BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25850_g1_i5 len=676 path=[10893:0-234 8622:235-258 11151:259-265
8646:266-323 16046:324-347 16070:348-354 16077:355-355 16078:356-372
16095:373-382 10414:383-413 11301:414-414 11302:415-441
11328:442-452 16207:453-457 16212:458-483 9197:484-494 9208:495-525
16300:526-541 8041:542-546 16321:547-566 16341:567-629 16438:630-630
16439:631-645 16455:646-650 16460:651-651 16461:652-652
16462:653-660 16708:661-675]

Length=676
                                                                      Score     E

ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...  75.1    2e-12   
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                   74.3    3e-12   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                  74.3    4e-12   
ref|XP_006279044.1|  hypothetical protein CARUB_v100165411mg          70.1    1e-11   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483    72.4    2e-11   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...  72.4    2e-11   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like             72.0    3e-11   
dbj|BAH20364.1|  AT3G14040                                            70.9    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...  71.2    3e-11   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like             71.2    4e-11   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative  70.9    5e-11   
ref|XP_002884670.1|  exopolygalacturonase                             71.2    5e-11   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                  70.9    5e-11   Vitis vinifera
gb|KDP30863.1|  hypothetical protein JCGZ_13806                       67.0    6e-11   
emb|CAA51692.1|  exopolygalacturonase                                 70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187442.1|  polygalacturonase-like protein                      70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51033.1|  exopolygalacturonase                                 70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...  70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                    70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                          70.9    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010657162.1|  PREDICTED: polygalacturonase                     70.5    6e-11   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative  70.9    8e-11   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like             70.5    8e-11   
ref|XP_010093135.1|  hypothetical protein L484_009327                 70.5    9e-11   
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg           70.5    9e-11   
ref|XP_002862616.1|  polygalacturonase                                70.1    1e-10   
ref|XP_002885005.1|  polygalacturonase                                70.1    1e-10   
gb|KCW88708.1|  hypothetical protein EUGRSUZ_A01063                   67.0    2e-10   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                  68.9    3e-10   Vitis vinifera
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like             68.6    3e-10   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like             68.6    3e-10   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like             68.6    4e-10   
gb|ADP09681.1|  polygalacturonase                                     68.6    4e-10   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  68.6    4e-10   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like             68.2    5e-10   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  68.2    5e-10   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                  68.2    5e-10   Vitis vinifera
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative  68.2    5e-10   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like             68.2    5e-10   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like             68.2    5e-10   
ref|XP_007049259.1|  Polygalacturonase                                67.8    6e-10   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...  67.4    7e-10   Oenothera organensis
emb|CBI22049.3|  unnamed protein product                              67.4    8e-10   
emb|CAN79473.1|  hypothetical protein VITISV_023355                   68.2    8e-10   Vitis vinifera
emb|CBI22052.3|  unnamed protein product                              68.2    8e-10   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like             67.4    8e-10   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...  67.4    9e-10   
emb|CDY07972.1|  BnaC03g35510D                                        67.4    9e-10   
emb|CDX74027.1|  BnaA03g30200D                                        67.4    9e-10   
emb|CDX80531.1|  BnaC07g29130D                                        67.4    9e-10   
emb|CBI28398.3|  unnamed protein product                              63.5    1e-09   
emb|CBI28390.3|  unnamed protein product                              67.0    1e-09   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like             66.6    1e-09   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                   67.0    1e-09   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like             66.6    1e-09   
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like             65.5    1e-09   
ref|XP_010112808.1|  hypothetical protein L484_020040                 66.6    1e-09   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  66.6    2e-09   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...  66.2    2e-09   
ref|XP_004154223.1|  PREDICTED: polygalacturonase-like                62.4    3e-09   
ref|XP_004174153.1|  PREDICTED: polygalacturonase-like                62.4    3e-09   
ref|XP_006387854.1|  hypothetical protein POPTR_0519s002002g          61.2    3e-09   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                   65.9    3e-09   
ref|XP_008449943.1|  PREDICTED: exopolygalacturonase-like             62.8    3e-09   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like             65.5    3e-09   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                65.5    3e-09   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  65.5    3e-09   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...  65.5    4e-09   
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                63.9    4e-09   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like             65.1    4e-09   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...  65.1    5e-09   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...  65.1    5e-09   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                     65.1    5e-09   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                65.1    5e-09   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like             65.1    5e-09   
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...  65.1    5e-09   
emb|CDP04347.1|  unnamed protein product                              62.4    6e-09   
ref|XP_010112809.1|  hypothetical protein L484_020041                 64.7    7e-09   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                64.7    7e-09   
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g           64.7    7e-09   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg           64.7    7e-09   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like             64.7    7e-09   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like             64.7    7e-09   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  65.5    7e-09   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...  64.3    8e-09   
ref|XP_010112811.1|  hypothetical protein L484_020043                 64.3    9e-09   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like             64.3    9e-09   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                64.3    1e-08   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...  63.9    1e-08   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                63.9    1e-08   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like             63.5    1e-08   
emb|CAN65674.1|  hypothetical protein VITISV_002009                   64.3    2e-08   Vitis vinifera
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                   63.5    2e-08   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  63.5    2e-08   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                     63.5    2e-08   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...  63.2    2e-08
emb|CAA50335.1|  polygalacturonase                                    63.2    2e-08   Nicotiana tabacum [American tobacco]
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                63.2    2e-08   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like             63.5    2e-08   
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like             63.2    2e-08   
dbj|BAA89478.1|  polygalacturonase                                    63.2    2e-08   Salix gilgiana
dbj|BAA89479.1|  polygalacturonase                                    62.8    3e-08   Salix gilgiana
dbj|BAA89476.1|  polygalacturonase                                    62.8    3e-08   Salix gilgiana
emb|CBI22050.3|  unnamed protein product                              62.8    3e-08   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                 62.8    3e-08   
ref|XP_004145161.1|  PREDICTED: polygalacturonase-like                61.2    3e-08   
dbj|BAA89477.1|  polygalacturonase                                    62.4    3e-08   Salix gilgiana
ref|XP_010489712.1|  PREDICTED: polygalacturonase-like                62.4    4e-08   
gb|ADC53480.1|  polygalacturonase                                     62.4    4e-08   Gossypium hirsutum [American cotton]
ref|XP_009780910.1|  PREDICTED: polygalacturonase                     62.4    4e-08   
emb|CDY35967.1|  BnaA05g29830D                                        62.0    4e-08   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like             62.4    4e-08   
emb|CDP04348.1|  unnamed protein product                              62.4    4e-08   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  62.4    5e-08   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like             62.0    5e-08   
emb|CDP18013.1|  unnamed protein product                              62.0    5e-08   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like             62.0    5e-08   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg           62.0    6e-08   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                62.0    6e-08   
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...  61.6    7e-08   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                  61.6    8e-08   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...  61.2    8e-08   Platanus x hispanica [London plane tree]
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like             61.2    8e-08   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                61.6    8e-08   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like             61.2    9e-08   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g           61.2    9e-08   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g           61.2    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like             61.2    1e-07   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like             61.2    1e-07   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                  60.8    1e-07   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                60.8    1e-07   
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...  61.2    1e-07   
emb|CDY28013.1|  BnaC05g44150D                                        61.2    1e-07   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g           60.8    1e-07   
emb|CDY35969.1|  BnaA05g29810D                                        61.2    1e-07   
emb|CDP04343.1|  unnamed protein product                              60.8    1e-07   
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...  60.8    1e-07
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like             60.8    1e-07   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                60.8    1e-07   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like             60.8    1e-07   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                60.8    1e-07   
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                60.8    1e-07   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g           60.5    2e-07   
gb|KDO36716.1|  hypothetical protein CISIN_1g036262mg                 58.5    2e-07   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                  60.5    2e-07   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                60.1    2e-07   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                60.1    2e-07   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                60.1    2e-07   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like             60.1    2e-07   
emb|CAN65676.1|  hypothetical protein VITISV_002011                   60.1    3e-07   Vitis vinifera
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...  59.7    3e-07   
emb|CDP04342.1|  unnamed protein product                              59.3    3e-07   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1  59.7    3e-07   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg           59.3    4e-07   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg           59.3    4e-07   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...  59.3    4e-07   Nicotiana tabacum [American tobacco]
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                59.3    5e-07   
ref|XP_006845390.1|  hypothetical protein AMTR_s00019p00055750        57.4    5e-07   
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...  58.9    5e-07   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg           58.9    5e-07   
ref|XP_002884668.1|  polygalacturonase 3                              58.9    5e-07   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like             58.9    5e-07   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like             58.9    5e-07   
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg           58.9    5e-07   
ref|XP_006492954.1|  PREDICTED: exopolygalacturonase-like             58.9    5e-07   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg           58.9    6e-07   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like             58.9    6e-07   
gb|ABL63521.1|  pollen-specific protein MF9l                          58.9    6e-07   Brassica oleracea var. alboglabra
emb|CDY07974.1|  BnaC03g35490D                                        58.9    6e-07   
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                58.9    6e-07   
