BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25850_g1_i2 len=769 path=[8601:0-20 8622:21-44 8646:45-102
16046:103-126 16070:127-133 16077:134-134 16078:135-151
16095:152-161 10414:162-192 11302:193-219 14494:220-261
11328:262-272 16207:273-277 16212:278-303 16238:304-320
10464:321-339 10483:340-341 9208:342-372 16300:373-388 16316:389-390
16318:391-393 16321:394-413 16341:414-476 16438:477-477
16439:478-492 16455:493-497 16460:498-498 16461:499-499
16462:500-507 16708:508-522 16365:523-535 16378:536-546
16483:547-547 16484:548-556 16493:557-575 16512:576-590
16527:591-594 16531:595-754 16853:755-755 2778:756-768]

Length=769
                                                                      Score     E

gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     205   8e-60   
ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    204   2e-59   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    204   4e-59   
gb|KCW88708.1|  hypothetical protein EUGRSUZ_A01063                     194   5e-58   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    197   2e-56   
ref|XP_006279044.1|  hypothetical protein CARUB_v100165411mg            187   2e-55   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               194   3e-55   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               194   3e-55   
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     193   2e-54   
dbj|BAH20364.1|  AT3G14040                                              187   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             189   1e-53   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    189   1e-53   
ref|XP_002884670.1|  exopolygalacturonase                               190   2e-53   
ref|XP_002862616.1|  polygalacturonase                                  189   4e-53   
ref|XP_002885005.1|  polygalacturonase                                  189   4e-53   
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               184   5e-53   
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    189   5e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                      189   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                            189   5e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51692.1|  exopolygalacturonase                                   189   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             189   7e-53   
ref|XP_010657162.1|  PREDICTED: polygalacturonase                       185   1e-52   
ref|XP_010112808.1|  hypothetical protein L484_020040                   187   1e-52   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    186   1e-52   Vitis vinifera
ref|NP_187442.1|  polygalacturonase-like protein                        187   3e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51033.1|  exopolygalacturonase                                   187   3e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               185   7e-52   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               184   9e-52   
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      184   1e-51   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  184   1e-51   
emb|CBI22049.3|  unnamed protein product                                182   2e-51   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               184   2e-51   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               184   2e-51   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    184   2e-51   Vitis vinifera
ref|XP_010093135.1|  hypothetical protein L484_009327                   183   2e-51   
ref|XP_007049259.1|  Polygalacturonase                                  184   2e-51   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  183   2e-51   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    183   3e-51   
emb|CDY35967.1|  BnaA05g29830D                                          180   3e-51   
ref|XP_008449943.1|  PREDICTED: exopolygalacturonase-like               176   3e-51   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    183   4e-51   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    182   6e-51   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               182   6e-51   
gb|ADK92878.1|  polygalacturonase                                       182   6e-51   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               182   6e-51   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               182   6e-51   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    182   6e-51   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    182   7e-51   Vitis vinifera
dbj|BAA89476.1|  polygalacturonase                                      182   9e-51   Salix gilgiana
dbj|BAA89477.1|  polygalacturonase                                      181   1e-50   Salix gilgiana
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               181   2e-50   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               181   2e-50   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               181   3e-50   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       181   3e-50   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  181   3e-50   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    181   3e-50   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    183   3e-50   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             181   3e-50   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  181   3e-50   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    181   3e-50   
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  176   4e-50   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    181   4e-50   
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    182   5e-50   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               180   5e-50   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    181   5e-50   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     179   6e-50   
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             179   6e-50   
dbj|BAA89478.1|  polygalacturonase                                      179   6e-50   Salix gilgiana
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               179   8e-50   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    179   9e-50   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               181   1e-49   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             179   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    179   2e-49   
ref|XP_010112811.1|  hypothetical protein L484_020043                   178   2e-49   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  178   2e-49   
gb|ADP09681.1|  polygalacturonase                                       179   2e-49   
emb|CBI22050.3|  unnamed protein product                                179   2e-49   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    178   2e-49   
dbj|BAA89479.1|  polygalacturonase                                      178   3e-49   Salix gilgiana
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               178   3e-49   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               177   3e-49   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               177   4e-49   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               177   5e-49   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    177   6e-49   Vitis vinifera
emb|CBI28390.3|  unnamed protein product                                178   6e-49   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             177   6e-49   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    177   6e-49   
emb|CBI22052.3|  unnamed protein product                                184   7e-49   
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               177   7e-49   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               176   7e-49   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    177   7e-49   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             176   1e-48   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               176   1e-48   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               176   2e-48   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    176   2e-48   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  176   2e-48   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    175   2e-48   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               175   3e-48   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               175   3e-48   
ref|XP_010112809.1|  hypothetical protein L484_020041                   175   4e-48   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    177   5e-48   
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               175   6e-48   
gb|AAO24261.1|  putative pollen polygalacturonase                       174   8e-48   Turnera subulata [white alder]
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    173   8e-48   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               174   1e-47   
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               174   1e-47   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               174   1e-47   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               174   2e-47   
emb|CDX74027.1|  BnaA03g30200D                                          174   2e-47   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     180   2e-47   Vitis vinifera
emb|CDY07972.1|  BnaC03g35510D                                          173   2e-47   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    173   2e-47   
emb|CDX80531.1|  BnaC07g29130D                                          173   2e-47   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               173   2e-47   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               172   2e-47   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               172   3e-47   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               172   3e-47   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               173   3e-47   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             174   6e-47   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               171   1e-46   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     174   1e-46   Vitis vinifera
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               170   2e-46   
gb|ADC53480.1|  polygalacturonase                                       170   2e-46   Gossypium hirsutum [American cotton]
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    169   3e-46   Oenothera organensis
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               169   4e-46   
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    169   5e-46
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       169   5e-46   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               169   6e-46   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               169   8e-46   
emb|CDP04343.1|  unnamed protein product                                169   9e-46   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    176   1e-45   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    168   1e-45   
emb|CDP04348.1|  unnamed protein product                                169   1e-45   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     167   2e-45   
emb|CDP04342.1|  unnamed protein product                                165   2e-45   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               167   3e-45   
emb|CDP18013.1|  unnamed protein product                                167   3e-45   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  167   3e-45   
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   167   4e-45   
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    166   4e-45
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       166   6e-45   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               166   2e-44   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    165   2e-44   Nicotiana tabacum [American tobacco]
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               167   2e-44   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  165   2e-44   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  166   2e-44   
emb|CAA50335.1|  polygalacturonase                                      164   2e-44   Nicotiana tabacum [American tobacco]
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  165   2e-44   
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g            162   3e-44   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               166   3e-44   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               165   3e-44   
gb|KDO36716.1|  hypothetical protein CISIN_1g036262mg                   159   3e-44   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               164   5e-44   
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  165   1e-43   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  163   1e-43   
emb|CDY35969.1|  BnaA05g29810D                                          165   1e-43   
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            159   1e-43   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    162   1e-43   Platanus x hispanica [London plane tree]
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    165   2e-43   
emb|CDP04350.1|  unnamed protein product                                162   2e-43   
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    160   2e-43   
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  162   3e-43   
emb|CDY28013.1|  BnaC05g44150D                                          163   4e-43   
gb|KHN24677.1|  Polygalacturonase                                       161   4e-43   
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  162   4e-43   
gb|ABE65925.1|  polygalacturonase/pectinase                             159   4e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    161   5e-43   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  161   7e-43   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    161   7e-43   
ref|XP_006492954.1|  PREDICTED: exopolygalacturonase-like               160   8e-43   
emb|CDP04347.1|  unnamed protein product                                154   9e-43   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       160   9e-43   
ref|XP_010112807.1|  hypothetical protein L484_020039                   160   1e-42   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             160   2e-42   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  160   2e-42   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             160   2e-42   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  160   2e-42   
ref|XP_007143491.1|  hypothetical protein PHAVU_007G0764001g            154   2e-42   
gb|AFK41055.1|  unknown                                                 159   2e-42   
gb|KHN44923.1|  Polygalacturonase                                       157   3e-42   
gb|KHN15656.1|  Polygalacturonase                                       158   3e-42   
emb|CDY07973.1|  BnaC03g35500D                                          153   3e-42   
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             159   3e-42   
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               159   4e-42   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               159   4e-42   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             159   4e-42   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               159   4e-42   
emb|CDY71093.1|  BnaCnng71300D                                          155   4e-42   
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  159   5e-42   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             158   5e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009348297.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    154   6e-42   
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               158   6e-42   
emb|CDY54512.1|  BnaC07g49180D                                          158   6e-42   
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               159   6e-42   
gb|KHN10402.1|  Polygalacturonase                                       157   6e-42   
ref|NP_187441.1|  polygalacturonase-like protein                        158   8e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007143497.1|  hypothetical protein PHAVU_007G0766000g            154   8e-42   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  158   9e-42   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  158   9e-42   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  158   9e-42   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  157   1e-41   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              157   1e-41   Ricinus communis
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  157   2e-41   
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               157   2e-41   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               157   2e-41   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               157   3e-41   
emb|CDY05701.1|  BnaC02g38360D                                          156   5e-41   
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               157   6e-41   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  155   7e-41   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               155   8e-41   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    155   8e-41   Brassica napus [oilseed rape]
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               153   1e-40   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               155   1e-40   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    155   1e-40   
ref|XP_008466943.1|  PREDICTED: polygalacturonase-like                  150   1e-40   
gb|ACP74159.1|  putative polygalacturonase                              154   2e-40   
emb|CDX86325.1|  BnaA06g30420D                                          154   2e-40   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       154   2e-40   
gb|ABR26683.1|  polygalacturonase                                       154   2e-40   Fragaria chiloensis
emb|CDY22139.1|  BnaC01g39620D                                          153   2e-40   
gb|ABE77145.1|  putative polygalacturonase                              154   2e-40   Fragaria x ananassa
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  154   2e-40   Ricinus communis
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  154   3e-40   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  154   3e-40   
gb|ABN13878.1|  polygalacturonase                                       154   3e-40   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  154   3e-40   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               154   3e-40   
dbj|BAC42591.1|  putative polygalacturonase                             149   4e-40   Arabidopsis thaliana [mouse-ear cress]
gb|KHN46909.1|  Polygalacturonase                                       153   4e-40   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       153   4e-40   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    154   4e-40   Gossypium hirsutum [American cotton]
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       153   4e-40   
emb|CDY22140.1|  BnaC01g39610D                                          153   4e-40   
gb|ABG38468.1|  pollen-expressed protein MF9c                           153   5e-40   Brassica oleracea
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  153   5e-40   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  153   5e-40   
emb|CDY07974.1|  BnaC03g35490D                                          153   5e-40   
gb|ABL63521.1|  pollen-specific protein MF9l                            153   5e-40   Brassica oleracea var. alboglabra
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               153   6e-40   
ref|XP_002884668.1|  polygalacturonase 3                                153   6e-40   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  154   7e-40   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  152   1e-39   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       152   1e-39   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             152   1e-39   
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             152   1e-39   
ref|XP_010489712.1|  PREDICTED: polygalacturonase-like                  151   1e-39   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  152   2e-39   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  152   2e-39   
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    152   2e-39   Gossypium barbadense [Egyptian cotton]
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             152   2e-39   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             151   2e-39   
gb|AAP37458.1|  polygalacturonase                                       152   2e-39   Fragaria x ananassa
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  151   3e-39   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  151   3e-39   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  151   3e-39   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    152   3e-39   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             150   5e-39   
emb|CAA05892.1|  polygalacturonase                                      150   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  150   5e-39   
ref|NP_187439.1|  polygalacturonase-like protein                        150   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003595656.1|  Polygalactorunase PG11                             150   5e-39   
ref|NP_199625.1|  putative polygalacturonase / pectinase                150   6e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AHL24657.1|  Sal k 6.01 allergen                                     150   6e-39   
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  150   6e-39   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             150   7e-39   
emb|CDY22137.1|  BnaC01g39640D                                          150   9e-39   
ref|NP_187440.1|  polygalacturonase-like protein                        150   9e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  150   9e-39   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  150   1e-38   
emb|CBI28400.3|  unnamed protein product                                143   2e-38   
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  147   2e-38   
gb|KHN40047.1|  Polygalacturonase                                       149   2e-38   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  149   2e-38   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        149   2e-38   Medicago sativa [alfalfa]
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  152   2e-38   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             149   2e-38   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             149   3e-38   
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             149   3e-38   Brassica oleracea
gb|AAP42648.1|  polygalacturonase                                       148   5e-38   Brassica napus [oilseed rape]
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       148   5e-38   
gb|AFK35534.1|  unknown                                                 148   6e-38   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               147   6e-38   
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               148   6e-38   
ref|XP_004154223.1|  PREDICTED: polygalacturonase-like                  140   7e-38   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          147   9e-38   
ref|XP_004174153.1|  PREDICTED: polygalacturonase-like                  139   1e-37   
ref|XP_006845391.1|  hypothetical protein AMTR_s00019p00057300          144   2e-37   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    146   2e-37   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  145   4e-37   
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               142   5e-37   
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    144   6e-37   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          144   3e-36   
gb|KDP30863.1|  hypothetical protein JCGZ_13806                         135   3e-36   
ref|XP_011097084.1|  PREDICTED: polygalacturonase-like                  140   4e-36   
gb|AES65915.2|  polygalacturonase 11c, putative                         143   5e-36   
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    143   5e-36   
emb|CAA72003.1|  polygalacturonase                                      142   6e-36   
ref|XP_003595659.1|  Polygalactorunase PG11                             142   6e-36   
gb|KHN43962.1|  Polygalacturonase                                       142   8e-36   
ref|XP_006845390.1|  hypothetical protein AMTR_s00019p00055750          137   8e-36   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  142   8e-36   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          141   1e-35   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               142   2e-35   
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  141   2e-35   
gb|ABY21306.1|  pollen allergen Pla o 2                                 140   3e-35   
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  142   4e-35   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             140   4e-35   
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               140   4e-35   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  140   4e-35   
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    141   6e-35   
ref|XP_009409865.1|  PREDICTED: exopolygalacturonase-like               139   8e-35   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  139   8e-35   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  139   9e-35   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                139   9e-35   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             139   1e-34   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  139   1e-34   
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       138   1e-34   
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          139   1e-34   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  139   1e-34   
ref|XP_008357340.1|  PREDICTED: exopolygalacturonase-like               134   2e-34   
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               139   2e-34   
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                138   2e-34   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                138   2e-34   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                138   2e-34   
emb|CBI28398.3|  unnamed protein product                                130   3e-34   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  137   3e-34   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                137   5e-34   
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    137   7e-34   
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             137   8e-34   
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  137   1e-33   
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               135   2e-33   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               135   2e-33   
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               135   2e-33   
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             134   5e-33   
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              134   6e-33   
emb|CDY01524.1|  BnaC07g35140D                                          134   6e-33   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  134   7e-33   
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               134   7e-33   
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          133   8e-33   
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             134   9e-33   
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    134   9e-33   
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               134   1e-32   
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               134   1e-32   
ref|XP_010645672.1|  PREDICTED: exopolygalacturonase                    132   1e-32   
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               133   1e-32   
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               133   1e-32   
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               133   1e-32   
gb|EPS61275.1|  polygalacturonase                                       129   2e-32   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  132   2e-32   
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             132   3e-32   
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               132   3e-32   
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    132   4e-32   
emb|CAA16789.1|  polygalacturonase-like protein                         131   4e-32   
ref|XP_006848769.1|  hypothetical protein AMTR_s00026p00071010          129   4e-32   
gb|KDO50514.1|  hypothetical protein CISIN_1g040962mg                   129   4e-32   
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               132   4e-32   
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    132   5e-32   
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               132   5e-32   
emb|CDX90415.1|  BnaA03g43660D                                          131   6e-32   
gb|AEK28685.1|  pectin lyase superfamily protein                        125   6e-32   
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    131   6e-32   
gb|ACU19275.1|  unknown                                                 124   6e-32   
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               129   1e-31   
ref|XP_011032297.1|  PREDICTED: polygalacturonase-like                  130   1e-31   
emb|CBM42665.1|  group 13 grass pollen allergen                         125   1e-31   
emb|CBM42664.1|  group 13 grass pollen allergen                         125   2e-31   
emb|CBI22963.3|  unnamed protein product                                130   2e-31   
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         129   3e-31   
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         129   3e-31   
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       130   3e-31   
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    129   3e-31   
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         129   3e-31   
ref|XP_010092712.1|  hypothetical protein L484_024607                   129   4e-31   
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             129   5e-31   
ref|XP_002300425.2|  hypothetical protein POPTR_0001s38690g             127   5e-31   
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               129   6e-31   
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    128   6e-31   
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               129   7e-31   
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               128   7e-31   
gb|AFS18538.1|  PG2                                                     123   8e-31   
emb|CDP04349.1|  unnamed protein product                                125   8e-31   
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    128   8e-31   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               127   9e-31   
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               128   1e-30   
ref|XP_002318410.2|  hypothetical protein POPTR_0012s02090g             123   1e-30   
ref|XP_004967188.1|  PREDICTED: exopolygalacturonase-like               123   2e-30   
dbj|BAJ88053.1|  predicted protein                                      127   2e-30   
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               127   2e-30   
emb|CDX88444.1|  BnaC06g38880D                                          127   2e-30   
emb|CDY52447.1|  BnaA07g39240D                                          127   2e-30   
ref|XP_002314146.2|  hypothetical protein POPTR_0009s04300g             127   2e-30   
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    127   2e-30   
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               127   2e-30   
ref|XP_007043097.1|  Pectin lyase-like superfamily protein isoform 3    126   3e-30   
gb|KDO71757.1|  hypothetical protein CISIN_1g0399591mg                  121   3e-30   
emb|CAN69218.1|  hypothetical protein VITISV_012014                     130   3e-30   
ref|XP_009586577.1|  PREDICTED: exopolygalacturonase-like               123   3e-30   
ref|XP_009417454.1|  PREDICTED: exopolygalacturonase-like               126   3e-30   
ref|XP_008450474.1|  PREDICTED: polygalacturonase-like                  125   4e-30   
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               126   4e-30   
ref|XP_007050989.1|  Polygalacturonase 4, putative                      126   5e-30   
gb|AAX45476.1|  polygalacturonase                                       126   5e-30   
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               126   6e-30   
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    126   6e-30   
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               125   7e-30   
ref|XP_004974902.1|  PREDICTED: exopolygalacturonase-like               125   9e-30   
ref|XP_010649600.1|  PREDICTED: exopolygalacturonase-like               125   9e-30   
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                125   9e-30   
emb|CDP06168.1|  unnamed protein product                                125   9e-30   
emb|CBI21720.3|  unnamed protein product                                118   1e-29   
ref|XP_008353213.1|  PREDICTED: exopolygalacturonase-like               125   1e-29   
gb|EPS62269.1|  hypothetical protein M569_12521                         122   1e-29   
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               124   2e-29   
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               124   2e-29   
ref|XP_004172677.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    119   2e-29   
ref|NP_001057816.2|  Os06g0545800                                       122   2e-29   
ref|XP_010646462.1|  PREDICTED: polygalacturonase                       124   2e-29   
emb|CBI23356.3|  unnamed protein product                                124   2e-29   
gb|EEC83381.1|  hypothetical protein OsI_28796                          120   3e-29   
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like               124   3e-29   
ref|XP_002438669.1|  hypothetical protein SORBIDRAFT_10g024000          119   3e-29   
gb|ACN85300.1|  exopolygalacturonase precursor                          124   4e-29   
ref|XP_010547006.1|  PREDICTED: exopolygalacturonase-like               124   4e-29   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               123   5e-29   
emb|CDY23765.1|  BnaC04g43570D                                          123   5e-29   
ref|XP_010099972.1|  hypothetical protein L484_014009                   123   6e-29   
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           123   6e-29   
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                123   6e-29   
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                  123   6e-29   
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          123   7e-29   
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           123   7e-29   
ref|XP_007143496.1|  hypothetical protein PHAVU_007G0766000g            117   8e-29   
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    122   1e-28   
ref|XP_010910801.1|  PREDICTED: exopolygalacturonase-like               122   1e-28   
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               122   1e-28   
gb|AFW76553.1|  hypothetical protein ZEAMMB73_007553                    121   1e-28   
ref|XP_004137312.1|  PREDICTED: exopolygalacturonase-like               120   1e-28   
gb|AAQ62998.1|  oil palm polygalacturonase allergen PEST459             122   1e-28   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               122   1e-28   
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                  122   1e-28   
gb|KGN53545.1|  hypothetical protein Csa_4G076240                       120   1e-28   
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             121   1e-28   
ref|XP_010324075.1|  PREDICTED: exopolygalacturonase-like               122   2e-28   
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             122   2e-28   
ref|XP_006489253.1|  PREDICTED: polygalacturonase-like                  122   2e-28   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               122   2e-28   
ref|XP_002444632.1|  hypothetical protein SORBIDRAFT_07g025130          121   2e-28   
ref|XP_008650471.1|  PREDICTED: exopolygalacturonase-like               121   2e-28   
ref|XP_002889191.1|  predicted protein                                  121   3e-28   
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               121   3e-28   
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               120   4e-28   
dbj|BAK05779.1|  predicted protein                                      120   4e-28   
ref|NP_001057815.1|  Os06g0545400                                       120   4e-28   
gb|EAZ01276.1|  hypothetical protein OsI_23299                          120   4e-28   
gb|ACN85237.1|  exopolygalacturonase precursor                          120   4e-28   
ref|XP_008337179.1|  PREDICTED: polygalacturonase-like                  117   4e-28   
ref|XP_002523118.1|  Exopolygalacturonase clone GBGE184 precursor...    119   4e-28   
ref|XP_004156544.1|  PREDICTED: exopolygalacturonase-like               120   4e-28   
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               120   5e-28   
gb|EEE68484.1|  hypothetical protein OsJ_26895                          120   5e-28   
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     120   5e-28   
ref|XP_004139060.1|  PREDICTED: polygalacturonase-like                  120   5e-28   
ref|NP_001061556.1|  Os08g0327200                                       120   6e-28   
ref|XP_008364854.1|  PREDICTED: exopolygalacturonase-like               120   7e-28   
emb|CBM42666.1|  group 13 grass pollen allergen                         115   7e-28   
gb|KGN56260.1|  hypothetical protein Csa_3G110080                       117   7e-28   
ref|XP_008452143.1|  PREDICTED: exopolygalacturonase                    120   7e-28   
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               120   8e-28   
ref|XP_009379685.1|  PREDICTED: exopolygalacturonase-like               120   8e-28   
gb|KGN58377.1|  hypothetical protein Csa_3G634290                       114   1e-27   
emb|CAA40803.1|  polygalacturonase                                      115   1e-27   
ref|XP_010676050.1|  PREDICTED: polygalacturonase-like                  119   1e-27   
emb|CBI28395.3|  unnamed protein product                                112   1e-27   
emb|CBM42667.1|  group 13 grass pollen allergen                         115   1e-27   
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               119   1e-27   
ref|XP_002529089.1|  Polygalacturonase precursor, putative              119   1e-27   
emb|CDP16134.1|  unnamed protein product                                119   1e-27   
ref|NP_001284460.1|  polygalacturonase-like precursor                   119   1e-27   
gb|EMT33862.1|  putative Exopolygalacturonase                           119   2e-27   
gb|KDP27841.1|  hypothetical protein JCGZ_18921                         119   2e-27   
gb|EAZ01129.1|  hypothetical protein OsI_23157                          119   2e-27   
gb|EEE65794.1|  hypothetical protein OsJ_21499                          119   2e-27   
dbj|BAD62225.1|  putative Exopolygalacturonase precursor                119   2e-27   
ref|XP_006395086.1|  hypothetical protein EUTSA_v10005587mg             119   2e-27   
gb|EMS68211.1|  Exopolygalacturonase                                    119   2e-27   
ref|XP_008223247.1|  PREDICTED: exopolygalacturonase-like               119   2e-27   
ref|XP_010248251.1|  PREDICTED: polygalacturonase-like                  114   2e-27   
emb|CDP18456.1|  unnamed protein product                                119   2e-27   
ref|XP_009416030.1|  PREDICTED: polygalacturonase-like                  118   2e-27   
ref|XP_002314372.2|  hypothetical protein POPTR_0010s01460g             118   2e-27   
ref|XP_007157814.1|  hypothetical protein PHAVU_002G100400g             118   3e-27   
emb|CDP17107.1|  unnamed protein product                                118   3e-27   
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          118   3e-27   
ref|XP_010101343.1|  hypothetical protein L484_020358                   118   3e-27   
ref|XP_010242497.1|  PREDICTED: polygalacturonase-like                  118   3e-27   
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               118   3e-27   
ref|XP_006659306.1|  PREDICTED: exopolygalacturonase-like               118   3e-27   
ref|XP_006419502.1|  hypothetical protein CICLE_v10004345mg             120   4e-27   
ref|XP_009343653.1|  PREDICTED: polygalacturonase-like                  118   4e-27   
ref|XP_010277790.1|  PREDICTED: polygalacturonase-like                  117   4e-27   



