BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25850_g1_i1 len=954 path=[10893:0-234 8622:235-258 11151:259-265
8646:266-323 16046:324-347 16070:348-354 16077:355-355 16078:356-372
16095:373-382 10414:383-413 11301:414-414 11302:415-441
14494:442-483 11328:484-494 16207:495-499 16266:500-501
11396:502-507 10483:508-509 9208:510-540 16300:541-556 16316:557-558
16318:559-561 16321:562-581 16341:582-644 16438:645-645
16439:646-660 16455:661-665 16460:666-666 16461:667-667
16462:668-675 16708:676-690 16365:691-703 16378:704-714 4285:715-715
16484:716-724 16493:725-743 16512:744-758 16527:759-762
16531:763-922 4611:923-936 16755:937-953]

Length=954
                                                                      Score     E

ref|XP_010557773.1|  PREDICTED: exopolygalacturonase clone GBGA48...    215   1e-62   
gb|KCW88708.1|  hypothetical protein EUGRSUZ_A01063                     204   2e-61   
gb|KCW46857.1|  hypothetical protein EUGRSUZ_K00661                     210   6e-61   
ref|XP_010038560.1|  PREDICTED: exopolygalacturonase                    209   3e-60   
ref|XP_006279044.1|  hypothetical protein CARUB_v100165411mg            199   3e-59   
ref|XP_010067907.1|  PREDICTED: exopolygalacturonase-like               205   1e-58   
ref|XP_010067918.1|  PREDICTED: exopolygalacturonase-like               205   1e-58   
ref|XP_004295350.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    204   3e-58   
dbj|BAH20364.1|  AT3G14040                                              199   6e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KCW88710.1|  hypothetical protein EUGRSUZ_A01065                     204   9e-58   
ref|XP_002884670.1|  exopolygalacturonase                               202   3e-57   
ref|XP_002862616.1|  polygalacturonase                                  201   6e-57   
ref|XP_002885005.1|  polygalacturonase                                  201   6e-57   
emb|CAA51692.1|  exopolygalacturonase                                   201   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_188020.1|  exopolygalacturonase / galacturan 1,4-alpha-gal...    201   1e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAA11160.1|  polygalacturonase                                      201   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32525.1|  polygalacturonase; pectinase                            201   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299516.1|  hypothetical protein CARUB_v10015686mg             201   1e-56   
ref|NP_187442.1|  polygalacturonase-like protein                        199   4e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAA51033.1|  exopolygalacturonase                                   199   5e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010657162.1|  PREDICTED: polygalacturonase                       195   1e-55   
ref|XP_009334235.1|  PREDICTED: exopolygalacturonase-like               197   1e-55   
ref|XP_002282594.1|  PREDICTED: exopolygalacturonase                    196   2e-55   Vitis vinifera
ref|XP_006375551.1|  hypothetical protein POPTR_0014s16040g             196   2e-55   
ref|XP_011003515.1|  PREDICTED: exopolygalacturonase clone GBGA48...    196   3e-55   
ref|XP_008349086.1|  PREDICTED: exopolygalacturonase-like               196   3e-55   
ref|XP_008391258.1|  PREDICTED: exopolygalacturonase-like               196   3e-55   
emb|CDY35967.1|  BnaA05g29830D                                          192   4e-55   
dbj|BAA89476.1|  polygalacturonase                                      194   1e-54   Salix gilgiana
emb|CBI22049.3|  unnamed protein product                                192   1e-54   
dbj|BAA89477.1|  polygalacturonase                                      194   1e-54   Salix gilgiana
ref|XP_010112808.1|  hypothetical protein L484_020040                   193   2e-54   
ref|XP_002282573.1|  PREDICTED: exopolygalacturonase                    193   2e-54   Vitis vinifera
ref|XP_008455553.1|  PREDICTED: exopolygalacturonase-like               194   2e-54   
ref|XP_004174175.1|  PREDICTED: exopolygalacturonase-like               189   3e-54   
ref|XP_004165943.1|  PREDICTED: polygalacturonase-like                  193   3e-54   
dbj|BAA89478.1|  polygalacturonase                                      192   8e-54   Salix gilgiana
ref|XP_009147020.1|  PREDICTED: exopolygalacturonase clone GBGA48...    194   8e-54   
ref|XP_002274125.1|  PREDICTED: exopolygalacturonase                    192   9e-54   Vitis vinifera
ref|XP_008462107.1|  PREDICTED: exopolygalacturonase clone GBGA483      191   1e-53   
ref|XP_004162885.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    191   2e-53   
ref|XP_004167279.1|  PREDICTED: exopolygalacturonase-like               191   2e-53   
ref|XP_010999488.1|  PREDICTED: exopolygalacturonase-like               191   2e-53   
dbj|BAA89479.1|  polygalacturonase                                      191   3e-53   Salix gilgiana
ref|XP_006387858.1|  hypothetical protein POPTR_0519s00220g             190   3e-53   
ref|XP_010093135.1|  hypothetical protein L484_009327                   190   3e-53   
ref|XP_008245681.1|  PREDICTED: exopolygalacturonase clone GBGA48...    191   3e-53   
ref|XP_010042694.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    190   4e-53   
ref|XP_010042444.1|  PREDICTED: exopolygalacturonase-like               190   5e-53   
ref|XP_010040513.1|  PREDICTED: exopolygalacturonase-like               190   5e-53   
ref|XP_010038565.1|  PREDICTED: exopolygalacturonase-like               190   6e-53   
ref|XP_010486356.1|  PREDICTED: exopolygalacturonase clone GBGA48...    191   6e-53   
gb|ADK92878.1|  polygalacturonase                                       189   7e-53   
ref|XP_002325639.2|  hypothetical protein POPTR_0019s09470g             190   7e-53   Populus trichocarpa [western balsam poplar]
ref|XP_004171844.1|  PREDICTED: polygalacturonase-like                  185   9e-53   
ref|XP_010464428.1|  PREDICTED: exopolygalacturonase clone GBGA48...    190   9e-53   
ref|XP_010458380.1|  PREDICTED: exopolygalacturonase clone GBGA48...    190   9e-53   
gb|KGN43464.1|  hypothetical protein Csa_7G037910                       189   1e-52   
ref|XP_010999486.1|  PREDICTED: exopolygalacturonase-like               189   1e-52   
ref|XP_004170151.1|  PREDICTED: polygalacturonase-like                  189   1e-52   
ref|XP_004153076.1|  PREDICTED: polygalacturonase-like                  189   1e-52   
ref|XP_010040848.1|  PREDICTED: exopolygalacturonase-like               189   1e-52   
ref|XP_010999485.1|  PREDICTED: exopolygalacturonase-like               189   1e-52   
ref|XP_010042729.1|  PREDICTED: exopolygalacturonase-like               189   1e-52   
ref|XP_004162875.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    189   2e-52   
emb|CBI22050.3|  unnamed protein product                                189   2e-52   
ref|XP_006371366.1|  hypothetical protein POPTR_0019s09500g             187   3e-52   
ref|XP_006469749.1|  PREDICTED: polygalacturonase-like                  188   3e-52   
ref|XP_006447720.1|  hypothetical protein CICLE_v10015423mg             188   3e-52   
ref|XP_010458261.1|  PREDICTED: exopolygalacturonase clone GBGA48...    189   4e-52   
ref|XP_006371367.1|  hypothetical protein POPTR_0019s09510g             187   5e-52   
ref|XP_004154764.1|  PREDICTED: polygalacturonase-like                  187   6e-52   
ref|XP_010657416.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    187   6e-52   
ref|XP_010038563.1|  PREDICTED: exopolygalacturonase-like               187   8e-52   
ref|XP_007049259.1|  Polygalacturonase                                  187   8e-52   
ref|XP_010038564.1|  PREDICTED: exopolygalacturonase-like               188   9e-52   
emb|CBI28390.3|  unnamed protein product                                188   9e-52   
ref|XP_004161033.1|  PREDICTED: exopolygalacturonase-like               186   1e-51   
emb|CBI22052.3|  unnamed protein product                                194   1e-51   
gb|KFK38239.1|  hypothetical protein AALP_AA3G087400                    188   2e-51   
gb|KCW46859.1|  hypothetical protein EUGRSUZ_K00664                     185   2e-51   
ref|XP_008245680.1|  PREDICTED: exopolygalacturonase-like               185   3e-51   
ref|XP_004144612.1|  PREDICTED: exopolygalacturonase clone GBGA48...    185   3e-51   
ref|XP_010112811.1|  hypothetical protein L484_020043                   185   4e-51   
ref|XP_008379966.1|  PREDICTED: exopolygalacturonase-like               184   7e-51   
ref|XP_007049261.1|  Pectin lyase-like superfamily protein, putative    186   8e-51   
ref|XP_007009871.1|  Pectin lyase-like superfamily protein, putative    184   9e-51   
ref|XP_010999532.1|  PREDICTED: exopolygalacturonase-like               183   1e-50   
gb|ADP09681.1|  polygalacturonase                                       184   1e-50   
ref|XP_010999487.1|  PREDICTED: exopolygalacturonase-like               184   1e-50   
ref|XP_008229849.1|  PREDICTED: exopolygalacturonase-like               184   1e-50   
emb|CDY07972.1|  BnaC03g35510D                                          184   1e-50   
ref|XP_008449697.1|  PREDICTED: exopolygalacturonase-like               184   1e-50   
emb|CDX80531.1|  BnaC07g29130D                                          184   1e-50   
ref|XP_009134998.1|  PREDICTED: exopolygalacturonase clone GBGA48...    184   1e-50   
emb|CDX74027.1|  BnaA03g30200D                                          184   1e-50   
ref|XP_004308599.1|  PREDICTED: exopolygalacturonase-like               183   1e-50   
ref|XP_008449696.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    183   1e-50   
ref|XP_002274096.1|  PREDICTED: exopolygalacturonase                    183   2e-50   Vitis vinifera
ref|XP_008229848.1|  PREDICTED: exopolygalacturonase-like               183   2e-50   
ref|XP_009365184.1|  PREDICTED: exopolygalacturonase-like               183   2e-50   
gb|AAO24261.1|  putative pollen polygalacturonase                       183   2e-50   Turnera subulata [white alder]
ref|XP_010675930.1|  PREDICTED: exopolygalacturonase-like               184   2e-50   
ref|XP_010668126.1|  PREDICTED: exopolygalacturonase clone GBGA48...    182   2e-50   
ref|XP_008229852.1|  PREDICTED: exopolygalacturonase-like               183   2e-50   
ref|XP_003633345.1|  PREDICTED: exopolygalacturonase                    182   3e-50   
ref|XP_010675940.1|  PREDICTED: exopolygalacturonase-like               183   3e-50   
ref|XP_010112809.1|  hypothetical protein L484_020041                   182   4e-50   
ref|XP_008467043.1|  PREDICTED: exopolygalacturonase-like               181   4e-50   
ref|XP_006407789.1|  hypothetical protein EUTSA_v10020501mg             185   5e-50   
ref|XP_007009872.1|  Pectin lyase-like superfamily protein, putative    182   5e-50   
ref|XP_008379967.1|  PREDICTED: exopolygalacturonase-like               181   8e-50   
ref|XP_010675916.1|  PREDICTED: exopolygalacturonase-like               182   8e-50   
ref|XP_008342227.1|  PREDICTED: exopolygalacturonase clone GBGA48...    181   8e-50   
ref|XP_004173029.1|  PREDICTED: polygalacturonase-like                  182   1e-49   
ref|XP_008449943.1|  PREDICTED: exopolygalacturonase-like               173   1e-49   
ref|XP_008441641.1|  PREDICTED: exopolygalacturonase-like               181   1e-49   
ref|XP_009365185.1|  PREDICTED: exopolygalacturonase-like               180   3e-49   
emb|CAN65674.1|  hypothetical protein VITISV_002009                     186   7e-49   Vitis vinifera
ref|XP_008459709.1|  PREDICTED: exopolygalacturonase-like               179   9e-49   
ref|XP_009365186.1|  PREDICTED: exopolygalacturonase-like               179   1e-48   
emb|CDP04343.1|  unnamed protein product                                178   1e-48   
emb|CDP04348.1|  unnamed protein product                                178   1e-48   
sp|P24548.1|PGLR_OENOR  RecName: Full=Exopolygalacturonase; Short...    177   1e-48   Oenothera organensis
emb|CDP04342.1|  unnamed protein product                                174   3e-48   
ref|XP_010689005.1|  PREDICTED: exopolygalacturonase-like               177   3e-48   
emb|CDP18013.1|  unnamed protein product                                177   5e-48   
emb|CAN65676.1|  hypothetical protein VITISV_002011                     180   6e-48   Vitis vinifera
ref|XP_008460220.1|  PREDICTED: exopolygalacturonase-like               176   1e-47   
gb|KCW46858.1|  hypothetical protein EUGRSUZ_K00662                     175   1e-47   
ref|XP_011073814.1|  PREDICTED: exopolygalacturonase clone GBGA48...    175   2e-47   
emb|CDY35969.1|  BnaA05g29810D                                          177   2e-47   
ref|XP_009147021.1|  PREDICTED: exopolygalacturonase clone GBGA48...    177   2e-47   
ref|XP_004169306.1|  PREDICTED: polygalacturonase-like                  175   4e-47   
ref|XP_004140444.1|  PREDICTED: exopolygalacturonase-like               174   4e-47   
gb|ADC53480.1|  polygalacturonase                                       174   5e-47   Gossypium hirsutum [American cotton]
emb|CDY28013.1|  BnaC05g44150D                                          176   7e-47   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    181   8e-47   
ref|XP_010667847.1|  PREDICTED: exopolygalacturonase-like               173   1e-46   
ref|XP_010038561.1|  PREDICTED: exopolygalacturonase-like               175   1e-46   
ref|XP_004144611.1|  PREDICTED: polygalacturonase-like                  175   2e-46   
ref|XP_010536244.1|  PREDICTED: exopolygalacturonase-like               172   3e-46   
ref|XP_010532220.1|  PREDICTED: exopolygalacturonase-like               172   5e-46   
ref|XP_009612480.1|  PREDICTED: polygalacturonase-like                  171   5e-46   
ref|XP_010536243.1|  PREDICTED: exopolygalacturonase-like               171   5e-46   
emb|CDP04350.1|  unnamed protein product                                171   5e-46   
ref|XP_008455507.1|  PREDICTED: exopolygalacturonase-like               171   7e-46   
ref|XP_010418169.1|  PREDICTED: polygalacturonase-like                  171   7e-46   
sp|Q6H9K0.1|PGLR2_PLAAC  RecName: Full=Exopolygalacturonase; AltN...    170   7e-46   Platanus x hispanica [London plane tree]
pir||S46530  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    170   1e-45
dbj|BAO02513.1|  predicted polygalacturonase ortholog                   171   1e-45   
emb|CDP04347.1|  unnamed protein product                                164   1e-45   
ref|XP_009599317.1|  PREDICTED: polygalacturonase                       170   1e-45   
ref|XP_007152047.1|  hypothetical protein PHAVU_004G097300g             170   1e-45   
ref|XP_007143503.1|  hypothetical protein PHAVU_007G0770001g            167   2e-45   
ref|XP_009780910.1|  PREDICTED: polygalacturonase                       170   2e-45   
ref|XP_004243884.1|  PREDICTED: polygalacturonase-like                  169   2e-45   
gb|KDO36716.1|  hypothetical protein CISIN_1g036262mg                   164   2e-45   
ref|XP_009764608.1|  PREDICTED: polygalacturonase-like                  169   3e-45   
ref|XP_004163433.1|  PREDICTED: polygalacturonase-like                  169   5e-45   
ref|XP_010675960.1|  PREDICTED: exopolygalacturonase clone GBGA48...    167   5e-45   
gb|AFK41055.1|  unknown                                                 169   5e-45   
ref|XP_010464426.1|  PREDICTED: polygalacturonase-like                  169   6e-45   
ref|XP_007143501.1|  hypothetical protein PHAVU_007G0769002g            164   6e-45   
pir||S46529  polygalacturonase (EC 3.2.1.15) precursor (clone pC2...    167   9e-45
gb|ABE65925.1|  polygalacturonase/pectinase                             165   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009334234.1|  PREDICTED: exopolygalacturonase-like               168   1e-44   
gb|KFK38253.1|  hypothetical protein AALP_AA3G089200                    167   1e-44   
ref|XP_010112807.1|  hypothetical protein L484_020039                   167   2e-44   
ref|XP_010675951.1|  PREDICTED: exopolygalacturonase-like isoform X1    167   2e-44   
ref|XP_004144529.1|  PREDICTED: polygalacturonase-like                  167   2e-44   
ref|XP_009348297.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    162   3e-44   
gb|KHN24677.1|  Polygalacturonase                                       166   3e-44   
ref|XP_006299382.1|  hypothetical protein CARUB_v10015541mg             166   3e-44   
ref|XP_006366630.1|  PREDICTED: polygalacturonase-like                  166   4e-44   
ref|XP_009601010.1|  PREDICTED: polygalacturonase-like                  166   4e-44   
sp|Q05967.1|PGLR_TOBAC  RecName: Full=Polygalacturonase; Short=PG...    166   5e-44   Nicotiana tabacum [American tobacco]
ref|XP_004305963.1|  PREDICTED: exopolygalacturonase-like               166   5e-44   
emb|CAA50335.1|  polygalacturonase                                      166   5e-44   Nicotiana tabacum [American tobacco]
ref|XP_009804151.1|  PREDICTED: polygalacturonase-like                  166   5e-44   
ref|XP_003552049.1|  PREDICTED: polygalacturonase                       165   7e-44   
ref|XP_010675884.1|  PREDICTED: exopolygalacturonase-like               165   8e-44   
emb|CDY07973.1|  BnaC03g35500D                                          159   9e-44   
ref|XP_006492954.1|  PREDICTED: exopolygalacturonase-like               165   9e-44   
gb|KHN44923.1|  Polygalacturonase                                       163   9e-44   
ref|XP_006407791.1|  hypothetical protein EUTSA_v10020866mg             165   1e-43   
gb|KHN15656.1|  Polygalacturonase                                       164   1e-43   
ref|XP_002526191.1|  Polygalacturonase precursor, putative              165   1e-43   Ricinus communis
ref|XP_007143491.1|  hypothetical protein PHAVU_007G0764001g            159   1e-43   
ref|NP_187441.1|  polygalacturonase-like protein                        164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039263.1|  PREDICTED: exopolygalacturonase-like               164   2e-43   
gb|KHN10402.1|  Polygalacturonase                                       163   2e-43   
ref|XP_002310765.1|  hypothetical protein POPTR_0007s11860g             164   3e-43   Populus trichocarpa [western balsam poplar]
gb|ABR26683.1|  polygalacturonase                                       164   3e-43   Fragaria chiloensis
ref|XP_006421347.1|  hypothetical protein CICLE_v10006970mg             163   3e-43   
ref|XP_010547226.1|  PREDICTED: polygalacturonase-like                  164   3e-43   
ref|XP_003522977.1|  PREDICTED: polygalacturonase-like                  164   3e-43   
ref|XP_003522976.1|  PREDICTED: polygalacturonase-like                  164   4e-43   
ref|XP_003522975.1|  PREDICTED: polygalacturonase-like                  163   4e-43   
ref|XP_006492955.1|  PREDICTED: exopolygalacturonase-like               164   4e-43   
emb|CDY71093.1|  BnaCnng71300D                                          160   4e-43   
ref|XP_006495222.1|  PREDICTED: exopolygalacturonase-like               164   4e-43   
gb|ABE77145.1|  putative polygalacturonase                              164   4e-43   Fragaria x ananassa
ref|XP_006489998.1|  PREDICTED: exopolygalacturonase-like               164   4e-43   
ref|XP_004293444.1|  PREDICTED: polygalacturonase-like                  164   4e-43   
ref|XP_008222765.1|  PREDICTED: exopolygalacturonase-like               164   5e-43   
ref|XP_007143497.1|  hypothetical protein PHAVU_007G0766000g            159   5e-43   
ref|XP_004490643.1|  PREDICTED: polygalacturonase-like                  163   5e-43   
ref|XP_009134996.1|  PREDICTED: polygalacturonase-like                  163   6e-43   
gb|ABN13878.1|  polygalacturonase                                       163   6e-43   
emb|CDY54512.1|  BnaC07g49180D                                          162   1e-42   
ref|XP_008231346.1|  PREDICTED: exopolygalacturonase-like               162   1e-42   
gb|ABG38468.1|  pollen-expressed protein MF9c                           162   1e-42   Brassica oleracea
emb|CDY07974.1|  BnaC03g35490D                                          162   1e-42   
gb|ABL63521.1|  pollen-specific protein MF9l                            162   1e-42   Brassica oleracea var. alboglabra
ref|XP_004253347.1|  PREDICTED: polygalacturonase-like                  162   1e-42   
gb|KHN46909.1|  Polygalacturonase                                       161   2e-42   
ref|XP_003544118.1|  PREDICTED: polygalacturonase-like isoform X1       161   2e-42   
ref|XP_002526193.1|  hypothetical protein RCOM_0764760                  161   2e-42   Ricinus communis
ref|XP_008462134.1|  PREDICTED: exopolygalacturonase-like               163   2e-42   
ref|XP_006595658.1|  PREDICTED: polygalacturonase-like isoform X2       161   3e-42   
sp|P35337.1|PGLR_BRANA  RecName: Full=Polygalacturonase; Short=PG...    161   3e-42   Brassica napus [oilseed rape]
ref|XP_008231357.1|  PREDICTED: exopolygalacturonase-like               159   4e-42   
ref|XP_008466943.1|  PREDICTED: polygalacturonase-like                  156   4e-42   
gb|KFK38252.1|  hypothetical protein AALP_AA3G089100                    161   4e-42   
ref|XP_009365183.1|  PREDICTED: exopolygalacturonase-like               161   4e-42   
ref|XP_008245812.1|  PREDICTED: exopolygalacturonase-like               161   4e-42   
gb|AAP37458.1|  polygalacturonase                                       161   4e-42   Fragaria x ananassa
dbj|BAC42591.1|  putative polygalacturonase                             156   4e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006407792.1|  hypothetical protein EUTSA_v10020872mg             160   5e-42   
ref|XP_006407793.1|  hypothetical protein EUTSA_v10020872mg             160   5e-42   
ref|XP_010548800.1|  PREDICTED: polygalacturonase-like                  160   6e-42   
ref|XP_010548798.1|  PREDICTED: polygalacturonase-like                  160   6e-42   
ref|XP_010464425.1|  PREDICTED: polygalacturonase-like                  160   6e-42   
emb|CDY05701.1|  BnaC02g38360D                                          160   6e-42   
ref|XP_009129707.1|  PREDICTED: polygalacturonase-like                  160   7e-42   
sp|Q39786.1|PGLR_GOSHI  RecName: Full=Polygalacturonase; Short=PG...    160   8e-42   Gossypium hirsutum [American cotton]
ref|XP_003527123.1|  PREDICTED: polygalacturonase-like                  160   9e-42   
ref|XP_010458152.1|  PREDICTED: polygalacturonase-like                  160   1e-41   
ref|XP_002884668.1|  polygalacturonase 3                                160   1e-41   
ref|XP_008366919.1|  PREDICTED: LOW QUALITY PROTEIN: exopolygalac...    161   1e-41   
