BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25850_g1_i4 len=727 path=[8601:0-20 8622:21-44 8646:45-102
16046:103-126 16070:127-133 16077:134-134 16078:135-151
16095:152-161 10414:162-192 11302:193-219 10607:220-230
16207:231-235 16212:236-261 16238:262-278 16255:279-289
16266:290-291 15339:292-299 9208:300-330 16300:331-346 16316:347-348
16318:349-351 16321:352-371 16341:372-434 16438:435-435
16439:436-450 16455:451-455 16460:456-456 16461:457-457
16462:458-465 16708:466-480 16365:481-493 16378:494-504
16483:505-505 16484:506-514 2579:515-549 16545:550-552 2617:553-587
2652:588-621 16612:622-633 2698:634-681 2746:682-703 2768:704-713
2778:714-726]

Length=727
                                                                      Score     E

gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     197   6e-57   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    197   1e-56   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    196   2e-56   
gb|KCW88708.1|  hypothetical protein EUGRSUZ_A01063                     187   2e-55   
ref|XP_006279044.1|  hypothetical protein CARUB_v100165411mg            184   1e-54   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      188   3e-53   
dbj|BAH20364.1|  AT3G14040                                              184   7e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               187   9e-53   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               187   9e-53   
ref|XP_002884670.1|  exopolygalacturonase                               187   2e-52   
ref|XP_002885005.1|  polygalacturonase                                  186   3e-52   
ref|XP_002862616.1|  polygalacturonase                                  186   3e-52   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     186   5e-52   
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             186   6e-52   
emb|CAA51692.1|  exopolygalacturonase                                   185   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    184   1e-51   
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    185   1e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                      185   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                            185   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  180   1e-51   
ref|NP_187442.1|  polygalacturonase-like protein                        183   4e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51033.1|  exopolygalacturonase                                   183   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010112808.1|  hypothetical protein L484_020040                   182   5e-51   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    182   5e-51   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               181   9e-51   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    181   1e-50   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               181   1e-50   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               181   1e-50   
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               181   1e-50   
ref|XP_010657162.1|  PREDICTED: polygalacturonase                       179   2e-50   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    180   3e-50   Vitis vinifera
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               180   3e-50   
emb|CDY35967.1|  BnaA05g29830D                                          177   3e-50   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               179   4e-50   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               179   4e-50   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    179   5e-50   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    179   5e-50   
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             179   6e-50   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  179   6e-50   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               179   1e-49   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       178   1e-49   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  178   1e-49   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  178   2e-49   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    178   2e-49   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               179   2e-49   
ref|XP_010093135.1|  hypothetical protein L484_009327                   177   2e-49   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    178   3e-49   
emb|CBI22049.3|  unnamed protein product                                176   3e-49   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    177   3e-49   Vitis vinifera
ref|XP_007049259.1|  Polygalacturonase                                  177   4e-49   
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    178   5e-49   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    179   6e-49   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    177   6e-49   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    177   6e-49   
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               172   9e-49   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               176   1e-48   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               176   1e-48   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    176   2e-48   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    175   2e-48   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    175   2e-48   Vitis vinifera
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               175   2e-48   
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    176   2e-48   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               175   3e-48   
gb|ADK92878.1|  polygalacturonase                                       175   3e-48   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     174   7e-48   
dbj|BAA89476.1|  polygalacturonase                                      173   1e-47   Salix gilgiana
dbj|BAA89477.1|  polygalacturonase                                      173   1e-47   Salix gilgiana
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    172   2e-47   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  172   3e-47   
emb|CBI22050.3|  unnamed protein product                                172   4e-47   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    174   4e-47   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               171   7e-47   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             171   8e-47   
dbj|BAA89478.1|  polygalacturonase                                      171   8e-47   Salix gilgiana
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               171   9e-47   
emb|CBI22052.3|  unnamed protein product                                177   1e-46   
ref|XP_010112811.1|  hypothetical protein L484_020043                   170   1e-46   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    169   1e-46   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             171   1e-46   Populus trichocarpa [western balsam poplar]
emb|CBI28390.3|  unnamed protein product                                171   1e-46   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    170   2e-46   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               171   2e-46   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    170   2e-46   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               170   3e-46   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    169   3e-46   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               169   3e-46   
dbj|BAA89479.1|  polygalacturonase                                      169   5e-46   Salix gilgiana
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               169   5e-46   
ref|XP_010112809.1|  hypothetical protein L484_020041                   169   5e-46   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               168   7e-46   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    168   1e-45   
ref|XP_008449943.1|  PREDICTED: exopolygalacturonase-like               160   1e-45   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             167   1e-45   
gb|ADP09681.1|  polygalacturonase                                       168   1e-45   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    167   2e-45   Oenothera organensis
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  167   2e-45   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             167   2e-45   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               167   2e-45   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             167   2e-45   
emb|CDX74027.1|  BnaA03g30200D                                          168   2e-45   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    168   2e-45   
emb|CDX80531.1|  BnaC07g29130D                                          168   2e-45   
emb|CDY07972.1|  BnaC03g35510D                                          167   2e-45   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             169   2e-45   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               167   2e-45   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               167   2e-45   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    167   3e-45   Vitis vinifera
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               166   7e-45   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               165   1e-44   
gb|AAO24261.1|  putative pollen polygalacturonase                       165   1e-44   Turnera subulata [white alder]
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               165   1e-44   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               165   1e-44   
gb|ADC53480.1|  polygalacturonase                                       165   1e-44   Gossypium hirsutum [American cotton]
emb|CAN65676.1|  hypothetical protein VITISV_002011                     167   2e-44   Vitis vinifera
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  164   2e-44   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               164   2e-44   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  165   2e-44   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     164   4e-44   
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               163   4e-44   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  163   4e-44   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               163   6e-44   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               162   7e-44   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               163   8e-44   
emb|CDP04350.1|  unnamed protein product                                163   9e-44   
emb|CDP04343.1|  unnamed protein product                                162   1e-43   
emb|CDP04348.1|  unnamed protein product                                162   1e-43   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               162   1e-43   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               162   2e-43   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               162   2e-43   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  162   2e-43   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    162   2e-43   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               163   3e-43   
emb|CDP04342.1|  unnamed protein product                                159   4e-43   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               161   4e-43   
emb|CDP18013.1|  unnamed protein product                                161   4e-43   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     167   5e-43   Vitis vinifera
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  160   7e-43   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               160   8e-43   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               160   2e-42   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               160   2e-42   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               159   3e-42   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    158   3e-42
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       159   3e-42   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   158   4e-42   
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       158   5e-42   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               158   5e-42   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               158   8e-42   
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g            154   1e-41   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             157   1e-41   
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            153   2e-41   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    162   3e-41   
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    155   3e-41
gb|AFK41055.1|  unknown                                                 155   5e-41   
ref|XP_010112807.1|  hypothetical protein L484_020039                   155   5e-41   
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    157   5e-41   
emb|CDY35969.1|  BnaA05g29810D                                          157   5e-41   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               155   7e-41   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              155   8e-41   Ricinus communis
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    154   9e-41   Platanus x hispanica [London plane tree]
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  155   1e-40   
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    153   1e-40   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  154   1e-40   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    154   1e-40   Nicotiana tabacum [American tobacco]
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  154   2e-40   
emb|CAA50335.1|  polygalacturonase                                      154   2e-40   Nicotiana tabacum [American tobacco]
gb|KHN24677.1|  Polygalacturonase                                       154   2e-40   
emb|CDY28013.1|  BnaC05g44150D                                          155   2e-40   
gb|KDO36716.1|  hypothetical protein CISIN_1g036262mg                   148   3e-40   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    154   3e-40   
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  155   3e-40   
emb|CDY07973.1|  BnaC03g35500D                                          147   3e-40   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    153   4e-40   Gossypium hirsutum [American cotton]
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       152   5e-40   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  152   6e-40   
emb|CDP04347.1|  unnamed protein product                                146   8e-40   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  152   9e-40   
gb|KHN44923.1|  Polygalacturonase                                       149   1e-39   
gb|KHN15656.1|  Polygalacturonase                                       150   1e-39   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  151   2e-39   Ricinus communis
ref|XP_007143491.1|  hypothetical protein PHAVU_007G0764001g            146   2e-39   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    151   2e-39   Gossypium barbadense [Egyptian cotton]
ref|XP_009348297.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    147   2e-39   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  151   3e-39   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       150   3e-39   
gb|KHN46909.1|  Polygalacturonase                                       150   3e-39   
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       150   3e-39   
gb|KHN10402.1|  Polygalacturonase                                       149   4e-39   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               150   4e-39   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  150   4e-39   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  150   5e-39   
ref|XP_007143497.1|  hypothetical protein PHAVU_007G0766000g            146   5e-39   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  150   5e-39   
ref|XP_006492954.1|  PREDICTED: exopolygalacturonase-like               149   6e-39   
emb|CDY54512.1|  BnaC07g49180D                                          150   7e-39   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               150   7e-39   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  150   7e-39   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               150   7e-39   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             149   8e-39   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             149   1e-38   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               148   2e-38   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             148   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             148   2e-38   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               148   2e-38   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               148   3e-38   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               148   3e-38   
emb|CDY22139.1|  BnaC01g39620D                                          147   3e-38   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  148   3e-38   
gb|KHN40047.1|  Polygalacturonase                                       148   3e-38   
emb|CBI28400.3|  unnamed protein product                                142   3e-38   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    148   3e-38   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  147   4e-38   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    148   4e-38   Brassica napus [oilseed rape]
gb|ABE65925.1|  polygalacturonase/pectinase                             145   4e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDY22140.1|  BnaC01g39610D                                          147   5e-38   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               147   6e-38   
emb|CDY71093.1|  BnaCnng71300D                                          144   7e-38   
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  147   9e-38   
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               148   9e-38   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       146   1e-37   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  146   2e-37   
gb|ACP74159.1|  putative polygalacturonase                              146   2e-37   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       145   2e-37   
emb|CDX86325.1|  BnaA06g30420D                                          145   2e-37   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  145   2e-37   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  145   3e-37   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               145   3e-37   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  146   3e-37   
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  145   4e-37   
gb|ABR26683.1|  polygalacturonase                                       145   4e-37   Fragaria chiloensis
gb|ABE77145.1|  putative polygalacturonase                              145   4e-37   Fragaria x ananassa
gb|ABN13878.1|  polygalacturonase                                       145   4e-37   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  145   4e-37   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               145   4e-37   
dbj|BAC42591.1|  putative polygalacturonase                             140   4e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               145   5e-37   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  145   5e-37   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  144   5e-37   
emb|CDY07974.1|  BnaC03g35490D                                          144   5e-37   
ref|NP_187441.1|  polygalacturonase-like protein                        144   6e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ABL63521.1|  pollen-specific protein MF9l                            144   6e-37   Brassica oleracea var. alboglabra
ref|XP_003595656.1|  Polygalactorunase PG11                             144   6e-37   
gb|ABG38468.1|  pollen-expressed protein MF9c                           144   7e-37   Brassica oleracea
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             144   7e-37   
ref|XP_002884668.1|  polygalacturonase 3                                144   7e-37   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  147   8e-37   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               144   1e-36   
ref|XP_004154223.1|  PREDICTED: polygalacturonase-like                  136   1e-36   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  144   1e-36   
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  142   1e-36   
emb|CDY05701.1|  BnaC02g38360D                                          144   1e-36   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  144   1e-36   
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             144   1e-36   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             144   1e-36   
gb|AHL24657.1|  Sal k 6.01 allergen                                     143   1e-36   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    143   1e-36   
ref|XP_004174153.1|  PREDICTED: polygalacturonase-like                  136   1e-36   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             143   2e-36   
ref|NP_199625.1|  putative polygalacturonase / pectinase                143   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             143   2e-36   Brassica oleracea
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             143   2e-36   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               143   2e-36   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  143   2e-36   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    144   2e-36   
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               141   2e-36   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  143   2e-36   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        143   2e-36   Medicago sativa [alfalfa]
gb|KDP30863.1|  hypothetical protein JCGZ_13806                         135   2e-36   
gb|AAP42648.1|  polygalacturonase                                       142   3e-36   Brassica napus [oilseed rape]
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       142   3e-36   
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    142   3e-36   
gb|AAP37458.1|  polygalacturonase                                       142   4e-36   Fragaria x ananassa
ref|XP_008466943.1|  PREDICTED: polygalacturonase-like                  137   5e-36   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  142   5e-36   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             142   7e-36   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             142   7e-36   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  141   8e-36   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  142   8e-36   
ref|XP_010489712.1|  PREDICTED: polygalacturonase-like                  140   8e-36   
emb|CDY22137.1|  BnaC01g39640D                                          141   9e-36   
ref|XP_011097084.1|  PREDICTED: polygalacturonase-like                  138   1e-35   
ref|NP_187440.1|  polygalacturonase-like protein                        141   1e-35   
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  141   1e-35   
emb|CAA05892.1|  polygalacturonase                                      140   1e-35   
ref|NP_187439.1|  polygalacturonase-like protein                        140   1e-35   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  140   2e-35   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  140   2e-35   
gb|KHN43962.1|  Polygalacturonase                                       140   2e-35   
emb|CAA72003.1|  polygalacturonase                                      140   2e-35   
gb|AFK35534.1|  unknown                                                 140   2e-35   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             139   4e-35   
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               140   4e-35   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             140   4e-35   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  139   6e-35   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          139   6e-35   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    139   8e-35   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  139   1e-34   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  138   1e-34   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          138   1e-34   
ref|XP_006845391.1|  hypothetical protein AMTR_s00019p00057300          136   2e-34   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  137   2e-34   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  137   2e-34   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  137   2e-34   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          137   4e-34   
gb|AES65915.2|  polygalacturonase 11c, putative                         136   1e-33   
ref|XP_003595659.1|  Polygalactorunase PG11                             136   1e-33   
emb|CBI28398.3|  unnamed protein product                                128   2e-33   
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    135   2e-33   
ref|XP_006845390.1|  hypothetical protein AMTR_s00019p00055750          129   5e-33   
gb|ABY21306.1|  pollen allergen Pla o 2                                 133   6e-33   
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               130   7e-33   
ref|XP_009586577.1|  PREDICTED: exopolygalacturonase-like               129   2e-32   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  132   2e-32   
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  132   2e-32   
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       130   3e-32   
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  133   4e-32   
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               132   4e-32   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             130   6e-32   
ref|XP_008357340.1|  PREDICTED: exopolygalacturonase-like               126   6e-32   
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    131   8e-32   
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               130   9e-32   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                130   1e-31   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               130   1e-31   
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               130   2e-31   
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               129   2e-31   
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               129   2e-31   
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                129   2e-31   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                129   3e-31   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                129   3e-31   
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             129   4e-31   
gb|ACU19275.1|  unknown                                                 121   4e-31   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  128   4e-31   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               128   6e-31   
emb|CAA40803.1|  polygalacturonase                                      123   6e-31   
ref|XP_009409865.1|  PREDICTED: exopolygalacturonase-like               128   6e-31   
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               128   6e-31   
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    128   6e-31   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                128   7e-31   
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    128   8e-31   
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          127   9e-31   
emb|CBM42665.1|  group 13 grass pollen allergen                         122   1e-30   
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    127   1e-30   
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          127   1e-30   
emb|CBM42664.1|  group 13 grass pollen allergen                         122   1e-30   
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  127   1e-30   
gb|EPS61275.1|  polygalacturonase                                       124   2e-30   
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               127   2e-30   
ref|XP_010645672.1|  PREDICTED: exopolygalacturonase                    125   2e-30   
ref|XP_006848769.1|  hypothetical protein AMTR_s00026p00071010          123   3e-30   
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    126   3e-30   
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               126   3e-30   
gb|AFW76324.1|  hypothetical protein ZEAMMB73_136411                    123   3e-30   
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               126   3e-30   
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               126   3e-30   
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             126   3e-30   
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               126   3e-30   
emb|CDY01524.1|  BnaC07g35140D                                          125   5e-30   
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              125   6e-30   
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               125   7e-30   
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               125   1e-29   
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         124   1e-29   
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       125   1e-29   
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         124   1e-29   
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               124   1e-29   
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         124   2e-29   
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             124   2e-29   
gb|AAX45476.1|  polygalacturonase                                       124   2e-29   
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               124   2e-29   
gb|AFS18538.1|  PG2                                                     119   2e-29   
ref|NP_001057816.2|  Os06g0545800                                       121   2e-29   
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    124   3e-29   
ref|XP_002438669.1|  hypothetical protein SORBIDRAFT_10g024000          119   3e-29   
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           124   3e-29   
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             124   3e-29   
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               122   3e-29   
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               123   3e-29   
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               124   3e-29   
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          123   3e-29   
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           123   3e-29   
emb|CAA16789.1|  polygalacturonase-like protein                         122   3e-29   
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    123   3e-29   
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               123   4e-29   
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               123   4e-29   
ref|XP_004967188.1|  PREDICTED: exopolygalacturonase-like               119   4e-29   
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like               123   4e-29   
gb|AFW76553.1|  hypothetical protein ZEAMMB73_007553                    121   6e-29   
pir||S16998  polygalacturonase (EC 3.2.1.15) - maize                    122   6e-29
emb|CDX90415.1|  BnaA03g43660D                                          122   6e-29   
gb|KDO50514.1|  hypothetical protein CISIN_1g040962mg                   120   6e-29   
emb|CAA40910.1|  polygalacturonase                                      122   7e-29   
ref|NP_001105432.1|  exopolygalacturonase precursor                     122   7e-29   
dbj|BAJ88053.1|  predicted protein                                      122   8e-29   
emb|CDX88444.1|  BnaC06g38880D                                          122   8e-29   
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               122   8e-29   
emb|CDP04349.1|  unnamed protein product                                119   9e-29   
ref|XP_006342403.1|  PREDICTED: exopolygalacturonase-like               121   9e-29   
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    122   1e-28   
gb|ABD79098.1|  Zea m 13 allergen                                       122   1e-28   
ref|XP_008650471.1|  PREDICTED: exopolygalacturonase-like               121   1e-28   
ref|XP_008649075.1|  PREDICTED: exopolygalacturonase-like               121   1e-28   
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                121   2e-28   
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    121   2e-28   
ref|XP_011032297.1|  PREDICTED: polygalacturonase-like                  121   2e-28   
emb|CBI22963.3|  unnamed protein product                                121   2e-28   
gb|EEC83381.1|  hypothetical protein OsI_28796                          118   2e-28   
ref|XP_008450474.1|  PREDICTED: polygalacturonase-like                  119   2e-28   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               120   2e-28   
gb|AFW76316.1|  hypothetical protein ZEAMMB73_878249                    118   2e-28   
ref|XP_002318410.2|  hypothetical protein POPTR_0012s02090g             117   3e-28   
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               120   3e-28   
emb|CBI23356.3|  unnamed protein product                                120   3e-28   
ref|XP_010646462.1|  PREDICTED: polygalacturonase                       120   3e-28   
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               120   3e-28   
ref|XP_010676050.1|  PREDICTED: polygalacturonase-like                  120   3e-28   
emb|CBM42666.1|  group 13 grass pollen allergen                         116   3e-28   
ref|XP_007143496.1|  hypothetical protein PHAVU_007G0766000g            115   3e-28   
emb|CAA46680.1|  polygalacturonase                                      120   3e-28   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               120   3e-28   
sp|P35338.1|PGLR2_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    120   3e-28   
gb|ACN85300.1|  exopolygalacturonase precursor                          120   3e-28   
emb|CAA40851.1|  polygalacturonase                                      120   4e-28   
ref|XP_010099972.1|  hypothetical protein L484_014009                   120   4e-28   
emb|CDY23765.1|  BnaC04g43570D                                          120   4e-28   
ref|XP_007043097.1|  Pectin lyase-like superfamily protein isoform 3    120   4e-28   
emb|CBM42667.1|  group 13 grass pollen allergen                         115   4e-28   
ref|XP_004974902.1|  PREDICTED: exopolygalacturonase-like               120   4e-28   
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               120   5e-28   
ref|NP_001057815.1|  Os06g0545400                                       120   5e-28   
gb|EAZ01276.1|  hypothetical protein OsI_23299                          120   5e-28   
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               120   5e-28   
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             119   6e-28   
ref|XP_004172677.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    115   6e-28   
emb|CDY52447.1|  BnaA07g39240D                                          119   6e-28   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               119   6e-28   
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    119   7e-28   
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    119   7e-28   
ref|XP_004289111.1|  PREDICTED: exopolygalacturonase-like               119   7e-28   
gb|AEK28685.1|  pectin lyase superfamily protein                        114   7e-28   
ref|XP_002300425.2|  hypothetical protein POPTR_0001s38690g             118   9e-28   
ref|XP_010092712.1|  hypothetical protein L484_024607                   119   9e-28   
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               119   9e-28   
emb|CDP06168.1|  unnamed protein product                                119   9e-28   
emb|CBI21720.3|  unnamed protein product                                112   1e-27   
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               119   1e-27   
ref|XP_009417454.1|  PREDICTED: exopolygalacturonase-like               119   1e-27   
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                119   1e-27   
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    119   1e-27   
gb|AFW76317.1|  hypothetical protein ZEAMMB73_878249                    118   1e-27   
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                  118   1e-27   
emb|CBI28395.3|  unnamed protein product                                111   2e-27   
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          119   2e-27   
ref|XP_004248938.2|  PREDICTED: exopolygalacturonase-like               118   2e-27   
emb|CAN69218.1|  hypothetical protein VITISV_012014                     121   2e-27   
ref|XP_002314146.2|  hypothetical protein POPTR_0009s04300g             118   2e-27   
gb|EPS62269.1|  hypothetical protein M569_12521                         115   2e-27   
gb|EEE68484.1|  hypothetical protein OsJ_26895                          117   3e-27   
ref|NP_001061556.1|  Os08g0327200                                       118   3e-27   
gb|KDO71757.1|  hypothetical protein CISIN_1g0399591mg                  112   3e-27   
gb|EMT18530.1|  Exopolygalacturonase                                    117   4e-27   
ref|XP_009343653.1|  PREDICTED: polygalacturonase-like                  117   4e-27   
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               117   4e-27   
ref|XP_007050989.1|  Polygalacturonase 4, putative                      117   4e-27   
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     117   4e-27   
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               117   4e-27   
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               117   5e-27   
dbj|BAK06865.1|  predicted protein                                      117   6e-27   
ref|XP_010649600.1|  PREDICTED: exopolygalacturonase-like               117   6e-27   
ref|XP_008226942.1|  PREDICTED: polygalacturonase-like                  117   6e-27   
ref|XP_010547006.1|  PREDICTED: exopolygalacturonase-like               117   6e-27   
ref|NP_001105862.1|  exopolygalacturonase precursor                     116   8e-27   
ref|XP_008649072.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
ref|XP_008337179.1|  PREDICTED: polygalacturonase-like                  113   1e-26   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
ref|XP_010910801.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
gb|AAQ62998.1|  oil palm polygalacturonase allergen PEST459             116   1e-26   
ref|XP_008366452.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
ref|XP_008349920.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
ref|XP_009364676.1|  PREDICTED: exopolygalacturonase-like               114   1e-26   
gb|EMT18006.1|  putative Exopolygalacturonase                           116   1e-26   
gb|KGN56260.1|  hypothetical protein Csa_3G110080                       113   1e-26   
ref|XP_008649079.1|  PREDICTED: exopolygalacturonase-like               116   1e-26   
emb|CAB42886.1|  polygalacturonase                                      115   1e-26   
gb|AFW76326.1|  hypothetical protein ZEAMMB73_463400                    116   1e-26   
ref|XP_006659306.1|  PREDICTED: exopolygalacturonase-like               115   2e-26   
sp|P35339.1|PGLR3_MAIZE  RecName: Full=Exopolygalacturonase; Shor...    115   2e-26   
gb|EAZ22092.1|  hypothetical protein OsJ_05753                          113   2e-26   
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               115   2e-26   
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               115   2e-26   
ref|XP_003563839.1|  PREDICTED: exopolygalacturonase-like               115   2e-26   
ref|NP_001284460.1|  polygalacturonase-like precursor                   115   2e-26   
ref|XP_010327493.1|  PREDICTED: exopolygalacturonase-like               113   2e-26   
gb|ACN85328.1|  exopolygalacturonase precursor                          115   2e-26   
gb|EMT18622.1|  putative Exopolygalacturonase                           114   3e-26   
ref|XP_004139060.1|  PREDICTED: polygalacturonase-like                  115   3e-26   
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             114   3e-26   
gb|EMS46493.1|  Exopolygalacturonase                                    114   4e-26   
gb|EMT24489.1|  Exopolygalacturonase                                    113   4e-26   
gb|EAZ01274.1|  hypothetical protein OsI_23298                          114   4e-26   
emb|CBI32893.3|  unnamed protein product                                108   4e-26   