>gb|KCW46857.1| hypothetical protein EUGRSUZ_K00661 [Eucalyptus grandis]
Length=370

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+GVTV++C L+NT+NG+R+KTWP SP+GVASGMHFED+ ++NVS PILIDQ YCP+
Sbjct  226  EQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILIDQNYCPY  285

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C+  +PSK+KISDVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A
Sbjct  286  NNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTA  345

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C+NVKPT++GK S  IC
Sbjct  346  TSQCENVKPTIAGKLSLPIC  365



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GV V+HC +SNT+NGVRIKTWPASP G+AS +HFED+ M+NV  PIL+DQ+YCP+
Sbjct  259  EQPVRGVHVRHCTISNTMNGVRIKTWPASPAGIASNLHFEDIVMENVGTPILVDQEYCPY  318

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK G PS +KISDVSFK I GTS+TK AVKL+CS GVPC+KV LS + L Y G +G A
Sbjct  319  NHCKRGSPSMVKISDVSFKNIRGTSSTKTAVKLVCSKGVPCSKVELSDINLTYNGKDGPA  378

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +SEC NVKP LSGK  PA C A
Sbjct  379  VSECANVKPILSGKIIPAACTA  400



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+GVTV++C L+NT+NG+R+KTWP SP+GVASGMHFED+ ++NVS PILIDQ YCP+
Sbjct  263  EQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILIDQNYCPY  322

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C+  +PSK+KISDVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y G NG+A
Sbjct  323  NNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYNGRNGTA  382

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C+NVKPT++GK S  IC
Sbjct  383  TSQCENVKPTIAGKLSLPIC  402



>gb|KCW88708.1| hypothetical protein EUGRSUZ_A01063 [Eucalyptus grandis]
Length=174

 Score =   194 bits (492),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++IDQQYCPW
Sbjct  25   EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  84

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK+  PS+IKIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  85   NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  144

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NVKPT+SGK +PAIC ++
Sbjct  145  TSVCSNVKPTISGKQNPAICASA  167



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNV-SNPILIDQQYCP  592
            EQPV GVTV++C++SNT NGVRIKTWPASPNGVAS +HFED+ MDNV +NP+L+DQ+YCP
Sbjct  254  EQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLVDQEYCP  313

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGT-NG  415
            + QC+  +PSK+KIS+VSFK I GT+   VAVKL+CS G+PC  V ++ + L Y G  NG
Sbjct  314  YGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTYNGNKNG  373

Query  414  SAISECDNVKPTLSGKNSPAIC  349
            +AISEC NVKPT+SG N P +C
Sbjct  374  TAISECANVKPTVSGFNHPQVC  395



>ref|XP_006279044.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
 gb|EOA11942.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
Length=168

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP GVAS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  21   EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLIDQEYCPY  80

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPS++K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  81   GHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  140

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP L+GK  PA C
Sbjct  141  VSACSNIKPVLTGKLVPAAC  160



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++IDQQYCPW
Sbjct  252  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK+  PS+IKIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  312  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NVKPT+SGK +PAIC ++
Sbjct  372  TSVCSNVKPTISGKQNPAICTSA  394



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++IDQQYCPW
Sbjct  252  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK+  PS+IKIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  312  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKPT+SGK +PAIC
Sbjct  372  TSVCSNVKPTISGKQNPAIC  391