emb|CDY54512.1|  BnaC07g49180D                                        58.9    7e-07   
gb|ABG38468.1|  pollen-expressed protein MF9c                         58.5    7e-07   Brassica oleracea
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                58.5    7e-07   
ref|XP_004289544.1|  PREDICTED: exopolygalacturonase-like             58.5    7e-07   
ref|XP_010099972.1|  hypothetical protein L484_014009                 58.5    7e-07   
gb|ABN13878.1|  polygalacturonase                                     58.5    8e-07   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                  58.5    8e-07   Vitis vinifera
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg           58.5    8e-07   
emb|CDY07973.1|  BnaC03g35500D                                        56.6    9e-07   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like             58.5    9e-07   
gb|ACP74159.1|  putative polygalacturonase                            58.2    1e-06   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                     58.2    1e-06   
emb|CDX86325.1|  BnaA06g30420D                                        58.2    1e-06   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                58.2    1e-06   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                58.2    1e-06   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like             58.2    1e-06   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...  58.2    1e-06   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                57.8    1e-06   
emb|CDY22137.1|  BnaC01g39640D                                        57.8    1e-06   
ref|NP_187439.1|  polygalacturonase-like protein                      57.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05892.1|  polygalacturonase                                    57.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like             57.4    2e-06   
dbj|BAC42591.1|  putative polygalacturonase                           56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                57.0    3e-06   
gb|AAO24261.1|  putative pollen polygalacturonase                     57.0    3e-06   Turnera subulata [white alder]
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like             57.0    3e-06   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g           57.0    3e-06   Populus trichocarpa [western balsam poplar]
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                  57.0    3e-06   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like             56.6    3e-06   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                57.0    3e-06   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                56.6    3e-06   
ref|XP_006424158.1|  hypothetical protein CICLE_v10030302mg           56.6    3e-06   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121           56.6    3e-06   
emb|CDP04350.1|  unnamed protein product                              56.6    3e-06   
ref|NP_187440.1|  polygalacturonase-like protein                      56.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase           56.6    3e-06   Brassica oleracea
gb|ADK92878.1|  polygalacturonase                                     56.6    4e-06   
emb|CDY22139.1|  BnaC01g39620D                                        56.6    4e-06   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                  56.6    4e-06   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                56.2    4e-06   
emb|CDY22140.1|  BnaC01g39610D                                        56.2    4e-06   
gb|AAP42648.1|  polygalacturonase                                     56.2    4e-06   Brassica napus [oilseed rape]
ref|XP_009134997.1|  PREDICTED: polygalacturonase                     56.2    4e-06   
ref|NP_199625.1|  putative polygalacturonase / pectinase              56.2    4e-06   Arabidopsis thaliana [mouse-ear cress]
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...  56.2    5e-06   Brassica napus [oilseed rape]
dbj|BAD94423.1|  polygalacturonase                                    52.4    5e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CDY71093.1|  BnaCnng71300D                                        55.5    6e-06   
gb|ABE65925.1|  polygalacturonase/pectinase                           55.5    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg           55.8    6e-06   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                55.8    7e-06   
emb|CDY05701.1|  BnaC02g38360D                                        55.8    7e-06   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                55.5    7e-06   
ref|NP_187441.1|  polygalacturonase-like protein                      55.5    8e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AHL24657.1|  Sal k 6.01 allergen                                   55.5    8e-06   
ref|XP_002889191.1|  predicted protein                                55.5    9e-06   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like             55.5    9e-06   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                55.5    1e-05   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                55.1    1e-05   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                55.1    1e-05   
ref|XP_008224174.1|  PREDICTED: exopolygalacturonase-like             52.8    1e-05   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg           55.1    1e-05   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                55.1    1e-05   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                     55.1    1e-05   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430        54.7    1e-05   
ref|XP_010112807.1|  hypothetical protein L484_020039                 54.7    2e-05   
ref|XP_004959073.1|  PREDICTED: polygalacturonase-like                54.7    2e-05   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like             54.7    2e-05   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like             54.7    2e-05   
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like             54.7    2e-05   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg           54.7    2e-05   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865           54.3    2e-05   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like             54.3    2e-05   
ref|XP_010480508.1|  PREDICTED: exopolygalacturonase-like             54.3    2e-05   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like             54.3    2e-05   
ref|XP_010476857.1|  PREDICTED: exopolygalacturonase-like isoform X1  54.3    2e-05   
ref|XP_010476858.1|  PREDICTED: exopolygalacturonase-like isoform X2  54.3    2e-05   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                54.3    2e-05   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like             54.3    2e-05   
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like             53.9    2e-05   
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like             53.9    3e-05   
ref|XP_002526191.1|  Polygalacturonase precursor, putative            53.9    3e-05   Ricinus communis
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210        53.9    3e-05   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like             53.9    3e-05   
ref|XP_010480616.1|  PREDICTED: exopolygalacturonase clone GBGA48...  52.4    3e-05   
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like             53.9    3e-05   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like             53.9    3e-05   
ref|XP_009348297.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  53.1    3e-05   
emb|CBI32893.3|  unnamed protein product                              50.8    4e-05   
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g          53.1    4e-05   
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g          52.8    4e-05   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like             53.5    4e-05   
emb|CDX88444.1|  BnaC06g38880D                                        53.5    4e-05   
gb|ACU19275.1|  unknown                                               50.4    4e-05   Aplysia californica
gb|EPS57526.1|  hypothetical protein M569_17291                       52.8    4e-05   
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                  53.1    5e-05   
emb|CDY52447.1|  BnaA07g39240D                                        53.1    5e-05   
ref|XP_006845391.1|  hypothetical protein AMTR_s00019p00057300        53.1    5e-05   
emb|CBM42665.1|  group 13 grass pollen allergen                       51.2    7e-05   
emb|CBM42664.1|  group 13 grass pollen allergen                       51.2    7e-05   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like             52.8    7e-05   
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like             52.8    8e-05   
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like             52.4    8e-05   
ref|XP_010459287.1|  PREDICTED: exopolygalacturonase                  52.4    1e-04   
ref|XP_010540121.1|  PREDICTED: exopolygalacturonase                  52.4    1e-04   
ref|XP_010498061.1|  PREDICTED: exopolygalacturonase-like             52.4    1e-04   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like             52.0    1e-04   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like             52.0    1e-04   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like             52.0    1e-04   
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like             51.6    2e-04   
emb|CAB42886.1|  polygalacturonase                                    51.6    2e-04   
emb|CDY23765.1|  BnaC04g43570D                                        51.6    2e-04   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710        51.6    2e-04   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like             51.2    2e-04   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                51.2    2e-04   
gb|AFK41055.1|  unknown                                               51.2    2e-04   
gb|AIL01321.1|  group 13 allergen Sor h 13.02                         51.2    2e-04   
ref|XP_002890206.1|  glycoside hydrolase family 28 protein            51.2    2e-04   
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590        51.2    2e-04   
gb|AIL01320.1|  group 13 allergen Sor h 13.01                         51.2    2e-04   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                     51.2    2e-04   
gb|KHN24677.1|  Polygalacturonase                                     51.2    3e-04   
gb|AFW76553.1|  hypothetical protein ZEAMMB73_007553                  50.8    3e-04   
ref|XP_002318410.2|  hypothetical protein POPTR_0012s02090g           50.1    3e-04   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g           50.8    3e-04   
emb|CDX93193.1|  BnaC04g47030D                                        50.8    3e-04   
ref|XP_008650471.1|  PREDICTED: exopolygalacturonase-like             50.8    3e-04   
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                   50.8    3e-04   
emb|CDP06168.1|  unnamed protein product                              50.8    3e-04   
gb|AAF71796.1|AC013430_5  F3F9.9                                      50.8    4e-04   
ref|NP_177961.2|  pectin lyase-like superfamily protein               50.4    4e-04   
gb|KDP24260.1|  hypothetical protein JCGZ_26694                       49.7    4e-04   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like             50.4    4e-04   
emb|CDY65227.1|  BnaCnng46180D                                        47.8    4e-04   
ref|XP_008337179.1|  PREDICTED: polygalacturonase-like                49.7    4e-04   
ref|XP_007143493.1|  hypothetical protein PHAVU_007G0765001g          48.1    5e-04   
ref|XP_006413912.1|  hypothetical protein EUTSA_v10027416mg           50.4    5e-04   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like             50.4    5e-04   
gb|EMS56561.1|  Exopolygalacturonase                                  50.4    5e-04   
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                50.4    5e-04   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like             50.4    5e-04   
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like             50.1    5e-04   
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                  50.1    5e-04   
ref|NP_001057816.2|  Os06g0545800                                     49.7    5e-04   
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                50.1    5e-04   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like             50.1    6e-04   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like             50.1    6e-04   
gb|EEC83381.1|  hypothetical protein OsI_28796                        49.7    6e-04   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...  50.1    6e-04   
dbj|BAK06865.1|  predicted protein                                    50.1    6e-04   
ref|XP_010092712.1|  hypothetical protein L484_024607                 50.1    7e-04   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                50.1    7e-04   
dbj|BAC57279.1|  putative polygalacturonase PG1                       50.1    7e-04   
ref|XP_007143496.1|  hypothetical protein PHAVU_007G0766000g          47.8    7e-04   
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg              49.7    7e-04   
ref|NP_001057815.1|  Os06g0545400                                     49.7    7e-04   
gb|EAZ01276.1|  hypothetical protein OsI_23299                        49.7    7e-04   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like             49.7    7e-04   
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                49.7    7e-04   
ref|XP_009586577.1|  PREDICTED: exopolygalacturonase-like             49.3    8e-04   
gb|EEC81719.1|  hypothetical protein OsI_25337                        49.7    8e-04   
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like             49.7    8e-04   
ref|XP_010663872.1|  PREDICTED: probable polygalacturonase At3g15720  49.7    8e-04   
emb|CBI15273.3|  unnamed protein product                              49.7    8e-04   
ref|NP_001061556.1|  Os08g0327200                                     49.7    9e-04   
ref|XP_008394262.1|  PREDICTED: polygalacturonase-like                49.7    9e-04   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like             49.7    0.001   
emb|CDP16134.1|  unnamed protein product                              49.7    0.001   
ref|XP_008665639.1|  PREDICTED: polygalacturonase ADPG2-like          49.7    0.001   
ref|NP_001140231.1|  uncharacterized protein LOC100272271 precursor   49.7    0.001   
gb|EMT33861.1|  Exopolygalacturonase                                  49.7    0.001   
gb|EEE68484.1|  hypothetical protein OsJ_26895                        49.3    0.001   
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg           49.3    0.001   