>gb|KCW46857.1| hypothetical protein EUGRSUZ_K00661 [Eucalyptus grandis]
Length=370

 Score =   197 bits (500),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++NC L NTM G+R+KTWP SP GVA+ MHFED+ ++NVSTPILIDQ YCP+
Sbjct  226  EQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILIDQNYCPY  285

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C+  +PSKVKISDVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A
Sbjct  286  NNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTA  345

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C+NVKPT++GK S  IC
Sbjct  346  TSQCENVKPTIAGKLSLPIC  365



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 110/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V +++C + NTM GVRIKTWPASP G+A+ +HFED+ M+NV TPIL+DQ+YCP+
Sbjct  259  EQPVRGVHVRHCTISNTMNGVRIKTWPASPAGIASNLHFEDIVMENVGTPILVDQEYCPY  318

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CK G PS VKISDVSFK I GTS+TK AVKL+CS GVPC+KV LS + L Y G +G A
Sbjct  319  NHCKRGSPSMVKISDVSFKNIRGTSSTKTAVKLVCSKGVPCSKVELSDINLTYNGKDGPA  378

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +SEC NVKP LSGK  PA C
Sbjct  379  VSECANVKPILSGKIIPAAC  398



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   196 bits (498),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++NC L NTM G+R+KTWP SP GVA+ MHFED+ ++NVSTPILIDQ YCP+
Sbjct  263  EQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILIDQNYCPY  322

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C+  +PSKVKISDVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A
Sbjct  323  NNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTA  382

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C+NVKPT++GK S  IC
Sbjct  383  TSQCENVKPTIAGKLSLPIC  402



>gb|KCW88708.1| hypothetical protein EUGRSUZ_A01063 [Eucalyptus grandis]
Length=174

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + +KNC +  TM G+RIKTWPASP G A+ MHFED+ +DNV  P++IDQQYCPW
Sbjct  25   EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  84

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK+  PS++KIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  85   NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  144

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKPT+SGK +PAIC
Sbjct  145  TSVCSNVKPTISGKQNPAIC  164



>ref|XP_006279044.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
 gb|EOA11942.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
Length=168

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP GVA+ + FED+ MDNVSTP+LIDQ+YCP+
Sbjct  21   EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLIDQEYCPY  80

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  81   GHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  140

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP L+GK  PA C
Sbjct  141  VSACSNIKPVLTGKLVPAAC  160



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +++++C + NTMFGVRIKTWPAS +G+A+ M FE++ MDNV TPILIDQQYCP+
Sbjct  258  EKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIVMDNVGTPILIDQQYCPY  317

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              C   VPS+V+ISDV FK I GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+A
Sbjct  318  GTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTA  377

Query  366  ISECDNVKPTLSGKNSPAIC  307
            ISEC NVKP + G+  P  C
Sbjct  378  ISECSNVKPAVVGRVVPPAC  397



>dbj|BAH20364.1| AT3G14040 [Arabidopsis thaliana]
Length=289

 Score =   184 bits (466),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  142  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  201

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  202  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  261

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  262  VSACSNIKPILSGKLVPAAC  281



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + +KNC +  TM G+RIKTWPASP G A+ MHFED+ +DNV  P++IDQQYCPW
Sbjct  252  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK+  PS++KIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  312  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKPT+SGK +PAIC
Sbjct  372  TSVCSNVKPTISGKQNPAIC  391