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++IDQQYCPW
Sbjct  317  EQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIIDQQYCPW  376

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK+  PS+IKIS+VSF  I GTS+T+ AV L CSS +PC +V +S + + Y G  G A
Sbjct  377  NQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYHGPEGPA  436

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NVKPT+SGK +PAIC ++
Sbjct  437  TSVCSNVKPTISGKQNPAICTSA  459



>dbj|BAH20364.1| AT3G14040 [Arabidopsis thaliana]
Length=289

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  142  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  201

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  202  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  261

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  262  VSACSNIKPILSGKLVPAAC  281



>ref|XP_006375551.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
 gb|ERP53348.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
Length=387

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+GVTV++C L+NT NGVRIKTWPASP+GVAS ++FED+ M+NVSNPILIDQ+YCP+
Sbjct  244  EQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQEYCPY  303

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C   VPS++KISDV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+
Sbjct  304  NNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVSVEDINLVYNGKEGSS  363

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NVKP +SGK  PA C  S
Sbjct  364  TSLCANVKPQVSGKVFPATCTPS  386



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+GVTV++C L+NT NGVRIKTWPASP+GVAS ++FED+ M+NVSNPILIDQ+YCP+
Sbjct  254  EQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILIDQEYCPY  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C   VPS++KISDV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y G  GS+
Sbjct  314  NNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLVYNGKEGSS  373

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NVKP +SGK  PA C  S
Sbjct  374  TSLCANVKPQVSGKVFPATCTPS  396



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  362  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  421

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  422  VSACSNIKPILSGKLVPAAC  441



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  357

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPA  417

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   189 bits (480),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + G  G A
Sbjct  362  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHNGKEGPA  421

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  422  VSACSNIKPILSGKLVPAAC  441



>ref|XP_004174175.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis sativus]
Length=261

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++IDQ+YCP
Sbjct  109  EKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  168

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  169  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  228

Query  411  AISECDNVKPTLSGKNSPAIC  349
             +SEC NV+P ++GK SP IC
Sbjct  229  ILSECANVQPLITGKQSPQIC  249



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  298  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  357

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  358  GHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  417

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  418  VSACSNIKPILSGKLVPAAC  437



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP GVAS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  302  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLIDQEYCPY  361

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPS++K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  362  GHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  421

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP L+GK  PA C
Sbjct  422  VSACSNIKPVLTGKLVPAAC  441



>ref|XP_010657162.1| PREDICTED: polygalacturonase [Vitis vinifera]
Length=336

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  196  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  255

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY G +G A
Sbjct  256  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPA  315

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C N+KP + G   P IC
Sbjct  316  MSQCKNIKPNVLGAQLPRIC  335



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV GV V++C + NT NGVR+KTWP S +G+AS +HFED+ M+NV NP+LIDQ+YCPW
Sbjct  253  EDPVEGVIVRNCTIRNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLIDQEYCPW  312

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPS+IKISDVSFK I GTS T +AV L+CSSG PC  V ++ + L+Y G +G  
Sbjct  313  NQCNAKVPSRIKISDVSFKNIRGTSTTALAVNLVCSSGFPCQNVEIADIDLQYSGNDGPI  372

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C NVKPT+SGK +P  C
Sbjct  373  MSQCKNVKPTISGKQNPNPC  392



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPA  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  356

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPS++K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  357  GHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  416

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  417  VSACSNIKPILSGKLVPAAC  436



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP+
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLIDQEYCPY  356

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPS++K+SDV+ K I GTSATKVAVKL+CS GVPC  + LS + L + G  G A
Sbjct  357  GHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHNGKEGPA  416

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  PA C
Sbjct  417  VSACSNIKPILSGKLVPAAC  436



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV VK+C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFLDITMVNVSNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PSKIKI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  316  WNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              SEC NVKP +SG  +P IC +S
Sbjct  376  LTSECMNVKPIISGTQNPPICSSS  399



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQCK  VPSKIKIS+VSFK I G+SAT +AV+++CSSG+ C KV L  + L Y G  G 
Sbjct  315  WNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLTYNGNKGP  374

Query  411  AISECDNVKPTLS  373
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+TV+ C ++NT+ GVRIKTWPAS  G+AS M FE++ MDNV  PILIDQQYCP+
Sbjct  258  EKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIVMDNVGTPILIDQQYCPY  317

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              C   VPS+++ISDV FK I GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+A
Sbjct  318  GTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTA  377

Query  408  ISECDNVKPTLSGKNSPAIC  349
            ISEC NVKP + G+  P  C
Sbjct  378  ISECSNVKPAVVGRVVPPAC  397



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 110/144 (76%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV VK+C + NT NGVRIKTWPASPN G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITMVNVSNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  316  WNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGP  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKP +SG  +P+IC +S
Sbjct  376  ITSQCMNVKPIVSGIQNPSICSSS  399



>emb|CBI22049.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  195  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  254

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY G +G A
Sbjct  255  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYNGNDGPA  314

Query  408  ISECDNVKPTLSGKNSPAI  352
            +S+C N+KP + G   P I
Sbjct  315  MSQCKNIKPNVLGAQLPRI  333



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQCK  VPSK+KIS+VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y G  G 
Sbjct  315  WNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGP  374

Query  411  AISECDNVKPTLS  373
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 107/133 (80%), Gaps = 1/133 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LIDQQYCP
Sbjct  255  EEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLIDQQYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQCK  VPSK+KIS+VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y G  G 
Sbjct  315  WNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTYNGNKGP  374

Query  411  AISECDNVKPTLS  373
              S+C NVKPT++
Sbjct  375  LTSQCSNVKPTIT  387



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPA  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V GV VK C L NT NGVRIKTWP S  G AS MHFED+++DNV NPI+IDQ+YCPW
Sbjct  251  EEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIVIDQEYCPW  310

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   V S++K+S++SFK I G+S+T VAVKL+CS G PC  V LS + L YKG+ G+ 
Sbjct  311  NKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLSYKGSEGAI  370

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             SEC NVKP LSGK +P  C  S
Sbjct  371  TSECKNVKPILSGKENPRACITS  393



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ V++C LSNT+NGVR+KTWP S  G A+ MHFED+ ++NV NPILIDQ+YCPW
Sbjct  257  EEPVSGIFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPW  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C   VPS+IK+S++SFK+I GTS+T+ AV+L+CS G+PC++V L+ + + YKG  G A
Sbjct  317  NLCNLKVPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYKGPGGPA  376

Query  408  ISECDNVKPTLSGKNSPAICDA  343
             SEC NVKP  SGK +P  C +
Sbjct  377  TSECTNVKPRTSGKQNPPACSS  398



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++IDQ+YCP
Sbjct  245  EKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  304

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  305  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  364

Query  411  AISECDNVKPTLSGKNSPAIC  349
             +SEC NV+P ++GK SP IC
Sbjct  365  ILSECANVQPLITGKQSPQIC  385



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++IDQ+YCP
Sbjct  245  EKDVVGVTVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVIIDQEYCP  304

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y G  G 
Sbjct  305  WNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTYSGIRGP  364

Query  411  AISECDNVKPTLSGKNSPAIC  349
             +SEC NV+P ++GK SP IC
Sbjct  365  ILSECANVQPLITGKQSPQIC  385



>emb|CDY35967.1| BnaA05g29830D [Brassica napus]
Length=293

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS PILIDQ+YCP+
Sbjct  146  EQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILIDQEYCPY  205

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+FK I GTSATK AVKL+CS G PC  V L+ + L + G  G A
Sbjct  206  ADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPA  265

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +  C N+KP L+G+  P  C
Sbjct  266  VGACANMKPVLTGQMIPPAC  285



>ref|XP_008449943.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=149

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -2

Query  756  MGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCPWNQC  580
            MGVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LIDQ+YCPWNQC
Sbjct  1    MGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQC  60

Query  579  KTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISE  400
               VPSKIKIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+
Sbjct  61   NRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQ  120

Query  399  CDNVKPTLSGKNSPAIC  349
            C NVKP +SGK +P IC
Sbjct  121  CANVKPVISGKQNPPIC  137



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 109/141 (77%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNV-SNPILIDQQYCP  592
            EQPV GVTV++C +SNT NGVR+KTWPASPNGVAS +HFED+ M+NV ++P+LIDQ+YCP
Sbjct  255  EQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLIDQEYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
              QC+  +PSK+KIS+VSFK I GTSA  V VKL CS G+PC  V +S + L Y G NG+
Sbjct  315  NGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQISDIHLTYNGKNGA  374

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A S C NVKPT++G+  P  C
Sbjct  375  ATSVCTNVKPTMTGQIFPPAC  395



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 110/140 (79%), Gaps = 2/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+G+TVK+C L++T+NGVRIKTWPASP+G+AS M FE++ M+NVSNPI+IDQQYCP+
Sbjct  254  EQPVVGITVKNCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMIDQQYCPY  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            +QC+  +PS++KISDVSF  I GTSAT++AVKL+CS G+PC  V +  + L Y    G A
Sbjct  314  SQCEAKIPSRVKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYN--KGQA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP + G   PA C
Sbjct  372  TSQCANVKPQVRGSVVPAPC  391



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  NQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            ++PV G+ V +C L NT NGVR+KTWPAS  G+AS MHFED+ M NVSNP+LIDQ+YCP 
Sbjct  257  DEPVFGINVVNCALINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPS  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C    PS++KIS+VSFK I GTSAT+VAVKL CSSG+PC  V +  + L Y GT G A
Sbjct  317  NKCNLKAPSRVKISNVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYIGTKGPA  376

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKPT++G+ +P  C
Sbjct  377  TSQCSNVKPTIAGRQTPLAC  396



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KT+PAS  G+AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IK+S+VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A
Sbjct  315  NQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPA  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C N+KP L G   P IC
Sbjct  375  MSQCKNIKPNLLGVQLPRIC  394



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   182 bits (461),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +SNT NGVRIK+WP    GVAS MHFED+ M+NV NPIL+DQ YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLVYSGSEGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPKISGIMSASGC  393



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +SNT NGVRIK+WP    GVAS MHFED+ M+NV NPIL+DQ YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLLYSGSEGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPKISGIMSASGC  393



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            +QCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            +QCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV VK+C + NT NGVRIKTWP SP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  256  EEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI+ VSF+ I G+SAT VAVKL+CSS +PC++V ++ + L Y G NGS
Sbjct  316  WNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDEVKVANIDLIYNGINGS  375

Query  411  AISECDNVKPTLSGKNSPAICDA  343
              S+C NVKP +SG  +P+IC +
Sbjct  376  ITSQCMNVKPIISGIQNPSICSS  398



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV V +C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  255  EEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILIDQEYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  315  WNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  374

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              SEC NVKP +SG  +P IC +S
Sbjct  375  ITSECMNVKPIISGIQNPPICSSS  398



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV V +C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  255  EEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILIDQEYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI+ VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y G  GS
Sbjct  315  WNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVYNGIKGS  374

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              SEC NVKP +SG  +P IC +S
Sbjct  375  ITSECMNVKPIISGIQNPPICSSS  398



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GV VK+C + NT NGVRIKTW ASP  G+A  MHF D+ M NVSNPILIDQ+YCP
Sbjct  253  EEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINVSNPILIDQEYCP  312

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PSKIKI+ VSFK I G SAT VAVKL+CSS +PC +V ++ + L Y GT GS
Sbjct  313  WNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVANIDLVYNGTKGS  372

Query  411  AISECDNVKPTLSGKNSPAICDA  343
              S+C NVKP LSG  +P+IC +
Sbjct  373  ITSQCMNVKPILSGIQNPSICSS  395



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ +++C +SNT+NGVR+KTWP S  G A+ MHFED+ ++NV NPILIDQ+YCPW
Sbjct  257  EEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILIDQEYCPW  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C   VPS++K+S++SFK+I GTS+T+ AVKL+CS G+PC++V L+ + + YKG  G A
Sbjct  317  NLCNLKVPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDRVELADIDITYKGPGGPA  376

Query  408  ISECDNVKPTLSGKNSPAIC  349
            IS+C NVKP LSGK +P  C
Sbjct  377  ISQCINVKPRLSGKQNPPAC  396



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+G+ V+ C +SNT NGVRIKTWPAS  G AS +HFED+KM+NVSNPIL+DQ YCP 
Sbjct  250  EQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPH  309

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPS++K+  VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y G  G  
Sbjct  310  NQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPI  369

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             SEC N++P  SGK +P  C AS
Sbjct  370  KSECTNIQPKTSGKMNPPPCIAS  392



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+G+ V+ C +SNT NGVRIKTWPAS  G AS +HFED+KM+NVSNPIL+DQ YCP 
Sbjct  248  EQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLDQVYCPH  307

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPS++K+  VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y G  G  
Sbjct  308  NQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYTGPEGPI  367

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             SEC N++P  SGK +P  C AS
Sbjct  368  KSECTNIQPKTSGKMNPPPCIAS  390



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP 
Sbjct  297  EQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  356

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK GVPS++K+SDV+ K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  357  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALADINLVHNGKEGPA  416

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  P  C
Sbjct  417  VSACSNIKPVLSGKLVPEAC  436



>ref|XP_004171844.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=256

 Score =   176 bits (446),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  V VK+C + NT NGVRIKTWP SP  G+A+ MHF D+ M NVSNPI+IDQ+YCP
Sbjct  107  EEPVEDVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPIVIDQEYCP  166

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI+ VSFK I G+SAT VAVKL+CSS +PC +V LS + L Y G  GS
Sbjct  167  WNQCNRKIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKLSNIDLIYNGIKGS  226

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKP + G  +P IC +S
Sbjct  227  ITSQCMNVKPIIYGIQNPPICSSS  250



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP 
Sbjct  292  EQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLIDQEYCPH  351

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK GVPS++K+SDV+ K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  352  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPA  411

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  P  C
Sbjct  412  VSACSNIKPILSGKLVPEAC  431



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS PILIDQ+YCP+
Sbjct  329  EQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILIDQEYCPY  388

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK GVPSK+K+SDV+FK I GTSATK AVKL+CS G PC  V L+ + L + G  G A
Sbjct  389  ADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHNGPEGPA  448