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS+TK AVKL+CS GVPC+KV LS + L Y G +G A+SEC N+KP LSGK  PA C A
Sbjct  341  GTSSTKTAVKLVCSKGVPCSKVELSDINLTYNGKDGPAVSECANVKPILSGKIIPAACTA  400



>gb|KCW46857.1| hypothetical protein EUGRSUZ_K00661 [Eucalyptus grandis]
Length=370

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A S+C+N+KPT++GK S  IC
Sbjct  308  GTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTATSQCENVKPTIAGKLSLPIC  365



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A S+C+N+KPT++GK S  IC
Sbjct  345  GTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTATSQCENVKPTIAGKLSLPIC  402



>ref|XP_006279044.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
 gb|EOA11942.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
Length=168

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP L+GK  PA C
Sbjct  103  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPVLTGKLVPAAC  160



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+AISEC N+KP + G+  P  C
Sbjct  340  GTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTAISECSNVKPAVVGRVVPPAC  397



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+AISEC N+KP ++G   P  C
Sbjct  339  GTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTAISECSNVKPAIAGSVVPPAC  396



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G S+ K AVKL+CS GVPC+KV L+ + L+Y GT+G A+S C  +KP L+GK SP  CDA
Sbjct  348  GKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPAVSMCKFVKPLLTGKQSPPACDA  407



>dbj|BAH20364.1| AT3G14040 [Arabidopsis thaliana]
Length=289

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  224  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  281



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A+S C  +KP L+GK SP  CDA
Sbjct  299  GKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSPPACDA  358



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A+S C  +KP L+GK SP  CDA
Sbjct  348  GKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPAVSMCKFVKPLLTGKQSPPACDA  407



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT+VAVKL CSSG+PC  V +  + L Y GT G A S+C N+KPT++G+ +P  C
Sbjct  339  GTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPATSQCSNVKPTIAGRQTPLAC  396



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  384  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  441



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A+S+C N+KP L G   P IC
Sbjct  337  GTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRIC  394



>gb|KDP30863.1| hypothetical protein JCGZ_13806 [Jatropha curcas]
Length=113

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT+ T +AV+L CS+G+PC KV L+ + L Y G+ G A SEC N+KPT++GK SPA C
Sbjct  56   GTTTTPIAVQLSCSTGLPCEKVELADIDLVYSGSEGPAKSECTNVKPTITGKLSPAGC  113



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  380  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  379  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  436



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  379  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  436



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  380  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  437



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  380  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  437



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP LSGK  PA C
Sbjct  380  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|XP_010657162.1| PREDICTED: polygalacturonase [Vitis vinifera]
Length=336

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKL+CS GVPC  V L  + LEY G +G A+S+C N+KP + G   P IC
Sbjct  278  GTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPAMSQCKNIKPNVLGAQLPRIC  335



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AVKL+CS G+PC++V L+ + + YKG  G AIS+C N+KP LSGK +P  C
Sbjct  339  GTSSTQQAVKLVCSRGLPCDRVELADIDITYKGPGGPAISQCINVKPRLSGKQNPPAC  396



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G S+TK AVKL+CS GVPC+KV L+ + ++Y G  G A+S C  +KP L+GK SP  CDA
Sbjct  348  GKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPAVSMCKFVKPLLTGKQSPPACDA  407



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S+T VAVKL+CS G PC  V LS + L YKG+ G+  SEC N+KP LSGK +P  C
Sbjct  333  GSSSTAVAVKLVCSKGYPCQNVQLSDINLSYKGSEGAITSECKNVKPILSGKENPRAC  390



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + LS + L + G  G A+S C N+KP L+GK  PA C
Sbjct  384  GTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPAVSACSNIKPVLTGKLVPAAC  441



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + L+ + L + G  G A+S C N+KP LSGK  PA C
Sbjct  380  GTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS GVPC  + L+ + L + G  G A+S C N+KP LSGK  PA C
Sbjct  384  GTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPAVSACSNIKPILSGKLVPAAC  441



>gb|KCW88708.1| hypothetical protein EUGRSUZ_A01063 [Eucalyptus grandis]
Length=174

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV L CSS +PC +V +S + + Y G  G A S C N+KPT+SGK +PAIC
Sbjct  107  GTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAIC  164



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A+S+C N+KP L G   P IC
Sbjct  337  GTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPNLLGVQLPRIC  394



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T VAVKL+CS   PC  V ++ + L Y G  G A+SEC N+KPT+SGK +P IC
Sbjct  346  GTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGPAVSECSNVKPTISGKQNPPIC  403



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGT-NGSAISECDNLKPTLSGKNSPAIC  502
            GT+   VAVKL+CS G+PC  V ++ + L Y G  NG+AISEC N+KPT+SG N P +C
Sbjct  337  GTTQDLVAVKLVCSRGIPCQNVQVADINLTYNGNKNGTAISECANVKPTVSGFNHPQVC  395



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKL+CS G PC  V L  + LEY G  G A+S+C N+KP L G   P IC
Sbjct  337  GTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRIC  394



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT+VAV+L CSSG+PC  V +  + L Y GT G A S C N+KP ++GK +P  C
Sbjct  338  GTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPATSRCSNVKPIITGKQTPLAC  395



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A SEC N+KP LSGK +PA C
Sbjct  334  GTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPATSECANVKPVLSGKLNPAAC  391


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSAT +A KL C  GVPC K+ L+ + L Y G NG+A S+C N+KPT++GK+S  +C  
Sbjct  412  GTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQCANVKPTITGKSSLPLCAG  471

Query  495  L  493
            L
Sbjct  472  L  472



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV+L+CS G+PC++V L+ + + YKG  G A SEC N+KP  SGK +P  C
Sbjct  339  GTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPATSECTNVKPRTSGKQNPPAC  396



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AVKL+CS   PCN V L+ + L Y G  G A S C+N+KPT+ GK  PAIC
Sbjct  297  GTSTTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPATSVCENIKPTIKGKQIPAIC  354