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   187 bits (474),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + +KNC +  TM G+RIKTWPASP G A+ MHFED+ +DNV  P++IDQQYCPW
Sbjct  252  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK+  PS++KIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  312  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKPT+SGK +PAIC
Sbjct  372  TSVCSNVKPTISGKQNPAIC  391



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  362  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  421

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  422  VSACSNIKPILSGKLVPAAC  441



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + G  G A
Sbjct  362  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPA  421

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  422  VSACSNIKPILSGKLVPAAC  441



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  357

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPA  417

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + +KNC +  TM G+RIKTWPASP G A+ MHFED+ +DNV  P++IDQQYCPW
Sbjct  317  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  376

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK+  PS++KIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  377  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  436

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKPT+SGK +PAIC
Sbjct  437  TSVCSNVKPTISGKQNPAIC  456



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP GVA+ + FED+ MDNVSTP+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  362  GHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  421

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP L+GK  PA C
Sbjct  422  VSACSNIKPVLTGKLVPAAC  441



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   185 bits (469),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVST-PILIDQQYCP  550
            EQPV+ V+++ C++ NT  GVRIKTWPASP GVA+ +HFED+ MDNV T P+L+DQ+YCP
Sbjct  254  EQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLVDQEYCP  313

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGT-NG  373
            + QC+A +PSKVKIS+VSFK I GT+   VAVKL+CS G+PC  V ++ + L Y G  NG
Sbjct  314  YGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTYNGNKNG  373

Query  372  SAISECDNVKPTLSGKNSPAIC  307
            +AISEC NVKPT+SG N P +C
Sbjct  374  TAISECANVKPTVSGFNHPQVC  395



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>ref|XP_004171844.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=256

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVEDV +KNC +INT  GVRIKTWP SP  G+AT MHF D+ M NVS PI+IDQ+YCP
Sbjct  107  EEPVEDVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPIVIDQEYCP  166

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI+ VSFK I G+SAT VAVKL+CSS +PC +V LS + L Y G  GS
Sbjct  167  WNQCNRKIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKLSNIDLIYNGIKGS  226

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP + G  +P IC
Sbjct  227  ITSQCMNVKPIIYGIQNPPIC  247



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  356

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  357  GHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  416

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  417  VSACSNIKPILSGKLVPAAC  436



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVS P+LIDQ+YCP+
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  356

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  357  GHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  416

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  PA C
Sbjct  417  VSACSNIKPILSGKLVPAAC  436



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PVE V ++NC + NT  GVR+KTWP S +G+A+ +HFED+ M+NV  P+LIDQ+YCPW
Sbjct  253  EDPVEGVIVRNCTIRNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPW  312

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC A VPS++KISDVSFK I GTS T +AV L+CSSG PC  V ++ + L+Y G +G  
Sbjct  313  NQCNAKVPSRIKISDVSFKNIRGTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPI  372

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C NVKPT+SGK +P  C
Sbjct  373  MSQCKNVKPTISGKQNPNPC  392



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +++++C + NTMFGVRIK+WPAS +G+A+ M FE + M+NV TPILIDQQYCP+
Sbjct  257  EKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILIDQQYCPY  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              C   +PS+V+IS+V FK I GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+A
Sbjct  317  GTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTA  376

Query  366  ISECDNVKPTLSGKNSPAIC  307
            ISEC NVKP ++G   P  C
Sbjct  377  ISECSNVKPAIAGSVVPPAC  396



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V +KNC ++NT  GVRIKTWPASP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFLDITMVNVSNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PSK+KI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  316  WNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              SEC NVKP +SG  +P IC
Sbjct  376  LTSECMNVKPIISGTQNPPIC  396



>ref|XP_010657162.1| PREDICTED: polygalacturonase [Vitis vinifera]
Length=336

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  196  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  255

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY G +G A
Sbjct  256  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPA  315

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C N+KP + G   P IC
Sbjct  316  MSQCKNIKPNVLGAQLPRIC  335



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V +KNC +INT  GVRIKTWP SP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI+ VSF+ I G+SAT VAVKL+CSS +PC++V ++ + L Y G NGS
Sbjct  316  WNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDEVKVANIDLIYNGINGS  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SG  +P+IC
Sbjct  376  ITSQCMNVKPIISGIQNPSIC  396



>emb|CDY35967.1| BnaA05g29830D [Brassica napus]
Length=293

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTPILIDQ+YCP+
Sbjct  146  EQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILIDQEYCPY  205

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+FK I GTSATK AVKL+CS G PC  V L+ + L + G  G A
Sbjct  206  ADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPA  265

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +  C N+KP L+G+  P  C
Sbjct  266  VGACANMKPVLTGQMIPPAC  285



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            +QCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            +QCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++NC L NT  GVRIKTWPASP GVA+ ++FED+ M+NVS PILIDQ+YCP+
Sbjct  254  EQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQEYCPY  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C A VPS+VKISDV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+
Sbjct  314  NNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLVYNGKEGSS  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP +SGK  PA C
Sbjct  374  TSLCANVKPQVSGKVFPATC  393



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            ++PV  +++ NC LINT  GVR+KTWPAS EG+A+ MHFED+ M NVS P+LIDQ+YCP 
Sbjct  257  DEPVFGINVVNCALINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPS  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C    PS+VKIS+VSFK I GTSAT+VAVKL CSSG+PC  V +  + L Y GT G A
Sbjct  317  NKCNLKAPSRVKISNVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPA  376

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKPT++G+ +P  C
Sbjct  377  TSQCSNVKPTIAGRQTPLAC  396



>ref|XP_006375551.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
 gb|ERP53348.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
Length=387

 Score =   179 bits (453),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++NC L NT  GVRIKTWPASP GVA+ ++FED+ M+NVS PILIDQ+YCP+
Sbjct  244  EQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQEYCPY  303

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C A VPS+VKISDV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+
Sbjct  304  NNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVSVEDINLVYNGKEGSS  363

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP +SGK  PA C
Sbjct  364  TSLCANVKPQVSGKVFPATC  383



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV+DV +KNC ++NT  GVRIKTWP+SP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  257  EEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHFSDITMINVSNPILIDQEYCP  316

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  317  WNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGP  376

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SG  +P+IC
Sbjct  377  VTSQCMNVKPIISGIQNPSIC  397



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV+DV +KNC ++NT  G+RIKTWP+SP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  256  EEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMHFSDITMVNVSNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  316  WNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNKPCEEVKVANIDLVYNGINGP  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SG  +P+IC
Sbjct  376  VTSQCMNVKPIISGIQNPSIC  396



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V + NC +INT  GVRIKTWPASP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  255  EEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  315  WNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              SEC NVKP +SG  +P IC
Sbjct  375  ITSECMNVKPIISGIQNPPIC  395



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V + NC +INT  GVRIKTWPASP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  255  EEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  315  WNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              SEC NVKP +SG  +P IC
Sbjct  375  ITSECMNVKPIISGIQNPPIC  395



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V +KNC ++NT  GVRIKTWPASP  G+AT MHF D+ M NVS PILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITMVNVSNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  316  WNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGP  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SG  +P+IC
Sbjct  376  ITSQCMNVKPIVSGIQNPSIC  396



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V +KNC ++NT  GVRIKTW ASP  G+A  MHF D+ M NVS PILIDQ+YCP
Sbjct  253  EEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINVSNPILIDQEYCP  312

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PSK+KI+ VSFK I G SAT VAVKL+CSS +PC +V ++ + L Y GT GS
Sbjct  313  WNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVANIDLVYNGTKGS  372

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP LSG  +P+IC
Sbjct  373  ITSQCMNVKPILSGIQNPSIC  393



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE V + NC +I    GVRIKTWPAS  G A+ MHFED++MDNV  P+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            +QCKAGVPS +KIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391


 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  537  KAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISE  358
            K  +P+KVKISDVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG+A S+
Sbjct  393  KPHIPTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQ  452

Query  357  CDNVKPTLSGKNSPAIC  307
            C NVKPT++GK+S  +C
Sbjct  453  CANVKPTITGKSSLPLC  469



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V+ V +K+C L NT  GVRIKTWP S  G A+ MHFED+++DNV  PI+IDQ+YCPW
Sbjct  251  EEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIVIDQEYCPW  310

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C A V S+VK+S++SFK I G+S+T VAVKL+CS G PC  V LS + L YKG+ G+ 
Sbjct  311  NKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLSYKGSEGAI  370

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP LSGK +P  C
Sbjct  371  TSECKNVKPILSGKENPRAC  390



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP 
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  356

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  357  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALADINLVHNGKEGPA  416

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  P  C
Sbjct  417  VSACSNIKPVLSGKLVPEAC  436



>emb|CBI22049.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  195  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  254

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY G +G A
Sbjct  255  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPA  314

Query  366  ISECDNVKPTLSGKNSPAI  310
            +S+C N+KP + G   P I
Sbjct  315  MSQCKNIKPNVLGAQLPRI  333



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + ++NC L NTM GVR+KTWP S  G AT MHFED+ ++NV  PILIDQ+YCPW
Sbjct  257  EEPVSGIFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPW  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C   VPS++K+S++SFK+I GTS+T+ AV+L+CS G+PC++V L+ + + YKG  G A
Sbjct  317  NLCNLKVPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPA  376

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKP  SGK +P  C
Sbjct  377  TSECTNVKPRTSGKQNPPAC  396



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTPILIDQ+YCP+
Sbjct  329  EQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILIDQEYCPY  388

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CKAGVPSKVK+SDV+FK I GTSATK AVKL+CS G PC  V L+ + L + G  G A
Sbjct  389  ADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPA  448

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +  C N+KP L+G+  P  C
Sbjct  449  VGACANMKPVLTGQMIPPAC  468



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + I+NC + NTM GVR+KTWP S  G AT MHFED+ ++NV  PILIDQ+YCPW
Sbjct  257  EEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPW  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C   VPS+VK+S++SFK+I GTS+T+ AVKL+CS G+PC++V L+ + + YKG  G A
Sbjct  317  NLCNLKVPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDRVELADIDITYKGPGGPA  376

Query  366  ISECDNVKPTLSGKNSPAIC  307
            IS+C NVKP LSGK +P  C
Sbjct  377  ISQCINVKPRLSGKQNPPAC  396



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP 
Sbjct  297  EQPVRGVTVRKCTIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  356

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS G PC  + LS + L + G  G A
Sbjct  357  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALSDINLVHNGKEGPA  416

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP ++GK  P  C
Sbjct  417  VSACSNIKPVITGKLIPEAC  436



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP 
Sbjct  292  EQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPH  351

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CKAGVPS+VK+SDV+ K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  352  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPA  411

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  P  C
Sbjct  412  VSACSNIKPILSGKLVPEAC  431



>ref|XP_004174175.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis sativus]
Length=261

 Score =   172 bits (436),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKLINT  GVRIKTWP S    +A+ MHFED+ M NVS P++IDQ+YCP
Sbjct  109  EKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  168

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  169  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  228

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +SEC NV+P ++GK SP IC
Sbjct  229  ILSECANVQPLITGKQSPQIC  249



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + +KNC L NT  GVRIKTWPASP +G+A+ MHFED+ M NVS P+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQCK  VPSKVKIS+VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y G  G 
Sbjct  315  WNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGP  374

Query  369  AISECDNVKPTLS  331
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + +KNC L NT  GVRIKTWPASP +G+A+ MHFED+ M NVS P+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQCK  VPSKVKIS+VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y G  G 
Sbjct  315  WNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGP  374

Query  369  AISECDNVKPTLS  331
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVST-PILIDQQYCP  550
            EQPV  V+++NC + NT  GVR+KTWPASP GVA+ +HFED+ M+NV T P+LIDQ+YCP
Sbjct  255  EQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
              QC+A +PSKVKIS+VSFK I GTSA  V VKL CS G+PC  V +S + L Y G NG+
Sbjct  315  NGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQISDIHLTYNGKNGA  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A S C NVKPT++G+  P  C
Sbjct  375  ATSVCTNVKPTMTGQIFPPAC  395



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  +++ NC LINT  GVR+KTWPAS EG+A+ MHFED+ M NVS P+LIDQ+YCP 
Sbjct  257  EDPVFGITVANCTLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPG  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C A  PS+VKIS+VSFK I GTSAT+VAV+L CSSG+PC  V +  + L Y GT G A
Sbjct  317  NKC-AKAPSRVKISNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPA  375

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP ++GK +P  C
Sbjct  376  TSRCSNVKPIITGKQTPLAC  395



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KT+PAS +G+A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++K+S+VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A
Sbjct  315  NQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V + NC +     GVRIKTWPAS  G+AT MHFED++M+NV  P+LIDQ YCPW
Sbjct  251  EEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPW  310

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC+A +PS VKIS+VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  311  NQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  370

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NV+P +SG  +P  C
Sbjct  371  TSECSNVRPLISGMQNPRAC  390



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNVSTP+LIDQ+YCP 
Sbjct  292  EQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  351

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CKAGVPS+VK+SDV  K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  352  GKCKAGVPSQVKLSDVIIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPA  411

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP LSGK  P  C
Sbjct  412  VSACSNIKPILSGKLVPEAC  431



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + +KNC L NT  GVRIKTWPASP +G+A+ MHFED+ M NVS P+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQCK  VPSK+KIS+VSFK I G+SAT +AV+++CSSG+ C KV L  + L Y G  G 
Sbjct  315  WNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLTYNGNKGP  374

Query  369  AISECDNVKPTLS  331
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  +++KNC L +TM GVRIKTWPASP G+A+ M FE++ M+NVS PI+IDQQYCP+
Sbjct  254  EQPVVGITVKNCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMIDQQYCPY  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            +QC+A +PS+VKISDVSF  I GTSAT++AVKL+CS G+PC  V +  + L Y    G A
Sbjct  314  SQCEAKIPSRVKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYN--KGQA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP + G   PA C
Sbjct  372  TSQCANVKPQVRGSVVPAPC  391