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +  C N+KP L+G+  P  C
Sbjct  449  VGACANMKPVLTGQMIPPAC  468



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   180 bits (456),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG PC KV L+ + L YKG  G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP 
Sbjct  297  EQPVRGVTVRKCTIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  356

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK GVPS++K+SDV+ K I GTSATKVAVKL+CS G PC  + LS + L + G  G A
Sbjct  357  GKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALSDINLVHNGKEGPA  416

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP ++GK  P  C
Sbjct  417  VSACSNIKPVITGKLIPEAC  436



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C ++   NGVRIKTWPAS  G+A+ MHFED++M+NV NP+LIDQ YCPW
Sbjct  251  EEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPW  310

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC+  +PS +KIS+VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  311  NQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  370

Query  408  ISECDNVKPTLSGKNSPAICDA  343
             SEC NV+P +SG  +P   DA
Sbjct  371  TSECSNVRPLISGMQNPRAYDA  392



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+G  G A
Sbjct  314  NQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +SNT NGVRIK+WP    G AS MHFED+ M+NV NP+++DQ+YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGAASNMHFEDIVMNNVQNPVVVDQEYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V VKL CS G+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKSPSKVKISDVSFKNIRGTSATPVVVKLACSGGIPCEKVELADINLVYSGSEGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKPT+SG  S + C
Sbjct  374  KSQCSNVKPTISGIMSASGC  393



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C ++   NGVRIKTWPAS  G+A+ MHFED++M+NV NP+LIDQ YCPW
Sbjct  251  EEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLIDQGYCPW  310

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC+  +PS +KIS+VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  311  NQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  370

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NV+P +SG  +P  C
Sbjct  371  TSECSNVRPLISGMQNPRAC  390



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   179 bits (454),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+TV +C L NT NGVR+KTWPAS  G+AS MHFED+ M NVSNP+LIDQ+YCP 
Sbjct  257  EDPVFGITVANCTLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLIDQEYCPG  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C    PS++KIS+VSFK I GTSAT+VAV+L CSSG+PC  V +  + L Y GT G A
Sbjct  317  NKCAKA-PSRVKISNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYIGTEGPA  375

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKP ++GK +P  C
Sbjct  376  TSRCSNVKPIITGKQTPLAC  395



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++DQ YCP+
Sbjct  252  EEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILDQGYCPF  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            +QCK GVPS IKIS VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y G  G A
Sbjct  312  DQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYNGPEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKP LSGK +PA C
Sbjct  372  TSECANVKPVLSGKLNPAAC  391


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  579  KTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISE  400
            K  +P+K+KISDVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG+A S+
Sbjct  393  KPHIPTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQ  452

Query  399  CDNVKPTLSGKNSPAIC  349
            C NVKPT++GK+S  +C
Sbjct  453  CANVKPTITGKSSLPLC  469



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  295  EKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQGYCPW  354

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+G  G A
Sbjct  355  NQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYRGPGGPA  414

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  415  KSQCSNVKPIISGIMSASGC  434



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LIDQ+YCP 
Sbjct  292  EQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLIDQEYCPH  351

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK GVPS++K+SDV  K I GTSATKVAVKL+CS G PC  + L+ + L + G  G A
Sbjct  352  GKCKAGVPSQVKLSDVIIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHNGKEGPA  411

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP LSGK  P  C
Sbjct  412  VSACSNIKPILSGKLVPEAC  431



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+ V  C L NTLNGVRIKTWP S  G AS +HF D+ M+NV NP+LIDQ+YCPW
Sbjct  251  ELPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLIDQEYCPW  310

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPSK+K+S++SFK+I GTS+T +AV L+CSSG PC  VV+  + L+Y G+ G  
Sbjct  311  NQCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYSGSQGPI  370

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S+C NVKPT+ G  +PA C  S
Sbjct  371  TSKCKNVKPTVGGVQNPAACITS  393



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  V VK+C + NT NGVRIKTWP+SP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  257  EEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHFSDITMINVSNPILIDQEYCP  316

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  317  WNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQPCEEVKVANIDLVYNGINGP  376

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKP +SG  +P+IC +S
Sbjct  377  VTSQCMNVKPIISGIQNPSICSSS  400



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL  T NGVRIK+WP S     AS MHFED++M+NV+NPI+IDQ+YCP
Sbjct  263  EKEVVGVTVKKCKLIGTTNGVRIKSWPDSAVSYPASDMHFEDIEMENVANPIIIDQEYCP  322

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPS IKIS VSFK I GTS+T VAVKL+CS   PC  V ++ + L Y G  G 
Sbjct  323  WNQCNRKVPSAIKISKVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTYSGKEGP  382

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A+SEC NVKPT+SGK +P IC
Sbjct  383  AVSECSNVKPTISGKQNPPIC  403



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYNGNEGPA  374

Query  408  ISECDNVKPTLSG  370
            +S+C N+KP L G
Sbjct  375  MSQCKNIKPNLLG  387



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+TV+ C ++NT+ GVRIK+WPAS  G+AS M FE + M+NV  PILIDQQYCP+
Sbjct  257  EKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILIDQQYCPY  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              C   +PS+++IS+V FK I GTS T+VAVKL+CS G PC  V LS + L+Y GTNG+A
Sbjct  317  GTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYSGTNGTA  376

Query  408  ISECDNVKPTLSGKNSPAIC  349
            ISEC NVKP ++G   P  C
Sbjct  377  ISECSNVKPAIAGSVVPPAC  396



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C +SNT NGVRIK+WP    G AS MHFED+ M+NV NP+ +DQ+YCPW
Sbjct  254  EKPVSGIFVKNCTISNTANGVRIKSWPDLYGGDASNMHFEDIVMNNVQNPVAVDQEYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y G+ G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELADINLVYSGSEGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S + C
Sbjct  374  KSQCSNVKPIISGIMSASGC  393



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPMISGIMSAPGC  393



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIISGIMSAPGC  393



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C ++NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            +NQC   VPSK+KIS+VSFK I G+S+T V +KL+CS G+PC  V LS + L Y G  GS
Sbjct  316  YNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGS  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              SEC ++KPT++    P  C  S
Sbjct  376  ITSECKHIKPTINNVAQPLACATS  399



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 108/144 (75%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  V VK+C + NT NG+RIKTWP+SP  G+A+ MHF D+ M NVSNPILIDQ+YCP
Sbjct  256  EEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMHFSDITMVNVSNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKI++VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y G NG 
Sbjct  316  WNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNKPCEEVKVANIDLVYNGINGP  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKP +SG  +P+IC +S
Sbjct  376  VTSQCMNVKPIISGIQNPSICSSS  399



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV+G+ V    L+NT NG+R+KTWPASP G+AS MHFED+ M+NV NPILIDQ+YCP+
Sbjct  254  EAPVVGIKVTGSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILIDQEYCPY  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            +QCK  +PS++KISDV+FK I GTS+T++AVKL+CSSGVPC  V L+ + L++ G  G+ 
Sbjct  314  SQCKQQIPSRVKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFNG--GAP  371

Query  408  ISECDNVKPTLSGKNSPAICDA  343
             S C NVKP L G   P  C A
Sbjct  372  TSICKNVKPILGGVQQPRSCSA  393



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   178 bits (452),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KT+PAS  G+AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IK+S+VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y G  G A
Sbjct  315  NQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYNGKEGPA  374

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S+C N+KP L G+   ++  A
Sbjct  375  MSQCKNIKPNLLGQEPFSVIHA  396



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C LS+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KIS VSFK I GTSAT V V++ CSSG PC KV L+ +K+ Y G +G A
Sbjct  314  NQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKVAYSGPDGPA  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIISGTMSAPGC  393



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C  +NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PS+I +S+VSF+ I GT++T+VAVKL+CS GVPC    L  + L+Y G  G A
Sbjct  315  NQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDINLKYNGKVGHA  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S+C N+KP L G   P  C
Sbjct  375  MSQCKNIKPNLLGTQLPRTC  394



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   184 bits (466),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+IDQ+YCP 
Sbjct  255  EEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIIDQEYCPH  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS+IKIS+VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY G  G A
Sbjct  315  NQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYNGNEGPA  374

Query  408  ISECDNVKPTLSGKNSPAI  352
            +S+C N+KP L G   P I
Sbjct  375  MSQCKNIKPNLLGVQLPRI  393



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+T+K+C L++T NGVRIKTWPASP+ G AS +HFED+ M NV NPILIDQ+YCP
Sbjct  255  EEPVSGITIKNCTLTDTQNGVRIKTWPASPSAGTASDIHFEDIIMVNVGNPILIDQEYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSK+KIS+VSFK I GTS T +A+KL+CS G+PC  V LS + L+Y G  G 
Sbjct  315  WNQCTLKVPSKVKISNVSFKNIKGTSTTPLALKLVCSKGLPCENVELSDIDLKYTGNQGP  374

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKP ++    P  C  S
Sbjct  375  LTSKCTNVKPKITRVTKPLACATS  398



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL++T NGVRIKTWP S     AS MHFED++M NVSNP++IDQ+YCP
Sbjct  213  EKEVVGVTVKKCKLTDTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVIIDQEYCP  272

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS+VSFK I GTSAT VAVK++CS   PC  V ++ + L Y G+ G 
Sbjct  273  WNQCNRKVPSKIKISNVSFKNIRGTSATPVAVKIVCSQSNPCEGVEVADIDLTYSGSEGP  332

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  333  IKSQCANVKPVISGKQNPPIC  353



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV+G+ VK+C LS+T NGVR+KTWP+SP G A+ MHF D+ M+NVSNPI+IDQ+YCP 
Sbjct  253  EAPVIGIRVKNCTLSDTTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  312

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PS++K+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  313  NQCNLQIPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  372

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NV+ TL G   P  C
Sbjct  373  SSQCKNVEATLWGTQQPKTC  392



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ VK+C LS+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  234  EKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  293

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KIS VSFK I GTSAT V V++ CSSG PC KV L+ +KL Y G +G +
Sbjct  294  NQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKLAYSGPDGPS  353

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S   C
Sbjct  354  KSQCSNVKPIISGIMSAPGC  373



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C +SNT NGVRIKTWPASP NGV S +HFED+ MDNV NP++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVIIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC   VPSK+KIS+VSFK I G+S+T V +KL+CS G+PC  V LS + L Y G  GS
Sbjct  316  HNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTYTGKEGS  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              SEC ++KPT+     P  C  S
Sbjct  376  ITSECKHIKPTIDNVAQPLACATS  399



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ ++GVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LIDQ+YCP
Sbjct  251  EKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G 
Sbjct  311  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGP  370

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  371  IKSQCANVKPVISGKQNPPIC  391



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ ++GVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LIDQ+YCP
Sbjct  252  EKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCP  311

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G 
Sbjct  312  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGP  371

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPVISGKQNPPIC  392



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL+ T NGVRIKTWP S     A+ MHFED++MDNVSNPI+IDQ+YCP
Sbjct  271  EKEVVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIIIDQEYCP  330

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   V SKIKIS+VSFK I GTSAT +AVK++CS  +PC  V ++ + L Y G  G 
Sbjct  331  WNQCNRKVASKIKISNVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTYSGPEGP  390

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP ++GK +P IC
Sbjct  391  IKSQCANVKPVITGKQNPPIC  411



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 107/143 (75%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVS-NPILIDQQYCP  592
            EQPV GVTV++C + NT NGVR+KTWPASPNGVAS +HFED+ M+NV+ +P+LIDQ+YCP
Sbjct  255  EQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLIDQEYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
              QC+  +PS++KIS+VSFK I GTSA  VAVKL CS G+PC  V +S + L   G NG+
Sbjct  315  NGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISDINLTCNGKNGT  374

Query  411  AISECDNVKPTLSGKNSPAICDA  343
              S C NV PT++GK  P  C A
Sbjct  375  CTSVCSNVNPTVTGKVIPPACSA  397



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+CK GVPSK+KIS+VSFK I GT    VAVKL C+ G+PC  V LS + L+Y G  G 
Sbjct  316  WNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKYIGDKGP  375

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S C NVKPT++    P  C
Sbjct  376  ITSVCSNVKPTINRVAQPLAC  396



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL++T NGVRIKTWP S     AS MHFED++M NVSNP++IDQ+YCP
Sbjct  252  EKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVIIDQEYCP  311

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT VAVK++CS   PC +V ++ + L Y G+ G 
Sbjct  312  WNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTYSGSEGP  371

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPVISGKQNPPIC  392



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V GV VK C L NT NGVRIKTWP S  G AS +HFED+ M+NV NP++IDQ+YCPW
Sbjct  255  EEAVKGVDVKSCTLKNTQNGVRIKTWPDSQEGKASDLHFEDIIMENVGNPVMIDQEYCPW  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC + +PS+++IS V FK I GTS+T +AVKL+CS G+PC  V ++ + L+Y G  G  
Sbjct  315  NQCVSQLPSRVQISGVRFKNIRGTSSTALAVKLVCSGGLPCQDVEMTDIDLKYSGDEGQI  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NVKPT+SG  +P  C
Sbjct  375  TSECKNVKPTVSGIQNPPAC  394



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+P+ GV V+ C + NT NGVRIKTWP SP G+AS + FED+ MDNV+ PILIDQ+YCP 
Sbjct  359  EEPLKGVVVRKCIIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVTTPILIDQEYCPH  418

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK GVPSK+K+SDV+FK I GTSA+K+AVK++CS G PC  + L+ + L   G  G A
Sbjct  419  GKCKAGVPSKVKLSDVTFKNIKGTSASKIAVKIICSKGCPCTNIALTDINLVSSGKEGPA  478

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C N+KP +SGK  PA C
Sbjct  479  VSACANMKPVVSGKVVPAAC  498



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   175 bits (443),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  325

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+KISD+ FK + G S+ K AVKL+CS GVPC+KV L+ + L+Y GT+G A
Sbjct  326  NHCKAKTPSKVKISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYTGTDGPA  385

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C  VKP L+GK SP  CDA
Sbjct  386  VSMCKFVKPLLTGKQSPPACDA  407