>emb|CBI22049.3| unnamed protein product [Vitis vinifera]
Length=345

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAI  505
            GT++T+VAVKL+CS GVPC  V L  + LEY G +G A+S+C N+KP + G   P I
Sbjct  277  GTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPAMSQCKNIKPNVLGAQLPRI  333



>emb|CAN79473.1| hypothetical protein VITISV_023355 [Vitis vinifera]
Length=1033

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675   GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
             GT++T+VAVKL+CS GVPC  V L  + L+Y G  G A+S+C N+KP L G   P  C
Sbjct  975   GTTSTQVAVKLVCSQGVPCQDVKLGDINLKYSGNEGPAMSQCKNIKPNLLGNQLPRTC  1032



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAI  505
            GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A+S+C N+KP L G   P I
Sbjct  337  GTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPAMSQCKNIKPNLLGVQLPRI  393



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS +PC++V ++ + L Y G NGS  S+C N+KP +SG  +P+IC +
Sbjct  339  GSSATPVAVKLICSSNLPCDEVKVANIDLIYNGINGSITSQCMNVKPIISGIQNPSICSS  398



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A+S C ++KP L GK  P  C
Sbjct  356  GTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPKLKGKMEPPAC  413



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A+S C ++KP L GK  P  C
Sbjct  356  GTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPKLKGKMEPPAC  413



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A+S C ++KP L GK  P  C
Sbjct  356  GTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPKLKGKMEPPAC  413



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A+S C ++KP L GK  P  C
Sbjct  356  GTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPAVSACSDVKPKLKGKMEPPAC  413



>emb|CBI28398.3| unnamed protein product [Vitis vinifera]
Length=105

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKL+CS GVPC    L  + L+Y G  G A+S+C N+KP L G   P  C
Sbjct  47   GTTSTQVAVKLVCSQGVPCEDAELGDINLKYNGKVGHAMSQCKNIKPNLLGTQLPRTC  104



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A+S+C N+KP L G+   ++  A
Sbjct  337  GTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPAMSQCKNIKPNLLGQEPFSVIHA  396

Query  495  L  493
            L
Sbjct  397  L  397



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV L CSS +PC +V +S + + Y G  G A S C N+KPT+SGK +PAIC
Sbjct  334  GTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAIC  391



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV L CSS +PC +V +S + + Y G  G A S C N+KPT+SGK +PAIC
Sbjct  399  GTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAIC  456



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV L CSS +PC +V +S + + Y G  G A S C N+KPT+SGK +PAIC
Sbjct  334  GTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPATSVCSNVKPTISGKQNPAIC  391



>ref|XP_004174175.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis sativus]
Length=261

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVKL+CS  +PC  V ++ + L Y G  G  +SEC N++P ++GK SP IC
Sbjct  192  GTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANVQPLITGKQSPQIC  249



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T +AV L+CSSG PC  V ++ + L+Y G +G  +S+C N+KPT+SGK +P  C
Sbjct  335  GTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPIMSQCKNVKPTISGKQNPNPC  392



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G SAT VAVKL+CSS +PC +V ++ + L Y GT GS  S+C N+KP LSG  +P+IC +
Sbjct  336  GCSATSVAVKLICSSNLPCEEVKVANIDLVYNGTKGSITSQCMNVKPILSGIQNPSICSS  395



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS G PC  + L+ + L + G  G A+S C N+KP LSGK  P  C
Sbjct  379  GTSATKVAVKLMCSKGCPCTNIALADINLVHNGKEGPAVSACSNIKPVLSGKLVPEAC  436



>ref|XP_004154223.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=113

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVK++CS  +PC  V ++ + L Y G  G   S+C N+KP ++GK +P IC
Sbjct  47   GTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGKQNPPIC  104



>ref|XP_004174153.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=116

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVK++CS  +PC  V ++ + L Y G  G   S+C N+KP ++GK +P IC
Sbjct  47   GTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGKQNPPIC  104



>ref|XP_006387854.1| hypothetical protein POPTR_0519s002002g, partial [Populus trichocarpa]
 gb|ERP46768.1| hypothetical protein POPTR_0519s002002g, partial [Populus trichocarpa]
Length=74

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GTSAT V V++ CSSG PC KV L+ + L Y+G  G A S+C N+KP +SG
Sbjct  17   GTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISG  67



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A SEC N++P +SG  +P   DA
Sbjct  333  GTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNPRAYDA  392



>ref|XP_008449943.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=149

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+C N+KP +SGK +P IC
Sbjct  80   GTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPIC  137



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS  SEC N+KP +SG  +P IC +
Sbjct  339  GSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGSLTSECMNVKPIISGTQNPPICSS  398



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVKL+CS  +PC  V ++ + L Y G  G  +SEC N++P ++GK SP IC
Sbjct  328  GTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANVQPLITGKQSPQIC  385



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVKL+CS  +PC  V ++ + L Y G  G  +SEC N++P ++GK SP IC
Sbjct  328  GTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGPILSECANVQPLITGKQSPQIC  385



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+ S C N+KP +SGK  PA C
Sbjct  336  GTSATQVAVKIVCSRGLPCQNVFVEDINLVYNGKEGSSTSLCANVKPQVSGKVFPATC  393



>ref|XP_004171844.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=256

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS +PC +V LS + L Y G  GS  S+C N+KP + G  +P IC +
Sbjct  190  GSSATPVAVKLICSSNLPCEEVKLSNIDLIYNGIKGSITSQCMNVKPIIYGIQNPPICSS  249



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A SEC N++P +SG  +P  C
Sbjct  333  GTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNPRAC  390



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS G PC  + L+ + L + G  G A+S C N+KP LSGK  P  C
Sbjct  374  GTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPAVSACSNIKPILSGKLVPEAC  431



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS G PC  + LS + L + G  G A+S C N+KP ++GK  P  C
Sbjct  379  GTSATKVAVKLMCSKGCPCTNIALSDINLVHNGKEGPAVSACSNIKPVITGKLIPEAC  436



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS  SEC N+KP +SG  +P IC +
Sbjct  338  GSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICSS  397



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS  SEC N+KP +SG  +P IC +
Sbjct  338  GSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGSITSECMNVKPIISGIQNPPICSS  397



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT+ T VAVKL+CS  +PC  V ++ + L+Y G  GS  S+C N+KP +SGK +P IC
Sbjct  332  GTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGSITSQCANVKPIISGKQNPRIC  389



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATKVAVKL+CS G PC  + L+ + L + G  G A+S C N+KP LSGK  P  C
Sbjct  374  GTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPAVSACSNIKPILSGKLVPEAC  431



>emb|CDP04347.1| unnamed protein product [Coffea canephora]
Length=174

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT  AV LLCS  +PC  V ++ + L Y G  GS  S C N+KP LSGK +P IC
Sbjct  107  GTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSVSSNCANVKPALSGKLNPPIC  164



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T +AVKL+CS G+PC  V ++ + L+Y G  G   SEC N+KPT+SG  +P  C
Sbjct  337  GTSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQITSECKNVKPTVSGIQNPPAC  394



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+SAT VAVKL+CSS  PC +V ++ + L Y G NG   S+C N+KP +SG  +P+IC
Sbjct  340  GSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSIC  397



>ref|XP_006375551.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
 gb|ERP53348.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
Length=387

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+ S C N+KP +SGK  PA C
Sbjct  326  GTSATQVAVKIVCSRGLPCQNVSVEDINLVYNGKEGSSTSLCANVKPQVSGKVFPATC  383



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAVKLLCS GVPC     + + L + G  G A+S C N+KP +SGK  P  C
Sbjct  461  GTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEGPAVSACSNVKPVVSGKMVPPAC  518



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS+T++A+KL CSSGVPC  V +S + ++Y G++G ++S+C N+ P + GK  P+ C A
Sbjct  343  GTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDSMSDCTNVSPKIFGKQYPSPCVA  402



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS+T++A+KL CSSGVPC  V +S + ++Y G++G ++S+C N+ P + GK  P+ C A
Sbjct  343  GTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDSMSDCTNVSPKIFGKQYPSPCVA  402



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK++CS   PC +V ++ + L Y G+ G   S+C N+KP ++GK +P IC
Sbjct  936  GTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGPIKSQCANVKPVITGKQNPPIC  993



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+KVAV+L CSS  PC  V LS + L Y G++G A SEC N+KP ++G+  P  C
Sbjct  332  GTSASKVAVRLRCSSASPCENVGLSNINLAYHGSDGKATSECANVKPKVTGQLFPPAC  389