ref|XP_004295347.1|  PREDICTED: polygalacturonase-like                  160   1e-41   
emb|CDY22139.1|  BnaC01g39620D                                          159   1e-41   
ref|XP_010486355.1|  PREDICTED: polygalacturonase-like                  160   1e-41   
ref|XP_010442229.1|  PREDICTED: polygalacturonase-like                  159   1e-41   
ref|XP_006395214.1|  hypothetical protein EUTSA_v10004361mg             159   1e-41   
ref|XP_008381794.1|  PREDICTED: exopolygalacturonase-like               159   1e-41   
emb|CDY22140.1|  BnaC01g39610D                                          159   2e-41   
ref|XP_010439352.1|  PREDICTED: polygalacturonase-like                  159   2e-41   
emb|CDX86325.1|  BnaA06g30420D                                          158   3e-41   
ref|XP_009151612.1|  PREDICTED: polygalacturonase                       158   3e-41   
gb|ACP74159.1|  putative polygalacturonase                              158   4e-41   
ref|XP_009350286.1|  PREDICTED: exopolygalacturonase-like               158   4e-41   
ref|NP_199625.1|  putative polygalacturonase / pectinase                158   4e-41   Arabidopsis thaliana [mouse-ear cress]
sp|Q39766.1|PGLR_GOSBA  RecName: Full=Polygalacturonase; Short=PG...    158   4e-41   Gossypium barbadense [Egyptian cotton]
ref|XP_006299274.1|  hypothetical protein CARUB_v10015428mg             158   4e-41   
emb|CDY22137.1|  BnaC01g39640D                                          158   5e-41   
ref|XP_009124086.1|  PREDICTED: polygalacturonase                       158   5e-41   
ref|XP_006279754.1|  hypothetical protein CARUB_v10027711mg             157   6e-41   
ref|NP_187439.1|  polygalacturonase-like protein                        157   6e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CAA05892.1|  polygalacturonase                                      157   7e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124109.1|  PREDICTED: polygalacturonase-like                  157   7e-41   
ref|XP_002884669.1|  hypothetical protein ARALYDRAFT_478121             157   8e-41   
gb|KHN40047.1|  Polygalacturonase                                       157   9e-41   
ref|XP_003595656.1|  Polygalactorunase PG11                             157   9e-41   
emb|CBI28400.3|  unnamed protein product                                150   9e-41   
ref|XP_003544285.1|  PREDICTED: polygalacturonase-like                  157   1e-40   
ref|XP_010482057.1|  PREDICTED: polygalacturonase-like                  157   1e-40   
ref|NP_187440.1|  polygalacturonase-like protein                        157   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536242.1|  PREDICTED: polygalacturonase-like                  154   2e-40   
ref|XP_002865611.1|  hypothetical protein ARALYDRAFT_494865             156   2e-40   
ref|XP_006299755.1|  hypothetical protein CARUB_v10015950mg             157   3e-40   
ref|XP_004488391.1|  PREDICTED: polygalacturonase-like                  155   3e-40   
gb|AHL24657.1|  Sal k 6.01 allergen                                     155   3e-40   
gb|AFK35534.1|  unknown                                                 155   5e-40   
ref|XP_004292143.1|  PREDICTED: polygalacturonase-like                  157   6e-40   
ref|XP_006856226.1|  hypothetical protein AMTR_s00059p00207710          155   6e-40   
ref|XP_006845391.1|  hypothetical protein AMTR_s00019p00057300          153   7e-40   
ref|XP_008229862.1|  PREDICTED: polygalacturonase-like                  158   9e-40   
ref|XP_006845389.1|  hypothetical protein AMTR_s00019p00055210          155   1e-39   
gb|KFK31316.1|  hypothetical protein AALP_AA6G096900                    154   1e-39   
gb|AAM74219.1|AF518563_1  putative pollen polygalacturonase             154   1e-39   
ref|XP_008465833.1|  PREDICTED: exopolygalacturonase-like               154   1e-39   
gb|AAO62938.1|  polygalactorunase PG11 precursor                        154   1e-39   
ref|XP_004491599.1|  PREDICTED: polygalacturonase-like                  154   1e-39   
gb|AAP42648.1|  polygalacturonase                                       154   2e-39   
ref|XP_009134997.1|  PREDICTED: polygalacturonase                       153   2e-39   
ref|XP_009409865.1|  PREDICTED: exopolygalacturonase-like               152   6e-39   
ref|XP_010266273.1|  PREDICTED: exopolygalacturonase-like               152   7e-39   
gb|KHN43962.1|  Polygalacturonase                                       151   2e-38   
ref|XP_003518573.1|  PREDICTED: polygalacturonase-like                  151   2e-38   
ref|XP_010489712.1|  PREDICTED: polygalacturonase-like                  150   2e-38   
emb|CAA72003.1|  polygalacturonase                                      150   2e-38   
ref|XP_007199143.1|  hypothetical protein PRUPE_ppa019563mg             149   6e-38   
ref|XP_008229865.1|  PREDICTED: polygalacturonase                       148   8e-38   
ref|XP_004292620.1|  PREDICTED: polygalacturonase-like                  151   9e-38   
gb|EYU42737.1|  hypothetical protein MIMGU_mgv1a0087912mg               145   9e-38   
ref|XP_006845390.1|  hypothetical protein AMTR_s00019p00055750          144   1e-37   
gb|KFK28496.1|  hypothetical protein AALP_AA7G003400                    149   1e-37   
ref|XP_008235914.1|  PREDICTED: exopolygalacturonase                    150   1e-37   
ref|XP_008357340.1|  PREDICTED: exopolygalacturonase-like               143   2e-37   
ref|XP_011097084.1|  PREDICTED: polygalacturonase-like                  144   4e-37   
ref|XP_010449495.1|  PREDICTED: exopolygalacturonase-like               147   4e-37   
ref|XP_010269646.1|  PREDICTED: exopolygalacturonase-like               148   6e-37   
ref|XP_006856225.1|  hypothetical protein AMTR_s00059p00207430          147   6e-37   
emb|CDY01524.1|  BnaC07g35140D                                          147   6e-37   
sp|Q40312.1|PGLR_MEDSA  RecName: Full=Polygalacturonase; Short=PG...    147   7e-37   
ref|XP_006414139.1|  hypothetical protein EUTSA_v10027030mg             146   8e-37   
gb|AES65915.2|  polygalacturonase 11c, putative                         147   8e-37   
ref|XP_002870065.1|  glycoside hydrolase family 28 protein              147   8e-37   
ref|XP_004289173.1|  PREDICTED: polygalacturonase-like                  146   8e-37   
ref|XP_003595659.1|  Polygalactorunase PG11                             147   9e-37   
gb|ABY21306.1|  pollen allergen Pla o 2                                 146   1e-36   
ref|XP_006845393.1|  hypothetical protein AMTR_s00019p00058670          146   1e-36   
ref|XP_008805455.1|  PREDICTED: exopolygalacturonase-like               146   1e-36   
ref|XP_010439893.1|  PREDICTED: exopolygalacturonase                    146   1e-36   
ref|XP_006285299.1|  hypothetical protein CARUB_v10006680mg             146   1e-36   
ref|XP_004154223.1|  PREDICTED: polygalacturonase-like                  138   2e-36   
ref|XP_010434565.1|  PREDICTED: exopolygalacturonase-like               145   2e-36   
ref|XP_004174153.1|  PREDICTED: polygalacturonase-like                  138   2e-36   
ref|XP_011099769.1|  PREDICTED: polygalacturonase-like                  145   3e-36   
ref|XP_002312795.2|  hypothetical protein POPTR_0009s17010g             145   4e-36   
ref|XP_004514023.1|  PREDICTED: polygalacturonase-like                  144   4e-36   
ref|XP_006845467.1|  hypothetical protein AMTR_s00019p00130680          144   4e-36   
ref|XP_007142511.1|  hypothetical protein PHAVU_008G286900g             144   4e-36   
ref|XP_010645672.1|  PREDICTED: exopolygalacturonase                    143   5e-36   
ref|XP_009136909.1|  PREDICTED: exopolygalacturonase                    145   5e-36   
emb|CAA16789.1|  polygalacturonase-like protein                         144   5e-36   
ref|XP_011097055.1|  PREDICTED: polygalacturonase-like                  144   7e-36   
emb|CDX90415.1|  BnaA03g43660D                                          144   9e-36   
ref|NP_193552.1|  glycoside hydrolase family 28 protein / polygal...    144   9e-36   
ref|XP_011097041.1|  PREDICTED: polygalacturonase-like                  144   1e-35   
ref|XP_008377875.1|  PREDICTED: exopolygalacturonase-like               144   1e-35   
ref|XP_010530386.1|  PREDICTED: exopolygalacturonase                    144   1e-35   
ref|XP_011097079.1|  PREDICTED: polygalacturonase-like                  143   1e-35   
ref|XP_010251320.1|  PREDICTED: exopolygalacturonase-like               143   1e-35   
ref|XP_010913888.1|  PREDICTED: exopolygalacturonase-like               143   1e-35   
gb|KDO50514.1|  hypothetical protein CISIN_1g040962mg                   139   2e-35   
ref|XP_008357338.1|  PREDICTED: exopolygalacturonase-like               143   2e-35   
ref|XP_006492953.1|  PREDICTED: exopolygalacturonase clone GBGA48...    142   2e-35   
ref|XP_009333810.1|  PREDICTED: exopolygalacturonase-like               143   2e-35   
ref|XP_009341510.1|  PREDICTED: exopolygalacturonase-like               143   2e-35   
ref|XP_011069588.1|  PREDICTED: polygalacturonase-like                  142   2e-35   
ref|XP_004296118.1|  PREDICTED: polygalacturonase-like                  143   2e-35   
gb|EYU42733.1|  hypothetical protein MIMGU_mgv1a007538mg                142   3e-35   
ref|XP_008798766.1|  PREDICTED: exopolygalacturonase-like               142   5e-35   
gb|EYU42736.1|  hypothetical protein MIMGU_mgv1a007545mg                142   5e-35   
gb|EYU42739.1|  hypothetical protein MIMGU_mgv1a007536mg                141   6e-35   
gb|EYU42734.1|  hypothetical protein MIMGU_mgv1a007528mg                141   6e-35   
gb|KDP30863.1|  hypothetical protein JCGZ_13806                         134   7e-35   
gb|AAQ63000.1|  oil palm polygalacturonase allergen PEST643             142   7e-35   
ref|XP_010913952.1|  PREDICTED: exopolygalacturonase-like               142   7e-35   
ref|XP_006486583.1|  PREDICTED: exopolygalacturonase-like               141   1e-34   
emb|CBM42665.1|  group 13 grass pollen allergen                         135   1e-34   
gb|EYU42735.1|  hypothetical protein MIMGU_mgv1a007533mg                140   1e-34   
emb|CBM42664.1|  group 13 grass pollen allergen                         135   1e-34   
ref|XP_011000860.1|  PREDICTED: exopolygalacturonase-like               140   2e-34   
ref|XP_006848769.1|  hypothetical protein AMTR_s00026p00071010          136   2e-34   
ref|XP_008367231.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    139   3e-34   
ref|XP_006442242.1|  hypothetical protein CICLE_v10023493mg             139   4e-34   
ref|XP_009419161.1|  PREDICTED: exopolygalacturonase-like               139   4e-34   
ref|XP_011097018.1|  PREDICTED: polygalacturonase-like                  139   4e-34   
ref|XP_006477959.1|  PREDICTED: exopolygalacturonase-like               139   4e-34   
ref|XP_004292314.1|  PREDICTED: exopolygalacturonase-like               139   5e-34   
emb|CDP04349.1|  unnamed protein product                                135   6e-34   
ref|XP_008451196.1|  PREDICTED: exopolygalacturonase isoform X3         138   6e-34   
ref|XP_008451195.1|  PREDICTED: exopolygalacturonase isoform X2         139   7e-34   
ref|XP_011097019.1|  PREDICTED: polygalacturonase-like                  138   7e-34   
gb|KGN43365.1|  hypothetical protein Csa_7G027810                       139   8e-34   
ref|XP_008451194.1|  PREDICTED: exopolygalacturonase isoform X1         138   8e-34   
ref|XP_004967188.1|  PREDICTED: exopolygalacturonase-like               133   1e-33   
gb|EPS61275.1|  polygalacturonase                                       134   2e-33   
ref|XP_010690734.1|  PREDICTED: exopolygalacturonase                    137   2e-33   
ref|XP_010253373.1|  PREDICTED: exopolygalacturonase-like               135   3e-33   
ref|XP_004144956.1|  PREDICTED: exopolygalacturonase-like               137   3e-33   
ref|XP_007043097.1|  Pectin lyase-like superfamily protein isoform 3    136   4e-33   
emb|CBI21720.3|  unnamed protein product                                128   5e-33   
ref|XP_010248093.1|  PREDICTED: exopolygalacturonase-like               135   5e-33   
emb|CBI28398.3|  unnamed protein product                                128   9e-33   
ref|XP_007043095.1|  Pectin lyase-like superfamily protein isoform 1    135   9e-33   
gb|AAX45476.1|  polygalacturonase                                       135   9e-33   
ref|XP_009417454.1|  PREDICTED: exopolygalacturonase-like               135   9e-33   
ref|XP_006656147.1|  PREDICTED: exopolygalacturonase-like               135   1e-32   
emb|CBI22963.3|  unnamed protein product                                135   1e-32   
emb|CDX88444.1|  BnaC06g38880D                                          135   1e-32   
ref|XP_009106547.1|  PREDICTED: exopolygalacturonase                    135   1e-32   
emb|CDY52447.1|  BnaA07g39240D                                          135   1e-32   
ref|XP_010092712.1|  hypothetical protein L484_024607                   135   2e-32   
ref|NP_001057816.2|  Os06g0545800                                       131   2e-32   
ref|XP_002438669.1|  hypothetical protein SORBIDRAFT_10g024000          130   2e-32   
ref|XP_009398783.1|  PREDICTED: exopolygalacturonase-like               134   3e-32   
ref|XP_004967084.1|  PREDICTED: exopolygalacturonase-like               133   6e-32   
gb|KDO71757.1|  hypothetical protein CISIN_1g0399591mg                  127   6e-32   
gb|ACN85300.1|  exopolygalacturonase precursor                          133   6e-32   
ref|XP_009141290.1|  PREDICTED: exopolygalacturonase-like               133   7e-32   
gb|AIL01321.1|  group 13 allergen Sor h 13.02                           133   8e-32   
gb|AEK28685.1|  pectin lyase superfamily protein                        126   8e-32   
ref|XP_007050989.1|  Polygalacturonase 4, putative                      133   9e-32   
ref|XP_002438528.1|  hypothetical protein SORBIDRAFT_10g021590          133   1e-31   
gb|AFW76553.1|  hypothetical protein ZEAMMB73_007553                    131   1e-31   
gb|KCW80887.1|  hypothetical protein EUGRSUZ_C02251                     132   1e-31   
gb|AIL01320.1|  group 13 allergen Sor h 13.01                           132   1e-31   
ref|XP_010547006.1|  PREDICTED: exopolygalacturonase-like               133   1e-31   
ref|XP_006389987.1|  hypothetical protein EUTSA_v10018650mg             132   1e-31   
gb|EEC83381.1|  hypothetical protein OsI_28796                          128   2e-31   
emb|CAN69218.1|  hypothetical protein VITISV_012014                     135   2e-31   
ref|XP_011032297.1|  PREDICTED: polygalacturonase-like                  131   2e-31   
gb|AAQ62998.1|  oil palm polygalacturonase allergen PEST459             131   3e-31   
ref|XP_010910801.1|  PREDICTED: exopolygalacturonase-like               131   3e-31   
ref|XP_008650471.1|  PREDICTED: exopolygalacturonase-like               131   3e-31   
ref|XP_008803528.1|  PREDICTED: exopolygalacturonase-like               131   3e-31   
ref|XP_009400098.1|  PREDICTED: exopolygalacturonase-like               132   4e-31   
dbj|BAJ88053.1|  predicted protein                                      131   4e-31   
ref|XP_002272193.1|  PREDICTED: exopolygalacturonase                    131   4e-31   
ref|XP_004965898.1|  PREDICTED: exopolygalacturonase-like               131   4e-31   
ref|XP_002273801.1|  PREDICTED: exopolygalacturonase                    130   5e-31   
emb|CBM42666.1|  group 13 grass pollen allergen                         125   5e-31   
ref|XP_004986318.1|  PREDICTED: exopolygalacturonase-like               130   5e-31   
emb|CDY23765.1|  BnaC04g43570D                                          130   6e-31   
ref|NP_001057815.1|  Os06g0545400                                       130   6e-31   
gb|EAZ01276.1|  hypothetical protein OsI_23299                          130   6e-31   
ref|XP_010649600.1|  PREDICTED: exopolygalacturonase-like               130   6e-31   
gb|ACN85237.1|  exopolygalacturonase precursor                          130   7e-31   
ref|XP_008353213.1|  PREDICTED: exopolygalacturonase-like               130   7e-31   
ref|XP_010099972.1|  hypothetical protein L484_014009                   130   7e-31   
emb|CBM42667.1|  group 13 grass pollen allergen                         125   7e-31   
emb|CAA40803.1|  polygalacturonase                                      125   7e-31   
ref|XP_008450474.1|  PREDICTED: polygalacturonase-like                  128   8e-31   
gb|ACU19275.1|  unknown                                                 122   1e-30   
gb|AFS18538.1|  PG2                                                     124   1e-30   
ref|XP_009586577.1|  PREDICTED: exopolygalacturonase-like               126   1e-30   
ref|XP_010259722.1|  PREDICTED: exopolygalacturonase-like               130   1e-30   
gb|EYU29596.1|  hypothetical protein MIMGU_mgv1a020057mg                129   1e-30   
dbj|BAK05779.1|  predicted protein                                      129   2e-30   
emb|CDP06168.1|  unnamed protein product                                129   2e-30   
gb|EPS62269.1|  hypothetical protein M569_12521                         126   2e-30   
ref|XP_002523118.1|  Exopolygalacturonase clone GBGE184 precursor...    127   2e-30   
ref|XP_007143499.1|  hypothetical protein PHAVU_007G076800g             127   2e-30   
ref|XP_002314146.2|  hypothetical protein POPTR_0009s04300g             128   3e-30   
ref|XP_002300425.2|  hypothetical protein POPTR_0001s38690g             127   3e-30   
ref|XP_002437275.1|  hypothetical protein SORBIDRAFT_10g024010          128   3e-30   
ref|XP_008227080.1|  PREDICTED: exopolygalacturonase-like               128   3e-30   
gb|AFW76324.1|  hypothetical protein ZEAMMB73_136411                    125   3e-30   
gb|KDP27841.1|  hypothetical protein JCGZ_18921                         128   3e-30   
gb|EEE68484.1|  hypothetical protein OsJ_26895                          128   4e-30   
ref|XP_004172677.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    122   4e-30   
gb|EYU31582.1|  hypothetical protein MIMGU_mgv1a023133mg                127   4e-30   
ref|NP_001061556.1|  Os08g0327200                                       128   5e-30   
ref|XP_004137312.1|  PREDICTED: exopolygalacturonase-like               125   5e-30   
gb|KGN53545.1|  hypothetical protein Csa_4G076240                       125   7e-30   
gb|EMT33862.1|  putative Exopolygalacturonase                           127   7e-30   
ref|XP_002318410.2|  hypothetical protein POPTR_0012s02090g             123   7e-30   
ref|XP_009596400.1|  PREDICTED: exopolygalacturonase-like               127   7e-30   
ref|XP_006489253.1|  PREDICTED: polygalacturonase-like                  127   8e-30   
gb|EMS68211.1|  Exopolygalacturonase                                    127   9e-30   
ref|XP_002314372.2|  hypothetical protein POPTR_0010s01460g             127   9e-30   
ref|XP_010652203.1|  PREDICTED: exopolygalacturonase                    127   1e-29   
gb|EMT18530.1|  Exopolygalacturonase                                    127   1e-29   
emb|CBI36886.3|  unnamed protein product                                127   1e-29   
ref|XP_009767891.1|  PREDICTED: exopolygalacturonase-like               127   1e-29   
ref|XP_010259724.1|  PREDICTED: exopolygalacturonase-like               127   1e-29   
ref|XP_010938496.1|  PREDICTED: exopolygalacturonase-like               128   1e-29   
gb|EMS56561.1|  Exopolygalacturonase                                    127   1e-29   
ref|XP_004974902.1|  PREDICTED: exopolygalacturonase-like               126   1e-29   
ref|XP_010270548.1|  PREDICTED: exopolygalacturonase-like               126   1e-29   
ref|XP_008452143.1|  PREDICTED: exopolygalacturonase                    126   2e-29   
ref|XP_010026119.1|  PREDICTED: exopolygalacturonase-like               126   2e-29   
ref|XP_004156544.1|  PREDICTED: exopolygalacturonase-like               125   2e-29   
emb|CAB42886.1|  polygalacturonase                                      125   3e-29   
ref|XP_008223247.1|  PREDICTED: exopolygalacturonase-like               125   3e-29   
ref|XP_011006455.1|  PREDICTED: exopolygalacturonase-like               125   3e-29   
gb|EMT24489.1|  Exopolygalacturonase                                    124   3e-29   
ref|XP_002889191.1|  predicted protein                                  125   3e-29   
gb|KDO58458.1|  hypothetical protein CISIN_1g045893mg                   124   3e-29   
ref|XP_006659306.1|  PREDICTED: exopolygalacturonase-like               125   3e-29   
gb|EAZ01274.1|  hypothetical protein OsI_23298                          125   4e-29   
ref|XP_002444237.1|  hypothetical protein SORBIDRAFT_07g016970          125   4e-29   
ref|XP_006656243.1|  PREDICTED: exopolygalacturonase-like               125   4e-29   
ref|XP_003563839.1|  PREDICTED: exopolygalacturonase-like               125   5e-29   
gb|ACN85328.1|  exopolygalacturonase precursor                          125   5e-29   
ref|XP_010277789.1|  PREDICTED: polygalacturonase-like                  125   5e-29   
ref|XP_006295486.1|  hypothetical protein CARUB_v10024590mg             125   5e-29   
ref|XP_011083305.1|  PREDICTED: exopolygalacturonase-like               124   6e-29   
ref|XP_009589812.1|  PREDICTED: exopolygalacturonase-like               124   6e-29   
ref|XP_002879431.1|  hypothetical protein ARALYDRAFT_902380             124   7e-29   
pir||S16998  polygalacturonase (EC 3.2.1.15) - maize                    124   8e-29
ref|XP_003560585.2|  PREDICTED: exopolygalacturonase-like               124   8e-29   
dbj|BAK06865.1|  predicted protein                                      124   8e-29   
ref|NP_001105432.1|  exopolygalacturonase precursor                     124   9e-29   
emb|CAA40910.1|  polygalacturonase                                      124   9e-29   
ref|XP_002315493.2|  hypothetical protein POPTR_0010s00940g             124   1e-28   
ref|XP_010431549.1|  PREDICTED: exopolygalacturonase-like               124   1e-28   
ref|XP_004139060.1|  PREDICTED: polygalacturonase-like                  124   1e-28   
ref|XP_004134494.1|  PREDICTED: exopolygalacturonase-like               124   1e-28   
emb|CDP17107.1|  unnamed protein product                                124   1e-28   
ref|XP_008649074.1|  PREDICTED: exopolygalacturonase                    124   1e-28   
ref|XP_004287176.1|  PREDICTED: polygalacturonase-like                  123   1e-28   
ref|XP_006851124.1|  hypothetical protein AMTR_s00179p00030770          119   1e-28   
ref|XP_009776874.1|  PREDICTED: exopolygalacturonase-like               124   1e-28   
ref|XP_007022170.1|  Pectin lyase-like superfamily protein, putative    124   1e-28   