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GV VK+C L NT NGVRIK+WPA   G AS +HFED+ M+NV+NP++IDQ+YCPW
Sbjct  249  EQPVRGVLVKNCILKNTDNGVRIKSWPAMKGGEASDIHFEDITMENVTNPVIIDQEYCPW  308

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KIS+VSFK I GT+ T  AVK++CSS +PC +V L+G+ L+Y GT G A
Sbjct  309  NQCTKDAPSKVKISNVSFKNIKGTTNTPEAVKIICSSALPCEQVQLNGIDLKYTGTQGPA  368

Query  408  ISECDNVKPTLSG  370
             SEC N K T++G
Sbjct  369  KSECKNAKLTVTG  381



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++DQ+YCPW
Sbjct  217  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  276

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+KISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A
Sbjct  277  NHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPA  336

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C  VKP L+GK SP  CDA
Sbjct  337  VSMCKFVKPLLTGKQSPPACDA  358



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 107/141 (76%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K C LSNT+NG+RIKTWP SP   +AS +HFED+ M+NV NPILIDQ+YCP
Sbjct  248  EEPVTGIYIKSCTLSNTMNGIRIKTWPNSPAASIASDIHFEDIIMNNVGNPILIDQEYCP  307

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN C   V SK+KIS+VSF+ I GTS+T +A+K+LC+ G+PC+KV ++ + L+Y G  GS
Sbjct  308  WNLCNKQVASKVKISNVSFRNIRGTSSTPLALKILCAKGLPCDKVEMTDINLKYNGKQGS  367

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NV+PT++   +P  C
Sbjct  368  LTSQCSNVRPTITRVPNPLAC  388



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ VK+C L+ T NG+RIKTWPASP  GVAS MH+EDV M+NV NPILIDQ+YCP
Sbjct  277  EEPVEGLQVKNCTLTGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILIDQEYCP  336

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            +NQC   VPSK+KIS VSFK I GTS    AV L+CSS  PC+ V L+ + L Y G+ G 
Sbjct  337  YNQCNKQVPSKVKISKVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTYSGSEGP  396

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S C NVKPT+SGK +P  C
Sbjct  397  ITSRCANVKPTVSGKQNPPAC  417



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+CK G PSKIKIS+VSFK I GT    VAVKL CS G+PC  V LS + L+Y G  G 
Sbjct  316  WNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKYTGDKGP  375

Query  411  AISECDNVKPTLSGKNSP  358
              S C NVKPT++    P
Sbjct  376  ITSVCSNVKPTINRVAQP  393



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVDQEYCPW  325

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+KISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G +G A
Sbjct  326  NHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYTGPDGPA  385

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C  VKP L+GK SP  CDA
Sbjct  386  VSMCKFVKPLLTGKQSPPACDA  407



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK G PSK+K+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   180 bits (457),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  768   EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
             E PV+G+ VK+C LS+T NGVR+KT+P+SP G A+ MHF D+ M+NVSNPI+IDQ+YCP 
Sbjct  1117  EAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  1176

Query  588   NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             NQC   VPS++K+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  1177  NQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  1236

Query  408   ISECDNVKPTLSGKNSPAIC  349
              S+C NV+ TL G   P  C
Sbjct  1237  SSQCKNVEATLWGTQQPKTC  1256


 Score =   104 bits (259),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/64 (64%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GVTVK+C L NT+NG+R+KTWP SP  VA+ +HFED+ M+NV NPILI+Q+YCP+
Sbjct  842  EEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPY  901

Query  588  NQCK  577
            +QC+
Sbjct  902  DQCQ  905



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK G PSK+K+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK G PSK+K+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILIDQ YCP 
Sbjct  274  EQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILIDQVYCPH  333

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK G PSK+K+SD+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y G  G A
Sbjct  334  GHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYTGKKGPA  393

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C +VKP L GK  P  C
Sbjct  394  VSACSDVKPKLKGKMEPPAC  413



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+P  G+ VK C +S+T NGVRIK+WPA   G AS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y G +G  
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYSGPDGPP  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP +SG  S   C
Sbjct  374  KSQCSNVKPIMSGIMSAPGC  393



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+P  G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++IDQ YCPW
Sbjct  254  EKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIIDQVYCPW  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PSK+KISDVSFK I GTSAT V V++ CSSG PC KV L+ + L YKG  G A
Sbjct  314  NQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYKGPGGPA  373

Query  408  ISECDNVKP  382
             S+C NVKP
Sbjct  374  KSQCSNVKP  382



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSK+KIS+VSFK I G+S+T V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTYSGNKGP  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C +VKPT++       C  S
Sbjct  376  ITSQCKHVKPTINNVARALACATS  399



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 1/133 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILIDQ+YCP
Sbjct  256  EEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+CK GVPSK+KIS+VSFK I GT    VAVKL C+ G+PC  V LS + ++Y G  G 
Sbjct  316  WNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKYTGDKGP  375

Query  411  AISECDNVKPTLS  373
              S C NVKPT++
Sbjct  376  ITSVCSNVKPTIN  388



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 104/142 (73%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++DQ+YCPW
Sbjct  266  EEPVSNITIRNCIIKNTDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVDQEYCPW  325

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+KISD+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y G  G A
Sbjct  326  NHCKARTPSKVKISDIRFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYTGPGGPA  385

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C  VKP L+GK SP  CDA
Sbjct  386  VSMCKFVKPLLTGKQSPPACDA  407



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GVT++   + NT NGVRIKTWP SP G+AS + F+D+ MDNVS PIL+DQ YCP 
Sbjct  379  EQPVRGVTIRKTLIKNTDNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVDQVYCPH  438

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
              CK+  PSK+K+SDVSFK I GTSA+KVAVKLLCS GVPC     + + L + G  G A
Sbjct  439  GTCKSQAPSKVKLSDVSFKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHNGKEGPA  498

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C NVKP +SGK  P  C
Sbjct  499  VSACSNVKPVVSGKMVPPAC  518



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 104/144 (72%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSK+KIS+VSFK I G+S++ V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTYTGNKGP  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C +VKPT++       C  S
Sbjct  376  ITSQCKHVKPTINNVARALACATS  399



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV+G+ VK+C LS+T NGVR+KT+P+SP G A+ MHF D+ M+NVSNPI+IDQ+YCP 
Sbjct  444  EAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIIDQEYCPH  503

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPS++K+S++SFK I GT++T++AV L+CS G PC KV L  + L+Y G  G+A
Sbjct  504  NQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYTGPEGTA  563

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NV+ TL G   P  C
Sbjct  564  SSQCKNVEATLWGTQQPKTC  583


 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GVTVK+C L NT+NG+R+KTWP SP  VA+ +HFED+ M+NV NPILI+Q+YCP+
Sbjct  75   EEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILINQEYCPY  134

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATK  505
            +QC+  VPS++KISDVSF+ I   S T+
Sbjct  135  DQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V  CKL++T NGVRIKTWP S     AS MHFED++M+NVSNPI+IDQ+YCP
Sbjct  252  EKAVEGVWVTKCKLTSTTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIIIDQEYCP  311

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKIS VSFK I GTSAT VAVKL+CS  +PC  V +  + L+Y G  G 
Sbjct  312  WNQCNPKIPSSIKISKVSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKYNGNKGP  371

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  372  IKSQCANVKPIISGKQNPRIC  392



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GVTVK+C ++NT NGVRIKTWP +  G  S +HFED+ + NVS+PI+IDQ+YCPW
Sbjct  261  EEPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIIDQKYCPW  320

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+CK    SK+K+S++SFK I GTSA   AVK++CS+ +PC  V L+ +++ + G  G A
Sbjct  321  NKCKINEESKVKLSNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHSGPTGPA  380

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S+C NVKP +SGK +PA C A
Sbjct  381  VSQCSNVKPKVSGKQNPAACSA  402



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+ VK+C ++ + NGVRIKTWP S  G AS MHF+D+ M++V  PILIDQ YCP+
Sbjct  215  EESVVGIYVKNCTITGSQNGVRIKTWPKSEPGEASEMHFQDITMNSVGTPILIDQGYCPY  274

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   VPS +K+S +SFK I GTS TK AVKL+CS   PCN V L+ + L Y G  G A
Sbjct  275  NQCTAEVPSSVKLSKISFKNIKGTSTTKEAVKLVCSKSFPCNGVELADIDLTYSGKGGPA  334

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KPT+ GK  PAIC  S
Sbjct  335  TSVCENIKPTIKGKQIPAICSGS  357



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++IDQ+YCP
Sbjct  256  EEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVIIDQEYCP  315

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSK+KIS+VSFK I G+S   V +K++CS G+PC  V LS + L Y G  G 
Sbjct  316  WNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTYTGNKGP  375

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C +VKPT++       C  S
Sbjct  376  ITSQCKHVKPTINNVARALACATS  399



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  238  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KP+L GK +P +C AS
Sbjct  358  KSSCENIKPSLKGKQNPPVCTAS  380



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 105/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  249  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  368

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KP+L GK +P +C AS
Sbjct  369  KSSCENIKPSLKGKQNPPVCTAS  391



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   169 bits (429),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 106/147 (72%), Gaps = 7/147 (5%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV+GV V++C L NT+NG+R+KTWP S NG+ASG+HF+D+ +DNVSNP+LIDQ YCP 
Sbjct  264  EQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQDIIIDNVSNPVLIDQDYCPD  323

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG--  415
            + CK  VPSK+K+SDV FK I GTSATK+A++L CS  +PC  V L  + L Y G  G  
Sbjct  324  DLCKLQVPSKVKVSDVLFKNIKGTSATKMAIQLKCSKIMPCENVTLDDIDLCYLGNKGNN  383

Query  414  -----SAISECDNVKPTLSGKNSPAIC  349
                 +A SEC NV+P + GK SP  C
Sbjct  384  RNTTSTATSECFNVRPAIMGKLSPPPC  410



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   169 bits (427),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V  CKL  T NGVRIKTWP S     AS MHFED++M +VSNPILIDQ+YCP
Sbjct  249  EKAVEGVWVTKCKLIKTTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILIDQEYCP  308

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   +PS IKIS VSFK I GT+ T VAVKL+CS  +PC  V ++ + L+Y G  GS
Sbjct  309  WNQCNRKIPSSIKISKVSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKYNGNKGS  368

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP +SGK +P IC
Sbjct  369  ITSQCANVKPIISGKQNPRIC  389



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+ V  C +S TLNGVR+K+WPAS  G A+ MHFE + M NVSNP++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS++KI+ VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y G  G+ 
Sbjct  315  NQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYNGKQGTL  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP LSGK +P IC
Sbjct  375  SSKCANVKPVLSGKLNPPIC  394



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CKL++T NGVRIKTWP S     A+ MHFED++M NVSNPI+IDQ+YCP
Sbjct  853  EKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPATDMHFEDIEMVNVSNPIIIDQEYCP  912

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC   VPSKIKIS VSFK I GTSAT VAVK++CS   PC +V ++ + L Y G+ G 
Sbjct  913  WNQCNRKVPSKIKISKVSFKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTYSGSEGP  972

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NVKP ++GK +P IC
Sbjct  973  IKSQCANVKPVITGKQNPPIC  993



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV+GVTVK+C +++T++GVR++TWPASP+ GVA  +HF+++ M+NVS PI IDQ+YCP
Sbjct  250  EEPVVGVTVKNCTITHTMSGVRVETWPASPSEGVARDLHFQNIVMNNVSTPISIDQEYCP  309

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + +C   VPS++KISDVSF +I GTSA+KVAV+L CSS  PC  V LS + L Y G++G 
Sbjct  310  Y-KCDKKVPSRVKISDVSFDDIRGTSASKVAVRLRCSSASPCENVGLSNINLAYHGSDGK  368

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
            A SEC NVKP ++G+  P  C  S
Sbjct  369  ATSECANVKPKVTGQLFPPACAVS  392



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+ V  C +S TLNGVR+K+WPAS +G A+ MHFE + M NVSNP++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS +KI+ VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y G  GS 
Sbjct  315  NQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSV  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKP LSGK +P IC
Sbjct  375  SSNCANVKPALSGKLNPPIC  394



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C ++   NG RIKTW AS  G+A+ MHF+DV+M++V+NP+LIDQ YCP+
Sbjct  253  EEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPF  312

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC+  +PS +KIS+VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  313  NQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  372

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NV+P +SG  +P  C
Sbjct  373  TSECSNVRPLISGMQNPLAC  392



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+ V  C +S TLNGVR+K+WPAS +G A+ MHFE + M NVSNP++IDQ+YCP 
Sbjct  148  ELPVEGIFVTDCIISGTLNGVRVKSWPASKSGCATNMHFEGIIMQNVSNPMIIDQEYCPN  207

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS +KI+ VSFK ITGTSAT   V LLCS  +PC  V ++ + L Y G  G+ 
Sbjct  208  NQCTNTAPSSVKIAQVSFKNITGTSATPAVVTLLCSKSIPCESVEVADIDLAYNGNQGNV  267

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKP LSGK +P IC
Sbjct  268  SSNCANVKPALSGKLNPPIC  287



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV GVTVK C +S+T NGVRIK+W  S   +AS +HFED+ + NV NPILIDQ+YCP+
Sbjct  255  EAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNPILIDQEYCPY  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+K+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G A
Sbjct  315  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFNG--GHA  372

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C NVKP  SGK +P  C A
Sbjct  373  VSMCKNVKPITSGKQNPVACGA  394



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+ V  C +S TLNGVR+K+WPA+ +G A+ MHFE + M NVSNP++IDQ+YCP 
Sbjct  255  ELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIIDQEYCPN  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC    PS +KI+ VSFK ITGTSAT  AV LLCS  +PC+ V ++ + L Y G  G+ 
Sbjct  315  NQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYNGNQGNV  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKP LSGK +P IC
Sbjct  375  SSNCANVKPALSGKLNPPIC  394



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+IDQ YCP+
Sbjct  256  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVIDQVYCPY  315

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PSK+KIS VS K I GTS T+ AV LLCS G PC+ V +  + + Y G  G A
Sbjct  316  NQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPA  375

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C+NVKP L GK +P IC
Sbjct  376  KSSCENVKPKLVGKQNPPIC  395



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  249  EKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDISYSGKEGPA  368