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T +AV L+CSSG PC  VV+  + L+Y G+ G   S+C N+KPT+ G  +PA C
Sbjct  333  GTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPITSKCKNVKPTVGGVQNPAAC  390



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+SAT VAVKL+CSS  PC +V ++ + L Y G NG   S+C N+KP +SG  +P+IC
Sbjct  339  GSSATPVAVKLICSSNKPCEEVKVANIDLVYNGINGPVTSQCMNVKPIISGIQNPSIC  396



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTSA K AVKLLCS G PC  VV+  + +EY G +G A   C N+KP L G  +P  CD
Sbjct  343  GTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPATFMCSNVKPKLVGIQNPKACD  401



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA  V VKL CS G+PC  V +S + L Y G NG+A S C N+KPT++G+  P  C
Sbjct  338  GTSADPVVVKLACSKGIPCQNVQISDIHLTYNGKNGAATSVCTNVKPTMTGQIFPPAC  395



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G+SAT VAVKL+CSS  PC +V ++ + L Y G NG   S+C N+KP +SG  +P+IC +
Sbjct  339  GSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGPITSQCMNVKPIVSGIQNPSICSS  398



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS+TK+A+KL CSSGVPC  V +S + ++Y G++G ++S+C N+ P   GK  P+ C A
Sbjct  371  GTSSTKMAMKLACSSGVPCENVEISNIDIKYIGSDGVSMSDCTNVSPKTFGKQYPSACVA  430



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675   GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
             GT++T++AV L+CS G PC KV L  + L+Y G  G+A S+C N++ TL G   P  C
Sbjct  1199  GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPKTC  1256



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A SEC N++P +SG  +P  C
Sbjct  335  GTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNPLAC  392



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T+VAVKL+CS GVPC    L  + L+Y G  G A+S+C N+KP L G   P  C
Sbjct  337  GTTSTQVAVKLVCSQGVPCEDAELGDINLKYNGKVGHAMSQCKNIKPNLLGTQLPRTC  394



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C A
Sbjct  331  GTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPPVCTA  390



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C A
Sbjct  320  GTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPPVCTA  379



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C A
Sbjct  320  GTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPPVCTA  379



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T+ AV+LLCS GVPC  V +  + + Y G  G A + C+N+KPT  GK +P +C
Sbjct  329  GTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPAKTSCENVKPTFVGKQNPPVC  386



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A SEC N++P +SG  +P  C
Sbjct  368  GTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPATSECSNVRPLISGMQNPLAC  425


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +A KL C  GVPC K+ L+ + L Y G NG++ S+  N+KPT++GK+S  IC
Sbjct  441  GTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKPTITGKSSLPIC  498



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVKL+CS  +PC  V +  + L+Y G  G   S+C N+KP +SGK +P IC
Sbjct  335  GTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGPIKSQCANVKPIISGKQNPRIC  392



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V VKL CS G+PC KV L+ + L Y G+ G A S+C N+KPT+SG  S + C
Sbjct  336  GTSATPVVVKLACSGGIPCEKVELADINLVYSGSEGPAKSQCSNVKPTISGIMSASGC  393



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A S+C N+KP +SG  S + C
Sbjct  336  GTSATPVVVKLACSSGIPCEKVELADINLVYSGSEGPAKSQCSNVKPIISGIMSASGC  393



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A S+C N+KP +SG  S + C
Sbjct  336  GTSATPVVVKLACSSGIPCEKVELANINLVYSGSEGPAKSQCSNVKPKISGIMSASGC  393



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GT++T+VAVKL+CS G PC  V L  + LEY G  G A+S+C N+KP L G
Sbjct  337  GTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPAMSQCKNIKPNLLG  387



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C
Sbjct  331  GTSRTQDAVSLLCSKGVPCEGIEVGDIDISYSGKEGPAKSSCENIKPSLKGKQNPPVC  388



>ref|XP_004145161.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=236

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK++CS   PC +V ++ + L Y G+ G   S+C N+KP ++GK +P IC
Sbjct  167  GTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGPIKSQCANVKPVITGKQNPPIC  224



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A S+C N+KP +SG  S + C
Sbjct  336  GTSATPVVVKLACSSGIPCEKVELANINLLYSGSEGPAKSQCSNVKPKISGIMSASGC  393



>ref|XP_010489712.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=352

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTSA K AVKLLCS G PC  VV+  + +EY G +G A   C N+KP L G  +P  C+
Sbjct  285  GTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPATFMCSNVKPKLVGVQNPKACN  343



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSA   AVK++CS+ +PC  V L+ +++ + G  G A+S+C N+KP +SGK +PA C A
Sbjct  343  GTSARPEAVKIICSATLPCENVELADIEITHSGPTGPAVSQCSNVKPKVSGKQNPAACSA  402



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C
Sbjct  332  GTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPPVC  389



>emb|CDY35967.1| BnaA05g29830D [Brassica napus]
Length=293

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSATK AVKL+CS G PC  V L+ + L + G  G A+  C N+KP L+G+  P  C  
Sbjct  228  GTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPAVGACANMKPVLTGQMIPPACTE  287

Query  495  L  493
            +
Sbjct  288  I  288



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK++CS   PC +V ++ + L Y G+ G   S+C N+KP +SGK +P IC
Sbjct  335  GTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPIC  392



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT  AV LLCS  +PC  V ++ + L Y G  GS  S C N+KP LSGK +P IC
Sbjct  337  GTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSVSSNCANVKPALSGKLNPPIC  394



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+C N+KP +SGK +P IC
Sbjct  335  GTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPIC  392



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+C N+KP +SGK +P IC
Sbjct  334  GTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPIC  391



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT  AV LLCS  +PC+ V ++ + L Y G  G+  S C N+KP LSGK +P IC
Sbjct  337  GTSATPAAVTLLCSKSIPCDGVEIADIDLAYNGNQGNVSSNCANVKPALSGKLNPPIC  394



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GT+ +K AVK+LCSSG PC+KV L+ + L + G  G A+S C N+KP  SGK +P  C A
Sbjct  337  GTAGSKEAVKILCSSGAPCDKVELADIDLTFNG--GHAVSMCKNVKPITSGKQNPVACGA  394



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSAT VA+KL CS GVPC  V L+ + L Y G  G   SEC N++P  SGK +P  C A
Sbjct  332  GTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPPPCIA  391



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSAT VA+KL CS GVPC  V L+ + L Y G  G   SEC N++P  SGK +P  C A
Sbjct  330  GTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPIKSECTNIQPKTSGKMNPPPCIA  389



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSATK AVKL+CS G PC  V L+ + L + G  G A+  C N+KP L+G+  P  C
Sbjct  411  GTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPAVGACANMKPVLTGQMIPPAC  468



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+K+AVK++CS G PC  + L+ + L   G  G A+S C N+KP +SGK  PA C
Sbjct  441  GTSASKIAVKIICSKGCPCTNIALTDINLVSSGKEGPAVSACANMKPVVSGKVVPAAC  498



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAI  505
            GTS  KVAV + CS G+PC+ + +  + L Y+G  G A S C N+KPT SGK  PAI
Sbjct  318  GTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAI  374



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK++CS   PC  V ++ + L Y G+ G   S+C N+KP +SGK +P IC
Sbjct  296  GTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCANVKPVISGKQNPPIC  353



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT +AVK++CS  +PC  V ++ + L Y G  G   S+C N+KP ++GK +P IC
Sbjct  354  GTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGKQNPPIC  411



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V V++ CSSG PC KV L+ + L YKG  G A S+C N+KP +SG  S + C
Sbjct  336  GTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V V++ CSSG PC KV L+ + L Y+G  G A S+C N+KP +SG  S + C
Sbjct  336  GTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V V++ CSSG PC KV L+ + L Y+G  G A S+C N+KP +SG  S + C
Sbjct  377  GTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPAKSQCSNVKPIISGIMSASGC  434



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GTSAT V V++ CSSG+PC KV L+ +KL Y G +G   S+C N+KP +SG
Sbjct  336  GTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPPKSQCSNVKPIMSG  386



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GTSAT V V++ CSSG+PC KV L+ +KL Y G +G   S+C N+KP +SG
Sbjct  336  GTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPPKSQCSNVKPMISG  386



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  + + YKG +G A  +C N+KP L G  +P  C A
Sbjct  329  GTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKGADGPATFQCSNVKPKLVGTQNPKACSA  388



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ A+ L CS G PC  V +  V + Y G  G A S C+N+KPT  GK +PA+C
Sbjct  332  GTSRTQNAISLTCSKGSPCEGVEVGDVDISYSGKEGPAKSSCENIKPTFKGKQTPAVC  389