>ref|XP_010557773.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Tarenaya 
hassleriana]
Length=406

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GV V+HC +SNT+NGVRIKTWPASP G+AS +HFED+ M+NV  PIL+D
Sbjct  253  LGRYPNEQPVRGVHVRHCTISNTMNGVRIKTWPASPAGIASNLHFEDIVMENVGTPILVD  312

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK G PS +KI+DVSFK I GTS+TK AVKL+CS GVPC+KV LS + L Y 
Sbjct  313  QEYCPYNHCKRGSPSMVKISDVSFKNIRGTSSTKTAVKLVCSKGVPCSKVELSDINLTYN  372

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A+SEC NVKP LSGK  PA C
Sbjct  373  GKDGPAVSECANVKPILSGKIIPAAC  398



>gb|KCW88708.1| hypothetical protein EUGRSUZ_A01063 [Eucalyptus grandis]
Length=174

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++ID
Sbjct  19   LGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIID  78

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCPWNQCK+  PS+IKI++VSF  I GTS+T+ AV L CSS +PC +V +S + + Y 
Sbjct  79   QQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYH  138

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NVKPT+SGK +PAIC
Sbjct  139  GPEGPATSVCSNVKPTISGKQNPAIC  164



>gb|KCW46857.1| hypothetical protein EUGRSUZ_K00661 [Eucalyptus grandis]
Length=370

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y +EQPV+GVTV++C L+NT+NG+R+KTWP SP+GVASGMHFED+ ++NVS PILID
Sbjct  220  LGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILID  279

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N C+  +PSK+KI+DVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y 
Sbjct  280  QNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYN  339

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G NG+A S+C+NVKPT++GK S  IC
Sbjct  340  GRNGTATSQCENVKPTIAGKLSLPIC  365



>ref|XP_010038560.1| PREDICTED: exopolygalacturonase [Eucalyptus grandis]
Length=407

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y +EQPV+GVTV++C L+NT+NG+R+KTWP SP+GVASGMHFED+ ++NVS PILID
Sbjct  257  LGKYHDEQPVVGVTVRNCTLTNTMNGIRVKTWPNSPSGVASGMHFEDITVNNVSTPILID  316

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N C+  +PSK+KI+DVSF+ I GTSAT +AVKL+CS GVPC KV L+ + L Y 
Sbjct  317  QNYCPYNNCQQKIPSKVKISDVSFRNIRGTSATPLAVKLVCSRGVPCQKVELADINLRYN  376

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G NG+A S+C+NVKPT++GK S  IC
Sbjct  377  GRNGTATSQCENVKPTIAGKLSLPIC  402



>ref|XP_006279044.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
 gb|EOA11942.1| hypothetical protein CARUB_v100165411mg, partial [Capsella rubella]
Length=168

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP GVAS + FED+ MDNVS P+LID
Sbjct  15   LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLID  74

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPS++K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  75   QEYCPYGHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  134

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP L+GK  PA C
Sbjct  135  GKEGPAVSACSNIKPVLTGKLVPAAC  160



>ref|XP_010067907.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=401

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++ID
Sbjct  246  LGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCPWNQCK+  PS+IKI++VSF  I GTS+T+ AV L CSS +PC +V +S + + Y 
Sbjct  306  QQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYH  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NVKPT+SGK +PAIC
Sbjct  366  GPEGPATSVCSNVKPTISGKQNPAIC  391



>ref|XP_010067918.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW88713.1| hypothetical protein EUGRSUZ_A01068 [Eucalyptus grandis]
Length=401

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++ID
Sbjct  246  LGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCPWNQCK+  PS+IKI++VSF  I GTS+T+ AV L CSS +PC +V +S + + Y 
Sbjct  306  QQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYH  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NVKPT+SGK +PAIC
Sbjct  366  GPEGPATSVCSNVKPTISGKQNPAIC  391



>ref|XP_004295350.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase clone GBGA483-like 
[Fragaria vesca subsp. vesca]
Length=400

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNV-SNPILI  778
            LGRY +EQPV GVTV++C++SNT NGVRIKTWPASPNGVAS +HFED+ MDNV +NP+L+
Sbjct  248  LGRYHDEQPVQGVTVRYCQISNTTNGVRIKTWPASPNGVASDLHFEDISMDNVKTNPVLV  307

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+ QC+  +PSK+KI++VSFK I GT+   VAVKL+CS G+PC  V ++ + L Y
Sbjct  308  DQEYCPYGQCQAKLPSKVKISNVSFKNIRGTTQDLVAVKLVCSRGIPCQNVQVADINLTY  367

Query  597  KGT-NGSAISECDNVKPTLSGKNSPAIC  517
             G  NG+AISEC NVKPT+SG N P +C
Sbjct  368  NGNKNGTAISECANVKPTVSGFNHPQVC  395



>dbj|BAH20364.1| AT3G14040 [Arabidopsis thaliana]
Length=289

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  136  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  195

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  196  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  255

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  256  GKEGPAVSACSNIKPILSGKLVPAAC  281



>gb|KCW88710.1| hypothetical protein EUGRSUZ_A01065 [Eucalyptus grandis]
Length=466

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+ VK+C ++ T+NG+RIKTWPASP G AS MHFED+ +DNV NP++ID
Sbjct  311  LGKYPNEQPVTGLHVKNCTMTGTMNGLRIKTWPASPAGTASDMHFEDITLDNVGNPVIID  370

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCPWNQCK+  PS+IKI++VSF  I GTS+T+ AV L CSS +PC +V +S + + Y 
Sbjct  371  QQYCPWNQCKSQAPSQIKISNVSFSRIRGTSSTQAAVTLACSSRLPCTEVEISDIDIAYH  430

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NVKPT+SGK +PAIC
Sbjct  431  GPEGPATSVCSNVKPTISGKQNPAIC  456



>ref|XP_002884670.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60929.1| exopolygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  296  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLID  355

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  356  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  415

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  416  GKEGPAVSACSNIKPILSGKLVPAAC  441



>ref|XP_002862616.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38874.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  292  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLID  351

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + 
Sbjct  352  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHN  411

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  412  GKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|XP_002885005.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61264.1| polygalacturonase [Arabidopsis lyrata subsp. lyrata]
Length=449

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  296  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLID  355

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + L+ + L + 
Sbjct  356  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALADINLVHN  415

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  416  GKEGPAVSACSNIKPILSGKLVPAAC  441



>emb|CAA51692.1| exopolygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  292  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  351

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  352  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  411

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  412  GKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|NP_188020.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
 dbj|BAB02336.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AEE75458.1| exopolygalacturonase / galacturan 1,4-alpha-galacturonidase / 
pectinase [Arabidopsis thaliana]
Length=445

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  292  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  351

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  352  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  411

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  412  GKEGPAVSACSNIKPILSGKLVPAAC  437



>emb|CAA11160.1| polygalacturonase [Arabidopsis thaliana]
Length=445

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  292  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  351

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  352  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  411

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  412  GKEGPAVSACSNIKPILSGKLVPAAC  437



>gb|AAL32525.1| polygalacturonase; pectinase [Arabidopsis thaliana]
 gb|AAM47954.1| polygalacturonase; pectinase [Arabidopsis thaliana]
Length=445

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  292  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  351

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  352  QEYCPYGHCKAGVPSKVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  411

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  412  GKEGPAVSACSNIKPILSGKLVPAAC  437



>ref|XP_006299516.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
 gb|EOA32414.1| hypothetical protein CARUB_v10015686mg [Capsella rubella]
Length=449

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP GVAS + FED+ MDNVS P+LID
Sbjct  296  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGVASNILFEDITMDNVSTPVLID  355

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPS++K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  356  QEYCPYGHCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  415

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP L+GK  PA C
Sbjct  416  GKEGPAVSACSNIKPVLTGKLVPAAC  441



>ref|NP_187442.1| polygalacturonase-like protein [Arabidopsis thaliana]
 sp|P49063.2|PGLR2_ARATH RecName: Full=Exopolygalacturonase clone GBGA483; Short=ExoPG; 
AltName: Full=Galacturan 1,4-alpha-galacturonidase; AltName: 
Full=Pectinase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF21195.1|AC013483_19 exopolygalacturonase [Arabidopsis thaliana]
 gb|AAL07022.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AAM14139.1| putative exopolygalacturonase [Arabidopsis thaliana]
 gb|AEE74611.1| polygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  291  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  350

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPS++K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  351  QEYCPYGHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  410

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  411  GKEGPAVSACSNIKPILSGKLVPAAC  436



>emb|CAA51033.1| exopolygalacturonase [Arabidopsis thaliana]
Length=444

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  291  LGRYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSLPVLID  350

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPS++K++DV+ K I GTSATKVAVKL+CS GVPC  + LS + L + 
Sbjct  351  QEYCPYGHCKAGVPSQVKLSDVTIKGIKGTSATKVAVKLMCSKGVPCTNIALSDINLVHN  410

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  PA C
Sbjct  411  GKEGPAVSACSNIKPILSGKLVPAAC  436



>ref|XP_010657162.1| PREDICTED: polygalacturonase [Vitis vinifera]
Length=336

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  190  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  249

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY 
Sbjct  250  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYN  309

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A+S+C N+KP + G   P IC
Sbjct  310  GNDGPAMSQCKNIKPNVLGAQLPRIC  335



>ref|XP_009334235.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=399

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYPNE+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LI
Sbjct  249  LGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQQYCPWNQCK  VPSKIKI++VSFK I G+SAT +AV+++CSSG+ C KV L  + L Y
Sbjct  309  DQQYCPWNQCKQNVPSKIKISNVSFKNIKGSSATPLAVQIVCSSGIACEKVELDDIDLTY  368

Query  597  KGTNGSAISECDNVKPTLS  541
             G  G   S+C NVKPT++
Sbjct  369  NGNKGPLTSQCSNVKPTIT  387



>ref|XP_002282594.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY 
Sbjct  309  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S+C N+KP L G   P IC
Sbjct  369  GNEGPAMSQCKNIKPNLLGVQLPRIC  394



>ref|XP_006375551.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
 gb|ERP53348.1| hypothetical protein POPTR_0014s16040g [Populus trichocarpa]
Length=387

 Score =   196 bits (497),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY +EQPV+GVTV++C L+NT NGVRIKTWPASP+GVAS ++FED+ M+NVSNPILID
Sbjct  238  LGRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILID  297

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N C   VPS++KI+DV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y 
Sbjct  298  QEYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVSVEDINLVYN  357

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  GS+ S C NVKP +SGK  PA C
Sbjct  358  GKEGSSTSLCANVKPQVSGKVFPATC  383



>ref|XP_011003515.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Populus euphratica]
Length=397

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY +EQPV+GVTV++C L+NT NGVRIKTWPASP+GVAS ++FED+ M+NVSNPILID
Sbjct  248  LGRYHDEQPVIGVTVRNCTLTNTENGVRIKTWPASPSGVASNVNFEDIIMNNVSNPILID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N C   VPS++KI+DV F+ I GTSAT+VAVK++CS G+PC  V +  + L Y 
Sbjct  308  QEYCPYNNCLAKVPSRVKISDVRFEGIRGTSATQVAVKIVCSRGLPCQNVFVEDINLVYN  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  GS+ S C NVKP +SGK  PA C
Sbjct  368  GKEGSSTSLCANVKPQVSGKVFPATC  393



>ref|XP_008349086.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYPNE+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LI
Sbjct  249  LGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQQYCPWNQCK  VPSK+KI++VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y
Sbjct  309  DQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTY  368

Query  597  KGTNGSAISECDNVKPTLS  541
             G  G   S+C NVKPT++
Sbjct  369  NGNKGPLTSQCSNVKPTIT  387



>ref|XP_008391258.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=399

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYPNE+PV+G+ VK+C L+NT NGVRIKTWPASP +G+AS MHFED+ M NVSNP+LI
Sbjct  249  LGRYPNEEPVVGIRVKNCTLTNTSNGVRIKTWPASPSDGIASDMHFEDIIMVNVSNPVLI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQQYCPWNQCK  VPSK+KI++VSFK I G+SAT +AV+++CS G+PC  V L+ + L Y
Sbjct  309  DQQYCPWNQCKQNVPSKVKISNVSFKNIKGSSATPLAVQIVCSGGIPCENVELADIDLTY  368