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C+N+KP+L GK +P +C
Sbjct  369  KSSCENIKPSLKGKQNPPVC  388



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  238  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  297

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KP+L  K +P +C AS
Sbjct  358  KSSCENIKPSLKDKQNPPVCTAS  380



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   166 bits (421),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 103/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  250  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  309

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  310  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  369

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C+N+KP+L GK +P +C
Sbjct  370  KSSCENIKPSLKGKQNPPVC  389



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ V++C   NT NGVR+KTW +S   +A+G++F+D+ + NVSNPI+IDQ+YCP+
Sbjct  261  EEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVIDQEYCPY  320

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PS++K+S++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  321  NHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDS  380

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
            +S+C NV P + GK  P+ C A+
Sbjct  381  MSDCTNVSPKIFGKQYPSPCVAA  403



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++IDQ YCP+
Sbjct  249  EKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVIDQVYCPF  308

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LL S GVPC  + +  + + Y G  G A
Sbjct  309  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDIDITYSGKEGPA  368

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KP+L GK +P +C AS
Sbjct  369  KSSCENIKPSLKGKQNPPVCTAS  391



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV V +C ++   NG RIKTW AS  G+A+ MHF+DV+M++V+NP+LIDQ YCP+
Sbjct  286  EEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLIDQGYCPF  345

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC+  +PS +KIS+VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YKG +G A
Sbjct  346  NQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYKGPDGPA  405

Query  408  ISECDNVKPTLSGKNSPAIC  349
             SEC NV+P +SG  +P  C
Sbjct  406  TSECSNVRPLISGMQNPLAC  425


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  558  IKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNVKPT  379
            +KISDVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG++ S+  N+KPT
Sbjct  429  VKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKPT  488

Query  378  LSGKNSPAICDAS  340
            ++GK+S  IC  S
Sbjct  489  ITGKSSLPICAGS  501



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNP++IDQ YCP+
Sbjct  247  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVIDQVYCPY  306

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PS +KIS VS K + GTS+T+ AV+LLCS GVPC  V +  + + Y G  G A
Sbjct  307  NQCNKDLPSLVKISKVSIKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYNGKEGPA  366

Query  408  ISECDNVKPTLSGKNSPAIC  349
             + C+NVKPT  GK +P +C
Sbjct  367  KTSCENVKPTFVGKQNPPVC  386



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = -2

Query  759  VMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCPWNQ  583
            V GVTVK CKL NT NGVRIK+WP S +   AS +HFED++M NVSNP++I+Q+YCP++Q
Sbjct  269  VTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQ  328

Query  582  CKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAIS  403
            C   +PSKIKIS+VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S
Sbjct  329  CDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITS  388

Query  402  ECDNVKPTLSGKNSPAIC  349
            +C NV P ++GK +P  C
Sbjct  389  QCRNVIPIITGKQNPRAC  406



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V +C ++NT NGVRIKTWPAS  GV + + FED+ + NVSNP++IDQ YCP+
Sbjct  238  EKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVIDQVYCPF  297

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C   +PS++KIS VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y G  G A
Sbjct  298  NKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYSGKEGPA  357

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C+N+KP+L GK +P +C AS
Sbjct  358  KSSCENIKPSLKGKQNPPVCTAS  380



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+IDQ YCP+
Sbjct  256  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVIDQVYCPY  315

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PS++KIS VS K I GTS T+ AV LLCS G PC+ V +  + + Y G  G A
Sbjct  316  NQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYNGKEGPA  375

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C+NVKP   GK +P IC
Sbjct  376  KSSCENVKPKFVGKQNPPIC  395



>ref|XP_007143503.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
 gb|ESW15497.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
Length=276

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 100/144 (69%), Gaps = 4/144 (3%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NPI+IDQ+YCP
Sbjct  90   EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIIIDQEYCP  149

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC  G PSK+KIS VSFK I GTSATK  + L CSSGVPC  V +  V L Y G  G 
Sbjct  150  NNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNG--GP  207

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
             I++C NVKPT++GK +PA  D +
Sbjct  208  IIAKCSNVKPTITGK-APACGDGA  230



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ V++C   NT NGVR+KTW +S   +A+G+HF D+ + NVSNPI+IDQ+YCP+
Sbjct  289  EEPVSGIIVRNCTFFNTDNGVRVKTWLSSEKAIATGLHFHDITVVNVSNPIVIDQEYCPY  348

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            + CK   PS++K+S++SFK I GTS+TK+A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  349  DHCKAKKPSQVKLSNISFKNIHGTSSTKMAMKLACSSGVPCENVEISNIDIKYIGSDGVS  408

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
            +S+C NV P   GK  P+ C A+
Sbjct  409  MSDCTNVSPKTFGKQYPSACVAA  431



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ V++C   NT NGVR+KTW +S   +A+G++F+D+ + NVSNP++IDQ+YCP+
Sbjct  261  EEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVIDQEYCPY  320

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PS++K+S++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y G++G +
Sbjct  321  NHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYTGSDGDS  380

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
            +S+C NV P + GK  P+ C A+
Sbjct  381  MSDCTNVSPKIFGKQYPSPCVAA  403



>gb|KDO36716.1| hypothetical protein CISIN_1g036262mg, partial [Citrus sinensis]
Length=195

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  53   EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  112

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  113  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  172

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  173  PAISSCSNVKPTLVGKQIPATC  194



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   164 bits (415),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GVTVK C L NT NGVRIK+WP S     AS +HFED++M NVSNPI+IDQ+YCP
Sbjct  250  EKEVAGVTVKSCNLINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIIIDQEYCP  309

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC   +PSKIKI +VSFK I GTSAT VA+K +CS  +PC+ V ++ + L Y GT G 
Sbjct  310  SNQCNKKIPSKIKIRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSYTGTQGR  369

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NV P ++GK +P  C
Sbjct  370  ITSQCRNVIPIITGKQNPRAC  390



>ref|XP_004144611.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=506

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = -2

Query  759  VMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCPWNQ  583
            V GVTVK CKL NT NGVRIK+WP S +   AS +HFED++M NVSNP++I+Q+YCP++Q
Sbjct  351  VTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVINQEYCPFDQ  410

Query  582  CKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAIS  403
            C   +PSKIKIS+VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y GT G   S
Sbjct  411  CDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTYTGTQGRITS  470

Query  402  ECDNVKPTLSGKNSPAIC  349
            +C NV P ++GK +P  C
Sbjct  471  QCRNVIPIITGKQNPRAC  488



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV+GV V++C   +T NGVR+KTWPAS NGV   +H+ED+ + NVSNP++IDQ YCP+
Sbjct  255  ELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVIDQLYCPY  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK  +PS++KIS VSFK I GTS T+ A+++ CS GVPC  V +  + + Y G  G A
Sbjct  315  NQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITYNGNEGPA  374

Query  408  ISECDNVKPTLSGKNSPAICDAS  340
             S C NV P+  GK +P +C +S
Sbjct  375  KSSCQNVDPSFVGKQNPPVCTSS  397



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+DQ YCP 
Sbjct  356  EQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  415

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  416  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  474

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C NVKPT++GK  PA C
Sbjct  475  VSACSNVKPTVTGKMIPAAC  494



>ref|XP_007143501.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
 gb|ESW15495.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
Length=243

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 98/139 (71%), Gaps = 4/139 (3%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NPI+IDQ+YCP
Sbjct  107  EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIIIDQEYCP  166

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC  G PSK+KIS VSFK I GTSATK  + L CSSGVPC  V +  V L Y G  G 
Sbjct  167  NNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNG--GP  224

Query  411  AISECDNVKPTLSGKNSPA  355
             I++C NVKPT++GK +PA
Sbjct  225  IIAKCSNVKPTITGK-APA  242



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V G+TVK C  S T+NGVR+KTWP SP G A+ + F+D+ M+NV NP+++DQ+YCP+
Sbjct  236  EKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPY  295

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             QC    PS+IK+S+++F  I GTS  KVAV + CS G+PC+ + +  + L Y+G  G A
Sbjct  296  GQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPA  355

Query  408  ISECDNVKPTLSGKNSPAI  352
             S C NVKPT SGK  PAI
Sbjct  356  TSTCSNVKPTFSGKQVPAI  374



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+DQ YCP 
Sbjct  370  EQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  429

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  430  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  488

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C NVKPT++GK  PA C
Sbjct  489  VSACSNVKPTVTGKMIPAAC  508



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV V++C L NTL GVR+K+WP++  G A+ +HF+D+ M NV++PI+IDQ+YCP 
Sbjct  254  EEPVVGVFVRNCTLINTLTGVRVKSWPSATTGAATDVHFDDITMRNVTSPIVIDQEYCPN  313

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC  G PS++KIS VSF  I GTSA+ +AVKL+CS   PC  V +  + L Y G+ G+ 
Sbjct  314  NQCTLGAPSRVKISKVSFNNIRGTSASALAVKLVCSKTFPCEGVEIGDIDLAYHGSLGNI  373

Query  408  ISECDNVKPTLSGKNSPAIC  349
             + C NV+PT  G+ +P IC
Sbjct  374  TTNCANVQPTFMGRQNPPIC  393



>ref|XP_010675960.1| PREDICTED: exopolygalacturonase clone GBGA483-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV GVTVK C +S+T NG+RIK+W  S    AS +HFED+ + NV  PILIDQ+YCP+
Sbjct  189  EAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILIDQEYCPY  248

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+K+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  
Sbjct  249  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPV  306

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C NVKP  SGK +P  C A
Sbjct  307  VSMCKNVKPITSGKQNPVACGA  328



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+IDQ YCP+
Sbjct  239  EKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVIDQVYCPY  298

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC   +PS +KIS VS K + GTS T+ AV LLCS GVPC  V +  + + Y G  G A
Sbjct  299  NQCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYNGKEGPA  358

Query  408  ISECDNVKPTLSGKNSPAIC  349
             + C+NVKPT  G  +P +C
Sbjct  359  KTSCENVKPTFVGNQNPPVC  378



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+DQ YCP 
Sbjct  346  EEPVKGITIRKCIVKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVDQVYCPH  405

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   G  G+A
Sbjct  406  GKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVSTGKEGAA  464

Query  408  ISECDNVKPTLSGKNSPAIC  349
            +S C NVKPT++GK  PA C
Sbjct  465  VSACSNVKPTVTGKMIPAAC  484



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  251  EEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS TK  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  368

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV+GV V++C   +T NGVR+KTWPAS NGV   +H+ED+ + NVSNP++IDQ YCP+
Sbjct  255  ELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVIDQLYCPY  314

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQCK  +PS++KIS VSFK I GTS T+ A+K+ CS GVPC  V +  + + Y G  G A
Sbjct  315  NQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITYNGNEGPA  374

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NV P+  GK  P +C
Sbjct  375  KSTCQNVDPSFVGKQIPPVC  394



>gb|ABE65925.1| polygalacturonase/pectinase [Arabidopsis thaliana]
Length=280

 Score =   159 bits (401),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ ++NVSNPILIDQ+YCP
Sbjct  126  EQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILIDQEYCP  185

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  186  WNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGP  245

Query  411  AISECDNVKPTLSGKNSPAICDA  343
                C NV P L G  +P  C A
Sbjct  246  PTFMCSNVSPKLVGTQNPKACSA  268



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ + NVSNPILIDQ+YCP
Sbjct  246  EQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D+ FK I GTS  K AVKLLCS G PC  V +  + + YKG +G 
Sbjct  306  WNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAYKGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NVKP L G  +P  C A
Sbjct  366  ATFQCSNVKPKLVGTQNPKACSA  388



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   161 bits (408),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GVTVK CKL NT NGVRIKTWP  +    AS +HFED++M NVSNP++IDQ+YCP
Sbjct  260  EKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCP  319

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC   +PSKIKIS+VSFK I GTSAT VAVK +CS+   C  V ++ + L Y GT G 
Sbjct  320  SNQCNKKIPSKIKISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGR  379

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NV P ++GK +P  C
Sbjct  380  ITSQCRNVIPIITGKQNPRAC  400



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 100/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV GVTVK C +S+T NG+RIK+W  S    AS +HFED+ + NV  PILIDQ+YCP+
Sbjct  265  EAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILIDQEYCPY  324

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+K+S++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + G  G  
Sbjct  325  NHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFSG--GPV  382

Query  408  ISECDNVKPTLSGKNSPAICDA  343
            +S C NVKP  SGK +P  C A
Sbjct  383  VSMCKNVKPITSGKQNPVACGA  404



>ref|XP_006492954.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=374

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  232  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  291

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  292  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  351

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  352  PAISSCSNVKPTLVGKQIPATC  373



>emb|CDP04347.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   154 bits (390),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E P+ G     C +S TLNGVR+K+WPAS +G A+ MHFE + + NVSNP++IDQ+YCP 
Sbjct  25   ELPIKGSFDTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIIQNVSNPVIIDQEYCPN  84

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             Q     PS ++I+ VSF  ITGTSAT  AV LLCS  +PC  V ++ + L Y G  GS 
Sbjct  85   KQSTNTAPSSVQIAQVSFNNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYNGNQGSV  144

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NVKP LSGK +P IC
Sbjct  145  SSNCANVKPALSGKLNPPIC  164



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV NPI+IDQ+YCP
Sbjct  251  EEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIIIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS TK  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  368

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E PV G+TV+ C   NT NGVRIKTWP +  G AS + FE++ M NV +P+LIDQ+YCPW
Sbjct  253  EAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLIDQEYCPW  312

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            NQC T  PSK+K+S +SFK I GTS+T +AV L+CS G PC  V +  + L+YKG +G A
Sbjct  313  NQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYKGKDGPA  372

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C NV   ++GK +P+ C
Sbjct  373  HSVCKNVNVKVTGKMNPSPC  392



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+TVK+C L  T NG+RIKTWP A+ +  ASG+HFED+ ++NVSNPILIDQ+YCP
Sbjct  245  EQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILIDQEYCP  304

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN C    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  305  WNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEYKGADGP  364

Query  411  AISECDNVKPTLSGKNSPAICDA  343
                C NV P L G  +P  C A
Sbjct  365  PTFTCSNVTPKLVGTQNPKACSA  387



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C +  T NG+RIKTWP A+ + VASG+HFED+ + NVSNPILIDQ+YCP
Sbjct  260  EQNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILIDQEYCP  319