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V + NC +     GVRIKTWPAS  G+AT MHFED++M+NV  P+LIDQ YCPW
Sbjct  251  EEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPW  310

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC+A +PS VKIS+VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  311  NQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  370

Query  366  ISECDNVKPTLSGKNSPAICD  304
             SEC NV+P +SG  +P   D
Sbjct  371  TSECSNVRPLISGMQNPRAYD  391



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + NT  GVRIK+WP    GVA+ MHFED+ M+NV  PIL+DQ YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLVYSGSEGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPKISGIMSASGC  393



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + NT  GVRIK+WP    GVA+ MHFED+ M+NV  PIL+DQ YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLLYSGSEGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPKISGIMSASGC  393



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKLINT  GVRIKTWP S    +A+ MHFED+ M NVS P++IDQ+YCP
Sbjct  245  EKDVVGVTVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  305  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +SEC NV+P ++GK SP IC
Sbjct  365  ILSECANVQPLITGKQSPQIC  385



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKLINT  GVRIKTWP S    +A+ MHFED+ M NVS P++IDQ+YCP
Sbjct  245  EKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  305  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +SEC NV+P ++GK SP IC
Sbjct  365  ILSECANVQPLITGKQSPQIC  385



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPA  374

Query  366  ISECDNVKPTLSG  328
            +S+C N+KP L G
Sbjct  375  MSQCKNIKPNLLG  387



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+P++ V ++ C + NT  GVRIKTWP SP G+A+ + FED+ MDNV+TPILIDQ+YCP 
Sbjct  359  EEPLKGVVVRKCIIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVTTPILIDQEYCPH  418

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CKAGVPSKVK+SDV+FK I GTSA+K+AVK++CS G PC  + L+ + L   G  G A
Sbjct  419  GKCKAGVPSKVKLSDVTFKNIKGTSASKIAVKIICSKGCPCTNIALTDINLVSSGKEGPA  478

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C N+KP +SGK  PA C
Sbjct  479  VSACANMKPVVSGKVVPAAC  498



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   171 bits (433),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG PC KV L+ + L YKG  G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+G  G A
Sbjct  314  NQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   171 bits (432),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + NT  GVRIK+WP    G A+ MHFED+ M+NV  P+++DQ+YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V VKL CS G+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKSPSKVKISDVSFKNIRGTSATPVVVKLACSGGIPCEKVELADINLVYSGSEGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKPT+SG  S + C
Sbjct  374  KSQCSNVKPTISGIMSASGC  393



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV +++I+NC + NT  GVR+KTW  S E   T ++FED+ ++NV  P+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  325

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVKISD+ FK + G S+ K AVKL+CS GVPC+KV L+ + L+Y GT+G A
Sbjct  326  NHCKAKTPSKVKISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPA  385

Query  366  ISECDNVKPTLSGKNSPAICD  304
            +S C  VKP L+GK SP  CD
Sbjct  386  VSMCKFVKPLLTGKQSPPACD  406



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++KIS+VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPA  374

Query  366  ISECDNVKPTLSGKNSPAI  310
            +S+C N+KP L G   P I
Sbjct  375  MSQCKNIKPNLLGVQLPRI  393



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV+ + +  C L NT+ GVRIKTWP S  G A+ +HF D+ M+NV  P+LIDQ+YCPW
Sbjct  251  ELPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLIDQEYCPW  310

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   VPSKVK+S++SFK+I GTS+T +AV L+CSSG PC  VV+  + L+Y G+ G  
Sbjct  311  NQCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPI  370

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKPT+ G  +PA C
Sbjct  371  TSKCKNVKPTVGGVQNPAAC  390



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV +++I+NC + NT  GVR+KTW  S E   T ++FED+ ++NV  P+++DQ+YCPW
Sbjct  217  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  276

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVKISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A
Sbjct  277  NHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPA  336

Query  366  ISECDNVKPTLSGKNSPAICD  304
            +S C  VKP L+GK SP  CD
Sbjct  337  VSMCKFVKPLLTGKQSPPACD  357



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  295  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  354

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+G  G A
Sbjct  355  NQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPA  414

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  415  KSQCSNVKPIISGIMSASGC  434



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC L NT  GVR+KT+PAS +G+A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS++K+S+VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A
Sbjct  315  NQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPA  374

Query  366  ISECDNVKPTLSGK  325
            +S+C N+KP L G+
Sbjct  375  MSQCKNIKPNLLGQ  388



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  +S+KNC   NT  GVR+KTWPAS +G A+ MHFED+ M+NV  PI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PS++ +S+VSF+ I GT++T+VAVKL+CS GVPC    L  + L+Y G  G A
Sbjct  315  NQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDINLKYNGKVGHA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C N+KP L G   P  C
Sbjct  375  MSQCKNIKPNLLGTQLPRTC  394



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE + +KNC L  T  G+RIKTWPASP  GVA+ MH+EDV M+NV  PILIDQ+YCP
Sbjct  277  EEPVEGLQVKNCTLTGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCP  336

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            +NQC   VPSKVKIS VSFK I GTS    AV L+CSS  PC+ V L+ + L Y G+ G 
Sbjct  337  YNQCNKQVPSKVKISKVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGP  396

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NVKPT+SGK +P  C
Sbjct  397  ITSRCANVKPTVSGKQNPPAC  417



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  + +KNC L +T  GVR+KTWP+SP+G AT MHF D+ M+NVS PI+IDQ+YCP 
Sbjct  253  EAPVIGIRVKNCTLSDTTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  312

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PS+VK+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  313  NQCNLQIPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  372

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NV+ TL G   P  C
Sbjct  373  SSQCKNVEATLWGTQQPKTC  392



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV +++I+NC + NT  GVR+KTW  S E   T ++FED+ ++NV  P+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  325

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVKISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A
Sbjct  326  NHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPA  385

Query  366  ISECDNVKPTLSGKNSPAICD  304
            +S C  VKP L+GK SP  CD
Sbjct  386  VSMCKFVKPLLTGKQSPPACD  406



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVST-PILIDQQYCP  550
            EQPV  V+++NC + NT  GVR+KTWPASP GVA+ +HFED+ M+NV+T P+LIDQ+YCP
Sbjct  255  EQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
              QC+A +PS+VKIS+VSFK I GTSA  VAVKL CS G+PC  V +S + L   G NG+
Sbjct  315  NGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISDINLTCNGKNGT  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NV PT++GK  P  C
Sbjct  375  CTSVCSNVNPTVTGKVIPPAC  395



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  ++IKNC L +T  GVRIKTWPASP  G A+ +HFED+ M NV  PILIDQ+YCP
Sbjct  255  EEPVSGITIKNCTLTDTQNGVRIKTWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSKVKIS+VSFK I GTS T +A+KL+CS G+PC  V LS + L+Y G  G 
Sbjct  315  WNQCTLKVPSKVKISNVSFKNIKGTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGP  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP ++    P  C
Sbjct  375  LTSKCTNVKPKITRVTKPLAC  395



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC + NT  GVRIK+WP    G A+ MHFED+ M+NV  P+ +DQ+YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELADINLVYSGSEGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV +++I+NC + NT  GVR+KTW  S E   T ++FED+ ++NV  P+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCIIKNTDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVDQEYCPW  325

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVKISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G  G A
Sbjct  326  NHCKARTPSKVKISDIRFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPA  385

Query  366  ISECDNVKPTLSGKNSPAICD  304
            +S C  VKP L+GK SP  CD
Sbjct  386  VSMCKFVKPLLTGKQSPPACD  406



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V+ V +K+C L NT  GVRIKTWP S EG A+ +HFED+ M+NV  P++IDQ+YCPW
Sbjct  255  EEAVKGVDVKSCTLKNTQNGVRIKTWPDSQEGKASDLHFEDIIMENVGNPVMIDQEYCPW  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC + +PS+V+IS V FK I GTS+T +AVKL+CS G+PC  V ++ + L+Y G  G  
Sbjct  315  NQCVSQLPSRVQISGVRFKNIRGTSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQI  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NVKPT+SG  +P  C
Sbjct  375  TSECKNVKPTVSGIQNPPAC  394



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC + NT  GVRIKTWPASP  GV + +HFED+ MDNV  P++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            +NQC   VPSKVKIS+VSFK I G+S+T V +KL+CS G+PC  V LS + L Y G  GS
Sbjct  316  YNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGS  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              SEC ++KPT++    P  C
Sbjct  376  ITSECKHIKPTINNVAQPLAC  396



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 107/141 (76%), Gaps = 2/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  V++KNC + +TM GVR++TWPASP EGVA  +HF+++ M+NVSTPI IDQ+YCP
Sbjct  250  EEPVVGVTVKNCTITHTMSGVRVETWPASPSEGVARDLHFQNIVMNNVSTPISIDQEYCP  309

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + +C   VPS+VKISDVSF +I GTSA+KVAV+L CSS  PC  V LS + L Y G++G 
Sbjct  310  Y-KCDKKVPSRVKISDVSFDDIRGTSASKVAVRLRCSSASPCENVGLSNINLAYHGSDGK  368

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A SEC NVKP ++G+  P  C
Sbjct  369  ATSECANVKPKVTGQLFPPAC  389



>ref|XP_008449943.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=149

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -2

Query  708  VSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCPWNQCKA  532
            V++K CKL  T  GVRIKTWP S     A+ MHFED+ M NVS P+LIDQ+YCPWNQC  
Sbjct  3    VTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQCNR  62

Query  531  GVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECD  352
             VPSK+KIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+C 
Sbjct  63   KVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQCA  122

Query  351  NVKPTLSGKNSPAIC  307
            NVKP +SGK +P IC
Sbjct  123  NVKPVISGKQNPPIC  137



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC L +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKIS VSFK I GTSAT V V++ CSSG PC KV L+ +K+ Y G +G A
Sbjct  314  NQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKVAYSGPDGPA  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIISGTMSAPGC  393



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKLI T  GVRIK+WP S     A+ MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  263  EKEVVGVTVKKCKLIGTTNGVRIKSWPDSAVSYPASDMHFEDIEMENVANPIIIDQEYCP  322

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPS +KIS VSFK I GTS+T VAVKL+CS   PC  V ++ + L Y G  G 
Sbjct  323  WNQCNRKVPSAIKISKVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGP  382

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A+SEC NVKPT+SGK +P IC
Sbjct  383  AVSECSNVKPTISGKQNPPIC  403



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  + +KNC +  +  GVRIKTWP S  G A+ MHF+D+ M++V TPILIDQ YCP+
Sbjct  215  EESVVGIYVKNCTITGSQNGVRIKTWPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPY  274

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC A VPS VK+S +SFK I GTS TK AVKL+CS   PCN V L+ + L Y G  G A
Sbjct  275  NQCTAEVPSSVKLSKISFKNIKGTSTTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPA  334

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KPT+ GK  PAIC
Sbjct  335  TSVCENIKPTIKGKQIPAIC  354



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + ++ C + NT  GVRIKTWPAS  G A+ +HFED++M+NVS PIL+DQ YCP 
Sbjct  248  EQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPH  307

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC A VPS+VK+  VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y G  G  
Sbjct  308  NQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPI  367

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC N++P  SGK +P  C
Sbjct  368  KSECTNIQPKTSGKMNPPPC  387



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  + ++ C + NT  GVRIKTWPAS  G A+ +HFED++M+NVS PIL+DQ YCP 
Sbjct  250  EQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPH  309

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC A VPS+VK+  VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y G  G  
Sbjct  310  NQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPI  369

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC N++P  SGK +P  C
Sbjct  370  KSECTNIQPKTSGKMNPPPC  389



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  ++IK C L NT  GVRIKTWPASP +G A+ +HFED+ M NV  PILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+CK GVPSKVKIS+VSFK I GT    VAVKL C+ G+PC  V LS + L+Y G  G 
Sbjct  316  WNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKYIGDKGP  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NVKPT++    P  C
Sbjct  376  ITSVCSNVKPTINRVAQPLAC  396



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +KNC L +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  234  EKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  293

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKIS VSFK I GTSAT V V++ CSSG PC KV L+ +KL Y G +G +
Sbjct  294  NQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKLAYSGPDGPS  353

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S   C
Sbjct  354  KSQCSNVKPIISGIMSAPGC  373



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+I+   + NT  GVRIKTWP SP G+ + + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CK G PSKVK+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+I+   + NT  GVRIKTWP SP G+ + + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CK G PSKVK+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+I+   + NT  GVRIKTWP SP G+ + + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CK G PSKVK+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+I+   + NT  GVRIKTWP SP G+ + + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CK G PSKVK+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V+I+   + NT  GVRIKTWP SP G+A+ + F+D+ MDNVSTPIL+DQ YCP 
Sbjct  379  EQPVRGVTIRKTLIKNTDNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVDQVYCPH  438

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
              CK+  PSKVK+SDVSFK I GTSA+KVAVKLLCS GVPC     + + L + G  G A
Sbjct  439  GTCKSQAPSKVKLSDVSFKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEGPA  498

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKP +SGK  P  C
Sbjct  499  VSACSNVKPVVSGKMVPPAC  518



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +K+C + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIISGIMSAPGC  393



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + +K+C + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPMISGIMSAPGC  393



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  + +    L NT  G+R+KTWPASP G+A+ MHFED+ M+NV  PILIDQ+YCP+
Sbjct  254  EAPVVGIKVTGSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPY  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            +QCK  +PS+VKISDV+FK I GTS+T++AVKL+CSSGVPC  V L+ + L++ G  G+ 
Sbjct  314  SQCKQQIPSRVKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNG--GAP  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP L G   P  C
Sbjct  372  TSICKNVKPILGGVQQPRSC  391



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC + NT  GVRIKTWPASP  GV + +HFED+ MDNV  P++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC   VPSKVKIS+VSFK I G+S+T V +KL+CS G+PC  V LS + L Y G  GS
Sbjct  316  HNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGS  375

Query  369  AISECDNVKPTLSGKNSPAIC  307
              SEC ++KPT+     P  C
Sbjct  376  ITSECKHIKPTIDNVAQPLAC  396



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IK+C L NTM G+RIKTWP SP   +A+ +HFED+ M+NV  PILIDQ+YCP
Sbjct  248  EEPVTGIYIKSCTLSNTMNGIRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCP  307