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+TK+AV+L CS G PC  V L+ + L   G  G+A+S C N+KPT++GK  PA C
Sbjct  451  GTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPTVTGKMIPAAC  508



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+TK+AV+L CS G PC  V L+ + L   G  G+A+S C N+KPT++GK  PA C
Sbjct  427  GTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPTVTGKMIPAAC  484



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT V V++ CSSG PC KV L+ +K+ Y G +G A S+C N+KP +SG  S   C
Sbjct  336  GTSATPVVVQIACSSGFPCEKVELADIKVAYSGPDGPAKSQCSNVKPIISGTMSAPGC  393



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+TK+AV+L CS G PC  V L+ + L   G  G+A+S C N+KPT++GK  PA C
Sbjct  437  GTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAAVSACSNVKPTVTGKMIPAAC  494



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT  AV LLCS  +PC  V ++ + L Y G  G+  S+C N+KP LSGK +P IC
Sbjct  337  GTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNGKQGTLSSKCANVKPVLSGKLNPPIC  394



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS T+ AV LLCS GVPC  + +  + + Y G  G A S C+N+KP+L  K +P +C A
Sbjct  320  GTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKDKQNPPVCTA  379



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VA+K +CS  +PC+ V ++ + L Y GT G   S+C N+ P ++GK +P  C
Sbjct  333  GTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGRITSQCRNVIPIITGKQNPRAC  390



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTS  K AVKLLCS G PC  VV+  + +EY G +G A   C N+KP L G  +P  C+
Sbjct  331  GTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPATFMCSNVKPRLVGIQNPKACN  389



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GTSAT V V++ CSSG+PC KV L+ +KL Y G +G   S+C N+KP +SG
Sbjct  336  GTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPPKSQCSNVKPIISG  386



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S+C N+ P ++GK +P  C
Sbjct  349  GTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITSQCRNVIPIITGKQNPRAC  406



>ref|XP_004144611.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=506

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S+C N+ P ++GK +P  C
Sbjct  431  GTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITSQCRNVIPIITGKQNPRAC  488



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            GTSAT V V++ CSSG PC KV L+ +KL Y G +G + S+C N+KP +SG
Sbjct  316  GTSATPVVVQIACSSGFPCEKVELADIKLAYSGPDGPSKSQCSNVKPIISG  366



>gb|KDO36716.1| hypothetical protein CISIN_1g036262mg, partial [Citrus sinensis]
Length=195

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  135  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  194



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T++AV L+CS G PC KV L  + L+Y G  G+A S+C N++ TL G   P  C
Sbjct  335  GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPKTC  392



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ AV LLCS G PC+ V +  + + Y G  G A S C+N+KP L GK +P IC
Sbjct  338  GTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPAKSSCENVKPKLVGKQNPPIC  395



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AV+LLCS GVPC  V +  + L Y G +G A  EC N+ P LSG   P  C
Sbjct  333  GTSGNKDAVRLLCSKGVPCTNVEVGDIDLRYGGADGPATFECSNVTPKLSGTQFPKAC  390



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  V ++Y G +G A  +C N+ P LSG  +P  C A
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGNVDIKYTGADGPATFQCSNVSPKLSGIQNPKACSA  388



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T +A+K+LC+ G+PC+KV ++ + L+Y G  GS  S+C N++PT++   +P  C
Sbjct  331  GTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGSLTSQCSNVRPTITRVPNPLAC  388



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT++T++AV L+CS G PC KV L  + L+Y G  G+A S+C N++ TL G   P  C
Sbjct  526  GTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTASSQCKNVEATLWGTQQPKTC  583



>ref|XP_010675960.1| PREDICTED: exopolygalacturonase clone GBGA483-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  +S C N+KP  SGK +P  C A
Sbjct  271  GTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPVVSMCKNVKPITSGKQNPVACGA  328



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT   V LLCS  +PC  V ++ + L Y G  G+  S C N+KP LSGK +P IC
Sbjct  230  GTSATPAVVTLLCSKSIPCESVEVADIDLAYNGNQGNVSSNCANVKPALSGKLNPPIC  287



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  +S C N+KP  SGK +P  C A
Sbjct  347  GTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPVVSMCKNVKPITSGKQNPVACGA  404



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC KV +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVSPQLLGSQSPKAC  386



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC KV +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  315  GTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGPATFQCSNVSPQLLGSQSPKAC  372



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS T+ AV LL S GVPC  + +  + + Y G  G A S C+N+KP+L GK +P +C A
Sbjct  331  GTSRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKEGPAKSSCENIKPSLKGKQNPPVCTA  390



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ AV LLCS G PC+ V +  + + Y G  G A S C+N+KP   GK +P IC
Sbjct  338  GTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPAKSSCENVKPKFVGKQNPPIC  395



>ref|XP_006845390.1| hypothetical protein AMTR_s00019p00055750 [Amborella trichopoda]
 gb|ERN07065.1| hypothetical protein AMTR_s00019p00055750 [Amborella trichopoda]
Length=184

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT+A++VAV LLC    PC+ V L G+KLEYKG   ++I+ C N+K   +G   P  C
Sbjct  126  GTTASEVAVNLLCREAFPCDNVKLDGIKLEYKGKGETSIASCTNVKGISAGVQMPPTC  183



>ref|XP_006492953.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Citrus 
sinensis]
Length=360

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  300  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  359



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G+PC  V +  + +EYKG +G    +C N+ P L G   P  C
Sbjct  328  GTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGPPTFQCSNVNPKLVGTQVPKAC  385



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ P L G  SP  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFQCSNVSPKLLGSQSPKACSA  388



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  342  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  401



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  347  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  406



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  320  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  379



>ref|XP_006492954.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=374

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  314  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  373



>ref|XP_006299755.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
 gb|EOA32653.1| hypothetical protein CARUB_v10015950mg [Capsella rubella]
Length=447

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTS  K AVKLLCS G PC  VV+  + ++Y G +G A   C N++P L G  +P  C+
Sbjct  330  GTSGNKDAVKLLCSKGYPCENVVVGDIDIQYTGADGPATFMCSNVRPKLVGIQNPKACN  388



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--GSAISECDNLKPTLSGKNSPAIC  502
            GTS TK AV+++CS  +PC  V +  + L Y G +  G AIS C N+KPTL GK  PA C
Sbjct  347  GTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKGPAISSCSNVKPTLVGKQIPATC  406



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGPATFQCSNVSPKLMGTQSPKAC  386



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGPATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ AV LLCS GVPC  V +  + + Y G  G A + C+N+KPT  G  +P +C
Sbjct  321  GTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPAKTSCENVKPTFVGNQNPPVC  378



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ PTL G   P  C
Sbjct  330  GTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADGPATFQCSNVSPTLMGTQVPKAC  387



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_004289544.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=350

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLS  526
            GTS+T VAVK+ C++G+PC KV ++ + L+Y G  GS  S+C N+KPT++
Sbjct  289  GTSSTPVAVKIACATGLPCEKVEMTDIDLKYSGNEGSITSQCSNVKPTVT  338



>ref|XP_010099972.1| hypothetical protein L484_014009 [Morus notabilis]
 gb|EXB81077.1| hypothetical protein L484_014009 [Morus notabilis]
Length=403

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS++KVAV L CS G PC ++VL  + L YKG +G AIS+C N+     GK  P  C
Sbjct  339  GTSSSKVAVNLDCSKGKPCQQIVLKDIYLAYKGKDGPAISQCSNVNGVSYGKLQPPSC  396



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGPATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS+T++AVKL+CSSGVPC  V L+ + L++ G  G+  S C N+KP L G   P  C A
Sbjct  336  GTSSTELAVKLVCSSGVPCQNVQLTDINLKFNG--GAPTSICKNVKPILGGVQQPRSCSA  393



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  V ++Y G +G A  +C N+ P L G  +P  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDVDIKYNGADGPATFQCSNVSPKLLGTQNPKACSA  388



>emb|CDY07973.1| BnaC03g35500D [Brassica napus]
Length=179

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  111  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGPPTFECTNVTPKLVGTQNPKAC  168



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S+T V +KL+CS G+PC  V LS + L Y G  GS  SEC ++KPT++    P  C
Sbjct  339  GSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGSITSECKHIKPTINNVAQPLAC  396



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ PTL G   P  C
Sbjct  330  GTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ PTL G   P  C
Sbjct  330  GTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPATFQCSNVSPTLMGTQVPKAC  387