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ DVSF  I GTSA K AVKLLCS G PC  VV+  + +EY G +G 
Sbjct  320  WNQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  379

Query  411  AISECDNVKPTLSGKNSPAICD  346
            A   C NVKP L G  +P  CD
Sbjct  380  ATFMCSNVKPKLVGIQNPKACD  401



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV    V +C L+NT NGVRIKTWP +P  +  +GMHFED+KM NV NPI+IDQ+YCP
Sbjct  254  EKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINVKNPIIIDQEYCP  313

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS+VSFK I GTS TK  V L+CSSGVPC  V+L+ + L + GT  S
Sbjct  314  WNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLTDIDLTFNGT--S  371

Query  411  AISECDNVKPTLSGK  367
            A ++  NVKP + GK
Sbjct  372  AAAKLSNVKPIIQGK  386



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GVTVK CKL NT NGVRIKTWP  +    AS +HFED++M NVSNP++IDQ+YCP
Sbjct  260  EKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVIIDQEYCP  319

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC   +PSKIKI++VSFK I GTSAT VAVK +CS+   C  V ++ + L Y GT G 
Sbjct  320  SNQCNKKIPSKIKINNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAYIGTQGR  379

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S+C NV P ++GK +P  C
Sbjct  380  ITSQCRNVIPIITGKQNPRAC  400



>ref|XP_007143491.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
 gb|ESW15485.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
Length=204

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 98/144 (68%), Gaps = 4/144 (3%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NP++IDQ+YCP
Sbjct  24   EEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVIIDQEYCP  83

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC  G PSK+KIS VS K I GTSATK  + L CSSGVPC  V +  V L Y G   +
Sbjct  84   NNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNGAPVT  143

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
            A   C NVKPT++GK +PA  +A+
Sbjct  144  AT--CTNVKPTITGK-APACGEAA  164



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 100/136 (74%), Gaps = 5/136 (4%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA--SGMHFEDVKMDNVSNPILIDQQYC  595
            E+PV G  VK+C L+NT NGVRIKTWP++P G A  + MHFED+ M NV NPI+IDQ+YC
Sbjct  253  EKPVEGFYVKNCTLTNTDNGVRIKTWPSTP-GTAPITDMHFEDIIMVNVKNPIIIDQEYC  311

Query  594  PWNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  415
            PWNQC    PSKIKIS VSFK I GTSAT   V L+CSSGVPC+ V L+GV L + G   
Sbjct  312  PWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGVDLTFNG--A  369

Query  414  SAISECDNVKPTLSGK  367
             A ++C NVKP ++GK
Sbjct  370  PATAKCANVKPIVTGK  385



>gb|KHN44923.1| Polygalacturonase, partial [Glycine soja]
Length=298

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  160  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  219

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  220  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNG--AA  277

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  278  ATAKCANVKPTITGK  292



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 100/135 (74%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  212  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  271

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  272  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  329

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  330  ATAKCANVKPTITGK  344



>emb|CDY07973.1| BnaC03g35500D [Brassica napus]
Length=179

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILIDQ+YCP
Sbjct  28   EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  87

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  88   WNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGADGP  147

Query  411  AISECDNVKPTLSGKNSPAIC  349
               EC NV P L G  +P  C
Sbjct  148  PTFECTNVTPKLVGTQNPKAC  168



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  238  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  297

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  298  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  357

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  358  PAISSCSNVKPTLVGKQIPATC  379



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  260  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  319

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  320  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  379

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  380  PAISSCSNVKPTLVGKQIPATC  401



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  265  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  324

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  325  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  384

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  385  PAISSCSNVKPTLVGKQIPATC  406



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 95/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V +C L  T NG+RIKTWP++     ASG+HFED+ + NVSNPILIDQ+YCP
Sbjct  245  EEDVAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILIDQEYCP  304

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D+SF++I GTS  K AVKLLCS G+PC  V +  + +EYKG +G 
Sbjct  305  WNQCNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEYKGADGP  364

Query  411  AISECDNVKPTLSGKNSPAIC  349
               +C NV P L G   P  C
Sbjct  365  PTFQCSNVNPKLVGTQVPKAC  385



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+IDQ+YCP 
Sbjct  265  EEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVIDQEYCPH  324

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTN--G  415
            NQC   VPS++KIS+V F+ I GTS TK AV+++CS  +PC  V +  + L Y G +  G
Sbjct  325  NQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYNGIDDKG  384

Query  414  SAISECDNVKPTLSGKNSPAIC  349
             AIS C NVKPTL GK  PA C
Sbjct  385  PAISSCSNVKPTLVGKQIPATC  406



>emb|CDY71093.1| BnaCnng71300D, partial [Brassica napus]
Length=257

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILIDQ+YCP
Sbjct  107  EEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILIDQEYCP  166

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  167  WNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGP  226

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L GK  P  C
Sbjct  227  ATFQCSNVSPKLVGKQCPKAC  247



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   159 bits (401),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV+GV VK+C L +T NGVRIKTWPAS  GV S +HFED+ + NVSNPI+IDQ YCP 
Sbjct  250  EKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPIVIDQVYCPS  309

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
             +C   +PS++KIS VS + I GTS T+ A+ L CS G PC  V +  V + Y G  G A
Sbjct  310  GKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDISYSGKEGPA  369

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S C+N+KPT  GK +PA+C
Sbjct  370  KSSCENIKPTFKGKQTPAVC  389



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V G+ VK+C +SNT NGVRIK+WPA   G AS +HFED+ M NVSNPI+IDQ YCPW
Sbjct  252  EESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C     SK+ I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A
Sbjct  312  NECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
              +C NV+P   GK +P+ C
Sbjct  372  KFQCSNVQPKFHGKINPSKC  391



>ref|XP_009348297.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like, partial 
[Pyrus x bretschneideri]
Length=236

 Score =   154 bits (390),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ + G+ VK+C L+NT NGVRIKTWP SP    AS +HFED+ M NV NPI+IDQ YCP
Sbjct  85   EESLAGIRVKNCTLTNTQNGVRIKTWPNSPLATTASDIHFEDIFMVNVGNPIVIDQLYCP  144

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + +C    PSK+KIS+VSFK I G+SAT +A+K++CSSG  C  V L+ + L Y G  G+
Sbjct  145  YRKCDNLPPSKVKISNVSFKNIKGSSATALALKIVCSSGSRCENVELTDIXLTYNGAKGT  204

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKPT+SG  S   C  S
Sbjct  205  LTSQCLNVKPTISGLISALACATS  228



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+ V G+ VK+C +SNT NGVRIK+WPA   G AS +HFED+ M NVSNPI+IDQ YCPW
Sbjct  252  EESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVIDQVYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+C     SK+ I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y G+ G A
Sbjct  312  NECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYTGSEGPA  371

Query  408  ISECDNVKPTLSGKNSPAIC  349
              +C NV+P   GK +P+ C
Sbjct  372  KFQCSNVQPKFHGKINPSKC  391



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   158 bits (400),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILIDQ+YCP
Sbjct  247  EEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQYTGADGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV PTL G   P  C +
Sbjct  367  ATFQCSNVSPTLMGTQVPKACSS  389



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   159 bits (401),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ + G+ VK+C L+NT NGVRIKTWP SP    AS +HFED+ M NVSNPI+IDQ YCP
Sbjct  255  EESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIVIDQLYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + +C    PSK+KISDVSFK I G+SAT +++K++CSSG PC  + L+ + L Y G  G+
Sbjct  315  YKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLTYSGAKGT  374

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S+C NVKPT+SG      C  S
Sbjct  375  LTSQCLNVKPTISGLTGALACATS  398



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   157 bits (397),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV NPI+IDQ+YCP
Sbjct  212  EEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIIIDQEYCP  271

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G+  +
Sbjct  272  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTFNGS--A  329

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  330  ATAKCANVKPTITGK  344



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   158 bits (400),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ ++NVSNPILIDQ+YCP
Sbjct  247  EQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEYKG +G 
Sbjct  307  WNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEYKGADGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
                C NV P L G  +P  C A
Sbjct  367  PTFMCSNVSPKLVGTQNPKACSA  389



>ref|XP_007143497.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
 gb|ESW15491.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
Length=247

 Score =   154 bits (389),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 98/144 (68%), Gaps = 4/144 (3%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+TVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NP++IDQ+YCP
Sbjct  67   EEPVEGITVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVIIDQEYCP  126

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
             NQC  G PSK+KIS VS K I GTSATK  + L CSSGVPC  V +  V L Y G   +
Sbjct  127  NNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTYNGAPVT  186

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
            A   C NVKPT++GK +PA  +A+
Sbjct  187  AT--CTNVKPTITGK-APACGEAA  207



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNG--AA  368

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMADIDLTFNG--AA  368

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+IDQ+YCP
Sbjct  251  EEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIIIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS VSFK I GTS ++  V L+CSSGVPC  V ++ + L + G   +
Sbjct  311  WNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTFNG--AA  368

Query  411  AISECDNVKPTLSGK  367
            A ++C NVKPT++GK
Sbjct  369  ATAKCANVKPTITGK  383



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 97/143 (68%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ +K+C L  T NG+RIKT+P+S + +  S +HFED+ + NVSNPILIDQ+YCP
Sbjct  250  EEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVSNPILIDQEYCP  309

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS +K+ ++SFK I GTS  K AV+LLCS GVPC  V +  + L Y G +G 
Sbjct  310  WNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGDIDLRYGGADGP  369

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  EC NV P LSG   P  C +
Sbjct  370  ATFECSNVTPKLSGTQFPKACSS  392



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 92/131 (70%), Gaps = 0/131 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV VK C L NT NG+RIK+WP   +G A+ MHFED+ M+NVSN ILIDQ YCPW
Sbjct  252  EEPVSGVYVKKCDLINTSNGIRIKSWPGLYSGAATDMHFEDISMNNVSNAILIDQMYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C +   S +KIS V+F  I GTS+T   VKLLCS G+PC  V L+ + + YKG +G A
Sbjct  312  NHCNSKASSNVKISKVTFSNIKGTSSTPTIVKLLCSKGLPCEGVELNNINVVYKGPDGPA  371

Query  408  ISECDNVKPTL  376
             SEC NVKP +
Sbjct  372  KSECTNVKPKI  382



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 1/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C +  T NG+RIKTWP A+ + VASG+HFED+ + NVSNPILIDQ+YCP
Sbjct  248  EQNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCP  307

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ DVSF  I GTS  K AVKLLCS G PC  VV+  + +EY G +G 
Sbjct  308  WNQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEYTGRDGP  367

Query  411  AISECDNVKPTLSGKNSPAICD  346
            A   C NVKP L G  +P  C+
Sbjct  368  ATFMCSNVKPRLVGIQNPKACN  389



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E  V G+ VK C +SNT+NGVRIKTWP SP    AS +HFE + M+NV NPILIDQ+YCP
Sbjct  251  EDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILIDQEYCP  310

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + QC T  PSK+KIS+VSFK I GT+ T  AVK++C+ G+PC+KVVLS + L+  G  G+
Sbjct  311  YGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKLTG-KGT  369

Query  411  AISECDNVKPTLS  373
              S+C NV+PT++
Sbjct  370  LTSQCANVQPTIT  382



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVA-SGMHFEDVKMDNVSNPILIDQQYC  595
            E+PV G+ +K+C +SNT NGVRIKTWPASP  G A S +HFED+ MDNV NP++IDQ+YC
Sbjct  256  EEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVVIDQEYC  315

Query  594  PWNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  415
            P   C   V SK+KIS+VSFK I G+S+  V VKLLCS  +PC  V LS + L Y G  G
Sbjct  316  PHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLTYTGDKG  375

Query  414  SAISECDNVKPTLSGKNSPAICDAS  340
            S  SEC +VKPT++    P  C  S
Sbjct  376  SLTSECKHVKPTINNVAKPLACATS  400



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   157 bits (396),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+H+ED+ M NVSNPIL+DQ YCP
Sbjct  255  EKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + QC+   PSK+KIS+VSFK I G+S T +AVKL+C++G+PC  V L+ + L Y G  G 
Sbjct  315  YTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGP  374

Query  411  AISECDNVKPTLSG  370
              S C NVKPT++G
Sbjct  375  LTSMCSNVKPTITG  388



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILIDQ+YCP
Sbjct  247  EEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  307  WNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L GK  P  C +
Sbjct  367  ATFQCSNVSPKLVGKQCPKACSS  389



>ref|XP_008462134.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=508

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 104/152 (68%), Gaps = 9/152 (6%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV VK CKL NT NGVRIKTWP S +   AS +HFED++M NVSNPI+I+Q+YC 
Sbjct  248  EREVTGVAVKSCKLINTWNGVRIKTWPDSASAYTASDLHFEDIEMVNVSNPIIINQEYCS  307

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG-  415
             NQC   +PSKIKI +VSFK I GTSAT VAVK +CS  +PC  V ++ + L Y G  G 
Sbjct  308  SNQCNNKIPSKIKILNVSFKNIRGTSATSVAVKFICSKDLPCEGVEVADIDLAYNGVEGQ  367

Query  414  -------SAISECDNVKPTLSGKNSPAICDAS  340
                   S +S+C NVK T++GK +P + D++
Sbjct  368  TTSHCWKSIVSQCANVKYTVTGKQNPQLDDSA  399



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score =   155 bits (393),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILIDQ+YCP
Sbjct  247  EEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILHNVSNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  307  WNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITYNGKDGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L GK  P  C +
Sbjct  367  ATFQCSNVSPKLVGKQCPKACSS  389



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVA-SGMHFEDVKMDNVSNPILIDQQYC  595
            E+PV G+ +K+C ++NT NGVRIKTWPASP  G A S +HF+D+ MDNV NP++IDQ+YC
Sbjct  256  EEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHFZDIIMDNVKNPVVIDQEYC  315

Query  594  PWNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNG  415
            P   C   V SK+KIS+VSFK I G+S+  V VKLLCS  +PC  V LS + L Y G  G
Sbjct  316  PHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLTYTGDKG  375