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN C   V SKVKIS+VSF+ I GTS+T +A+K+LC+ G+PC+KV ++ + L+Y G  GS
Sbjct  308  WNLCNKQVASKVKISNVSFRNIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGS  367

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NV+PT++   +P  C
Sbjct  368  LTSQCSNVRPTITRVPNPLAC  388



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V +KNC L NT  GVRIK+WPA   G A+ +HFED+ M+NV+ P++IDQ+YCPW
Sbjct  249  EQPVRGVLVKNCILKNTDNGVRIKSWPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPW  308

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKIS+VSFK I GT+ T  AVK++CSS +PC +V L+G+ L+Y GT G A
Sbjct  309  NQCTKDAPSKVKISNVSFKNIKGTTNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPA  368

Query  366  ISECDNVKPTLSG  328
             SEC N K T++G
Sbjct  369  KSECKNAKLTVTG  381



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  ++IK C L NT  GVRIKTWPASP +G A+ +HFED+ M NV  PILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+CK G PSK+KIS+VSFK I GT    VAVKL CS G+PC  V LS + L+Y G  G 
Sbjct  316  WNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKYTGDKGP  375

Query  369  AISECDNVKPTLS  331
              S C NVKPT++
Sbjct  376  ITSVCSNVKPTIN  388



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 97/133 (73%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  ++IK C L NT  GVRIKTWPASP +G A+ +HFED+ M NV  PILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+CK GVPSKVKIS+VSFK I GT    VAVKL C+ G+PC  V LS + ++Y G  G 
Sbjct  316  WNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKYTGDKGP  375

Query  369  AISECDNVKPTLS  331
              S C NVKPT++
Sbjct  376  ITSVCSNVKPTIN  388



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV+ V++KNC + NT  GVRIKTWP +  G  + +HFED+ + NVS+PI+IDQ+YCPW
Sbjct  261  EEPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPW  320

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+CK    SKVK+S++SFK I GTSA   AVK++CS+ +PC  V L+ +++ + G  G A
Sbjct  321  NKCKINEESKVKLSNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPA  380

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C NVKP +SGK +PA C
Sbjct  381  VSQCSNVKPKVSGKQNPAAC  400



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  + +KNC L +T  GVR+KT+P+SP+G AT MHF D+ M+NVS PI+IDQ+YCP 
Sbjct  444  EAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  503

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   VPS+VK+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  504  NQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  563

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NV+ TL G   P  C
Sbjct  564  SSQCKNVEATLWGTQQPKTC  583


 Score =   124 bits (310),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V++KNC LINTM G+R+KTWP SP  VAT +HFED+ M+NV  PILI+Q+YCP+
Sbjct  75   EEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPY  134

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATK  463
            +QC+A VPS+VKISDVSF+ I   S T+
Sbjct  135  DQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +KNC  INT  GVR+KTWPAS +GV T +H+ED+ + NVS PI+IDQ YCP+
Sbjct  256  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVIDQVYCPY  315

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PSKVKIS VS K I GTS T+ AV LLCS G PC+ V +  + + Y G  G A
Sbjct  316  NQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPA  375

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+NVKP L GK +P IC
Sbjct  376  KSSCENVKPKLVGKQNPPIC  395



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC + NT  GVRIKTWPASP  GV + +HFED+ MDNV  P++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSKVKIS+VSFK I G+S+T V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTYSGNKGP  375

Query  369  AISECDNVKPTLS  331
              S+C +VKPT++
Sbjct  376  ITSQCKHVKPTIN  388



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKL  T  GVRIKTWP S     AT MHFED+ MDNVS PI+IDQ+YCP
Sbjct  271  EKEVVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCP  330

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   V SK+KIS+VSFK I GTSAT +AVK++CS  +PC  V ++ + L Y G  G 
Sbjct  331  WNQCNRKVASKIKISNVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGP  390

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP ++GK +P IC
Sbjct  391  IKSQCANVKPVITGKQNPPIC  411



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V + NC +     G RIKTW AS  G+AT MHF+DV+M++V+ P+LIDQ YCP+
Sbjct  253  EEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPF  312

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC+A +PS VKIS+VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  313  NQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  372

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NV+P +SG  +P  C
Sbjct  373  TSECSNVRPLISGMQNPLAC  392



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ VE V +  CKL +T  GVRIKTWP S  E  A+ MHFED+ M+NVS PI+IDQ+YCP
Sbjct  252  EKAVEGVWVTKCKLTSTTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCP  311

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KIS VSFK I GTSAT VAVKL+CS  +PC  V +  + L+Y G  G 
Sbjct  312  WNQCNPKIPSSIKISKVSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGP  371

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPIISGKQNPRIC  392



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +KNC  INT  GVR+KTWPAS +GV T +H+ED+ + NVS P++IDQ YCP+
Sbjct  247  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPY  306

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PS VKIS VS K + GTS+T+ AV+LLCS GVPC  V +  + + Y G  G A
Sbjct  307  NQCNKDLPSLVKISKVSIKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPA  366

Query  366  ISECDNVKPTLSGKNSPAIC  307
             + C+NVKPT  GK +P +C
Sbjct  367  KTSCENVKPTFVGKQNPPVC  386



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 99/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ VE V +  CKLI T  GVRIKTWP S  +  A+ MHFED+ M +VS PILIDQ+YCP
Sbjct  249  EKAVEGVWVTKCKLIKTTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCP  308

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   +PS +KIS VSFK I GT+ T VAVKL+CS  +PC  V ++ + L+Y G  GS
Sbjct  309  WNQCNRKIPSSIKISKVSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGS  368

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  369  ITSQCANVKPIISGKQNPRIC  389



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKL +T  GVRIKTWP S     A+ MHFED+ M NVS P++IDQ+YCP
Sbjct  213  EKEVVGVTVKKCKLTDTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVIIDQEYCP  272

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS+VSFK I GTSAT VAVK++CS   PC  V ++ + L Y G+ G 
Sbjct  273  WNQCNRKVPSKIKISNVSFKNIRGTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGP  332

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  333  IKSQCANVKPVISGKQNPPIC  353



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC + NT  GVRIKTWPASP  GV + +HFED+ MDNV  P++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSKVKIS+VSFK I G+S++ V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTYTGNKGP  375

Query  369  AISECDNVKPTLS  331
              S+C +VKPT++
Sbjct  376  ITSQCKHVKPTIN  388



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC LINT+ GVR+K+WP++  G AT +HF+D+ M NV++PI+IDQ+YCP 
Sbjct  254  EEPVVGVFVRNCTLINTLTGVRVKSWPSATTGAATDVHFDDITMRNVTSPIVIDQEYCPN  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC  G PS+VKIS VSF  I GTSA+ +AVKL+CS   PC  V +  + L Y G+ G+ 
Sbjct  314  NQCTLGAPSRVKISKVSFNNIRGTSASALAVKLVCSKTFPCEGVEIGDIDLAYHGSLGNI  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             + C NV+PT  G+ +P IC
Sbjct  374  TTNCANVQPTFMGRQNPPIC  393



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PVE + + +C +  T+ GVR+K+WPAS  G AT MHFE + M NVS P++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS+VKI+ VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y G  G+ 
Sbjct  315  NQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNGKQGTL  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP LSGK +P IC
Sbjct  375  SSKCANVKPVLSGKLNPPIC  394



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PVE + + +C +  T+ GVR+K+WPAS  G AT MHFE + M NVS P++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS VKI+ VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y G  GS 
Sbjct  315  NQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSV  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP LSGK +P IC
Sbjct  375  SSNCANVKPALSGKLNPPIC  394



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ +  V++K CKL  T  GVRIKTWP S     A+ MHFED+ M NVS P+LIDQ+YCP
Sbjct  251  EKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G 
Sbjct  311  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGP  370

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  371  IKSQCANVKPVISGKQNPPIC  391



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+P   + +K+C + +T  GVRIK+WPA   GVA+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG PC KV L+ + L YKG  G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPA  373

Query  366  ISECDNVKP  340
             S+C NVKP
Sbjct  374  KSQCSNVKP  382



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+P   + +K+C + +T  GVRIK+WPA   G A+ MHFED+ M+NV  P++IDQ YCPW
Sbjct  254  EKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVKISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIMSGIMSAPGC  393



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +KNC  INT  GVR+KTWPAS +GV T +H+ED+ + NVS PI+IDQ YCP+
Sbjct  256  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVIDQVYCPY  315

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PS+VKIS VS K I GTS T+ AV LLCS G PC+ V +  + + Y G  G A
Sbjct  316  NQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPA  375

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+NVKP   GK +P IC
Sbjct  376  KSSCENVKPKFVGKQNPPIC  395



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ +  V++K CKL  T  GVRIKTWP S     A+ MHFED+ M NVS P+LIDQ+YCP
Sbjct  252  EKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCP  311

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G 
Sbjct  312  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGP  371

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPVISGKQNPPIC  392



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V + NC +     G RIKTW AS  G+AT MHF+DV+M++V+ P+LIDQ YCP+
Sbjct  286  EEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPF  345

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC+A +PS VKIS+VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  346  NQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  405

Query  366  ISECDNVKPTLSGKNSPAIC  307
             SEC NV+P +SG  +P  C
Sbjct  406  TSECSNVRPLISGMQNPLAC  425


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  516  VKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNVKPT  337
            VKISDVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG++ S+  N+KPT
Sbjct  429  VKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKPT  488

Query  336  LSGKNSPAIC  307
            ++GK+S  IC
Sbjct  489  ITGKSSLPIC  498



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PVE + + +C +  T+ GVR+K+WPAS  G AT MHFE + M NVS P++IDQ+YCP 
Sbjct  148  ELPVEGIFVTDCIISGTLNGVRVKSWPASKSGCATNMHFEGIIMQNVSNPMIIDQEYCPN  207

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS VKI+ VSFK ITGTSAT   V LLCS  +PC  V ++ + L Y G  G+ 
Sbjct  208  NQCTNTAPSSVKIAQVSFKNITGTSATPAVVTLLCSKSIPCESVEVADIDLAYNGNQGNV  267

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP LSGK +P IC
Sbjct  268  SSNCANVKPALSGKLNPPIC  287



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 96/133 (72%), Gaps = 1/133 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC + NT  GVRIKTWPASP  GV + +HFED+ MDNV  P++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSKVKIS+VSFK I G+S   V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTYTGNKGP  375

Query  369  AISECDNVKPTLS  331
              S+C +VKPT++
Sbjct  376  ITSQCKHVKPTIN  388



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PVE + + +C +  T+ GVR+K+WPA+  G AT MHFE + M NVS P++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PS VKI+ VSFK ITGTSAT  AV LLCS  +PC+ V ++ + L Y G  G+ 
Sbjct  315  NQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYNGNQGNV  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP LSGK +P IC
Sbjct  375  SSNCANVKPALSGKLNPPIC  394



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   167 bits (422),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  726   EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
             E PV  + +KNC L +T  GVR+KT+P+SP+G AT MHF D+ M+NVS PI+IDQ+YCP 
Sbjct  1117  EAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  1176

Query  546   NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             NQC   VPS+VK+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  1177  NQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  1236

Query  366   ISECDNVKPTLSGKNSPAIC  307
              S+C NV+ TL G   P  C
Sbjct  1237  SSQCKNVEATLWGTQQPKTC  1256


 Score = 99.0 bits (245),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V++KNC LINTM G+R+KTWP SP  VAT +HFED+ M+NV  PILI+Q+YCP+
Sbjct  842  EEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPY  901

Query  546  NQCKA  532
            +QC+A
Sbjct  902  DQCQA  906



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +KNC  INT  GVR+KTWPAS +GV T +H+ED+ + NVS PI+IDQ YCP+
Sbjct  239  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPY  298

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC   +PS VKIS VS K + GTS T+ AV LLCS GVPC  V +  + + Y G  G A
Sbjct  299  NQCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPA  358

Query  366  ISECDNVKPTLSGKNSPAIC  307
             + C+NVKPT  G  +P +C
Sbjct  359  KTSCENVKPTFVGNQNPPVC  378



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKL +T  GVRIKTWP S     A+ MHFED+ M NVS P++IDQ+YCP
Sbjct  252  EKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEYCP  311

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT VAVK++CS   PC +V ++ + L Y G+ G 
Sbjct  312  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSEGP  371

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPVISGKQNPPIC  392



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + ++NC   NT  GVR+KTW +S + +AT ++F+D+ + NVS PI+IDQ+YCP+
Sbjct  261  EEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQEYCPY  320

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PS+VK+S++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  321  NHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDS  380

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C NV P + GK  P+ C
Sbjct  381  MSDCTNVSPKIFGKQYPSPC  400



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + ++NC   NT  GVR+KTW +S + +AT +HF D+ + NVS PI+IDQ+YCP+
Sbjct  289  EEPVSGIIVRNCTFFNTDNGVRVKTWLSSEKAIATGLHFHDITVVNVSNPIVIDQEYCPY  348

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            + CKA  PS+VK+S++SFK I GTS+TK+A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  349  DHCKAKKPSQVKLSNISFKNIHGTSSTKMAMKLACSSGVPCENVEISNIDIKYIGSDGVS  408

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C NV P   GK  P+ C
Sbjct  409  MSDCTNVSPKTFGKQYPSAC  428



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + ++NC   NT  GVR+KTW +S + +AT ++F+D+ + NVS P++IDQ+YCP+
Sbjct  261  EEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVIDQEYCPY  320

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PS+VK+S++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  321  NHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDS  380

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S+C NV P + GK  P+ C
Sbjct  381  MSDCTNVSPKIFGKQYPSPC  400



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  238  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  358  KSSCENIKPSLKGKQNPPVC  377



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  249  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  368

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  369  KSSCENIKPSLKGKQNPPVC  388



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   158 bits (400),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  249  EKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDISYSGKEGPA  368

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  369  KSSCENIKPSLKGKQNPPVC  388



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  250  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  309

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  310  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  369

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  370  KSSCENIKPSLKGKQNPPVC  389