Query  597  KGTNGSAISECDNVKPTLS  541
             G  G   S+C NVKPT++
Sbjct  369  NGNKGPLTSQCSNVKPTIT  387



>emb|CDY35967.1| BnaA05g29830D [Brassica napus]
Length=293

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS PILID
Sbjct  140  LGRYPNEQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILID  199

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+FK I GTSATK AVKL+CS G PC  V L+ + L + 
Sbjct  200  QEYCPYADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHN  259

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+  C N+KP L+G+  P  C
Sbjct  260  GPEGPAVGACANMKPVLTGQMIPPAC  285



>dbj|BAA89476.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNE+PV G+ VK+C +SNT NGVRIK+WP    GVAS MHFED+ M+NV NPIL+D
Sbjct  248  LGRYPNEKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLD  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLVYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A S+C NVKP +SG  S + C
Sbjct  368  GSEGPAKSQCSNVKPKISGIMSASGC  393



>emb|CBI22049.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  189  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  248

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS GVPC  V L  + LEY 
Sbjct  249  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCQDVELGDINLEYN  308

Query  594  GTNGSAISECDNVKPTLSGKNSPAI  520
            G +G A+S+C N+KP + G   P I
Sbjct  309  GNDGPAMSQCKNIKPNVLGAQLPRI  333



>dbj|BAA89477.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   194 bits (492),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNE+PV G+ VK+C +SNT NGVRIK+WP    GVAS MHFED+ M+NV NPIL+D
Sbjct  248  LGRYPNEKPVSGIFVKNCTISNTANGVRIKSWPDLYGGVASNMHFEDIVMNNVQNPILLD  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELANINLLYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A S+C NVKP +SG  S + C
Sbjct  368  GSEGPAKSQCSNVKPKISGIMSASGC  393



>ref|XP_010112808.1| hypothetical protein L484_020040 [Morus notabilis]
 gb|EXC34923.1| hypothetical protein L484_020040 [Morus notabilis]
Length=394

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE PV GV V++C + NT NGVR+KTWP S +G+AS +HFED+ M+NV NP+LID
Sbjct  247  LGKYSNEDPVEGVIVRNCTIRNTSNGVRVKTWPDSHDGLASNLHFEDIVMENVGNPVLID  306

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC   VPS+IKI+DVSFK I GTS T +AV L+CSSG PC  V ++ + L+Y 
Sbjct  307  QEYCPWNQCNAKVPSRIKISDVSFKNIRGTSTTALAVNLVCSSGFPCQNVEIADIDLQYS  366

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G  +S+C NVKPT+SGK +P  C
Sbjct  367  GNDGPIMSQCKNVKPTISGKQNPNPC  392



>ref|XP_002282573.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY 
Sbjct  309  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S+C N+KP L G   P IC
Sbjct  369  GNEGPAMSQCKNIKPNLLGVQLPRIC  394



>ref|XP_008455553.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV VK+C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILI
Sbjct  250  LGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPVAGIATNMHFLDITMVNVSNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PSKIKIN VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y
Sbjct  310  DQEYCPWNQCNRKIPSKIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  SEC NVKP +SG  +P IC
Sbjct  370  NGIKGSLTSECMNVKPIISGTQNPPIC  396



>ref|XP_004174175.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis sativus]
Length=261

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++I
Sbjct  103  LGKYTKEKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVII  162

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y
Sbjct  163  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTY  222

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G  +SEC NV+P ++GK SP IC
Sbjct  223  SGIRGPILSECANVQPLITGKQSPQIC  249



>ref|XP_004165943.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=405

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV VK+C + NT NGVRIKTWPASPN G+A+ MHF D+ M NVSNPILI
Sbjct  250  LGKYTNEEPVEGVIVKNCTIMNTTNGVRIKTWPASPNAGIATDMHFSDITMVNVSNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN+VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y
Sbjct  310  DQEYCPWNQCNREIPSNIKINNVSFKNIRGSSATPVAVKLICSSNQPCEEVKVANIDLVY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NG   S+C NVKP +SG  +P+IC
Sbjct  370  NGINGPITSQCMNVKPIVSGIQNPSIC  396



>dbj|BAA89478.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNE+PV G+ VK+C +SNT NGVRIK+WP    G AS MHFED+ M+NV NP+++D
Sbjct  248  LGRYPNEKPVSGIFVKNCTISNTANGVRIKSWPDLYGGAASNMHFEDIVMNNVQNPVVVD  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC    PSK+KI+DVSFK I GTSAT V VKL CS G+PC KV L+ + L Y 
Sbjct  308  QEYCPWNQCSLKSPSKVKISDVSFKNIRGTSATPVVVKLACSGGIPCEKVELADINLVYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A S+C NVKPT+SG  S + C
Sbjct  368  GSEGPAKSQCSNVKPTISGIMSASGC  393



>ref|XP_009147020.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
 gb|ADJ68232.1| exo-polygalacturonase [Brassica rapa subsp. oleifera]
Length=476

 Score =   194 bits (492),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS PILID
Sbjct  323  LGRYPNEQPVRGVTVRKCLIKNTSNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPILID  382

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+  CK GVPSK+K++DV+FK I GTSATK AVKL+CS G PC  V L+ + L + 
Sbjct  383  QEYCPYADCKAGVPSKVKLSDVTFKNIKGTSATKTAVKLICSVGTPCTNVALANINLVHN  442

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+  C N+KP L+G+  P  C
Sbjct  443  GPEGPAVGACANMKPVLTGQMIPPAC  468



>ref|XP_002274125.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KT+PAS  G+AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IK+++VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y 
Sbjct  309  QEYCPHNQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S+C N+KP L G   P IC
Sbjct  369  GKEGPAMSQCKNIKPNLLGVQLPRIC  394



>ref|XP_008462107.1| PREDICTED: exopolygalacturonase clone GBGA483 [Cucumis melo]
Length=403

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV G+TV+ C ++NT+ GVRIKTWPAS  G+AS M FE++ MDNV  PILID
Sbjct  252  LGKYKNEKPVSGITVRDCTITNTMFGVRIKTWPASTKGIASNMQFENIVMDNVGTPILID  311

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCP+  C   VPS+++I+DV FK I GTS T+VAVKL+CS G PC  V LS + L+Y 
Sbjct  312  QQYCPYGTCHHQVPSRVQISDVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYS  371

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            GTNG+AISEC NVKP + G+  P  C
Sbjct  372  GTNGTAISECSNVKPAVVGRVVPPAC  397



>ref|XP_004162885.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=402

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV VK+C + NT NGVRIKTW ASP  G+A  MHF D+ M NVSNPILI
Sbjct  247  LGKYTNEEPVEGVVVKNCTIMNTTNGVRIKTWSASPVAGIAIIMHFSDITMINVSNPILI  306

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PSKIKIN VSFK I G SAT VAVKL+CSS +PC +V ++ + L Y
Sbjct  307  DQEYCPWNQCNRQIPSKIKINKVSFKNIRGCSATSVAVKLICSSNLPCEEVKVANIDLVY  366

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT GS  S+C NVKP LSG  +P+IC
Sbjct  367  NGTKGSITSQCMNVKPILSGIQNPSIC  393



>ref|XP_004167279.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=404

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 113/147 (77%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV VK+C + NT NGVRIKTWP SP  G+A+ MHF D+ M NVSNPILI
Sbjct  250  LGKYTNEEPVEGVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN VSF+ I G+SAT VAVKL+CSS +PC++V ++ + L Y
Sbjct  310  DQEYCPWNQCNREIPSNIKINKVSFENIRGSSATPVAVKLICSSNLPCDEVKVANIDLIY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NGS  S+C NVKP +SG  +P+IC
Sbjct  370  NGINGSITSQCMNVKPIISGIQNPSIC  396



>ref|XP_010999488.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG PC KV L+ + L YK
Sbjct  308  QGYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYK  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S+C NVKP +SG  S + C
Sbjct  368  GPGGPAKSQCSNVKPIISGIMSASGC  393



>dbj|BAA89479.1| polygalacturonase [Salix gilgiana]
Length=393

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNE+PV G+ VK+C +SNT NGVRIK+WP    G AS MHFED+ M+NV NP+ +D
Sbjct  248  LGRYPNEKPVSGIFVKNCTISNTANGVRIKSWPDLYGGDASNMHFEDIVMNNVQNPVAVD  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC    PSK+KI+DVSFK I GTSAT V VKL CSSG+PC KV L+ + L Y 
Sbjct  308  QEYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVKLACSSGIPCEKVELADINLVYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A S+C NVKP +SG  S + C
Sbjct  368  GSEGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_006387858.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
 gb|ERP46772.1| hypothetical protein POPTR_0519s00220g [Populus trichocarpa]
Length=393

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+
Sbjct  308  QGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYR  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S+C NVKP +SG  S + C
Sbjct  368  GPGGPAKSQCSNVKPIISGIMSASGC  393



>ref|XP_010093135.1| hypothetical protein L484_009327 [Morus notabilis]
 gb|EXB53587.1| hypothetical protein L484_009327 [Morus notabilis]
Length=394

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG Y NE+ V GV VK C L NT NGVRIKTWP S  G AS MHFED+++DNV NPI+ID
Sbjct  245  LGMYANEEAVKGVFVKSCTLKNTQNGVRIKTWPDSQPGTASDMHFEDIQLDNVGNPIVID  304

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN+C   V S++K++++SFK I G+S+T VAVKL+CS G PC  V LS + L YK
Sbjct  305  QEYCPWNKCNAKVSSRVKLSNISFKNIRGSSSTAVAVKLVCSKGYPCQNVQLSDINLSYK  364

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G+  SEC NVKP LSGK +P  C
Sbjct  365  GSEGAITSECKNVKPILSGKENPRAC  390



>ref|XP_008245681.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Prunus mume]
Length=402

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNV-SNPILI  778
            LGRY +EQPV GVTV++C +SNT NGVR+KTWPASPNGVAS +HFED+ M+NV ++P+LI
Sbjct  249  LGRYHDEQPVTGVTVRNCTISNTSNGVRVKTWPASPNGVASDLHFEDIIMENVKTSPVLI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP  QC+  +PSK+KI++VSFK I GTSA  V VKL CS G+PC  V +S + L Y
Sbjct  309  DQEYCPNGQCQAKIPSKVKISNVSFKNIRGTSADPVVVKLACSKGIPCQNVQISDIHLTY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NG+A S C NVKPT++G+  P  C
Sbjct  369  NGKNGAATSVCTNVKPTMTGQIFPPAC  395



>ref|XP_010042694.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Eucalyptus 
grandis]
Length=396

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFNQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010042444.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFNQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010040513.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW45154.1| hypothetical protein EUGRSUZ_L01230 [Eucalyptus grandis]
Length=396

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFNQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010038565.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW46861.1| hypothetical protein EUGRSUZ_K00666 [Eucalyptus grandis]
Length=396

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFNQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSRSVPCEEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010486356.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
 ref|XP_010486357.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG YPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  291  LGLYPNEQPVKGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLID  350

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  +CK GVPS++K++DV+ K I GTSATKVAVKL+CS G PC  + L+ + L + 
Sbjct  351  QEYCPHGKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALADINLVHN  410

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  P  C
Sbjct  411  GKEGPAVSACSNIKPVLSGKLVPEAC  436



>gb|ADK92878.1| polygalacturonase [Hypericum perforatum]
Length=398

 Score =   189 bits (481),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 115/146 (79%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY +EQPV+G+TVK+C L++T+NGVRIKTWPASP+G+AS M FE++ M+NVSNPI+ID
Sbjct  248  LGRYHDEQPVVGITVKNCTLTSTMNGVRIKTWPASPSGLASNMRFENIIMNNVSNPIMID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCP++QC+  +PS++KI+DVSF  I GTSAT++AVKL+CS G+PC  V +  + L Y 
Sbjct  308  QQYCPYSQCEAKIPSRVKISDVSFSGIRGTSATQLAVKLVCSKGIPCQNVAVGDINLAYN  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
               G A S+C NVKP + G   PA C
Sbjct  368  --KGQATSQCANVKPQVRGSVVPAPC  391



>ref|XP_002325639.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
 gb|EEF00021.2| hypothetical protein POPTR_0019s09470g, partial [Populus trichocarpa]
Length=434

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK+C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  289  LGKYPNEKPVSGIFVKNCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  348

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG PC KV L+ + L Y+
Sbjct  349  QGYCPWNQCTLKAPSKVKISDVSFKSIRGTSATPVVVRIACSSGFPCQKVKLANINLAYR  408

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S+C NVKP +SG  S + C
Sbjct  409  GPGGPAKSQCSNVKPIISGIMSASGC  434



>ref|XP_004171844.1| PREDICTED: polygalacturonase-like, partial [Cucumis sativus]
Length=256

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 108/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV  V VK+C + NT NGVRIKTWP SP  G+A+ MHF D+ M NVSNPI+I
Sbjct  101  LGKYTNEEPVEDVIVKNCTIINTTNGVRIKTWPTSPAAGIATNMHFSDITMVNVSNPIVI  160

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN VSFK I G+SAT VAVKL+CSS +PC +V LS + L Y
Sbjct  161  DQEYCPWNQCNRKIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKLSNIDLIY  220

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  S+C NVKP + G  +P IC
Sbjct  221  NGIKGSITSQCMNVKPIIYGIQNPPIC  247



>ref|XP_010464428.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=444

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG YPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  291  LGLYPNEQPVRGVTVRKCTIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLID  350

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  +CK GVPS++K++DV+ K I GTSATKVAVKL+CS G PC  + LS + L + 
Sbjct  351  QEYCPHGKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNIALSDINLVHN  410

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP ++GK  P  C
Sbjct  411  GKEGPAVSACSNIKPVITGKLIPEAC  436



>ref|XP_010458380.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   190 bits (483),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG YPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  286  LGLYPNEQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVSTPVLID  345

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  +CK GVPS++K++DV+ K I GTSATKVAVKL+CS G PC  + L+ + L + 
Sbjct  346  QEYCPHGKCKAGVPSQVKLSDVTIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHN  405

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  P  C
Sbjct  406  GKEGPAVSACSNIKPILSGKLVPEAC  431



>gb|KGN43464.1| hypothetical protein Csa_7G037910 [Cucumis sativus]
Length=404

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV V +C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILI
Sbjct  249  LGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y
Sbjct  309  DQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  SEC NVKP +SG  +P IC
Sbjct  369  NGIKGSITSECMNVKPIISGIQNPPIC  395



>ref|XP_010999486.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G   S+C NVKP +SG  S   C
Sbjct  368  GPDGPPKSQCSNVKPIISGIMSAPGC  393



>ref|XP_004170151.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=404

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV GV V +C + NT NGVRIKTWPASP  G+A+ MHF D+ M NVSNPILI
Sbjct  249  LGKYNNEEPVEGVIVNNCTIINTTNGVRIKTWPASPVAGIATNMHFSDITMVNVSNPILI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN VSFK I G+SAT VAVKL+CSS +PC +V ++ + L Y
Sbjct  309  DQEYCPWNQCNREIPSNIKINKVSFKNIRGSSATPVAVKLICSSNLPCEEVKVANIDLVY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  SEC NVKP +SG  +P IC
Sbjct  369  NGIKGSITSECMNVKPIISGIQNPPIC  395



>ref|XP_004153076.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
 ref|XP_004172630.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=397

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++I
Sbjct  239  LGKYTKEKDVVGVTVKACKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVII  298

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y
Sbjct  299  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTY  358

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G  +SEC NV+P ++GK SP IC
Sbjct  359  SGIRGPILSECANVQPLITGKQSPQIC  385



>ref|XP_010040848.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
 gb|KCW44869.1| hypothetical protein EUGRSUZ_L01551 [Eucalyptus grandis]
 gb|KCW46860.1| hypothetical protein EUGRSUZ_K00665 [Eucalyptus grandis]
Length=396

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP++QCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFDQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_010999485.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPVSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G   S+C NVKP +SG  S   C
Sbjct  368  GPDGPPKSQCSNVKPMISGIMSAPGC  393



>ref|XP_010042729.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=396

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP++QCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFDQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391



>ref|XP_004162875.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=397

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL NT NGVRIKTWP S    +AS MHFED++M NVSNP++I
Sbjct  239  LGKYTKEKDVVGVTVKTCKLINTTNGVRIKTWPDSAGAFIASDMHFEDIEMQNVSNPVII  298

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT +AVKL+CS  +PC  V ++ + L Y
Sbjct  299  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPIAVKLVCSKSIPCEGVEVADINLTY  358

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G  +SEC NV+P ++GK SP IC
Sbjct  359  SGIRGPILSECANVQPLITGKQSPQIC  385



>emb|CBI22050.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 0/139 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS G PC  V L  + LEY 
Sbjct  309  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGEPCQDVELGDINLEYN  368

Query  594  GTNGSAISECDNVKPTLSG  538
            G  G A+S+C N+KP L G
Sbjct  369  GNEGPAMSQCKNIKPNLLG  387



>ref|XP_006371366.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
 gb|ERP49163.1| hypothetical protein POPTR_0019s09500g [Populus trichocarpa]
Length=393

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK+C LS+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+ VSFK I GTSAT V V++ CSSG PC KV L+ +K+ Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKVAYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A S+C NVKP +SG  S   C
Sbjct  368  GPDGPAKSQCSNVKPIISGTMSAPGC  393



>ref|XP_006469749.1| PREDICTED: polygalacturonase-like [Citrus sinensis]
Length=408

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NEQPV+G+ V+ C +SNT NGVRIKTWPAS  G AS +HFED+KM+NVSNPIL+D
Sbjct  242  LGKYQNEQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLD  301

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP NQC   VPS++K++ VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y 
Sbjct  302  QVYCPHNQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYT  361

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G   SEC N++P  SGK +P  C
Sbjct  362  GPEGPIKSECTNIQPKTSGKMNPPPC  387



>ref|XP_006447720.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|ESR60960.1| hypothetical protein CICLE_v10015423mg [Citrus clementina]
 gb|KDO58459.1| hypothetical protein CISIN_1g015254mg [Citrus sinensis]
Length=410

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NEQPV+G+ V+ C +SNT NGVRIKTWPAS  G AS +HFED+KM+NVSNPIL+D
Sbjct  244  LGKYQNEQPVVGIRVRECNISNTSNGVRIKTWPASYPGTASDLHFEDIKMNNVSNPILLD  303

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP NQC   VPS++K++ VSFK I GTSAT VA+KL CS GVPC  V L+ + L Y 
Sbjct  304  QVYCPHNQCNAKVPSRVKLDRVSFKNIRGTSATAVAIKLACSGGVPCEGVELADISLTYT  363

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G   SEC N++P  SGK +P  C
Sbjct  364  GPEGPIKSECTNIQPKTSGKMNPPPC  389



>ref|XP_010458261.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Camelina 
sativa]
Length=439

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG YPNEQPV GVTV+ C + NT NGVRIKTWP SP G+AS + FED+ MDNVS P+LID
Sbjct  286  LGLYPNEQPVRGVTVRKCLIKNTDNGVRIKTWPGSPPGIASNIIFEDITMDNVSTPVLID  345

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  +CK GVPS++K++DV  K I GTSATKVAVKL+CS G PC  + L+ + L + 
Sbjct  346  QEYCPHGKCKAGVPSQVKLSDVIIKNIKGTSATKVAVKLMCSKGCPCTNISLADINLVHN  405

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP LSGK  P  C
Sbjct  406  GKEGPAVSACSNIKPILSGKLVPEAC  431