Query  414  SAISECDNVKPTLSGKNSPAICDAS  340
            S  SEC +VKPT++    P  C  S
Sbjct  376  SITSECKHVKPTINNVAKPLACATS  400



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V  +TVK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILIDQ+YCP
Sbjct  246  EQDVTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGAQNPKAC  386



>ref|XP_008231357.1| PREDICTED: exopolygalacturonase-like, partial [Prunus mume]
Length=308

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+ +ED+ M NVSNPIL+DQ YCP
Sbjct  155  EKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIRYEDIIMVNVSNPILVDQLYCP  214

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + QC+   PSK+KIS+VSFK I G+S T +AVKL+C++G+PC  V L+ + L Y G  G 
Sbjct  215  YTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTYGGDKGP  274

Query  411  AISECDNVKPTLSG  370
              S C NVKPT++G
Sbjct  275  LTSMCSNVKPTITG  288



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+H+ED+ M NVSNPIL+DQ YCP
Sbjct  255  EKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILVDQLYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + QC+   PSK+KIS+VSFK I G+S T +AVKL+C++G+PC  V L  + L Y G  G 
Sbjct  315  YTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELIDIDLTYGGDKGP  374

Query  411  AISECDNVKPTLSG  370
              S C NVKPT++G
Sbjct  375  LTSMCSNVKPTIAG  388



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+TVK+C L +T NG+RIKTWP+S  +  AS +HFED+ + +VSNPILIDQ+YCP
Sbjct  246  EQDVSGITVKNCTLQSTDNGLRIKTWPSSACSTTASDIHFEDIILKDVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKSSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIRYNGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P + G   P  C A
Sbjct  366  ATFQCSNVSPKIMGTQIPKACSA  388



>ref|XP_008466943.1| PREDICTED: polygalacturonase-like, partial [Cucumis melo]
Length=211

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V+GVTVK CK+ NT NGVRIKTWP S    +AS MHFED++M+NVSNPI+IDQ+YCP
Sbjct  107  EKDVVGVTVKACKIFNTTNGVRIKTWPDSAVAFMASDMHFEDIEMENVSNPIIIDQEYCP  166

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKV  457
            WNQC   VPSKIKIS+VSFK I GTSAT VAVKL+CS  +PC  V
Sbjct  167  WNQCNRKVPSKIKISNVSFKNIRGTSATPVAVKLVCSKSIPCEGV  211



>gb|ACP74159.1| putative polygalacturonase [Brassica rapa subsp. oleifera]
Length=397

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +  L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV PTL G   P  C +
Sbjct  367  ATFQCSNVSPTLMGTQVPKACSS  389



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +  L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV PTL G   P  C +
Sbjct  367  ATFQCSNVSPTLMGTQVPKACSS  389



>ref|XP_009151612.1| PREDICTED: polygalacturonase [Brassica rapa]
 gb|ABG38467.1| pollen-expressed protein MF6t [Brassica juncea]
Length=397

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +  L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILIDQ+YCP
Sbjct  247  EEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILIDQEYCP  306

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  307  WNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKYTGADGP  366

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV PTL G   P  C +
Sbjct  367  ATFQCSNVSPTLMGTQVPKACSS  389



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKITMNNVANPVLIDQEYCP  321

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            W QC   +PSK+KIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTITRVPPPLAC  401



>emb|CDY22139.1| BnaC01g39620D [Brassica napus]
Length=359

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILIDQ+YCP
Sbjct  208  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  267

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  268  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  327

Query  411  AISECDNVKPTLSGKNSPAIC  349
               EC NV P L G  +P  C
Sbjct  328  PTFECTNVTPKLVGTQNPKAC  348



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCP  321

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            W QC   +PSK+KIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTITRVPPPLAC  401



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 90/131 (69%), Gaps = 0/131 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV GV VK C L NT NG+RIK+WP   +G A+ +HFED+ M+NVSN ILIDQ YCPW
Sbjct  252  EEPVSGVYVKKCDLINTTNGIRIKSWPGLYSGTATDLHFEDISMNNVSNAILIDQMYCPW  311

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C +   S +KIS V+F  I GTS+    VKLLCS G+PC  V L+ + + YKG  G A
Sbjct  312  NHCNSKASSNVKISKVTFSNIKGTSSIPTIVKLLCSKGLPCEGVELNNINVVYKGPEGPA  371

Query  408  ISECDNVKPTL  376
             SEC NVKP +
Sbjct  372  KSECTNVKPKI  382



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 102/141 (72%), Gaps = 2/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LIDQ+YCP
Sbjct  262  EDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLIDQEYCP  321

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            W QC   +PSK+KIS+VSFK I GT++T  A+K++C+ G+ C++VVLS + L+  G  G+
Sbjct  322  WGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKLSG-KGT  380

Query  411  AISECDNVKPTLSGKNSPAIC  349
              S C NV+PT++    P  C
Sbjct  381  LTSHCANVQPTIARVPPPLAC  401



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NV+NPILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIKYTGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P LSG  +P  C A
Sbjct  366  ATFQCSNVSPKLSGIQNPKACSA  388



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ VK+C L+NT NGVRIKTWP SP+   AS +H+E++ M NVSNPILIDQ YCP
Sbjct  255  EKAVTGIIVKNCTLTNTQNGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILIDQLYCP  314

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            + +C    PSK+KI++VSFK I G+S T +AVKL+CS G+PC  V L+ + L Y G  G 
Sbjct  315  YTRCDQKPPSKVKINNVSFKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTYGGDQGP  374

Query  411  AISECDNVKPTLSGKNSPAICDAS  340
              S C NVKPT++G      C  S
Sbjct  375  LTSLCSNVKPTITGMKKALACATS  398



>dbj|BAC42591.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAO63309.1| At3g07830 [Arabidopsis thaliana]
Length=225

 Score =   149 bits (377),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 94/142 (66%), Gaps = 1/142 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILIDQ+YCP
Sbjct  75   EQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILIDQEYCP  134

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK++++SF+ I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  135  WNQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQYTGADGP  194

Query  411  AISECDNVKPTLSGKNSPAICD  346
            A   C NV+P L G   P  C+
Sbjct  195  ATFMCSNVRPKLVGTQFPKACN  216



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++IDQ+YCP
Sbjct  250  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  309

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  310  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  367

Query  411  AISECDNVKPTLSGKNSPAICDA  343
             +++C NVKP ++GK     C A
Sbjct  368  IVAKCANVKPIVTGKAPACTCTA  390



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++IDQ+YCP
Sbjct  252  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  311

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  312  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  369

Query  411  AISECDNVKPTLSGKNSPAICDA  343
             +++C NVKP ++GK     C A
Sbjct  370  IVAKCANVKPIVTGKAPACTCTA  392



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ + +C ++NT NG RIKTWP    G  S +HFED+ M+NVS+PILIDQQYCPW
Sbjct  257  EEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPW  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+CK    SK+K+S++SFK I GTSA   A+K +CS   PC  V L+ + +++ G    A
Sbjct  317  NKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHNGAE-PA  375

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP  SGK +P  C
Sbjct  376  TSQCLNVKPITSGKLNPIPC  395



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++IDQ+YCP
Sbjct  246  EEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVIIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PSKIKIS V+FK I GTS TK  V L+CS GVPC  V L+ V L + G    
Sbjct  306  WNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTFNG--AP  363

Query  411  AISECDNVKPTLSGKNSPAICDA  343
             +++C NVKP ++GK     C A
Sbjct  364  IVAKCANVKPIVTGKAPACTCTA  386



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILIDQ+YCP
Sbjct  246  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEYTGPDGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGTQNPKAC  386



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYSGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NVSNPILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G  +P  C A
Sbjct  366  ATFQCSNVSPKLLGTQNPKACSA  388



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NVSNPILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKYTGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G  +P  C A
Sbjct  366  ATFQCSNVSPKLLGTQNPKACSA  388



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 94/141 (67%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILIDQ+YCP
Sbjct  246  EQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK++++SFK+I GTS  K AVKLLCS G PC  V +  + + Y G +G 
Sbjct  306  WNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRYNGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+TVK C + NT NGVR+KTW  S  GV +G+HFED+ ++NV NPI++DQ+YCP+
Sbjct  263  EEPVQGITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVDQEYCPY  322

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N CK   PSK+K+SD+ F+ + GTS++K AVK++CSSGVPC KV L  + L+Y G +G A
Sbjct  323  NHCKQKTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYTGKDGPA  382

Query  408  I  406
            +
Sbjct  383  V  383



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   153 bits (386),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILIDQ+YCP
Sbjct  246  EQDVSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  306  WNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKYNGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G  SP  C A
Sbjct  366  ATFQCSNVSPKLLGSQSPKACSA  388



>ref|XP_004292143.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 0/128 (0%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            EQPV GV +K+   ++T NG RIKTWP S  G+ S +H+ED+ M NVSNPI+IDQ+YCPW
Sbjct  256  EQPVTGVIIKNVTFNSTQNGARIKTWPGSYGGLVSDIHYEDIIMVNVSNPIIIDQEYCPW  315

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N C   +PSK+KIS+VSFK I GTS T +AV  +CS  VPC  V +SG+ L Y G  G  
Sbjct  316  NLCNKKIPSKVKISNVSFKNIKGTSTTPLAVNFICSWSVPCENVEISGIDLTYTGHKGFI  375

Query  408  ISECDNVK  385
             S+C NVK
Sbjct  376  SSQCSNVK  383



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ VMG+ + +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILIDQ+YCP
Sbjct  246  EQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+S +SFK I GTS  K AVKLLCS G PC  V L  + ++Y G++G 
Sbjct  306  WNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGSDGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G   P  C +
Sbjct  366  ATFQCSNVSPKLMGTQVPKACSS  388



>ref|XP_009124086.1| PREDICTED: polygalacturonase [Brassica rapa]
 ref|XP_009124094.1| PREDICTED: polygalacturonase [Brassica rapa]
Length=397

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILIDQ+YCP
Sbjct  246  EQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + ++Y G +G 
Sbjct  306  WNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIDYTGPDGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
               EC NV P L G  +P  C
Sbjct  366  PTFECTNVTPKLVGTQNPKAC  386



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILIDQ+YCP
Sbjct  246  EEDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC KV +  + + Y G +G 
Sbjct  306  WNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGP  365

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  366  ATFQCSNVSPQLLGSQSPKAC  386



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILIDQ+YCP
Sbjct  232  EEDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILIDQEYCP  291

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC KV +  + + Y G +G 
Sbjct  292  WNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAYSGADGP  351

Query  411  AISECDNVKPTLSGKNSPAIC  349
            A  +C NV P L G  SP  C
Sbjct  352  ATFQCSNVSPQLLGSQSPKAC  372



>ref|XP_010489712.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=352

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 90/131 (69%), Gaps = 1/131 (1%)
 Frame = -2

Query  735  CKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCPWNQCKTGVPSK  559
            C +  T NG+RIKTWP A+ + VASG+HFED+ + NVSNPILIDQ+YCPWNQC     S 
Sbjct  213  CTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILIDQEYCPWNQCNKQKSSS  272

Query  558  IKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNVKPT  379
            IK+ DVSF  I GTSA K AVKLLCS G PC  VV+  + +EY G +G A   C NVKP 
Sbjct  273  IKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEYTGRDGPATFMCSNVKPK  332

Query  378  LSGKNSPAICD  346
            L G  +P  C+
Sbjct  333  LVGVQNPKACN  343



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 97/133 (73%), Gaps = 2/133 (2%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCP  592
            E+PV G+ VK+C +S T NGVR+KTWP  P+ + AS +HFED+ MDNV NPI++DQ+YCP
Sbjct  258  EEPVAGIFVKNCTISKTQNGVRVKTWPNGPSAITASDIHFEDIIMDNVQNPIVLDQEYCP  317

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            ++QC     SKIKIS+VSFK I GTSAT + VK+ CS   PC++VV+S + L+  G  G 
Sbjct  318  YDQCDKSASSKIKISNVSFKNIRGTSATALGVKVACSKSNPCDQVVMSDIDLKLSGA-GE  376

Query  411  AISECDNVKPTLS  373
              S+C N KPT++
Sbjct  377  LTSQCTNTKPTIT  389



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ VMG+ + +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILIDQ+YCP
Sbjct  246  EQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC     S IK+S +SFK I GTS  K AVKLLCS G PC  V L  + ++Y G +G 
Sbjct  306  WNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKYTGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G   P  C +
Sbjct  366  ATFQCSNVSPKLMGTQVPKACSS  388



>sp|Q39766.1|PGLR_GOSBA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium barbadense]
 gb|AAA58322.1| polygalacturonase [Gossypium barbadense]
Length=407

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 95/140 (68%), Gaps = 1/140 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILIDQQYCPW  589
            E+PV G+ + +C ++NT NG RIKTWP    G  S +HFED+ M+NVS+PILIDQQYCPW
Sbjct  257  EEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILIDQQYCPW  316

Query  588  NQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSA  409
            N+CK    SK+K+S++SFK I GTSA   A+K +CS   PC  V L+ + +++ G    A
Sbjct  317  NKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIQHNGAE-PA  375

Query  408  ISECDNVKPTLSGKNSPAIC  349
             S+C NVKP   GK +P  C
Sbjct  376  TSQCLNVKPITIGKLNPIPC  395



>ref|XP_006299274.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
 gb|EOA32172.1| hypothetical protein CARUB_v10015428mg [Capsella rubella]
Length=396

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = -2

Query  768  EQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILIDQQYCP  592
            EQ V G+ + +C L  T NG+RIKTWP A+ +  A  +HFED+ + NVSNPILIDQ+YCP
Sbjct  246  EQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTAFDIHFEDIIVKNVSNPILIDQEYCP  305

Query  591  WNQCKTGVPSKIKISDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGS  412
            WNQC    PS IK+ + SFK I GTS  K AVKLLCS G PC  V +  V ++Y G +G 
Sbjct  306  WNQCNKQKPSTIKLVNTSFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDVDIKYNGADGP  365

Query  411  AISECDNVKPTLSGKNSPAICDA  343
            A  +C NV P L G  +P  C A
Sbjct  366  ATFQCSNVSPKLLGTQNPKACSA  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1352312960240