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 2/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  V++K C + +T  GVRIK+W  S E +A+ +HFED+ + NV  PILIDQ+YCP+
Sbjct  255  EAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNPILIDQEYCPY  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVK+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G A
Sbjct  315  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFNG--GHA  372

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKP  SGK +P  C
Sbjct  373  VSMCKNVKPITSGKQNPVAC  392



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   158 bits (399),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 7/147 (5%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V ++NC L+NTM G+R+KTWP S  G+A+ +HF+D+ +DNVS P+LIDQ YCP 
Sbjct  264  EQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQDIIIDNVSNPVLIDQDYCPD  323

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG--  373
            + CK  VPSKVK+SDV FK I GTSATK+A++L CS  +PC  V L  + L Y G  G  
Sbjct  324  DLCKLQVPSKVKVSDVLFKNIKGTSATKMAIQLKCSKIMPCENVTLDDIDLCYLGNKGNN  383

Query  372  -----SAISECDNVKPTLSGKNSPAIC  307
                 +A SEC NV+P + GK SP  C
Sbjct  384  RNTTSTATSECFNVRPAIMGKLSPPPC  410



>ref|XP_007143503.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
 gb|ESW15497.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
Length=276

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 96/142 (68%), Gaps = 4/142 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATR-MHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V++K C L  T  GVRIKTWP  P  +    M FED+ MDNV  PI+IDQ+YCP
Sbjct  90   EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIIIDQEYCP  149

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC  G PSKVKIS VSFK I GTSATK  + L CSSGVPC  V +  V L Y G  G 
Sbjct  150  NNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNG--GP  207

Query  369  AISECDNVKPTLSGKNSPAICD  304
             I++C NVKPT++GK +PA  D
Sbjct  208  IIAKCSNVKPTITGK-APACGD  228



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVED  + NC L NT  GVRIKTWP +P  +  T MHFED++M NV  PI+IDQ+YCP
Sbjct  254  EKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINVKNPIIIDQEYCP  313

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS+VSFK I GTS TK  V L+CSSGVPC  V+L+ + L + GT  S
Sbjct  314  WNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLTDIDLTFNGT--S  371

Query  369  AISECDNVKPTLSGK  325
            A ++  NVKP + GK
Sbjct  372  AAAKLSNVKPIIQGK  386



>ref|XP_007143501.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
 gb|ESW15495.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
Length=243

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATR-MHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V++K C L  T  GVRIKTWP  P  +    M FED+ MDNV  PI+IDQ+YCP
Sbjct  107  EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIIIDQEYCP  166

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC  G PSKVKIS VSFK I GTSATK  + L CSSGVPC  V +  V L Y G  G 
Sbjct  167  NNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNG--GP  224

Query  369  AISECDNVKPTLSGKNSPA  313
             I++C NVKPT++GK +PA
Sbjct  225  IIAKCSNVKPTITGK-APA  242



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   162 bits (411),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K CKL +T  GVRIKTWP S     AT MHFED+ M NVS PI+IDQ+YCP
Sbjct  853  EKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPATDMHFEDIEMVNVSNPIIIDQEYCP  912

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC   VPSK+KIS VSFK I GTSAT VAVK++CS   PC +V ++ + L Y G+ G 
Sbjct  913  WNQCNRKVPSKIKISKVSFKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGP  972

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKP ++GK +P IC
Sbjct  973  IKSQCANVKPVITGKQNPPIC  993



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  238  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L  K +P +C
Sbjct  358  KSSCENIKPSLKDKQNPPVC  377



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 97/136 (71%), Gaps = 5/136 (4%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA--TRMHFEDVRMDNVSTPILIDQQYC  553
            E+PVE   +KNC L NT  GVRIKTWP++P G A  T MHFED+ M NV  PI+IDQ+YC
Sbjct  253  EKPVEGFYVKNCTLTNTDNGVRIKTWPSTP-GTAPITDMHFEDIIMVNVKNPIIIDQEYC  311

Query  552  PWNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  373
            PWNQC    PSK+KIS VSFK I GTSAT   V L+CSSGVPC+ V L+GV L + G   
Sbjct  312  PWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGVDLTFNG--A  369

Query  372  SAISECDNVKPTLSGK  325
             A ++C NVKP ++GK
Sbjct  370  PATAKCANVKPIVTGK  385



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV+ +++++C   NT  GVRIKTWP + EG A+ + FE++ M NV +P+LIDQ+YCPW
Sbjct  253  EAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQEYCPW  312

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQC    PSKVK+S +SFK I GTS+T +AV L+CS G PC  V +  + L+YKG +G A
Sbjct  313  NQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDGPA  372

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NV   ++GK +P+ C
Sbjct  373  HSVCKNVNVKVTGKMNPSPC  392



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ ++I+ C + +T  GVRIKTWP SP G+ +   FED+ MDNVS PIL+DQ YCP 
Sbjct  370  EQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  429

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CK+G PSKV++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  430  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  488

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKPT++GK  PA C
Sbjct  489  VSACSNVKPTVTGKMIPAAC  508



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV+ ++I+ C + +T  GVRIKTWP SP G+ +   FED+ MDNVS PIL+DQ YCP 
Sbjct  356  EQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  415

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CK+G PSKV++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  416  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  474

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKPT++GK  PA C
Sbjct  475  VSACSNVKPTVTGKMIPAAC  494



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K+C LINT  GVRIK+WP S     A+ +HFED+ M NVS PI+IDQ+YCP
Sbjct  250  EKEVAGVTVKSCNLINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIIIDQEYCP  309

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC   +PSK+KI +VSFK I GTSAT VA+K +CS  +PC+ V ++ + L Y GT G 
Sbjct  310  SNQCNKKIPSKIKIRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGR  369

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NV P ++GK +P  C
Sbjct  370  ITSQCRNVIPIITGKQNPRAC  390



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +K C LINT  G+RIK+WP    G AT MHFED+ M+NVS  ILIDQ YCPW
Sbjct  252  EEPVSGVYVKKCDLINTSNGIRIKSWPGLYSGAATDMHFEDISMNNVSNAILIDQMYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C +   S VKIS V+F  I GTS+T   VKLLCS G+PC  V L+ + + YKG +G A
Sbjct  312  NHCNSKASSNVKISKVTFSNIKGTSSTPTIVKLLCSKGLPCEGVELNNINVVYKGPDGPA  371

Query  366  ISECDNVKPTL  334
             SEC NVKP +
Sbjct  372  KSECTNVKPKI  382



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 94/139 (68%), Gaps = 0/139 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++K C    TM GVR+KTWP SP G AT + F+D+ M+NV  P+++DQ+YCP+
Sbjct  236  EKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPY  295

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             QC    PS++K+S+++F  I GTS  KVAV + CS G+PC+ + +  + L Y+G  G A
Sbjct  296  GQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPA  355

Query  366  ISECDNVKPTLSGKNSPAI  310
             S C NVKPT SGK  PAI
Sbjct  356  TSTCSNVKPTFSGKQVPAI  374



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  717  VEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCPWNQ  541
            V  V++K+CKLINT  GVRIK+WP S     A+ +HFED+ M NVS P++I+Q+YCP++Q
Sbjct  269  VTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQ  328

Query  540  CKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAIS  361
            C   +PSK+KIS+VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S
Sbjct  329  CDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITS  388

Query  360  ECDNVKPTLSGKNSPAIC  307
            +C NV P ++GK +P  C
Sbjct  389  QCRNVIPIITGKQNPRAC  406



>ref|XP_010675960.1| PREDICTED: exopolygalacturonase clone GBGA483-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  V++K C + +T  G+RIK+W  S    A+ +HFED+ + NV TPILIDQ+YCP+
Sbjct  189  EAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILIDQEYCPY  248

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVK+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  
Sbjct  249  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPV  306

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKP  SGK +P  C
Sbjct  307  VSMCKNVKPITSGKQNPVAC  326



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  V ++NC  I+T  GVR+KTWPAS  GV   +H+ED+ + NVS P++IDQ YCP+
Sbjct  255  ELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVIDQLYCPY  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK  +PS+VKIS VSFK I GTS T+ A+++ CS GVPC  V +  + + Y G  G A
Sbjct  315  NQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITYNGNEGPA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NV P+  GK +P +C
Sbjct  375  KSSCQNVDPSFVGKQNPPVC  394



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V ++NC   NT  GVRIKTWPAS  GV   +HFED+ + NVS P++IDQ YCP+
Sbjct  249  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LL S GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKEGPA  368

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  369  KSSCENIKPSLKGKQNPPVC  388



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  V ++NC  I+T  GVR+KTWPAS  GV   +H+ED+ + NVS P++IDQ YCP+
Sbjct  255  ELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVIDQLYCPY  314

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            NQCK  +PS+VKIS VSFK I GTS T+ A+K+ CS GVPC  V +  + + Y G  G A
Sbjct  315  NQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITYNGNEGPA  374

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NV P+  GK  P +C
Sbjct  375  KSTCQNVDPSFVGKQIPPVC  394



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V + NC + NT  GVRIKTWPAS  GV   + FED+ + NVS P++IDQ YCP+
Sbjct  238  EKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCPF  297

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C   +PS+VKIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KP+L GK +P +C
Sbjct  358  KSSCENIKPSLKGKQNPPVC  377



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 97/135 (72%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  251  EEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS TK  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  368

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV+ ++I+ C + +T  GVRIKTWP SP G+ +   FED+ MDNVS PIL+DQ YCP 
Sbjct  346  EEPVKGITIRKCIVKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  405

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +CK+G PSKV++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  406  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  464

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKPT++GK  PA C
Sbjct  465  VSACSNVKPTVTGKMIPAAC  484



>gb|KDO36716.1| hypothetical protein CISIN_1g036262mg, partial [Citrus sinensis]
Length=195

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  53   EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  112

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  113  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  172

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  173  PAISSCSNVKPTLVGKQIPATC  194



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 98/140 (70%), Gaps = 2/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E PV  V++K C + +T  G+RIK+W  S    A+ +HFED+ + NV TPILIDQ+YCP+
Sbjct  265  EAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILIDQEYCPY  324

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CKA  PSKVK+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  
Sbjct  325  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPV  382

Query  366  ISECDNVKPTLSGKNSPAIC  307
            +S C NVKP  SGK +P  C
Sbjct  383  VSMCKNVKPITSGKQNPVAC  402



>ref|XP_004144611.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=506

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  717  VEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCPWNQ  541
            V  V++K+CKLINT  GVRIK+WP S     A+ +HFED+ M NVS P++I+Q+YCP++Q
Sbjct  351  VTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQ  410

Query  540  CKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAIS  361
            C   +PSK+KIS+VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S
Sbjct  411  CDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITS  470

Query  360  ECDNVKPTLSGKNSPAIC  307
            +C NV P ++GK +P  C
Sbjct  471  QCRNVIPIITGKQNPRAC  488



>emb|CDY07973.1| BnaC03g35500D [Brassica napus]
Length=179

 Score =   147 bits (372),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V D+++KNC L  T  G+RIKTWP A+    A  +HFED+ ++ VS PILIDQ+YCP
Sbjct  28   EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  87

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  88   WNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGP  147

Query  369  AISECDNVKPTLSGKNSPAIC  307
               EC NV P L G  +P  C
Sbjct  148  PTFECTNVTPKLVGTQNPKAC  168



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 94/140 (67%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE + I NC + NT  G RIKTWP    G  + +HFED+ M+NVS+PILIDQQYCPW
Sbjct  257  EEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPW  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+CK    SKVK+S++SFK I GTSA   A+K +CS   PC  V L+ + +++ G    A
Sbjct  317  NKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHNGAE-PA  375

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP  SGK +P  C
Sbjct  376  TSQCLNVKPITSGKLNPIPC  395



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV  PI+IDQ+YCP
Sbjct  251  EEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS TK  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  368

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +KNC L++T  GVRIKTWPAS  GV + +HFED+ + NVS PI+IDQ YCP 
Sbjct  250  EKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPIVIDQVYCPS  309

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             +C   +PS+VKIS VS + I GTS T+ A+ L CS G PC  V +  V + Y G  G A
Sbjct  310  GKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDISYSGKEGPA  369

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C+N+KPT  GK +PA+C
Sbjct  370  KSSCENIKPTFKGKQTPAVC  389



>emb|CDP04347.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   146 bits (369),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 90/140 (64%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E P++     +C +  T+ GVR+K+WPAS  G AT MHFE + + NVS P++IDQ+YCP 
Sbjct  25   ELPIKGSFDTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIIQNVSNPVIIDQEYCPN  84

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
             Q     PS V+I+ VSF  ITGTSAT  AV LLCS  +PC  V ++ + L Y G  GS 
Sbjct  85   KQSTNTAPSSVQIAQVSFNNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSV  144

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S C NVKP LSGK +P IC
Sbjct  145  SSNCANVKPALSGKLNPPIC  164



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K+CKLINT  GVRIKTWP  +    A+ +HFED+ M NVS P++IDQ+YCP
Sbjct  260  EKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCP  319

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC   +PSK+KIS+VSFK I GTSAT VAVK +CS+   C  V ++ + L Y GT G 
Sbjct  320  SNQCNKKIPSKIKISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGR  379

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NV P ++GK +P  C
Sbjct  380  ITSQCRNVIPIITGKQNPRAC  400



>gb|KHN44923.1| Polygalacturonase, partial [Glycine soja]
Length=298

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  160  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  219

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  220  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNG--AA  277

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  278  ATAKCANVKPTITGK  292



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  212  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  271

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  272  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  329

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  330  ATAKCANVKPTITGK  344



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 87/131 (66%), Gaps = 0/131 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V +K C LINT  G+RIK+WP    G AT +HFED+ M+NVS  ILIDQ YCPW
Sbjct  252  EEPVSGVYVKKCDLINTTNGIRIKSWPGLYSGTATDLHFEDISMNNVSNAILIDQMYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C +   S VKIS V+F  I GTS+    VKLLCS G+PC  V L+ + + YKG  G A
Sbjct  312  NHCNSKASSNVKISKVTFSNIKGTSSIPTIVKLLCSKGLPCEGVELNNINVVYKGPEGPA  371