>ref|XP_006371367.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
 gb|ERP49164.1| hypothetical protein POPTR_0019s09510g, partial [Populus trichocarpa]
Length=373

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+ VK+C LS+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  228  LGKYPNEKPVSGIFVKNCTLSDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  287

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+ VSFK I GTSAT V V++ CSSG PC KV L+ +KL Y 
Sbjct  288  QVYCPWNQCSLKAPSKVKISGVSFKNIRGTSATPVVVQIACSSGFPCEKVELADIKLAYS  347

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G + S+C NVKP +SG  S   C
Sbjct  348  GPDGPSKSQCSNVKPIISGIMSAPGC  373



>ref|XP_004154764.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=406

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV  V VK+C + NT NGVRIKTWP+SP  G+A+ MHF D+ M NVSNPILI
Sbjct  251  LGKYTNEEPVDDVVVKNCTIMNTTNGVRIKTWPSSPVAGIATNMHFSDITMINVSNPILI  310

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN+VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y
Sbjct  311  DQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNQPCEEVKVANIDLVY  370

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NG   S+C NVKP +SG  +P+IC
Sbjct  371  NGINGPVTSQCMNVKPIISGIQNPSIC  397



>ref|XP_010657416.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase [Vitis vinifera]
Length=395

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C  +NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTRTNTQNGVRVKTWPASHQGTASXMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   +PS+I +++VSF+ I GT++T+VAVKL+CS GVPC    L  + L+Y 
Sbjct  309  QEYCPHNQCNLKIPSRIMLSNVSFRNIRGTTSTQVAVKLVCSQGVPCEDAELGDINLKYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S+C N+KP L G   P  C
Sbjct  369  GKVGHAMSQCKNIKPNLLGTQLPRTC  394



>ref|XP_010038563.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=395

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C ++   NGVRIKTWPAS  G+A+ MHFED++M+NV NP+LID
Sbjct  245  LGKYDNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLID  304

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC+  +PS +KI++VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YK
Sbjct  305  QGYCPWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYK  364

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A SEC NV+P +SG  +P  C
Sbjct  365  GPDGPATSECSNVRPLISGMQNPRAC  390



>ref|XP_007049259.1| Polygalacturonase [Theobroma cacao]
 gb|EOX93416.1| Polygalacturonase [Theobroma cacao]
Length=405

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 114/146 (78%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG++ +E+PV G+ V++C LSNT+NGVR+KTWP S  G A+ MHFED+ ++NV NPILID
Sbjct  251  LGKFNDEEPVSGIFVRNCTLSNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN C   VPS+IK++++SFK+I GTS+T+ AV+L+CS G+PC++V L+ + + YK
Sbjct  311  QEYCPWNLCNLKVPSRIKLSNISFKKIRGTSSTQQAVRLVCSRGLPCDRVELADIDITYK  370

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP  SGK +P  C
Sbjct  371  GPGGPATSECTNVKPRTSGKQNPPAC  396



>ref|XP_010038564.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=474

 Score =   188 bits (478),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C +    NGVRIKTWPAS  G AS MHFED++MDNV NP+++D
Sbjct  246  LGKYENEEPVEGVFVTNCTIIGADNGVRIKTWPASKPGTASDMHFEDIQMDNVLNPVILD  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP++QCK GVPS IKI+ VSFK+I GTSA++VAVK+LCS  VPC +V ++ + L Y 
Sbjct  306  QGYCPFDQCKAGVPSLIKISKVSFKKIRGTSASQVAVKVLCSQSVPCQEVEIADIDLVYN  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A SEC NVKP LSGK +PA C
Sbjct  366  GPEGPATSECANVKPVLSGKLNPAAC  391


 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -1

Query  747  KTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISE  568
            K  +P+K+KI+DVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG+A S+
Sbjct  393  KPHIPTKVKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGAATSQ  452

Query  567  CDNVKPTLSGKNSPAIC  517
            C NVKPT++GK+S  +C
Sbjct  453  CANVKPTITGKSSLPLC  469



>emb|CBI28390.3| unnamed protein product [Vitis vinifera]
Length=452

 Score =   188 bits (477),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KT+PAS  G+AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTFPASHQGIASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IK+++VSF+ I GT++T+VAVKLLCS GVPC  V L  + L+Y 
Sbjct  309  QEYCPHNQCNLKSPSRIKLSNVSFRNIRGTTSTQVAVKLLCSQGVPCQDVELGDINLKYN  368

Query  594  GTNGSAISECDNVKPTLSGK  535
            G  G A+S+C N+KP L G+
Sbjct  369  GKEGPAMSQCKNIKPNLLGQ  388



>ref|XP_004161033.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=405

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV  V VK+C + NT NG+RIKTWP+SP  G+A+ MHF D+ M NVSNPILI
Sbjct  250  LGKYTNEEPVDDVVVKNCTIMNTTNGIRIKTWPSSPVAGIATNMHFSDITMVNVSNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKIN+VSFK I G+SAT VAVKL+CSS  PC +V ++ + L Y
Sbjct  310  DQEYCPWNQCNREIPSNIKINNVSFKNIKGSSATPVAVKLICSSNKPCEEVKVANIDLVY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NG   S+C NVKP +SG  +P+IC
Sbjct  370  NGINGPVTSQCMNVKPIISGIQNPSIC  396



>emb|CBI22052.3| unnamed protein product [Vitis vinifera]
Length=1080

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV+G++VK+C L+NT NGVR+KTWPAS  G AS MHFED+ M+NV NPI+ID
Sbjct  249  LGKYPNEEPVVGISVKNCTLTNTQNGVRVKTWPASHQGTASEMHFEDIVMNNVGNPIIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS+IKI++VSF+ I GT++T+VAVKL+CS GVPC+ V L  + LEY 
Sbjct  309  QEYCPHNQCNLKSPSRIKISNVSFRNIRGTTSTQVAVKLICSQGVPCHDVELGDINLEYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAI  520
            G  G A+S+C N+KP L G   P I
Sbjct  369  GNEGPAMSQCKNIKPNLLGVQLPRI  393



>gb|KFK38239.1| hypothetical protein AALP_AA3G087400 [Arabis alpina]
Length=510

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+P+ GV V+ C + NT NGVRIKTWP SP G+AS + FED+ MDNV+ PILID
Sbjct  353  LGKYPNEEPLKGVVVRKCIIKNTDNGVRIKTWPGSPPGIASNILFEDITMDNVTTPILID  412

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  +CK GVPSK+K++DV+FK I GTSA+K+AVK++CS G PC  + L+ + L   
Sbjct  413  QEYCPHGKCKAGVPSKVKLSDVTFKNIKGTSASKIAVKIICSKGCPCTNIALTDINLVSS  472

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C N+KP +SGK  PA C
Sbjct  473  GKEGPAVSACANMKPVVSGKVVPAAC  498



>gb|KCW46859.1| hypothetical protein EUGRSUZ_K00664 [Eucalyptus grandis]
Length=392

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C ++   NGVRIKTWPAS  G+A+ MHFED++M+NV NP+LID
Sbjct  245  LGKYDNEEPVSGVFVTNCTINGATNGVRIKTWPASKIGIATDMHFEDIQMNNVFNPVLID  304

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC+  +PS +KI++VSFK I GTSATKVAVK+ CS  +PC  V ++ + L YK
Sbjct  305  QGYCPWNQCQAQIPSLVKISNVSFKRIRGTSATKVAVKIACSKRIPCEGVEIADINLVYK  364

Query  594  GTNGSAISECDNVKPTLSGKNSPAICD  514
            G +G A SEC NV+P +SG  +P   D
Sbjct  365  GPDGPATSECSNVRPLISGMQNPRAYD  391



>ref|XP_008245680.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYP E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILI
Sbjct  250  LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+CK GVPSK+KI++VSFK I GT    VAVKL C+ G+PC  V LS + L+Y
Sbjct  310  DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDLKY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G   S C NVKPT++    P  C
Sbjct  370  IGDKGPITSVCSNVKPTINRVAQPLAC  396



>ref|XP_004144612.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
 ref|XP_004162886.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Cucumis sativus]
Length=402

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV G+TV+ C ++NT+ GVRIK+WPAS  G+AS M FE + M+NV  PILID
Sbjct  251  LGKYKNEKPVSGITVRDCTITNTMFGVRIKSWPASTKGIASNMQFESIVMNNVGTPILID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCP+  C   +PS+++I++V FK I GTS T+VAVKL+CS G PC  V LS + L+Y 
Sbjct  311  QQYCPYGTCNRQIPSRVQISNVGFKNIRGTSTTQVAVKLVCSRGYPCKNVKLSNINLKYS  370

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            GTNG+AISEC NVKP ++G   P  C
Sbjct  371  GTNGTAISECSNVKPAIAGSVVPPAC  396



>ref|XP_010112811.1| hypothetical protein L484_020043 [Morus notabilis]
 gb|EXC34926.1| hypothetical protein L484_020043 [Morus notabilis]
Length=394

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE PV G+ V  C L NTLNGVRIKTWP S  G AS +HF D+ M+NV NP+LID
Sbjct  245  LGKYLNELPVQGIFVTGCTLKNTLNGVRIKTWPNSYPGTASDIHFADITMENVGNPVLID  304

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC   VPSK+K++++SFK+I GTS+T +AV L+CSSG PC  VV+  + L+Y 
Sbjct  305  QEYCPWNQCNLKVPSKVKLSNISFKKIHGTSSTPLAVNLVCSSGAPCQNVVIQDINLKYS  364

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G   S+C NVKPT+ G  +PA C
Sbjct  365  GSQGPITSKCKNVKPTVGGVQNPAAC  390



>ref|XP_008379966.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV G+ +K+C ++NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++I
Sbjct  250  LGKYENEEPVSGIFIKNCTITNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVII  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+NQC   VPSK+KI++VSFK I G+S+T V +KL+CS G+PC  V LS + L Y
Sbjct  310  DQEYCPYNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  SEC ++KPT++    P  C
Sbjct  370  TGKEGSITSECKHIKPTINNVAQPLAC  396



>ref|XP_007049261.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOX93418.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=515

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG++  E+PV G+ +++C +SNT+NGVR+KTWP S  G A+ MHFED+ ++NV NPILID
Sbjct  251  LGKFKGEEPVSGIFIRNCTISNTMNGVRVKTWPDSHPGSATDMHFEDIILNNVGNPILID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN C   VPS++K++++SFK+I GTS+T+ AVKL+CS G+PC++V L+ + + YK
Sbjct  311  QEYCPWNLCNLKVPSRVKLSNISFKKIWGTSSTQQAVKLVCSRGLPCDRVELADIDITYK  370

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G AIS+C NVKP LSGK +P  C
Sbjct  371  GPGGPAISQCINVKPRLSGKQNPPAC  396



>ref|XP_007009871.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18681.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=400

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 110/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y +E PV G+ V +C L NT NGVR+KTWPAS  G+AS MHFED+ M NVSNP+LID
Sbjct  252  LGKYKDE-PVFGINVVNCALINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP N+C    PS++KI++VSFK I GTSAT+VAVKL CSSG+PC  V +  + L Y 
Sbjct  311  QEYCPSNKCNLKAPSRVKISNVSFKNIRGTSATQVAVKLACSSGIPCENVEIGDINLSYI  370

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            GT G A S+C NVKPT++G+ +P  C
Sbjct  371  GTKGPATSQCSNVKPTIAGRQTPLAC  396



>ref|XP_010999532.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=384

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+P  G+ VK C +S+T NGVRIK+WPA   GVAS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPFSGIFVKSCTISDTTNGVRIKSWPALYGGVASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG PC KV L+ + L YK
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGFPCEKVKLANINLAYK  367

Query  594  GTNGSAISECDNVKP  550
            G  G A S+C NVKP
Sbjct  368  GPGGPAKSQCSNVKP  382



>gb|ADP09681.1| polygalacturonase [Cucurbita pepo]
Length=416

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL  T NGVRIK+WP S     AS MHFED++M+NV+NPI+I
Sbjct  257  LGKYKTEKEVVGVTVKKCKLIGTTNGVRIKSWPDSAVSYPASDMHFEDIEMENVANPIII  316

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPS IKI+ VSFK I GTS+T VAVKL+CS   PC  V ++ + L Y
Sbjct  317  DQEYCPWNQCNRKVPSAIKISKVSFKNIRGTSSTPVAVKLVCSKSNPCEGVEIADIDLTY  376

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G A+SEC NVKPT+SGK +P IC
Sbjct  377  SGKEGPAVSECSNVKPTISGKQNPPIC  403



>ref|XP_010999487.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=393

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+P  G+ VK C +S+T NGVRIK+WPA   G AS MHFED+ M+NV NP++ID
Sbjct  248  LGKYPNEKPASGIFVKSCTISDTPNGVRIKSWPALYGGGASNMHFEDIVMNNVQNPVIID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWNQC    PSK+KI+DVSFK I GTSAT V V++ CSSG+PC KV L+ +KL Y 
Sbjct  308  QVYCPWNQCSLKAPSKVKISDVSFKNIRGTSATPVVVQIACSSGIPCEKVELADIKLAYS  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G   S+C NVKP +SG  S   C
Sbjct  368  GPDGPPKSQCSNVKPIMSGIMSAPGC  393



>ref|XP_008229849.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 105/144 (73%), Gaps = 1/144 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYP E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILI
Sbjct  250  LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+CK G PSKIKI++VSFK I GT    VAVKL CS G+PC  V LS + L+Y
Sbjct  310  DQEYCPWNECKKGAPSKIKISNVSFKNIKGTCTDPVAVKLACSPGLPCENVELSDIDLKY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSP  526
             G  G   S C NVKPT++    P
Sbjct  370  TGDKGPITSVCSNVKPTINRVAQP  393



>emb|CDY07972.1| BnaC03g35510D [Brassica napus]
Length=421

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILID
Sbjct  268  LGKYPNEQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILID  327

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP   CK G PSK+K++D+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y 
Sbjct  328  QVYCPHGHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYT  387

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C +VKP L GK  P  C
Sbjct  388  GKKGPAVSACSDVKPKLKGKMEPPAC  413



>ref|XP_008449697.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=403

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+ ++GVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LI
Sbjct  245  LGKYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLI  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y
Sbjct  305  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTY  364

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S+C NVKP +SGK +P IC
Sbjct  365  SGSEGPIKSQCANVKPVISGKQNPPIC  391



>emb|CDX80531.1| BnaC07g29130D [Brassica napus]
Length=421

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILID
Sbjct  268  LGKYPNEQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILID  327

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP   CK G PSK+K++D+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y 
Sbjct  328  QVYCPHGHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYT  387

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C +VKP L GK  P  C
Sbjct  388  GKKGPAVSACSDVKPKLKGKMEPPAC  413



>ref|XP_009134998.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=421

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILID
Sbjct  268  LGKYPNEQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILID  327

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP   CK G PSK+K++D+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y 
Sbjct  328  QVYCPHGHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYT  387

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C +VKP L GK  P  C
Sbjct  388  GKKGPAVSACSDVKPKLKGKMEPPAC  413



>emb|CDX74027.1| BnaA03g30200D [Brassica napus]
Length=421

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV GVT++   + NT NGVRIKTWP SP G+ S + F+D+ MDNVS PILID
Sbjct  268  LGKYPNEQPVRGVTIRRSLIKNTDNGVRIKTWPGSPPGIVSNILFQDITMDNVSLPILID  327

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP   CK G PSK+K++D+++++I GTSA+KVAVKLLCS GVPC  V LS +   Y 
Sbjct  328  QVYCPHGHCKKGGPSKVKLSDITYRDIKGTSASKVAVKLLCSPGVPCTNVTLSNIDFVYT  387

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C +VKP L GK  P  C
Sbjct  388  GKKGPAVSACSDVKPKLKGKMEPPAC  413



>ref|XP_004308599.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=392

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 112/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LGRYP E+PV G+ +K C LSNT+NG+RIKTWP SP   +AS +HFED+ M+NV NPILI
Sbjct  242  LGRYPKEEPVTGIYIKSCTLSNTMNGIRIKTWPNSPAASIASDIHFEDIIMNNVGNPILI  301

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN C   V SK+KI++VSF+ I GTS+T +A+K+LC+ G+PC+KV ++ + L+Y
Sbjct  302  DQEYCPWNLCNKQVASKVKISNVSFRNIRGTSSTPLALKILCAKGLPCDKVEMTDINLKY  361

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  S+C NV+PT++   +P  C
Sbjct  362  NGKQGSLTSQCSNVRPTITRVPNPLAC  388



>ref|XP_008449696.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Cucumis 
melo]
Length=404

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+ ++GVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LI
Sbjct  246  LGKYTNEKELVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLI  305

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y
Sbjct  306  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTY  365

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S+C NVKP +SGK +P IC
Sbjct  366  SGSEGPIKSQCANVKPVISGKQNPPIC  392



>ref|XP_002274096.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28389.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE PV+G+ V    L+NT NG+R+KTWPASP G+AS MHFED+ M+NV NPILID
Sbjct  248  LGKYANEAPVVGIKVTGSTLTNTQNGIRVKTWPASPAGIASNMHFEDIIMNNVGNPILID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP++QCK  +PS++KI+DV+FK I GTS+T++AVKL+CSSGVPC  V L+ + L++ 
Sbjct  308  QEYCPYSQCKQQIPSRVKISDVTFKNIRGTSSTELAVKLVCSSGVPCQNVQLTDINLKFN  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+  S C NVKP L G   P  C
Sbjct  368  G--GAPTSICKNVKPILGGVQQPRSC  391



>ref|XP_008229848.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=399

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LGRY  E+PV G+T+K+C L++T NGVRIKTWPASP+ G AS +HFED+ M NV NPILI
Sbjct  249  LGRYQKEEPVSGITIKNCTLTDTQNGVRIKTWPASPSAGTASDIHFEDIIMVNVGNPILI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSK+KI++VSFK I GTS T +A+KL+CS G+PC  V LS + L+Y
Sbjct  309  DQEYCPWNQCTLKVPSKVKISNVSFKNIKGTSTTPLALKLVCSKGLPCENVELSDIDLKY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G   S+C NVKP ++    P  C
Sbjct  369  TGNQGPLTSKCTNVKPKITRVTKPLAC  395



>ref|XP_009365184.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV G+ +K+C +SNT NGVRIKTWPASP NGV S +HFED+ MDNV NP++I
Sbjct  250  LGKYENEEPVSGIFIKNCTISNTDNGVRIKTWPASPANGVVSDVHFEDIIMDNVKNPVII  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC   VPSK+KI++VSFK I G+S+T V +KL+CS G+PC  V LS + L Y
Sbjct  310  DQEYCPHNQCTLQVPSKVKISNVSFKNIKGSSSTPVGIKLVCSGGLPCENVELSNIDLTY  369

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  SEC ++KPT+     P  C
Sbjct  370  TGKEGSITSECKHIKPTIDNVAQPLAC  396



>gb|AAO24261.1| putative pollen polygalacturonase [Turnera subulata]
Length=382

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NEQPV GV VK+C L NT NGVRIK+WPA   G AS +HFED+ M+NV+NP++ID
Sbjct  243  LGRYDNEQPVRGVLVKNCILKNTDNGVRIKSWPAMKGGEASDIHFEDITMENVTNPVIID  302

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC    PSK+KI++VSFK I GT+ T  AVK++CSS +PC +V L+G+ L+Y 
Sbjct  303  QEYCPWNQCTKDAPSKVKISNVSFKNIKGTTNTPEAVKIICSSALPCEQVQLNGIDLKYT  362

Query  594  GTNGSAISECDNVKPTLSG  538
            GT G A SEC N K T++G
Sbjct  363  GTQGPAKSECKNAKLTVTG  381



>ref|XP_010675930.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++D
Sbjct  260  LGKYPNEEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVD  319

