKGTFT  57

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            + Q+   GPCKS +       A   AP+D SQ K  + W+  + +  FT+SGG   +GQ 
Sbjct  58   MNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKLDQFTMSGGGILDGQA  114

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
            +AAW+  + K+      C  LP N++  +LTN+ +K I ++DSK FH+NV QCKNLT  +
Sbjct  115  AAAWECKQSKK------CNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIR  168

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  169  FNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  202



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 124/214 (58%), Gaps = 13/214 (6%)
 Frame = -2

Query  641  IFFYVAYLVATVQGVEVNVKTSGAKGDGDCDDTAAFKKAWDEVCKATEPSTLKVPEGKYR  462
            +  ++A+   +  GV  ++   GA  + D  +  A   A+ E C++T PST+ +P+G + 
Sbjct  1    VLLFLAHFGESQTGV-FDITKYGANSNADISE--ALLNAFKEACQSTSPSTIVIPKGTFT  57

Query  461  LGQIGFLGPCKSAVTFDAAEGAKFIAPTDLSQFKTKDGWILFSMIKDFTLSGG-TYNGQG  285
            + Q+   GPCKS +       A   AP+D SQ K  + W+  + +  FT+SGG   +GQ 
Sbjct  58   MNQVKLEGPCKSPLELQIQ--ATLKAPSDPSQLKVGE-WLTVNKLDQFTMSGGGILDGQA  114

Query  284  SAAWKINKCKENMNAPLCKNLPINMNLGTLTNAVVKGIKSVDSKFFHMNVIQCKNLTLNK  105
            +AAW+  + K+      C  LP N++  +LTN+ +K I ++DSK FH+NV QCKNLT  +
Sbjct  115  AAAWECKQSKK------CNKLPNNLSFNSLTNSTIKDITTLDSKSFHVNVNQCKNLTFIR  168

Query  104  IKIRAPADSANTDGIHIGRSEGVTVDDAEIKTGD  3
              + APA+S NTDGIH+ RS  V + D+   TGD
Sbjct  169  FNVSAPANSPNTDGIHVSRSSSVNITDSNFSTGD  202



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1079622696708