Query  366  ISECDNVKPTL  334
             SEC NVKP +
Sbjct  372  KSECTNVKPKI  382



>ref|XP_007143491.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
 gb|ESW15485.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
Length=204

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 92/139 (66%), Gaps = 4/139 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATR-MHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE V++K C L  T  GVRIKTWP  P  +    M FED+ MDNV  P++IDQ+YCP
Sbjct  24   EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVIIDQEYCP  83

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC  G PSKVKIS VS K I GTSATK  + L CSSGVPC  V +  V L Y G   +
Sbjct  84   NNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNGAPVT  143

Query  369  AISECDNVKPTLSGKNSPA  313
            A   C NVKPT++GK +PA
Sbjct  144  AT--CTNVKPTITGK-APA  159



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 93/140 (66%), Gaps = 1/140 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PVE + I NC + NT  G RIKTWP    G  + +HFED+ M+NVS+PILIDQQYCPW
Sbjct  257  EEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPW  316

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+CK    SKVK+S++SFK I GTSA   A+K +CS   PC  V L+ + +++ G    A
Sbjct  317  NKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIQHNGAE-PA  375

Query  366  ISECDNVKPTLSGKNSPAIC  307
             S+C NVKP   GK +P  C
Sbjct  376  TSQCLNVKPITIGKLNPIPC  395



>ref|XP_009348297.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like, partial 
[Pyrus x bretschneideri]
Length=236

 Score =   147 bits (371),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ +  + +KNC L NT  GVRIKTWP SP    A+ +HFED+ M NV  PI+IDQ YCP
Sbjct  85   EESLAGIRVKNCTLTNTQNGVRIKTWPNSPLATTASDIHFEDIFMVNVGNPIVIDQLYCP  144

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + +C    PSKVKIS+VSFK I G+SAT +A+K++CSSG  C  V L+ + L Y G  G+
Sbjct  145  YRKCDNLPPSKVKISNVSFKNIKGSSATALALKIVCSSGSRCENVELTDIXLTYNGAKGT  204

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKPT+SG  S   C
Sbjct  205  LTSQCLNVKPTISGLISALAC  225



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 98/141 (70%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K+CKLINT  GVRIKTWP  +    A+ +HFED+ M NVS P++IDQ+YCP
Sbjct  260  EKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCP  319

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC   +PSK+KI++VSFK I GTSAT VAVK +CS+   C  V ++ + L Y GT G 
Sbjct  320  SNQCNKKIPSKIKINNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGR  379

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NV P ++GK +P  C
Sbjct  380  ITSQCRNVIPIITGKQNPRAC  400



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 3/141 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE + +KNC L NT  GVRIKTWP+SP     T MHFED+ M +V  P++IDQ+YCP
Sbjct  252  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  311

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  312  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  369

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +++C NVKP ++GK     C
Sbjct  370  IVAKCANVKPIVTGKAPACTC  390



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 3/141 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE + +KNC L NT  GVRIKTWP+SP     T MHFED+ M +V  P++IDQ+YCP
Sbjct  250  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  309

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  310  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  367

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +++C NVKP ++GK     C
Sbjct  368  IVAKCANVKPIVTGKAPACTC  388



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 3/141 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE + +KNC L NT  GVRIKTWP+SP     T MHFED+ M +V  P++IDQ+YCP
Sbjct  246  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  306  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  363

Query  369  AISECDNVKPTLSGKNSPAIC  307
             +++C NVKP ++GK     C
Sbjct  364  IVAKCANVKPIVTGKAPACTC  384



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV  PI+IDQ+YCP
Sbjct  212  EEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIIIDQEYCP  271

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  272  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  329

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  330  ATAKCANVKPTITGK  344



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ +  + +KNC L NT  GVRIKTWP SP    A+ +HFED+ M NVS PI+IDQ YCP
Sbjct  255  EESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIVIDQLYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + +C    PSKVKISDVSFK I G+SAT +++K++CSSG PC  + L+ + L Y G  G+
Sbjct  315  YKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLTYSGAKGT  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C NVKPT+SG      C
Sbjct  375  LTSQCLNVKPTISGLTGALAC  395



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNGA--A  368

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNGA--A  368

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_007143497.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
 gb|ESW15491.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
Length=247

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 92/139 (66%), Gaps = 4/139 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATR-MHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE +++K C L  T  GVRIKTWP  P  +    M FED+ MDNV  P++IDQ+YCP
Sbjct  67   EEPVEGITVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVIIDQEYCP  126

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC  G PSKVKIS VS K I GTSATK  + L CSSGVPC  V +  V L Y G   +
Sbjct  127  NNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNGAPVT  186

Query  369  AISECDNVKPTLSGKNSPA  313
            A   C NVKPT++GK +PA
Sbjct  187  AT--CTNVKPTITGK-APA  202



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV    +KNC L  T  GVRIKTWP +P  +  T MHFED+ M+NV+ PI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMADIDLTFNG--AA  368

Query  369  AISECDNVKPTLSGK  325
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_006492954.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=374

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  232  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  291

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  292  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  351

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  352  PAISSCSNVKPTLVGKQIPATC  373



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + + NC LINT  GVRIKTWP A+    A+ +HFE++ + NV+ PILIDQ+YCP
Sbjct  247  EEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS +K+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADGP  366

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV PTL G   P  C
Sbjct  367  ATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 96/142 (68%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVA-TRMHFEDVRMDNVSTPILIDQQYC  553
            E+PV  + IKNC + NT  GVRIKTWPASP +G A + +HF+D+ MDNV  P++IDQ+YC
Sbjct  256  EEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHFZDIIMDNVKNPVVIDQEYC  315

Query  552  PWNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  373
            P   C   V SKVKIS+VSFK I G+S+  V VKLLCS  +PC  V LS + L Y G  G
Sbjct  316  PHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLTYTGDKG  375

Query  372  SAISECDNVKPTLSGKNSPAIC  307
            S  SEC +VKPT++    P  C
Sbjct  376  SITSECKHVKPTINNVAKPLAC  397



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PV  + IKNC L  T  G+RIKT+P+S   +  + +HFED+ + NVS PILIDQ+YCP
Sbjct  250  EEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVSNPILIDQEYCP  309

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS VK+ ++SFK I GTS  K AV+LLCS GVPC  V +  + L Y G +G 
Sbjct  310  WNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGDIDLRYGGADGP  369

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  EC NV P LSG   P  C
Sbjct  370  ATFECSNVTPKLSGTQFPKAC  390



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   150 bits (378),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 96/142 (68%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVA-TRMHFEDVRMDNVSTPILIDQQYC  553
            E+PV  + IKNC + NT  GVRIKTWPASP +G A + +HFED+ MDNV  P++IDQ+YC
Sbjct  256  EEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVVIDQEYC  315

Query  552  PWNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  373
            P   C   V SKVKIS+VSFK I G+S+  V VKLLCS  +PC  V LS + L Y G  G
Sbjct  316  PHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLTYTGDKG  375

Query  372  SAISECDNVKPTLSGKNSPAIC  307
            S  SEC +VKPT++    P  C
Sbjct  376  SLTSECKHVKPTINNVAKPLAC  397



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  +++KNC LI T  G+RIKTWP A+    A+ +HFED+ ++NVS PILIDQ+YCP
Sbjct  245  EQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILIDQEYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN C    PS +K+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  305  WNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKGADGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
                C NV P L G  +P  C
Sbjct  365  PTFTCSNVTPKLVGTQNPKAC  385



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V + NC L+ T  G+RIKTWP++     A+ +HFED+ + NVS PILIDQ+YCP
Sbjct  245  EEDVAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILIDQEYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D+SF++I GTS  K AVKLLCS G+PC  V +  + +EYKG +G 
Sbjct  305  WNQCNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
               +C NV P L G   P  C
Sbjct  365  PTFQCSNVNPKLVGTQVPKAC  385



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  + +KNC + NT  GVRIK+WPA   G A+ +HFED+ M NVS PI+IDQ YCPW
Sbjct  252  EESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C     SKV I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A
Sbjct  312  NECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
              +C NV+P   GK +P+ C
Sbjct  372  KFQCSNVQPKFHGKINPSKC  391



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  + +KNC + NT  GVRIK+WPA   G A+ +HFED+ M NVS PI+IDQ YCPW
Sbjct  252  EESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPW  311

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N+C     SKV I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A
Sbjct  312  NECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPA  371

Query  366  ISECDNVKPTLSGKNSPAIC  307
              +C NV+P   GK +P+ C
Sbjct  372  KFQCSNVQPKFHGKINPSKC  391



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  238  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  297

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  298  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  357

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  358  PAISSCSNVKPTLVGKQIPATC  379



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  260  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  319

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  320  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  379

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  380  PAISSCSNVKPTLVGKQIPATC  401



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  265  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  324

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  325  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  384

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  385  PAISSCSNVKPTLVGKQIPATC  406



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 2/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+ V  +++ NC    T  GVRIKTWP S +G A+   FED+ M+NV  PI+IDQ+YCP 
Sbjct  265  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  324

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  373
            NQC   VPS+VKIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  325  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  384

Query  372  SAISECDNVKPTLSGKNSPAIC  307
             AIS C NVKPTL GK  PA C
Sbjct  385  PAISSCSNVKPTLVGKQIPATC  406



>emb|CDY22139.1| BnaC01g39620D [Brassica napus]
Length=359

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V D+++KNC L  T  G+RIKTWP A+    A  +HFED+ ++ VS PILIDQ+YCP
Sbjct  208  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  267

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  268  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  327

Query  369  AISECDNVKPTLSGKNSPAIC  307
               EC NV P L G  +P  C
Sbjct  328  PTFECTNVTPKLVGTQNPKAC  348



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 92/142 (65%), Gaps = 1/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC +  T  G+RIKTWP A+   VA+ +HFED+ + NVS PILIDQ+YCP
Sbjct  260  EQNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILIDQEYCP  319

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC     S +K+ DVSF  I GTSA K AVKLLCS G PC  VV+  + +EY G +G 
Sbjct  320  WNQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  379

Query  369  AISECDNVKPTLSGKNSPAICD  304
            A   C NVKP L G  +P  CD
Sbjct  380  ATFMCSNVKPKLVGIQNPKACD  401



>gb|KHN40047.1| Polygalacturonase [Glycine soja]
Length=392

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  VEDV +KNC L NT  G+RIKTWP +    +A+ +HFED+ M NVS PI+IDQ+YCP
Sbjct  253  EDSVEDVIVKNCTLKNTNNGLRIKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCP  312

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTSAT+  + L+CSSG+PC  V LS + L + GT   
Sbjct  313  WNQCSKQSPSKIKISKVTFKNIRGTSATQEGITLVCSSGIPCETVELSDINLRFNGTT-L  371

Query  369  AISECDNVKPTLSGKNSPAIC  307
              ++C NVKP + G+ +P IC
Sbjct  372  VTAKCANVKPKI-GRKAP-IC  390



>emb|CBI28400.3| unnamed protein product [Vitis vinifera]
Length=163

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  V++KNC LINTM G+R+KTWP SP  VAT +HFED+ M+NV  PILI+Q+YCP+
Sbjct  54   EEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPY  113

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKL  394
            +QC+A VPS+VKISDVSF+ I   S T+VAV  +CS GVPC  V +S + L
Sbjct  114  DQCQAKVPSQVKISDVSFQGICSMSGTQVAV--VCSRGVPCQTVDISDINL  162



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  +++ NC L  T  G+RIKTWP A+    A+ +HFE++ + NVS PILIDQ+YCP
Sbjct  246  EQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D+ FK I GTS  K AVKLLCS G PC  V +  + + YKG +G 
Sbjct  306  WNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NVKP L G  +P  C
Sbjct  366  ATFQCSNVKPKLVGTQNPKAC  386



>ref|XP_003544285.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=386

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 98/141 (70%), Gaps = 4/141 (3%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  VEDV +KNC L NT  G+RIKTWP +    +A+ +HFED+ M NVS PI+IDQ+YCP
Sbjct  247  EDSVEDVIVKNCTLKNTNNGLRIKTWPGTAIISLASDLHFEDITMINVSNPIIIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTSAT+  + L+CSSG+PC  V LS + L + GT   
Sbjct  307  WNQCSKQSPSKIKISKVTFKNIRGTSATQEGITLVCSSGIPCETVELSDINLRFNGTT-L  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
              ++C NVKP + G+ +P IC
Sbjct  366  VTAKCANVKPKI-GRKAP-IC  384



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V D+++KNC L  T  G+RIKTWP A+    A  +HFED+ ++ VS PILIDQ+YCP
Sbjct  246  EQDVTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGAQNPKAC  386



>gb|ABE65925.1| polygalacturonase/pectinase [Arabidopsis thaliana]
Length=280

 Score =   145 bits (365),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  +++ NC L  T  G+RIKTWP A+    A+ +HFE++ ++NVS PILIDQ+YCP
Sbjct  126  EQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILIDQEYCP  185

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  186  WNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGP  245

Query  369  AISECDNVKPTLSGKNSPAIC  307
                C NV P L G  +P  C
Sbjct  246  PTFMCSNVSPKLVGTQNPKAC  266



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V D+++KNC L  T  G+RIKTWP A+    A  +HFED+ ++ VS PILIDQ+YCP
Sbjct  246  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGTQNPKAC  386



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 2/133 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  V  +++K+C + NTM GVRIKTWP SP    A+ +HFE + M+NV  PILIDQ+YCP
Sbjct  251  EDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + QC    PSKVKIS+VSFK I GT+ T  AVK++C+ G+PC+KVVLS + L+  G  G+
Sbjct  311  YGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKLTG-KGT  369

Query  369  AISECDNVKPTLS  331
              S+C NV+PT++
Sbjct  370  LTSQCANVQPTIT  382



>emb|CDY71093.1| BnaCnng71300D, partial [Brassica napus]
Length=257

 Score =   144 bits (362),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V + NC L NT  GVRIKTWP A+    A+ +HFE++ + NVS PILIDQ+YCP
Sbjct  107  EEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILIDQEYCP  166