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN CK   PSK+KI+D+ FK + G S+ K AVKL+CS GVPC+KV L+ + L+Y 
Sbjct  320  QEYCPWNHCKAKTPSKVKISDIRFKNVKGKSSGKEAVKLICSEGVPCDKVELADIDLQYT  379

Query  594  GTNGSAISECDNVKPTLSGKNSPAICD  514
            GT+G A+S C  VKP L+GK SP  CD
Sbjct  380  GTDGPAVSMCKFVKPLLTGKQSPPACD  406



>ref|XP_010668126.1| PREDICTED: exopolygalacturonase clone GBGA483-like, partial [Beta 
vulgaris subsp. vulgaris]
Length=366

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++D
Sbjct  211  LGKYPNEEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVD  270

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN CK   PSK+KI+D+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y 
Sbjct  271  QEYCPWNHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYT  330

Query  594  GTNGSAISECDNVKPTLSGKNSPAICD  514
            G +G A+S C  VKP L+GK SP  CD
Sbjct  331  GPDGPAVSMCKFVKPLLTGKQSPPACD  357



>ref|XP_008229852.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=403

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRYP E+PV G+ +K C L+NT NGVRIKTWPASP +G AS +HFED+ M NV NPILI
Sbjct  250  LGRYPEEEPVSGINIKKCTLTNTTNGVRIKTWPASPKDGTASDIHFEDITMVNVGNPILI  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+CK GVPSK+KI++VSFK I GT    VAVKL C+ G+PC  V LS + ++Y
Sbjct  310  DQEYCPWNECKKGVPSKVKISNVSFKNIKGTCTDPVAVKLACAPGLPCENVELSDIDIKY  369

Query  597  KGTNGSAISECDNVKPTL  544
             G  G   S C NVKPT+
Sbjct  370  TGDKGPITSVCSNVKPTI  387



>ref|XP_003633345.1| PREDICTED: exopolygalacturonase [Vitis vinifera]
 emb|CBI28394.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG Y NE PV+G+ VK+C LS+T NGVR+KTWP+SP G A+ MHF D+ M+NVSNPI+ID
Sbjct  247  LGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTWPSSPQGTATEMHFHDIVMNNVSNPIIID  306

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   +PS++K++++SFK I GT++T++AV L+CS G PC KV L  + L+Y 
Sbjct  307  QEYCPHNQCNLQIPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYT  366

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+A S+C NV+ TL G   P  C
Sbjct  367  GPEGTASSQCKNVEATLWGTQQPKTC  392



>ref|XP_010675940.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++D
Sbjct  260  LGKYPNEEPVSNITIRNCTIKNTDNGVRVKTWHNSYESTVTGLYFEDITVENVRNPVIVD  319

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN CK   PSK+KI+D+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y 
Sbjct  320  QEYCPWNHCKAKTPSKVKISDIRFKNVKGKSSTKEAVKLICSEGVPCDKVELADIDIQYT  379

Query  594  GTNGSAISECDNVKPTLSGKNSPAICD  514
            G +G A+S C  VKP L+GK SP  CD
Sbjct  380  GPDGPAVSMCKFVKPLLTGKQSPPACD  406



>ref|XP_010112809.1| hypothetical protein L484_020041 [Morus notabilis]
 gb|EXC34924.1| hypothetical protein L484_020041 [Morus notabilis]
Length=399

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+ V GV VK C L NT NGVRIKTWP S  G AS +HFED+ M+NV NP++ID
Sbjct  249  LGKYLNEEAVKGVDVKSCTLKNTQNGVRIKTWPDSQEGKASDLHFEDIIMENVGNPVMID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC + +PS+++I+ V FK I GTS+T +AVKL+CS G+PC  V ++ + L+Y 
Sbjct  309  QEYCPWNQCVSQLPSRVQISGVRFKNIRGTSSTALAVKLVCSGGLPCQDVEMTDIDLKYS  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G   SEC NVKPT+SG  +P  C
Sbjct  369  GDEGQITSECKNVKPTVSGIQNPPAC  394



>ref|XP_008467043.1| PREDICTED: exopolygalacturonase-like, partial [Cucumis melo]
Length=365

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL++T NGVRIKTWP S     AS MHFED++M NVSNP++I
Sbjct  207  LGKYSKEKEVVGVTVKKCKLTDTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVII  266

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI++VSFK I GTSAT VAVK++CS   PC  V ++ + L Y
Sbjct  267  DQEYCPWNQCNRKVPSKIKISNVSFKNIRGTSATPVAVKIVCSQSNPCEGVEVADIDLTY  326

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S+C NVKP +SGK +P IC
Sbjct  327  SGSEGPIKSQCANVKPVISGKQNPPIC  353



>ref|XP_006407789.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
 gb|ESQ49242.1| hypothetical protein EUTSA_v10020501mg [Eutrema salsugineum]
Length=526

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV GVT++   + NT NGVRIKTWP SP G+AS + F+D+ MDNVS PIL+D
Sbjct  373  LGKYPNEQPVRGVTIRKTLIKNTDNGVRIKTWPGSPPGIASNILFDDITMDNVSTPILVD  432

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP   CK+  PSK+K++DVSFK I GTSA+KVAVKLLCS GVPC     + + L + 
Sbjct  433  QVYCPHGTCKSQAPSKVKLSDVSFKNIRGTSASKVAVKLLCSPGVPCTNFAFADINLVHN  492

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C NVKP +SGK  P  C
Sbjct  493  GKEGPAVSACSNVKPVVSGKMVPPAC  518



>ref|XP_007009872.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
 gb|EOY18682.1| Pectin lyase-like superfamily protein, putative [Theobroma cacao]
Length=399

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 108/146 (74%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E PV G+TV +C L NT NGVR+KTWPAS  G+AS MHFED+ M NVSNP+LID
Sbjct  252  LGRY-REDPVFGITVANCTLINTSNGVRVKTWPASLEGIASDMHFEDIVMVNVSNPVLID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP N+C    PS++KI++VSFK I GTSAT+VAV+L CSSG+PC  V +  + L Y 
Sbjct  311  QEYCPGNKCAKA-PSRVKISNVSFKNIRGTSATQVAVELRCSSGIPCENVEIGDINLSYI  369

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            GT G A S C NVKP ++GK +P  C
Sbjct  370  GTEGPATSRCSNVKPIITGKQTPLAC  395



>ref|XP_008379967.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=400

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRY NE+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++I
Sbjct  250  LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSK+KI++VSFK I G+S+T V +K++CS G+PC  V LS + L Y
Sbjct  310  DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSTPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  597  KGTNGSAISECDNVKPTL  544
             G  G   S+C +VKPT+
Sbjct  370  SGNKGPITSQCKHVKPTI  387



>ref|XP_010675916.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=415

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 109/147 (74%), Gaps = 0/147 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV  +T+++C + NT NGVR+KTW  S     +G++FED+ ++NV NP+++D
Sbjct  260  LGKYPNEEPVSNITIRNCIIKNTDNGVRVKTWHNSYESTVTGLYFEDITLENVRNPVIVD  319

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN CK   PSK+KI+D+ FK + G S+TK AVKL+CS GVPC+KV L+ + ++Y 
Sbjct  320  QEYCPWNHCKARTPSKVKISDIRFKNVRGKSSTKEAVKLICSQGVPCDKVELADIDIQYT  379

Query  594  GTNGSAISECDNVKPTLSGKNSPAICD  514
            G  G A+S C  VKP L+GK SP  CD
Sbjct  380  GPGGPAVSMCKFVKPLLTGKQSPPACD  406



>ref|XP_008342227.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Malus domestica]
Length=400

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 111/147 (76%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVS-NPILI  778
            LGRY +EQPV GVTV++C + NT NGVR+KTWPASPNGVAS +HFED+ M+NV+ +P+LI
Sbjct  249  LGRYHDEQPVRGVTVRNCTIKNTSNGVRVKTWPASPNGVASDLHFEDIIMENVTTSPVLI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP  QC+  +PS++KI++VSFK I GTSA  VAVKL CS G+PC  V +S + L  
Sbjct  309  DQEYCPNGQCQAKMPSRVKISNVSFKNIRGTSADPVAVKLACSKGIPCQNVEISDINLTC  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G NG+  S C NV PT++GK  P  C
Sbjct  369  NGKNGTCTSVCSNVNPTVTGKVIPPAC  395



>ref|XP_004173029.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=423

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL+ T NGVRIKTWP S     A+ MHFED++MDNVSNPI+I
Sbjct  265  LGKYTKEKEVVGVTVKKCKLTGTTNGVRIKTWPDSAVAFPATDMHFEDIEMDNVSNPIII  324

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   V SKIKI++VSFK I GTSAT +AVK++CS  +PC  V ++ + L Y
Sbjct  325  DQEYCPWNQCNRKVASKIKISNVSFKNIRGTSATAIAVKIVCSKSIPCEGVEIADIDLTY  384

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G   S+C NVKP ++GK +P IC
Sbjct  385  SGPEGPIKSQCANVKPVITGKQNPPIC  411



>ref|XP_008449943.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=149

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = -1

Query  924  MGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILIDQQYCPWNQC  748
            MGVTVK CKL+ T NGVRIKTWP S     AS MHFED++M NVSNP+LIDQ+YCPWNQC
Sbjct  1    MGVTVKKCKLTGTTNGVRIKTWPDSAVAFPASDMHFEDIEMVNVSNPVLIDQEYCPWNQC  60

Query  747  KTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISE  568
               VPSKIKI+ VSFK I GTSAT VAVKL+CS   PC  V ++ + L Y G+ G   S+
Sbjct  61   NRKVPSKIKISKVSFKNIRGTSATPVAVKLVCSQSNPCEGVEVADIDLTYSGSEGPIKSQ  120

Query  567  CDNVKPTLSGKNSPAIC  517
            C NVKP +SGK +P IC
Sbjct  121  CANVKPVISGKQNPPIC  137



>ref|XP_008441641.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=404

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL++T NGVRIKTWP S     AS MHFED++M NVSNP++I
Sbjct  246  LGKYSKEKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPASDMHFEDIEMVNVSNPVII  305

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT VAVK++CS   PC +V ++ + L Y
Sbjct  306  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATPVAVKIVCSKSNPCEEVEVADIDLTY  365

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S+C NVKP +SGK +P IC
Sbjct  366  SGSEGPIKSQCANVKPVISGKQNPPIC  392



>ref|XP_009365185.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRY NE+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++I
Sbjct  250  LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSK+KI++VSFK I G+S++ V +K++CS G+PC  V LS + L Y
Sbjct  310  DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSSSPVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  597  KGTNGSAISECDNVKPTL  544
             G  G   S+C +VKPT+
Sbjct  370  TGNKGPITSQCKHVKPTI  387



>emb|CAN65674.1| hypothetical protein VITISV_002009 [Vitis vinifera]
Length=1260

 Score =   186 bits (473),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954   LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
             LG Y NE PV+G+ VK+C LS+T NGVR+KT+P+SP G A+ MHF D+ M+NVSNPI+ID
Sbjct  1111  LGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIID  1170

Query  774   QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
             Q+YCP NQC   VPS++K++++SFK I GT++T++AV L+CS G PC KV L  + L+Y 
Sbjct  1171  QEYCPHNQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYT  1230

Query  594   GTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+A S+C NV+ TL G   P  C
Sbjct  1231  GPEGTASSQCKNVEATLWGTQQPKTC  1256


 Score =   113 bits (282),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV+GVTVK+C L NT+NG+R+KTWP SP  VA+ +HFED+ M+NV NPILI+
Sbjct  836  LGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILIN  895

Query  774  QQYCPWNQCK  745
            Q+YCP++QC+
Sbjct  896  QEYCPYDQCQ  905



>ref|XP_008459709.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=428

 Score =   179 bits (455),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LGRY  E+PV G+ VK+C L+ T NG+RIKTWPASP  GVAS MH+EDV M+NV NPILI
Sbjct  271  LGRYNLEEPVEGLQVKNCTLTGTTNGLRIKTWPASPAAGVASDMHYEDVVMNNVMNPILI  330

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+NQC   VPSK+KI+ VSFK I GTS    AV L+CSS  PC+ V L+ + L Y
Sbjct  331  DQEYCPYNQCNKQVPSKVKISKVSFKNIRGTSGNAAAVTLVCSSSNPCDGVELADIDLTY  390

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S C NVKPT+SGK +P  C
Sbjct  391  SGSEGPITSRCANVKPTVSGKQNPPAC  417



>ref|XP_009365186.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=400

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRY NE+PV G+ +K+C + NT NGVRIKTWPASP NGV S +HFED+ MDNV NP++I
Sbjct  250  LGRYQNEEPVSGIFIKNCTIKNTDNGVRIKTWPASPSNGVVSDVHFEDIIMDNVGNPVII  309

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSK+KI++VSFK I G+S   V +K++CS G+PC  V LS + L Y
Sbjct  310  DQEYCPWNQCTLKVPSKVKISNVSFKNIKGSSVGIVGIKIVCSGGLPCENVQLSDIDLTY  369

Query  597  KGTNGSAISECDNVKPTL  544
             G  G   S+C +VKPT+
Sbjct  370  TGNKGPITSQCKHVKPTI  387



>emb|CDP04343.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE PV G+ V  C +S TLNGVR+K+WPAS  G A+ MHFE + M NVSNP++ID
Sbjct  249  LGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKRGSATNMHFEGIIMQNVSNPVIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS++KI  VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y 
Sbjct  309  QEYCPNNQCTNTAPSRVKIAQVSFKHITGTSATPAAVTLLCSKSIPCEGVEVAHIDLAYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+  S+C NVKP LSGK +P IC
Sbjct  369  GKQGTLSSKCANVKPVLSGKLNPPIC  394



>emb|CDP04348.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE PV G+ V  C +S TLNGVR+K+WPAS +G A+ MHFE + M NVSNP++ID
Sbjct  249  LGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIMQNVSNPVIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS +KI  VSFK ITGTSAT  AV LLCS  +PC  V ++ + L Y 
Sbjct  309  QEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  GS  S C NVKP LSGK +P IC
Sbjct  369  GNQGSVSSNCANVKPALSGKLNPPIC  394



>sp|P24548.1|PGLR_OENOR RecName: Full=Exopolygalacturonase; Short=ExoPG; AltName: Full=Galacturan 
1,4-alpha-galacturonidase; AltName: Full=Pectinase, 
partial [Oenothera organensis]
 gb|AAB23476.1| polygalacturonase homolog {clone P22} [Oenothera organensis]
Length=362

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE+ V+G+ VK+C ++ + NGVRIKTWP S  G AS MHF+D+ M++V  PILID
Sbjct  209  LGRYKNEESVVGIYVKNCTITGSQNGVRIKTWPKSEPGEASEMHFQDITMNSVGTPILID  268

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC   VPS +K++ +SFK I GTS TK AVKL+CS   PCN V L+ + L Y 
Sbjct  269  QGYCPYNQCTAEVPSSVKLSKISFKNIKGTSTTKEAVKLVCSKSFPCNGVELADIDLTYS  328

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KPT+ GK  PAIC
Sbjct  329  GKGGPATSVCENIKPTIKGKQIPAIC  354



>emb|CDP04342.1| unnamed protein product [Coffea canephora]
Length=297

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE PV G+ V  C +S TLNGVR+K+WPAS +G A+ MHFE + M NVSNP++ID
Sbjct  142  LGRYDNELPVEGIFVTDCIISGTLNGVRVKSWPASKSGCATNMHFEGIIMQNVSNPMIID  201

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS +KI  VSFK ITGTSAT   V LLCS  +PC  V ++ + L Y 
Sbjct  202  QEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAVVTLLCSKSIPCESVEVADIDLAYN  261

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+  S C NVKP LSGK +P IC
Sbjct  262  GNQGNVSSNCANVKPALSGKLNPPIC  287



>ref|XP_010689005.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=413

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 111/153 (73%), Gaps = 7/153 (5%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YP EQPV+GV V++C L NT+NG+R+KTWP S NG+ASG+HF+D+ +DNVSNP+LID
Sbjct  258  LGKYPGEQPVVGVIVRNCTLVNTMNGLRVKTWPNSFNGIASGLHFQDIIIDNVSNPVLID  317

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP + CK  VPSK+K++DV FK I GTSATK+A++L CS  +PC  V L  + L Y 
Sbjct  318  QDYCPDDLCKLQVPSKVKVSDVLFKNIKGTSATKMAIQLKCSKIMPCENVTLDDIDLCYL  377

Query  594  GTNG-------SAISECDNVKPTLSGKNSPAIC  517
            G  G       +A SEC NV+P + GK SP  C
Sbjct  378  GNKGNNRNTTSTATSECFNVRPAIMGKLSPPPC  410



>emb|CDP18013.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE PV G+ V  C +S TLNGVR+K+WPA+ +G A+ MHFE + M NVSNP++ID
Sbjct  249  LGRYDNELPVEGIFVTDCTISGTLNGVRVKSWPAAKSGSATNMHFEGIIMQNVSNPVIID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC    PS +KI  VSFK ITGTSAT  AV LLCS  +PC+ V ++ + L Y 
Sbjct  309  QEYCPNNQCTNTAPSSVKIAQVSFKNITGTSATPAAVTLLCSKSIPCDGVEIADIDLAYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+  S C NVKP LSGK +P IC
Sbjct  369  GNQGNVSSNCANVKPALSGKLNPPIC  394



>emb|CAN65676.1| hypothetical protein VITISV_002011 [Vitis vinifera]
Length=587

 Score =   180 bits (456),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG Y NE PV+G+ VK+C LS+T NGVR+KT+P+SP G A+ MHF D+ M+NVSNPI+ID
Sbjct  438  LGLYKNEAPVIGIRVKNCTLSDTTNGVRVKTYPSSPQGTATEMHFHDIVMNNVSNPIIID  497

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++K++++SFK I GT++T++AV L+CS G PC KV L  + L+Y 
Sbjct  498  QEYCPHNQCNLQVPSRVKLSNISFKNIRGTTSTELAVNLVCSKGAPCQKVELGNIDLKYT  557

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+A S+C NV+ TL G   P  C
Sbjct  558  GPEGTASSQCKNVEATLWGTQQPKTC  583


 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 78/94 (83%), Gaps = 0/94 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV+GVTVK+C L NT+NG+R+KTWP SP  VA+ +HFED+ M+NV NPILI+
Sbjct  69   LGKYHNEEPVVGVTVKNCTLINTMNGIRVKTWPDSPASVATDLHFEDIIMNNVGNPILIN  128

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATK  673
            Q+YCP++QC+  VPS++KI+DVSF+ I   S T+
Sbjct  129  QEYCPYDQCQAKVPSQVKISDVSFQGICSMSGTQ  162



>ref|XP_008460220.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=393

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 106/147 (72%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GV V  CKL++T NGVRIKTWP S     AS MHFED++M+NVSNPI+I
Sbjct  246  LGKYSKEKAVEGVWVTKCKLTSTTNGVRIKTWPDSAGEYSASDMHFEDIEMNNVSNPIII  305

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKI+ VSFK I GTSAT VAVKL+CS  +PC  V +  + L+Y
Sbjct  306  DQEYCPWNQCNPKIPSSIKISKVSFKNIRGTSATPVAVKLVCSKKIPCEAVEVVDIDLKY  365

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G   S+C NVKP +SGK +P IC
Sbjct  366  NGNKGPIKSQCANVKPIISGKQNPRIC  392



>gb|KCW46858.1| hypothetical protein EUGRSUZ_K00662, partial [Eucalyptus grandis]
Length=395

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C ++   NG RIKTW AS  G+A+ MHF+DV+M++V+NP+LID
Sbjct  247  LGKYDNEEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLID  306