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ PTL G   P  C
Sbjct  330  GTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGPATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  V ++Y G +G A  +C N+ P L G  +P  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATFQCSNVSPKLLGTQNPKACSA  388



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 35/60 (58%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  V ++Y G +G A  +C N+ P L G  +P  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGPATFQCSNVSPKLLGTQNPKACSA  388



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S+T V +KL+CS G+PC  V LS + L Y G  GS  SEC ++KPT+     P  C
Sbjct  339  GSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGSITSECKHIKPTIDNVAQPLAC  396



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTSA  VAVKL CS G+PC  V +S + L   G NG+  S C N+ PT++GK  P  C A
Sbjct  338  GTSADPVAVKLACSKGIPCQNVEISDINLTCNGKNGTCTSVCSNVNPTVTGKVIPPACSA  397



>ref|XP_009124109.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGEDGPATFQCSNVSPKLLGAQSPEAC  386



>emb|CDY22137.1| BnaC01g39640D [Brassica napus]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ P L G  SP  C
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYSGADGPATFQCSNVSPKLLGAQSPEAC  386



>ref|NP_187439.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21192.1|AC013483_16 polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAL38715.1| putative polygalacturonase(PGA3 [Arabidopsis thaliana]
 gb|AAM20184.1| putative polygalacturonase (PGA3) [Arabidopsis thaliana]
 gb|AAM65120.1| polygalacturonase PGA3 [Arabidopsis thaliana]
 gb|AEE74608.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N+ P + G  SP  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFHCSNVSPKILGSQSPKACSA  388



>emb|CAA05892.1| polygalacturonase [Arabidopsis thaliana]
 emb|CAA06610.1| polygalacturonase [Arabidopsis thaliana]
Length=391

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (57%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N+ P + G  SP  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFHCSNVSPKILGSQSPKACSA  388



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS    AV L+CSS  PC+ V L+ + L Y G+ G   S C N+KPT+SGK +P  C
Sbjct  360  GTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGPITSRCANVKPTVSGKQNPPAC  417



>dbj|BAC42591.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAO63309.1| At3g07830 [Arabidopsis thaliana]
Length=225

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N++P L G   P  C+
Sbjct  158  GTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPATFMCSNVRPKLVGTQFPKACN  216



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V L  + ++Y G++G A  +C N+ P L G   P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGSDGPATFQCSNVSPKLMGTQVPKAC  386



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGK  520
            GT+ T  AVK++CSS +PC +V L+G+ L+Y GT G A SEC N K T++G 
Sbjct  331  GTTNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPAKSECKNAKLTVTGH  382



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKP  535
            GTSAT V V++ CSSG PC KV L+ + L YKG  G A S+C N+KP
Sbjct  336  GTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPAKSQCSNVKP  382



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A  +C N++P   GK +P+ C
Sbjct  334  GTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPAKFQCSNVQPKFHGKINPSKC  391



>gb|KFK31316.1| hypothetical protein AALP_AA6G096900 [Arabis alpina]
Length=395

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLC+ G+PC  V L  + ++Y G +G A  +C N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCAKGLPCTNVELGDINIKYNGADGPATFQCANVSPKLMGTQTPKAC  386



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A  +C N++P   GK +P+ C
Sbjct  334  GTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPAKFQCSNVQPKFHGKINPSKC  391



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AV+LLCS  VPC  V +  + L Y G +G A  +C N+ P LSG   P  C
Sbjct  333  GTSGNKDAVRLLCSKAVPCTNVEVGDIDLRYGGADGPATFQCSNVTPKLSGTQFPKAC  390



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AV+LLCS  VPC  V +  + L Y G +G A  +C N+ P LSG   P  C
Sbjct  333  GTSGNKDAVRLLCSKAVPCTNVEVGDIDLRYGGADGPATFQCSNVTPKLSGTQFPKAC  390



>ref|XP_006424158.1| hypothetical protein CICLE_v10030302mg [Citrus clementina]
 gb|ESR37398.1| hypothetical protein CICLE_v10030302mg [Citrus clementina]
Length=358

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 36/63 (57%), Gaps = 5/63 (8%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN-----GSAISECDNLKPTLSGKNSP  511
            GTSATKVAV L+CS  +PC  + +  + L Y G N         S C N+KPTL GK  P
Sbjct  295  GTSATKVAVSLVCSQKIPCQNIEIGNINLVYNGVNVKVEGPETTSLCSNVKPTLFGKQIP  354

Query  510  AIC  502
            A C
Sbjct  355  ATC  357



>ref|XP_002884669.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60928.1| hypothetical protein ARALYDRAFT_478121 [Arabidopsis lyrata subsp. 
lyrata]
Length=397

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N++P L G   P  C+
Sbjct  330  GTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPATFMCSNVRPKLVGTQFPKACN  388



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+ +AVKL+CS   PC  V +  + L Y G+ G+  + C N++PT  G+ +P IC
Sbjct  336  GTSASALAVKLVCSKTFPCEGVEIGDIDLAYHGSLGNITTNCANVQPTFMGRQNPPIC  393



>ref|NP_187440.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21193.1|AC013483_17 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74609.1| polygalacturonase-like protein [Arabidopsis thaliana]
Length=397

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N++P L G   P  C+
Sbjct  330  GTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGPATFMCSNVRPKLVGTQFPKACN  388



>gb|AAM74219.1|AF518563_1 putative pollen polygalacturonase [Brassica oleracea]
Length=397

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGPPTFECTNVTPKLVGTQNPKAC  386



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT++AVKL+CS G+PC  V +  + L Y    G A S+C N+KP + G   PA C
Sbjct  336  GTSATQLAVKLVCSKGIPCQNVAVGDINLAYN--KGQATSQCANVKPQVRGSVVPAPC  391



>emb|CDY22139.1| BnaC01g39620D [Brassica napus]
Length=359

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  291  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTFECTNVTPKLVGTQNPKAC  348



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P + G   P  C A
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEIGDIDIRYNGADGPATFQCSNVSPKIMGTQIPKACSA  388



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V L  + ++Y G +G A  +C N+ P L G   P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGADGPATFQCSNVSPKLMGTQVPKAC  386



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTFECTNVTPKLVGTQNPKAC  386



>gb|AAP42648.1| polygalacturonase [Brassica napus]
Length=397

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTFECTNVTPKLVGTQNPKAC  386



>ref|XP_009134997.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTFECTNVTPKLVGTQNPKAC  386



>ref|NP_199625.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
 dbj|BAA96994.1| polygalacturonase [Arabidopsis thaliana]
 dbj|BAC43278.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAP81805.1| At5g48140 [Arabidopsis thaliana]
 gb|AED95623.1| putative polygalacturonase / pectinase [Arabidopsis thaliana]
Length=395

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  V ++Y G +G A  +C N+ P L G   P  C
Sbjct  329  GTSGNKDAVKLLCSKGYPCQNVEVGDVNIQYTGADGPATFQCSNVSPKLVGTQIPKAC  386



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + +EY G +G    EC N+ P L G  +P  C
Sbjct  329  GTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGPPTFECTNVTPKLVGAQNPKAC  386



>dbj|BAD94423.1| polygalacturonase [Arabidopsis thaliana]
Length=60

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 31/56 (55%), Gaps = 0/56 (0%)
 Frame = -2

Query  663  TKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
             K AVKLLCS G PC  V +  + ++Y G +G A   C N+ P + G  SP  C A
Sbjct  2    NKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGPATFHCSNVSPKILGSQSPKACSA  57



>emb|CDY71093.1| BnaCnng71300D, partial [Brassica napus]
Length=257

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L GK  P  C
Sbjct  190  GSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPATFQCSNVSPKLVGKQCPKAC  247



>gb|ABE65925.1| polygalacturonase/pectinase [Arabidopsis thaliana]
Length=280

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS   PC  V +  + LEYKG +G     C N+ P L G  +P  C A
Sbjct  209  GTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGPPTFMCSNVSPKLVGTQNPKACSA  268



>ref|XP_006279754.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
 gb|EOA12652.1| hypothetical protein CARUB_v10027711mg [Capsella rubella]
Length=395

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V L  + ++Y G +G A  +C N+ P + G   P  C
Sbjct  329  GTSGNKDAVKLLCSKGFPCQNVELGNIDIKYTGADGPATFQCANVSPKIMGTQVPKAC  386



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L GK  P  C
Sbjct  330  GSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPATFQCSNVSPKLVGKQCPKAC  387



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            G+S  K AVKLLCS G PC  V +  + + Y G +G A  +C N+ P L GK  P  C
Sbjct  330  GSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGPATFQCSNVSPKLVGKQCPKAC  387