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS +K+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  167  WNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGP  226

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L GK  P  C
Sbjct  227  ATFQCSNVSPKLVGKQCPKAC  247



>ref|XP_004488391.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=391

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E PVE V IKNC L  T  GVRIKTWP +P  +  T M+FED+ M NV  PI+IDQ+YCP
Sbjct  251  ESPVEGVLIKNCTLTETDNGVRIKTWPDAPGTITVTDMNFEDITMVNVRNPIIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTSAT   V L+CSSGVPC+ V L+ + L + G    
Sbjct  311  WNQCSKKNPSKIKISKVSFKNIKGTSATPEGVLLICSSGVPCDGVELNNIDLTFNG--AP  368

Query  369  AISECDNVKPTLSG  328
            A + C NVKP ++G
Sbjct  369  AKANCSNVKPIITG  382



>ref|XP_008462134.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=508

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 100/150 (67%), Gaps = 9/150 (6%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  V++K+CKLINT  GVRIKTWP S     A+ +HFED+ M NVS PI+I+Q+YC 
Sbjct  248  EREVTGVAVKSCKLINTWNGVRIKTWPDSASAYTASDLHFEDIEMVNVSNPIIINQEYCS  307

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG-  373
             NQC   +PSK+KI +VSFK I GTSAT VAVK +CS  +PC  V ++ + L Y G  G 
Sbjct  308  SNQCNNKIPSKIKILNVSFKNIRGTSATSVAVKFICSKDLPCEGVEVADIDLAYNGVEGQ  367

Query  372  -------SAISECDNVKPTLSGKNSPAICD  304
                   S +S+C NVK T++GK +P + D
Sbjct  368  TTSHCWKSIVSQCANVKYTVTGKQNPQLDD  397



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V D+++KNC L  T  G+RIKTWP A+    A  +HFED+ ++ VS PILIDQ+YCP
Sbjct  246  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D++F+ I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGTQNPKAC  386



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 91/142 (64%), Gaps = 1/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC +  T  G+RIKTWP A+   VA+ +HFED+ + NVS PILIDQ+YCP
Sbjct  248  EQNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCP  307

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC     S +K+ DVSF  I GTS  K AVKLLCS G PC  VV+  + +EY G +G 
Sbjct  308  WNQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  367

Query  369  AISECDNVKPTLSGKNSPAICD  304
            A   C NVKP L G  +P  C+
Sbjct  368  ATFMCSNVKPRLVGIQNPKACN  389



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + + N  LINT  GVRIKTWP A+    A+ +HFE++ + NV+ PILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS +K+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV PTL G   P  C
Sbjct  367  ATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 91/135 (67%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPA-SPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E PV D+ +KNC L NT  GVRIKTWP  S   +A+ +HFED+ M NVS PI+IDQQYCP
Sbjct  253  EDPVVDLIVKNCTLNNTDNGVRIKTWPGTSVISIASHLHFEDIVMVNVSNPIIIDQQYCP  312

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KI  V FK I GTSAT+  V L+CS GVPC  VVLS + L + G+  +
Sbjct  313  WNQCSKQSPSKIKIRKVIFKNIRGTSATQEGVSLICSRGVPCEAVVLSDINLSFNGSEVT  372

Query  369  AISECDNVKPTLSGK  325
            A  +C NV P +  K
Sbjct  373  A--KCANVNPKIRRK  385



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + + N  LINT  GVRIKTWP A+    A+ +HFE++ + NV+ PILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS +K+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV PTL G   P  C
Sbjct  367  ATFQCSNVSPTLMGTQVPKAC  387



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + + N  LINT  GVRIKTWP A+    A+ +HFE++ + NV+ PILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN+C    PS +K+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV PTL G   P  C
Sbjct  367  ATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + I NC L  T  G+RIKTWP A+    A+ +HF+D+ + NV+ PILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIKYTGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P LSG  +P  C
Sbjct  366  ATFQCSNVSPKLSGIQNPKAC  386



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 93/135 (69%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ VE + +KNC L NT  G+RIKTWP++P  +  T MHFED+ M+NVS P++IDQ+YCP
Sbjct  251  EEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITMENVSNPVIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS VSFK I GTS TK  V  +CSS  PC  V ++ V L + G   +
Sbjct  311  WNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGVEMTDVDLTFNG--AA  368

Query  369  AISECDNVKPTLSGK  325
              ++C NVKP ++GK
Sbjct  369  TTAKCANVKPVITGK  383



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV+ +++K C + NT  GVR+KTW  S EGV T +HFED+ ++NV  PI++DQ+YCP+
Sbjct  263  EEPVQGITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPY  322

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N CK   PSKVK+SD+ F+ + GTS++K AVK++CSSGVPC KV L  + L+Y G +G A
Sbjct  323  NHCKQKTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTGKDGPA  382

Query  366  I  364
            +
Sbjct  383  V  383



>ref|XP_004292143.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            EQPV  V IKN    +T  G RIKTWP S  G+ + +H+ED+ M NVS PI+IDQ+YCPW
Sbjct  256  EQPVTGVIIKNVTFNSTQNGARIKTWPGSYGGLVSDIHYEDIIMVNVSNPIIIDQEYCPW  315

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  367
            N C   +PSKVKIS+VSFK I GTS T +AV  +CS  VPC  V +SG+ L Y G  G  
Sbjct  316  NLCNKKIPSKVKISNVSFKNIKGTSTTPLAVNFICSWSVPCENVEISGIDLTYTGHKGFI  375

Query  366  ISECDNVK  343
             S+C NVK
Sbjct  376  SSQCSNVK  383



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  V  ++I++C L NT+ GVRIKT+PASP+   A+ +HFE + M+NV+ P+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCP  321

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            W QC   +PSKVKIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTIARVPPPLAC  401



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  V  ++I++C L NT+ GVRIKT+PASP+   A+ +HFE + M+NV+ P+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKITMNNVANPVLIDQEYCP  321

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            W QC   +PSKVKIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTITRVPPPLAC  401



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 101/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGV-ATRMHFEDVRMDNVSTPILIDQQYCP  550
            E  V  ++I++C L NT+ GVRIKT+PASP+   A+ +HFE + M+NV+ P+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCP  321

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            W QC   +PSKVKIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTITRVPPPLAC  401



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NV  PILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NV  PILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEG-VATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + +KNC L NT  GVRIKTWP SP    A+ +H+E++ M NVS PILIDQ YCP
Sbjct  255  EKAVTGIIVKNCTLTNTQNGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + +C    PSKVKI++VSFK I G+S T +AVKL+CS G+PC  V L+ + L Y G  G 
Sbjct  315  YTRCDQKPPSKVKINNVSFKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGP  374

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C NVKPT++G      C
Sbjct  375  LTSLCSNVKPTITGMKKALAC  395



>dbj|BAC42591.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAO63309.1| At3g07830 [Arabidopsis thaliana]
Length=225

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 90/142 (63%), Gaps = 1/142 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NVS PILIDQ+YCP
Sbjct  75   EQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCP  134

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC     S +K++++SF+ I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  135  WNQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGP  194

Query  369  AISECDNVKPTLSGKNSPAICD  304
            A   C NV+P L G   P  C+
Sbjct  195  ATFMCSNVRPKLVGTQFPKACN  216



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 1/134 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + +KNC L NT  GVRIKT+P SP    A+ +H+ED+ M NVS PIL+DQ YCP
Sbjct  255  EKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            + QC+   PSKVKIS+VSFK I G+S T +AVKL+C++G+PC  V L+ + L Y G  G 
Sbjct  315  YTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGP  374

Query  369  AISECDNVKPTLSG  328
              S C NVKPT++G
Sbjct  375  LTSMCSNVKPTITG  388



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + I NC L  T  G+RIKTWP A+    A+ +HF+D+ + NVS PILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  +P  C
Sbjct  366  ATFQCSNVSPKLLGTQNPKAC  386



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + I NC L  T  G+RIKTWP A+    A+ +HF+D+ + NVS PILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  +P  C
Sbjct  366  ATFQCSNVSPKLLGTQNPKAC  386



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NV  PILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  +++ NC L  T  G+RIKTWP A+    A+ +HFE++ ++NVS PILIDQ+YCP
Sbjct  247  EQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILIDQEYCP  306

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  307  WNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGP  366

Query  369  AISECDNVKPTLSGKNSPAIC  307
                C NV P L G  +P  C
Sbjct  367  PTFMCSNVSPKLVGTQNPKAC  387



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NV  PILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_003595656.1| Polygalactorunase PG11 [Medicago truncatula]
 gb|AES65907.1| polygalacturonase 11c, putative [Medicago truncatula]
Length=407

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVA-TRMHFEDVRMDNVSTPILIDQQYCP  550
            E  VE V++KNC L  T  GVRIKTWP +P  +  + +HFED+ M+NV+ PI+IDQ+YCP
Sbjct  255  EDNVEGVTVKNCTLTATQNGVRIKTWPDAPGTITVSDIHFEDITMNNVTNPIIIDQEYCP  314

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WN C   VPSKVK+S +SFK I GTS     V L+CSS VPC+ V L+ V +++ G    
Sbjct  315  WNACNKKVPSKVKLSKISFKNIQGTSGAPEGVVLVCSSAVPCDGVELNNVDVKFNGK--P  372

Query  369  AISECDNVKPTLSG  328
            AI++C NVKPT++G
Sbjct  373  AIAKCSNVKPTVTG  386



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + + NC L  T  G+RIKTWP A+    A+ +HFE++ + NV  PILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+ V  + + NC L NT  GVRIKTWP++     A+ +HFE++ + NVS PILIDQ+YCP
Sbjct  245  EEDVTGIRVVNCTLQNTDNGVRIKTWPSAKCATTASEIHFENILLKNVSNPILIDQEYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PS +K+ ++SFK+I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  305  WNQCNKQKPSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCKNVEIGDINIKYTGADGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A   C NV P L G   P  C
Sbjct  365  ATFSCSNVSPKLKGTQVPKAC  385



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWP-ASPEGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            EQ V  + I NC L  T  G+RIKTWP A+    A+ +HFED+ + NVS PILIDQ+YCP
Sbjct  246  EQDVSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCP  305

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC     S +K+ ++SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  306  WNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGP  365

Query  369  AISECDNVKPTLSGKNSPAIC  307
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLLGSQSPKAC  386



>ref|XP_008229862.1| PREDICTED: polygalacturonase-like [Prunus mume]
Length=726

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 89/141 (63%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E PV  V +KNC L NT  G+RIKTWP SP  G AT +HF+D+ M NV  PI IDQQYCP
Sbjct  245  EVPVAGVLVKNCTLTNTQNGLRIKTWPGSPAFGTATHIHFQDIAMVNVGNPIFIDQQYCP  304

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            ++QC    PS V+IS VSF  I GTSAT VAV+L+CS  +PC  V L  + + Y G  G 
Sbjct  305  YSQCAQKAPSTVQISSVSFVNIKGTSATPVAVQLMCSRKLPCQNVGLEDIDITYSGDKGP  364

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S+C  VKP  +   +P  C
Sbjct  365  LTSQCAYVKPQFTRVANPLSC  385



>ref|XP_008465833.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=384

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPE-GVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E PV+ +  KNC LINT  GVRIKT P+SP  GVA+ +HFED+ M NV  P++IDQ+YCP
Sbjct  233  EAPVQGIRAKNCTLINTTNGVRIKTRPSSPSLGVASDIHFEDIIMVNVINPMVIDQEYCP  292

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
             NQC    PSKVKIS+VSF  I GT+A  +AV  +CSS  PC  + ++ + L Y G+   
Sbjct  293  SNQCDKKNPSKVKISNVSFTNIRGTAANALAVSFVCSSQFPCEDIKVTDINLTYNGSGDP  352

Query  369  AISECDNVKPTLSGKNSPAIC  307
              S C  VKP +SG  +P IC
Sbjct  353  ISSTCKYVKPIVSGIQNPQIC  373



>ref|XP_004154223.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=113

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -2

Query  618  MHFEDVRMDNVSTPILIDQQYCPWNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCS  439
            MHFED+ MDNVS PI+IDQ+YCPWNQC   V SK+KIS+VSFK I GTSAT +AVK++CS
Sbjct  1    MHFEDIEMDNVSNPIIIDQEYCPWNQCNRKVASKIKISNVSFKNIRGTSATAIAVKIVCS  60

Query  438  SGVPCNKVVLSGVKLEYKGTNGSAISECDNVKPTLSGKNSPAIC  307
              +PC  V ++ + L Y G  G   S+C NVKP ++GK +P IC
Sbjct  61   KSIPCEGVEIADIDLTYSGPEGPIKSQCANVKPVITGKQNPPIC  104



>ref|XP_004491599.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=393

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASP-EGVATRMHFEDVRMDNVSTPILIDQQYCP  550
            E+PVE + +KNC L NT  GVRIKTWP++P     T MHFED+ M +V  P++IDQ+YCP
Sbjct  251  EEPVEQLLVKNCTLTNTDNGVRIKTWPSTPGTNPITDMHFEDITMVDVLNPVIIDQEYCP  310

Query  549  WNQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  370
            WNQC    PSK+KIS V+FK I GTS TK  V L+CS  VPC  V L+ V L + GT   
Sbjct  311  WNQCSKQSPSKIKISKVTFKNIKGTSKTKDGVILICSKSVPCEGVELNNVALTFNGTEVD  370

Query  369  AISECDNVKPTLSGK  325
            A  +C NVKP ++GK
Sbjct  371  A--KCVNVKPIVTGK  383



>ref|XP_010536242.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=291

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -2

Query  726  EQPVEDVSIKNCKLINTMFGVRIKTWPASPEGVATRMHFEDVRMDNVSTPILIDQQYCPW  547
            E+PV  + ++NC   NT  GVR+KTW +S + +AT ++F+D+ + NVS PI+IDQ+YCP+
Sbjct  157  EEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQEYCPY  216

Query  546  NQCKAGVPSKVKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  373
            N CKA  PS+VK+S++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y G++G
Sbjct  217  NHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDG  274



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1198105707698