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC+  +PS +KI++VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YK
Sbjct  307  QGYCPFNQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYK  366

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A SEC NV+P +SG  +P  C
Sbjct  367  GPDGPATSECSNVRPLISGMQNPLAC  392



>ref|XP_011073814.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Sesamum indicum]
Length=394

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 115/147 (78%), Gaps = 2/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV+GVTVK+C +++T++GVR++TWPASP+ GVA  +HF+++ M+NVS PI I
Sbjct  244  LGKYNNEEPVVGVTVKNCTITHTMSGVRVETWPASPSEGVARDLHFQNIVMNNVSTPISI  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+ +C   VPS++KI+DVSF +I GTSA+KVAV+L CSS  PC  V LS + L Y
Sbjct  304  DQEYCPY-KCDKKVPSRVKISDVSFDDIRGTSASKVAVRLRCSSASPCENVGLSNINLAY  362

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G++G A SEC NVKP ++G+  P  C
Sbjct  363  HGSDGKATSECANVKPKVTGQLFPPAC  389



>emb|CDY35969.1| BnaA05g29810D [Brassica napus]
Length=503

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+D
Sbjct  350  LGKYPNEQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVD  409

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP  +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   
Sbjct  410  QVYCPHGKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVST  468

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+A+S C NVKPT++GK  PA C
Sbjct  469  GKEGAAVSACSNVKPTVTGKMIPAAC  494



>ref|XP_009147021.1| PREDICTED: exopolygalacturonase clone GBGA483-like [Brassica 
rapa]
Length=517

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNEQPV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+D
Sbjct  364  LGKYPNEQPVKGITIRKCIIKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVD  423

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP  +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   
Sbjct  424  QVYCPHGKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVST  482

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+A+S C NVKPT++GK  PA C
Sbjct  483  GKEGAAVSACSNVKPTVTGKMIPAAC  508



>ref|XP_004169306.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=424

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LGRY N   V GVTVK CKL NT NGVRIK+WP S +   AS +HFED++M NVSNP++I
Sbjct  260  LGRYANRTEVTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVI  319

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            +Q+YCP++QC   +PSKIKI++VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y
Sbjct  320  NQEYCPFDQCDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTY  379

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT G   S+C NV P ++GK +P  C
Sbjct  380  TGTQGRITSQCRNVIPIITGKQNPRAC  406



>ref|XP_004140444.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
 ref|XP_004157869.1| PREDICTED: exopolygalacturonase-like [Cucumis sativus]
Length=401

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GV V  CKL  T NGVRIKTWP S     AS MHFED++M +VSNPILI
Sbjct  243  LGKYTKEKAVEGVWVTKCKLIKTTNGVRIKTWPDSAVKYSASDMHFEDIEMIDVSNPILI  302

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   +PS IKI+ VSFK I GT+ T VAVKL+CS  +PC  V ++ + L+Y
Sbjct  303  DQEYCPWNQCNRKIPSSIKISKVSFKNIRGTTVTPVAVKLVCSKSIPCEAVEVADIDLKY  362

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  GS  S+C NVKP +SGK +P IC
Sbjct  363  NGNKGSITSQCANVKPIISGKQNPRIC  389



>gb|ADC53480.1| polygalacturonase [Gossypium hirsutum]
Length=412

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 110/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG + NE+PV GVTVK+C ++NT NGVRIKTWP +  G  S +HFED+ + NVS+PI+ID
Sbjct  255  LGLFKNEEPVDGVTVKNCTMTNTSNGVRIKTWPGAEPGTCSNIHFEDITVTNVSSPIIID  314

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWN+CK    SK+K++++SFK I GTSA   AVK++CS+ +PC  V L+ +++ + 
Sbjct  315  QKYCPWNKCKINEESKVKLSNISFKNIHGTSARPEAVKIICSATLPCENVELADIEITHS  374

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S+C NVKP +SGK +PA C
Sbjct  375  GPTGPAVSQCSNVKPKVSGKQNPAAC  400



>emb|CDY28013.1| BnaC05g44150D [Brassica napus]
Length=493

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 109/146 (75%), Gaps = 1/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+YPNE+PV G+T++ C + +T NGVRIKTWP SP G+ SG  FED+ MDNVS PIL+D
Sbjct  340  LGKYPNEEPVKGITIRKCIVKHTDNGVRIKTWPGSPPGLVSGALFEDITMDNVSLPILVD  399

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP  +CK+G PSK+++ ++SFK I GTS+TK+AV+L CS G PC  V L+ + L   
Sbjct  400  QVYCPHGKCKSG-PSKVQLENLSFKNIRGTSSTKIAVQLNCSPGCPCKNVALADINLVST  458

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G+A+S C NVKPT++GK  PA C
Sbjct  459  GKEGAAVSACSNVKPTVTGKMIPAAC  484



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score =   181 bits (460),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 110/147 (75%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CKL++T NGVRIKTWP S     A+ MHFED++M NVSNPI+I
Sbjct  847  LGKYSKEKEVVGVTVKKCKLTSTTNGVRIKTWPDSVGTFPATDMHFEDIEMVNVSNPIII  906

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC   VPSKIKI+ VSFK I GTSAT VAVK++CS   PC +V ++ + L Y
Sbjct  907  DQEYCPWNQCNRKVPSKIKISKVSFKNIRGTSATAVAVKIVCSQSNPCEEVEVADIDLTY  966

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G+ G   S+C NVKP ++GK +P IC
Sbjct  967  SGSEGPIKSQCANVKPVITGKQNPPIC  993



>ref|XP_010667847.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=400

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 106/146 (73%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E PV GVTVK C +S+T NGVRIK+W  S   +AS +HFED+ + NV NPILID
Sbjct  249  LGRYQKEAPVTGVTVKKCTISDTDNGVRIKSWLNSFEAIASNLHFEDITVKNVLNPILID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PSK+K++++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + 
Sbjct  309  QEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A+S C NVKP  SGK +P  C
Sbjct  369  G--GHAVSMCKNVKPITSGKQNPVAC  392



>ref|XP_010038561.1| PREDICTED: exopolygalacturonase-like [Eucalyptus grandis]
Length=501

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV V +C ++   NG RIKTW AS  G+A+ MHF+DV+M++V+NP+LID
Sbjct  280  LGKYDNEEPVSGVFVTNCTITGATNGARIKTWLASKIGIATDMHFQDVQMNDVANPVLID  339

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC+  +PS +KI++VSF+ I GTS+TKVAVK+ CS  +PC  V ++ + L YK
Sbjct  340  QGYCPFNQCQAQIPSLVKISNVSFERIRGTSSTKVAVKIACSKRIPCEGVEIADINLVYK  399

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A SEC NV+P +SG  +P  C
Sbjct  400  GPDGPATSECSNVRPLISGMQNPLAC  425


 Score = 78.6 bits (192),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -1

Query  726  IKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYKGTNGSAISECDNVKPT  547
            +KI+DVSF++I GTSAT +A KL C  GVPC K+ L+ + L Y G NG++ S+  N+KPT
Sbjct  429  VKISDVSFRDIRGTSATPLAEKLGCGRGVPCQKLELADINLRYNGRNGASTSQSANMKPT  488

Query  546  LSGKNSPAIC  517
            ++GK+S  IC
Sbjct  489  ITGKSSLPIC  498



>ref|XP_004144611.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=506

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 107/147 (73%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LGRY N   V GVTVK CKL NT NGVRIK+WP S +   AS +HFED++M NVSNP++I
Sbjct  342  LGRYANRTEVTGVTVKSCKLINTWNGVRIKSWPDSASAYTASDLHFEDIEMVNVSNPVVI  401

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            +Q+YCP++QC   +PSKIKI++VSFK I GTSAT VA++L+CS  +PC  V ++ + L Y
Sbjct  402  NQEYCPFDQCDKKIPSKIKISNVSFKNIRGTSATSVAIQLICSKDLPCEDVEVADIDLTY  461

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT G   S+C NV P ++GK +P  C
Sbjct  462  TGTQGRITSQCRNVIPIITGKQNPRAC  488



>ref|XP_010536244.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E+PV G+ V++C   NT NGVR+KTW +S   +A+G++F+D+ + NVSNPI+ID
Sbjct  255  LGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPIVID  314

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PS++K++++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y 
Sbjct  315  QEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYT  374

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G++G ++S+C NV P + GK  P+ C
Sbjct  375  GSDGDSMSDCTNVSPKIFGKQYPSPC  400



>ref|XP_010532220.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=436

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 109/146 (75%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E+PV G+ V++C   NT NGVR+KTW +S   +A+G+HF D+ + NVSNPI+ID
Sbjct  283  LGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWLSSEKAIATGLHFHDITVVNVSNPIVID  342

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP++ CK   PS++K++++SFK I GTS+TK+A+KL CSSGVPC  V +S + ++Y 
Sbjct  343  QEYCPYDHCKAKKPSQVKLSNISFKNIHGTSSTKMAMKLACSSGVPCENVEISNIDIKYI  402

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G++G ++S+C NV P   GK  P+ C
Sbjct  403  GSDGVSMSDCTNVSPKTFGKQYPSAC  428



>ref|XP_009612480.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+ID
Sbjct  250  LGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVID  309

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC   +PSK+KI+ VS K I GTS T+ AV LLCS G PC+ V +  + + Y 
Sbjct  310  QVYCPYNQCNKDLPSKVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYN  369

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+NVKP L GK +P IC
Sbjct  370  GKEGPAKSSCENVKPKLVGKQNPPIC  395



>ref|XP_010536243.1| PREDICTED: exopolygalacturonase-like [Tarenaya hassleriana]
Length=407

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 72/146 (49%), Positives = 111/146 (76%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E+PV G+ V++C   NT NGVR+KTW +S   +A+G++F+D+ + NVSNP++ID
Sbjct  255  LGRYTKEEPVSGIIVRNCTFFNTDNGVRVKTWMSSEKAIATGLYFQDIAVVNVSNPVVID  314

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PS++K++++SF+ I GTS+T++A+KL CSSGVPC  V +S + ++Y 
Sbjct  315  QEYCPYNHCKAKKPSQVKLSNISFRNIHGTSSTQMAMKLACSSGVPCENVEISDIDIKYT  374

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G++G ++S+C NV P + GK  P+ C
Sbjct  375  GSDGDSMSDCTNVSPKIFGKQYPSPC  400



>emb|CDP04350.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE+PV+GV V++C L NTL GVR+K+WP++  G A+ +HF+D+ M NV++PI+ID
Sbjct  248  LGRYKNEEPVVGVFVRNCTLINTLTGVRVKSWPSATTGAATDVHFDDITMRNVTSPIVID  307

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC  G PS++KI+ VSF  I GTSA+ +AVKL+CS   PC  V +  + L Y 
Sbjct  308  QEYCPNNQCTLGAPSRVKISKVSFNNIRGTSASALAVKLVCSKTFPCEGVEIGDIDLAYH  367

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G+  + C NV+PT  G+ +P IC
Sbjct  368  GSLGNITTNCANVQPTFMGRQNPPIC  393



>ref|XP_008455507.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=402

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GVTVK C L NT NGVRIK+WP S     AS +HFED++M NVSNPI+I
Sbjct  244  LGKYTTEKEVAGVTVKSCNLINTSNGVRIKSWPDSAVAYTASDLHFEDIEMVNVSNPIII  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC   +PSKIKI +VSFK I GTSAT VA+K +CS  +PC+ V ++ + L Y
Sbjct  304  DQEYCPSNQCNKKIPSKIKIRNVSFKNIRGTSATFVAIKFICSKDLPCDDVEVADINLSY  363

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT G   S+C NV P ++GK +P  C
Sbjct  364  TGTQGRITSQCRNVIPIITGKQNPRAC  390



>ref|XP_010418169.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=410

 Score =   171 bits (433),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRYP+EQ V G+ V +C +  T NG+RIKTWP A+ + VASG+HFED+ + NVSNPILI
Sbjct  254  LGRYPHEQNVRGIRVINCTVQETDNGLRIKTWPTAACSIVASGIHFEDIILKNVSNPILI  313

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ DVSF  I GTSA K AVKLLCS G PC  VV+  + +EY
Sbjct  314  DQEYCPWNQCNKQKSSSIKLVDVSFTNIRGTSANKDAVKLLCSKGYPCENVVVGNINIEY  373

Query  597  KGTNGSAISECDNVKPTLSGKNSPAICD  514
             G +G A   C NVKP L G  +P  CD
Sbjct  374  TGRDGPATFMCSNVKPKLVGIQNPKACD  401



>sp|Q6H9K0.1|PGLR2_PLAAC RecName: Full=Exopolygalacturonase; AltName: Full=Pollen allergen 
Pla a 2; AltName: Allergen=Pla a 2; Flags: Precursor, partial 
[Platanus x acerifolia]
 emb|CAE52833.1| polygalacturonase [Platanus x acerifolia]
Length=377

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 103/145 (71%), Gaps = 0/145 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE+ V G+TVK C  S T+NGVR+KTWP SP G A+ + F+D+ M+NV NP+++D
Sbjct  230  LGRYNNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILD  289

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+ QC    PS+IK+++++F  I GTS  KVAV + CS G+PC+ + +  + L Y+
Sbjct  290  QEYCPYGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYR  349

Query  594  GTNGSAISECDNVKPTLSGKNSPAI  520
            G  G A S C NVKPT SGK  PAI
Sbjct  350  GAGGPATSTCSNVKPTFSGKQVPAI  374



>pir||S46530 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.X and clone 
pC27.Y) - common tobacco (fragment)
 emb|CAA50334.1| polygalacturonase [Nicotiana tabacum]
 emb|CAA50336.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  232  LGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  291

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  292  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYS  351

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  352  GKEGPAKSSCENIKPSLKGKQNPPVC  377



>dbj|BAO02513.1| predicted polygalacturonase ortholog [Nicotiana alata]
Length=401

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  243  LGGNPDEKPVIGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  302

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  303  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDISYS  362

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  363  GKEGPAKSSCENIKPSLKGKQNPPVC  388



>emb|CDP04347.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 97/146 (66%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY NE P+ G     C +S TLNGVR+K+WPAS +G A+ MHFE + + NVSNP++ID
Sbjct  19   LGRYDNELPIKGSFDTDCTISGTLNGVRVKSWPASKSGSATNMHFEGIIIQNVSNPVIID  78

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP  Q     PS ++I  VSF  ITGTSAT  AV LLCS  +PC  V ++ + L Y 
Sbjct  79   QEYCPNKQSTNTAPSSVQIAQVSFNNITGTSATPAAVTLLCSKSIPCEGVEVADIDLAYN  138

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  GS  S C NVKP LSGK +P IC
Sbjct  139  GNQGSVSSNCANVKPALSGKLNPPIC  164



>ref|XP_009599317.1| PREDICTED: polygalacturonase [Nicotiana tomentosiformis]
Length=396

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  243  LGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  302

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  303  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYS  362

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  363  GKEGPAKSSCENIKPSLKGKQNPPVC  388



>ref|XP_007152047.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
 gb|ESW24041.1| hypothetical protein PHAVU_004G097300g [Phaseolus vulgaris]
Length=398

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+YPNE+PV    V +C L+NT NGVRIKTWP +P  +  +GMHFED+KM NV NPI+I
Sbjct  248  LGKYPNEKPVEDFFVSNCILNNTDNGVRIKTWPDTPATITVTGMHFEDIKMINVKNPIII  307

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI++VSFK I GTS TK  V L+CSSGVPC  V+L+ + L +
Sbjct  308  DQEYCPWNQCTKQNPSKIKISNVSFKNIIGTSGTKEGVVLICSSGVPCEDVMLTDIDLTF  367

Query  597  KGTNGSAISECDNVKPTLSGK  535
             GT  SA ++  NVKP + GK
Sbjct  368  NGT--SAAAKLSNVKPIIQGK  386



>ref|XP_007143503.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
 gb|ESW15497.1| hypothetical protein PHAVU_007G0770001g, partial [Phaseolus vulgaris]
Length=276

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 103/148 (70%), Gaps = 4/148 (3%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NPI+I
Sbjct  84   LGKYKEEEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIII  143

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC  G PSK+KI+ VSFK I GTSATK  + L CSSGVPC  V +  V L Y
Sbjct  144  DQEYCPNNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTY  203

Query  597  KGTNGSAISECDNVKPTLSGKNSPAICD  514
             G  G  I++C NVKPT++GK +PA  D
Sbjct  204  NG--GPIIAKCSNVKPTITGK-APACGD  228



>ref|XP_009780910.1| PREDICTED: polygalacturonase [Nicotiana sylvestris]
Length=402

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  244  LGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  303

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  304  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYS  363

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  364  GKEGPAKSSCENIKPSLKGKQNPPVC  389



>ref|XP_004243884.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=392

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNP++ID
Sbjct  241  LGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIVVQNVSNPVVID  300

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC   +PS +KI+ VS K + GTS+T+ AV+LLCS GVPC  V +  + + Y 
Sbjct  301  QVYCPYNQCNKDLPSLVKISKVSIKNVKGTSSTQDAVQLLCSKGVPCEGVEVGDIDIAYN  360

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A + C+NVKPT  GK +P +C
Sbjct  361  GKEGPAKTSCENVKPTFVGKQNPPVC  386



>gb|KDO36716.1| hypothetical protein CISIN_1g036262mg, partial [Citrus sinensis]
Length=195

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  47   LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  106

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  107  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  166

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  167  GIDDKGPAISSCSNVKPTLVGKQIPATC  194



>ref|XP_009764608.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+ID
Sbjct  250  LGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTDLHYEDIIVQNVSNPIVID  309

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC   +PS++KI+ VS K I GTS T+ AV LLCS G PC+ V +  + + Y 
Sbjct  310  QVYCPYNQCNKDLPSQVKISKVSIKNIRGTSRTQDAVLLLCSKGAPCDGVEVGDIDITYN  369

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+NVKP   GK +P IC
Sbjct  370  GKEGPAKSSCENVKPKFVGKQNPPIC  395



>ref|XP_004163433.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   169 bits (428),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GVTVK CKL NT NGVRIKTWP  +    AS +HFED++M NVSNP++I
Sbjct  254  LGKYTKEKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVII  313

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC   +PSKIKIN+VSFK I GTSAT VAVK +CS+   C  V ++ + L Y
Sbjct  314  DQEYCPSNQCNKKIPSKIKINNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAY  373

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT G   S+C NV P ++GK +P  C
Sbjct  374  IGTQGRITSQCRNVIPIITGKQNPRAC  400



>ref|XP_010675960.1| PREDICTED: exopolygalacturonase clone GBGA483-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E PV GVTVK C +S+T NG+RIK+W  S    AS +HFED+ + NV  PILID
Sbjct  183  LGRYEKEAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILID  242

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PSK+K++++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + 
Sbjct  243  QEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFS  302

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G  +S C NVKP  SGK +P  C
Sbjct  303  G--GPVVSMCKNVKPITSGKQNPVAC  326



>gb|AFK41055.1| unknown [Lotus japonicus]
Length=394

 Score =   169 bits (427),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 5/142 (4%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA--SGMHFEDVKMDNVSNPIL  781
            LG+YP+E+PV G  VK+C L+NT NGVRIKTWP++P G A  + MHFED+ M NV NPI+
Sbjct  247  LGKYPDEKPVEGFYVKNCTLTNTDNGVRIKTWPSTP-GTAPITDMHFEDIIMVNVKNPII  305

Query  780  IDQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLE  601
            IDQ+YCPWNQC    PSKIKI+ VSFK I GTSAT   V L+CSSGVPC+ V L+GV L 
Sbjct  306  IDQEYCPWNQCSKKSPSKIKISKVSFKNIRGTSATPEGVILICSSGVPCDTVELNGVDLT  365