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ A+++ CS GVPC  V +  + + Y G  G A S C N+ P+  GK +P +C
Sbjct  337  GTSRTQDAIQINCSKGVPCEGVEVGDIDITYNGNEGPAKSSCQNVDPSFVGKQNPPVC  394



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS   PC  V +  + LEYKG +G     C N+ P L G  +P  C A
Sbjct  330  GTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGPPTFMCSNVSPKLVGTQNPKACSA  389



>gb|AHL24657.1| Sal k 6.01 allergen, partial [Salsola kali]
Length=381

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 40/60 (67%), Gaps = 2/60 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            G + +   VKLLCSS VPC+ V L+ + L + G  G+A+S+C N+KP ++GK +P  C A
Sbjct  315  GAAKSAEVVKLLCSSAVPCDGVELADIDLTFPG--GAAVSQCKNVKPIVTGKQNPVACGA  372



>ref|XP_002889191.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65450.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=404

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  KVAVKL CS  VPC  V L  V L ++G +G AIS C+N+     GK SP  C
Sbjct  345  GTSTNKVAVKLQCSKNVPCKNVELFNVNLVHRGRDGPAISLCENVAGWTRGKISPPSC  402



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T +A+KL+CS G+PC  V LS + L+Y G  G   S+C N+KP ++    P  C
Sbjct  338  GTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGPLTSKCTNVKPKITRVTKPLAC  395



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK +CS+   C  V ++ + L Y GT G   S+C N+ P ++GK +P  C
Sbjct  343  GTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPIITGKQNPRAC  400



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+ A+K+ CS GVPC  V +  + + Y G  G A S C N+ P+  GK  P +C
Sbjct  337  GTSRTQDAIKINCSKGVPCEGVEVGDIDITYNGNEGPAKSTCQNVDPSFVGKQIPPVC  394



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT VAVK +CS+   C  V ++ + L Y GT G   S+C N+ P ++GK +P  C
Sbjct  343  GTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGRITSQCRNVIPIITGKQNPRAC  400



>ref|XP_008224174.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=127

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICD  499
            G++ T +AV+L+C SGVPC  V L+ + L Y G  G   S C N+KPT+ G  S   CD
Sbjct  40   GSTFTPIAVRLVCCSGVPCENVELADIGLAYVGDKGPLSSLCSNVKPTIIGVISSVSCD  98



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 0/60 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAICDA  496
            GTS  K AVKLLCS   PC  V +  + LEYKG +G     C N+ P L G  +P  C A
Sbjct  328  GTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKGADGPPTFTCSNVTPKLVGTQNPKACSA  387



>ref|XP_011099769.1| PREDICTED: polygalacturonase-like [Sesamum indicum]
Length=402

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GT+ ++ AV LLCS   PC  VV+  + L+Y G  G   ++C N++PT  GK +P IC
Sbjct  338  GTTNSEEAVTLLCSKLKPCENVVVGDIDLKYNGNRGPVTTKCVNVQPTFVGKQNPPIC  395



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G    EC N+ P L G  +P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGPPTFECTNVTPKLVGTQNPKAC  386



>ref|XP_006856225.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
 gb|ERN17692.1| hypothetical protein AMTR_s00059p00207430 [Amborella trichopoda]
Length=403

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS T+VAVKL CS G PC +++L  V LEY G  G A + C N+K T SG   P  C
Sbjct  347  GTSKTEVAVKLECSKGHPCKEIILQDVHLEYNG--GPAKASCVNVKATYSGTQIPPPC  402



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+T +AV L+CS G PC  V +  + L+YKG +G A S C N+   ++GK +P+ C
Sbjct  335  GTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDGPAHSVCKNVNVKVTGKMNPSPC  392



>ref|XP_004959073.1| PREDICTED: polygalacturonase-like [Setaria italica]
Length=417

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSA+K A+KL CS+ VPC+ + L  VKL  KG +G A S C+N K   SG  +P  C
Sbjct  356  GTSASKEAIKLRCSTSVPCHGITLENVKLTLKGGDGVAKSTCENAKWRKSGTVTPQPC  413



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLS  526
            G+SAT +AV+++CS G+PC  V L+ + L Y G  G   S+C N+KPT++
Sbjct  338  GSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGPLTSQCSNVKPTIT  387



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLS  526
            G+SAT +AV+++CS G+PC  V L+ + L Y G  G   S+C N+KPT++
Sbjct  338  GSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGPLTSQCSNVKPTIT  387



>ref|XP_008462134.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=508

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 8/68 (12%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG--------SAISECDNLKPTLSGK  520
            GTSAT VAVK +CS  +PC  V ++ + L Y G  G        S +S+C N+K T++GK
Sbjct  331  GTSATSVAVKFICSKDLPCEGVEVADIDLAYNGVEGQTTSHCWKSIVSQCANVKYTVTGK  390

Query  519  NSPAICDA  496
             +P + D+
Sbjct  391  QNPQLDDS  398



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A   C N+ P L G   P  C
Sbjct  328  GTSGNKDAVKLLCSKGYPCKNVEIGDINIKYTGADGPATFSCSNVSPKLKGTQVPKAC  385



>ref|XP_002865611.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41870.1| hypothetical protein ARALYDRAFT_494865 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 33/58 (57%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS G PC  V +  + ++Y G +G A  +C N+ P L G   P  C
Sbjct  329  GTSGNKDAVKLLCSKGHPCQNVEVGDINIKYTGADGPATFQCSNVSPKLVGTQIPKAC  386



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            G+SAT +++K++CSSG PC  + L+ + L Y G  G+  S+C N+KPT+SG
Sbjct  338  GSSATALSLKIVCSSGSPCENMELADIDLTYSGAKGTLTSQCLNVKPTISG  388



>ref|XP_010480508.1| PREDICTED: exopolygalacturonase-like [Camelina sativa]
Length=332

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS+ KVAVK  CS   PC  V  S + L++ G +G AI+ C+N+K + +GK +P  C
Sbjct  273  GTSSNKVAVKFQCSKSFPCKNVHSSDINLKHNGVDGPAITLCENIKGSATGKMNPPHC  330



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLS  526
            G+SAT +AV+++CSSG+ C KV L  + L Y G  G   S+C N+KPT++
Sbjct  338  GSSATPLAVQIVCSSGIACEKVELDDIDLTYNGNKGPLTSQCSNVKPTIT  387



>ref|XP_010476857.1| PREDICTED: exopolygalacturonase-like isoform X1 [Camelina sativa]
 ref|XP_010476859.1| PREDICTED: exopolygalacturonase-like isoform X3 [Camelina sativa]
Length=402

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  KVAVK  CS   PC  V  S + L++KG +G AI+ C+N+K + +GK  P  C
Sbjct  343  GTSRNKVAVKFQCSKSFPCKNVHSSDINLKHKGVDGPAITLCENIKGSATGKMIPPHC  400



>ref|XP_010476858.1| PREDICTED: exopolygalacturonase-like isoform X2 [Camelina sativa]
Length=402

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  KVAVK  CS   PC  V  S + L++KG +G AI+ C+N+K + +GK  P  C
Sbjct  343  GTSRNKVAVKFQCSKSFPCKNVHSSDINLKHKGVDGPAITLCENIKGSATGKMIPPHC  400



>ref|XP_010482057.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 32/58 (55%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTS  K AVKLLCS   PC  V L  + ++Y G +G A  +C N+ P L G   P  C
Sbjct  329  GTSGNKDAVKLLCSKAHPCQNVELGNINIKYTGADGPATFQCSNVSPKLMGTQVPKAC  386



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            G+S T +AVKL+C++G+PC  V L+ + L Y G  G   S C N+KPT++G
Sbjct  338  GSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSNVKPTITG  388



>ref|XP_008231357.1| PREDICTED: exopolygalacturonase-like, partial [Prunus mume]
Length=308

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSG  523
            G+S T +AVKL+C++G+PC  V L+ + L Y G  G   S C N+KPT++G
Sbjct  238  GSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGPLTSMCSNVKPTITG  288



>ref|XP_009141290.1| PREDICTED: exopolygalacturonase-like [Brassica rapa]
Length=413

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 35/58 (60%), Gaps = 0/58 (0%)
 Frame = -2

Query  675  GTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNLKPTLSGKNSPAIC  502
            GTSAT+ A+ L CS   PC  V LS + L YKG NGS  + C+N+  ++ GK  P  C
Sbjct  353  GTSATQAALMLQCSKAFPCQGVELSDINLVYKGRNGSVTATCENVGGSVYGKIVPGDC  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1022319201388