Query  600  YKGTNGSAISECDNVKPTLSGK  535
            + G    A ++C NVKP ++GK
Sbjct  366  FNG--APATAKCANVKPIVTGK  385



>ref|XP_010464426.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=398

 Score =   169 bits (427),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRYP+EQ V G+ V +C +  T NG+RIKTWP A+ + VASG+HFED+ + NVSNPILI
Sbjct  242  LGRYPHEQNVRGIKVINCTVQETDNGLRIKTWPTAACSTVASGIHFEDIILKNVSNPILI  301

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ DVSF  I GTS  K AVKLLCS G PC  VV+  + +EY
Sbjct  302  DQEYCPWNQCNKQKSSSIKLIDVSFTNIRGTSGNKDAVKLLCSKGYPCENVVVGNINIEY  361

Query  597  KGTNGSAISECDNVKPTLSGKNSPAICD  514
             G +G A   C NVKP L G  +P  C+
Sbjct  362  TGRDGPATFMCSNVKPRLVGIQNPKACN  389



>ref|XP_007143501.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
 gb|ESW15495.1| hypothetical protein PHAVU_007G0769002g, partial [Phaseolus vulgaris]
Length=243

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 102/145 (70%), Gaps = 4/145 (3%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NPI+I
Sbjct  101  LGKYKEEEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPIII  160

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC  G PSK+KI+ VSFK I GTSATK  + L CSSGVPC  V +  V L Y
Sbjct  161  DQEYCPNNQCSKGSPSKVKISKVSFKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTY  220

Query  597  KGTNGSAISECDNVKPTLSGKNSPA  523
             G  G  I++C NVKPT++GK +PA
Sbjct  221  NG--GPIIAKCSNVKPTITGK-APA  242



>pir||S46529 polygalacturonase (EC 3.2.1.15) precursor (clone pC27.W) - common 
tobacco (fragment)
 emb|CAA50337.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  232  LGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  291

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  292  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYS  351

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L  K +P +C
Sbjct  352  GKEGPAKSSCENIKPSLKDKQNPPVC  377



>gb|ABE65925.1| polygalacturonase/pectinase [Arabidopsis thaliana]
Length=280

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ ++NVSNPILI
Sbjct  120  LGRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILI  179

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEY
Sbjct  180  DQEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEY  239

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
            KG +G     C NV P L G  +P  C
Sbjct  240  KGADGPPTFMCSNVSPKLVGTQNPKAC  266



>ref|XP_009334234.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=406

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LGRY NE+ + G+ VK+C L+NT NGVRIKTWP SP    AS +HFED+ M NVSNPI+I
Sbjct  249  LGRYDNEESLAGIIVKNCTLTNTQNGVRIKTWPNSPVATAASDIHFEDIIMVNVSNPIVI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ +C    PSK+KI+DVSFK I G+SAT +++K++CSSG PC  + L+ + L Y
Sbjct  309  DQLYCPYKKCDNLPPSKVKISDVSFKNIQGSSATALSLKIVCSSGSPCENMELADIDLTY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S+C NVKPT+SG      C
Sbjct  369  SGAKGTLTSQCLNVKPTISGLTGALAC  395



>gb|KFK38253.1| hypothetical protein AALP_AA3G089200 [Arabis alpina]
Length=394

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ + NVSNPILI
Sbjct  240  LGRYGHEQDVSGITVVNCTLQETDNGLRIKTWPSAACATTASGIHFENIILKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D+ FK I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKNKPSTIKLVDIKFKNIRGTSGNKDAVKLLCSKGHPCQNVEIGNINIAY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
            KG +G A  +C NVKP L G  +P  C
Sbjct  360  KGADGPATFQCSNVKPKLVGTQNPKAC  386



>ref|XP_010112807.1| hypothetical protein L484_020039 [Morus notabilis]
 gb|EXC34922.1| hypothetical protein L484_020039 [Morus notabilis]
Length=396

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE PV G+TV+ C   NT NGVRIKTWP +  G AS + FE++ M NV +P+LID
Sbjct  247  LGKYRNEAPVQGITVRDCTFKNTQNGVRIKTWPNANEGSASDLRFENLYMQNVGSPVLID  306

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCPWNQC T  PSK+K++ +SFK I GTS+T +AV L+CS G PC  V +  + L+YK
Sbjct  307  QEYCPWNQCNTQNPSKVKLSKISFKNIWGTSSTPLAVNLICSRGYPCQNVEVGNIDLKYK  366

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G +G A S C NV   ++GK +P+ C
Sbjct  367  GKDGPAHSVCKNVNVKVTGKMNPSPC  392



>ref|XP_010675951.1| PREDICTED: exopolygalacturonase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=410

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRY  E PV GVTVK C +S+T NG+RIK+W  S    AS +HFED+ + NV  PILID
Sbjct  259  LGRYEKEAPVTGVTVKKCTISDTENGIRIKSWLNSFVATASDLHFEDITVKNVLTPILID  318

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PSK+K++++SFK I GT+ +K AVK+LCSSG PC+KV L+ + L + 
Sbjct  319  QEYCPYNHCKAKTPSKVKLSNISFKNIRGTAGSKEAVKILCSSGAPCDKVELADIDLTFS  378

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G  +S C NVKP  SGK +P  C
Sbjct  379  G--GPVVSMCKNVKPITSGKQNPVAC  402



>ref|XP_004144529.1| PREDICTED: polygalacturonase-like [Cucumis sativus]
Length=412

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GVTVK CKL NT NGVRIKTWP  +    AS +HFED++M NVSNP++I
Sbjct  254  LGKYTKEKEVAGVTVKSCKLINTSNGVRIKTWPDCAVAYTASDLHFEDIEMVNVSNPVII  313

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC   +PSKIKI++VSFK I GTSAT VAVK +CS+   C  V ++ + L Y
Sbjct  314  DQEYCPSNQCNKKIPSKIKISNVSFKNIRGTSATFVAVKFICSTVFSCEGVEVTDIDLAY  373

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             GT G   S+C NV P ++GK +P  C
Sbjct  374  IGTQGRITSQCRNVIPIITGKQNPRAC  400



>ref|XP_009348297.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like, partial 
[Pyrus x bretschneideri]
Length=236

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 104/147 (71%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE+ + G+ VK+C L+NT NGVRIKTWP SP    AS +HFED+ M NV NPI+I
Sbjct  79   LGRYNNEESLAGIRVKNCTLTNTQNGVRIKTWPNSPLATTASDIHFEDIFMVNVGNPIVI  138

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ +C    PSK+KI++VSFK I G+SAT +A+K++CSSG  C  V L+ + L Y
Sbjct  139  DQLYCPYRKCDNLPPSKVKISNVSFKNIKGSSATALALKIVCSSGSRCENVELTDIXLTY  198

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S+C NVKPT+SG  S   C
Sbjct  199  NGAKGTLTSQCLNVKPTISGLISALAC  225



>gb|KHN24677.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV G+ VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  245  LGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS TK  V L+CSSGVPC  V ++ + L +
Sbjct  305  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G+  +A ++C NVKPT++GK
Sbjct  365  NGS--AATAKCANVKPTITGK  383



>ref|XP_006299382.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
 gb|EOA32280.1| hypothetical protein CARUB_v10015541mg [Capsella rubella]
Length=400

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+TVK+C L  T NG+RIKTWP A+ +  ASG+HFED+ ++NVSNPILI
Sbjct  239  LGRYGHEQDVAGITVKNCTLIGTDNGLRIKTWPSAACSTTASGIHFEDIILNNVSNPILI  298

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN C    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEY
Sbjct  299  DQEYCPWNHCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCVNVEIGNINLEY  358

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
            KG +G     C NV P L G  +P  C
Sbjct  359  KGADGPPTFTCSNVTPKLVGTQNPKAC  385



>ref|XP_006366630.1| PREDICTED: polygalacturonase-like [Solanum tuberosum]
Length=384

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E+PV+GV VK+C   NT NGVR+KTWPAS  GV + +H+ED+ + NVSNPI+ID
Sbjct  233  LGKTPGEKPVVGVYVKNCTFINTDNGVRVKTWPASHQGVVTELHYEDIIVQNVSNPIVID  292

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQC   +PS +KI+ VS K + GTS T+ AV LLCS GVPC  V +  + + Y 
Sbjct  293  QVYCPYNQCNKDLPSLVKISKVSIKNVKGTSRTQDAVLLLCSKGVPCEGVEVGDIDITYN  352

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A + C+NVKPT  G  +P +C
Sbjct  353  GKEGPAKTSCENVKPTFVGNQNPPVC  378



>ref|XP_009601010.1| PREDICTED: polygalacturonase-like [Nicotiana tomentosiformis]
Length=401

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E PV+GV V++C   +T NGVR+KTWPAS NGV   +H+ED+ + NVSNP++ID
Sbjct  249  LGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK  +PS++KI+ VSFK I GTS T+ A+++ CS GVPC  V +  + + Y 
Sbjct  309  QLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIQINCSKGVPCEGVEVGDIDITYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NV P+  GK +P +C
Sbjct  369  GNEGPAKSSCQNVDPSFVGKQNPPVC  394



>sp|Q05967.1|PGLR_TOBAC RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA50338.1| polygalacturonase [Nicotiana tabacum]
Length=396

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V++C  +NT NGVRIKTWPAS  GV + +HFED+ + NVSNP++ID
Sbjct  243  LGGNPDEKPVVGVFVRNCTFTNTDNGVRIKTWPASHPGVVNDVHFEDIIVQNVSNPVVID  302

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LL S GVPC  + +  + + Y 
Sbjct  303  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLRSKGVPCEGIEVGDIDITYS  362

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  363  GKEGPAKSSCENIKPSLKGKQNPPVC  388



>ref|XP_004305963.1| PREDICTED: exopolygalacturonase-like [Fragaria vesca subsp. vesca]
Length=394

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 104/139 (75%), Gaps = 2/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE  V G+ VK C +SNT+NGVRIKTWP SP    AS +HFE + M+NV NPILI
Sbjct  245  LGRYNNEDHVTGINVKDCTISNTMNGVRIKTWPNSPIATTASDIHFEHITMNNVGNPILI  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+ QC T  PSK+KI++VSFK I GT+ T  AVK++C+ G+PC+KVVLS + L+ 
Sbjct  305  DQEYCPYGQCNTQTPSKVKISNVSFKNIRGTTTTAEAVKIVCAKGLPCDKVVLSDIDLKL  364

Query  597  KGTNGSAISECDNVKPTLS  541
             G  G+  S+C NV+PT++
Sbjct  365  TG-KGTLTSQCANVQPTIT  382



>emb|CAA50335.1| polygalacturonase [Nicotiana tabacum]
Length=385

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 106/146 (73%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P+E+PV+GV V +C ++NT NGVRIKTWPAS  GV + + FED+ + NVSNP++ID
Sbjct  232  LGGNPDEKPVVGVFVSNCTVTNTDNGVRIKTWPASHPGVVNDVRFEDIIVQNVSNPVVID  291

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+N+C   +PS++KI+ VSF+ I GTS T+ AV LLCS GVPC  + +  + + Y 
Sbjct  292  QVYCPFNKCNKDLPSQVKISKVSFQNIKGTSRTQDAVSLLCSKGVPCEGIEVGDIDITYS  351

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KP+L GK +P +C
Sbjct  352  GKEGPAKSSCENIKPSLKGKQNPPVC  377



>ref|XP_009804151.1| PREDICTED: polygalacturonase-like [Nicotiana sylvestris]
Length=401

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+ P E PV+GV V++C   +T NGVR+KTWPAS NGV   +H+ED+ + NVSNP++ID
Sbjct  249  LGKTPGELPVVGVFVQNCTFIDTDNGVRVKTWPASHNGVVRDLHYEDIIVQNVSNPVVID  308

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP+NQCK  +PS++KI+ VSFK I GTS T+ A+K+ CS GVPC  V +  + + Y 
Sbjct  309  QLYCPYNQCKKDLPSQVKISKVSFKNIRGTSRTQDAIKINCSKGVPCEGVEVGDIDITYN  368

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C NV P+  GK  P +C
Sbjct  369  GNEGPAKSTCQNVDPSFVGKQIPPVC  394



>ref|XP_003552049.1| PREDICTED: polygalacturonase [Glycine max]
Length=389

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV G+ VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV NPI+I
Sbjct  245  LGKYDAEEPVAGLLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS TK  V L+CSSGVPC  V ++ + L +
Sbjct  305  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGTKEGVVLVCSSGVPCEAVEMADIDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G+  +A ++C NVKPT++GK
Sbjct  365  NGS--AATAKCANVKPTITGK  383



>ref|XP_010675884.1| PREDICTED: exopolygalacturonase-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LGRYPNE+PV G+TVK C + NT NGVR+KTW  S  GV +G+HFED+ ++NV NPI++D
Sbjct  257  LGRYPNEEPVQGITVKGCTIKNTHNGVRVKTWHNSYEGVVTGLHFEDIIVENVLNPIIVD  316

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP+N CK   PSK+K++D+ F+ + GTS++K AVK++CSSGVPC KV L  + L+Y 
Sbjct  317  QEYCPYNHCKQKTPSKVKLSDIKFQNVRGTSSSKEAVKVVCSSGVPCEKVQLVNIDLKYT  376

Query  594  GTNGSAI  574
            G +G A+
Sbjct  377  GKDGPAV  383



>emb|CDY07973.1| BnaC03g35500D [Brassica napus]
Length=179

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY  EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILI
Sbjct  22   LGRYGWEQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILI  81

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY
Sbjct  82   DQEYCPWNQCNKSKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEY  141

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G    EC NV P L G  +P  C
Sbjct  142  TGADGPPTFECTNVTPKLVGTQNPKAC  168



>ref|XP_006492954.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=374

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  226  LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  285

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  286  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  345

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  346  GIDDKGPAISSCSNVKPTLVGKQIPATC  373



>gb|KHN44923.1| Polygalacturonase, partial [Glycine soja]
Length=298

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  154  LGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  213

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  214  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTF  273

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G   +A ++C NVKPT++GK
Sbjct  274  NG--AAATAKCANVKPTITGK  292



>ref|XP_006407791.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
 gb|ESQ49244.1| hypothetical protein EUTSA_v10020866mg [Eutrema salsugineum]
Length=398

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRY  E+ V GV V +C L  T NG+RIKTWP++     ASG+HFED+ + NVSNPILI
Sbjct  239  LGRYGFEEDVAGVRVVNCTLVGTDNGLRIKTWPSAKCTTTASGIHFEDIILQNVSNPILI  298

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D+SF++I GTS  K AVKLLCS G+PC  V +  + +EY
Sbjct  299  DQEYCPWNQCNKQKPSTIKLVDISFRKIRGTSGNKDAVKLLCSKGIPCENVEIGDINIEY  358

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
            KG +G    +C NV P L G   P  C
Sbjct  359  KGADGPPTFQCSNVNPKLVGTQVPKAC  385



>gb|KHN15656.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  206  LGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  265

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  266  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTF  325

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G+  +A ++C NVKPT++GK
Sbjct  326  NGS--AATAKCANVKPTITGK  344



>ref|XP_002526191.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF36195.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=392

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 97/137 (71%), Gaps = 0/137 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV VK C L NT NG+RIK+WP   +G A+ MHFED+ M+NVSN ILID
Sbjct  246  LGKYKNEEPVSGVYVKKCDLINTSNGIRIKSWPGLYSGAATDMHFEDISMNNVSNAILID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWN C +   S +KI+ V+F  I GTS+T   VKLLCS G+PC  V L+ + + YK
Sbjct  306  QMYCPWNHCNSKASSNVKISKVTFSNIKGTSSTPTIVKLLCSKGLPCEGVELNNINVVYK  365

Query  594  GTNGSAISECDNVKPTL  544
            G +G A SEC NVKP +
Sbjct  366  GPDGPAKSECTNVKPKI  382



>ref|XP_007143491.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
 gb|ESW15485.1| hypothetical protein PHAVU_007G0764001g, partial [Phaseolus vulgaris]
Length=204

 Score =   159 bits (403),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV GVTVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NP++I
Sbjct  18   LGKYKEEEPVEGVTVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVII  77

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC  G PSK+KI+ VS K I GTSATK  + L CSSGVPC  V +  V L Y
Sbjct  78   DQEYCPNNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTY  137

Query  597  KGTNGSAISECDNVKPTLSGKNSPA  523
             G   +A   C NVKPT++GK +PA
Sbjct  138  NGAPVTAT--CTNVKPTITGK-APA  159



>ref|NP_187441.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAF21194.1|AC013483_18 putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE74610.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=401

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+TV +C L  T NG+RIKTWP A+    ASG+HFE++ ++NVSNPILI
Sbjct  241  LGRYVHEQDVTGITVVNCTLQGTDNGLRIKTWPSAACATTASGIHFENIILNNVSNPILI  300

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D+SFK I GTS  K AVKLLCS   PC  V +  + LEY
Sbjct  301  DQEYCPWNQCNKQKPSTIKLVDISFKNIRGTSGNKDAVKLLCSKAHPCANVEIGNINLEY  360

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
            KG +G     C NV P L G  +P  C
Sbjct  361  KGADGPPTFMCSNVSPKLVGTQNPKAC  387



>ref|XP_011039263.1| PREDICTED: exopolygalacturonase-like [Populus euphratica]
Length=391

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+  NE+ V G+ VK+C +SNT NGVRIK+WPA   G AS +HFED+ M NVSNPI+ID
Sbjct  246  LGKSQNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWN+C     SK+ I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y 
Sbjct  306  QVYCPWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYT  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A  +C NV+P   GK +P+ C
Sbjct  366  GSEGPAKFQCSNVQPKFHGKINPSKC  391



>gb|KHN10402.1| Polygalacturonase, partial [Glycine soja]
Length=350

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV NPI+I
Sbjct  206  LGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVMNPIII  265

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  266  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEAVEMADIDLTF  325

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G+  +A ++C NVKPT++GK
Sbjct  326  NGS--AATAKCANVKPTITGK  344



>ref|XP_002310765.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
 gb|EEE91215.1| hypothetical protein POPTR_0007s11860g [Populus trichocarpa]
Length=391

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+  NE+ V G+ VK+C +SNT NGVRIK+WPA   G AS +HFED+ M NVSNPI+ID
Sbjct  246  LGKSQNEESVSGIFVKNCTISNTQNGVRIKSWPALFGGSASDIHFEDIIMKNVSNPIVID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWN+C     SK+ I +VSFK I GTS T VAV+L CS  +PC++V ++ + L+Y 
Sbjct  306  QVYCPWNECNRKSASKVSIKNVSFKNIRGTSRTPVAVQLSCSKDIPCDEVEVADIDLKYT  365

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G+ G A  +C NV+P   GK +P+ C
Sbjct  366  GSEGPAKFQCSNVQPKFHGKINPSKC  391



>gb|ABR26683.1| polygalacturonase [Fragaria chiloensis]
Length=405

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 107/147 (73%), Gaps = 2/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LI
Sbjct  256  LGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATPASDIHFEKITMNNVANPVLI  315

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPW QC   +PSK+KI++VSFK I GT++T  A+K++C+ G+ C++VVLS + L+ 
Sbjct  316  DQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKL  375

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S C NV+PT++    P  C
Sbjct  376  SG-KGTLTSHCANVQPTITRVPPPLAC  401



>ref|XP_006421347.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
 gb|ESR34587.1| hypothetical protein CICLE_v10006970mg [Citrus clementina]
Length=380

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  232  LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  291

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  292  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  351

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  352  GIDDKGPAISSCSNVKPTLVGKQIPATC  379



>ref|XP_010547226.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LGRY  E+PV G+ +K+C L  T NG+RIKT+P+S + +  S +HFED+ + NVSNPILI
Sbjct  244  LGRYTIEEPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVSNPILI  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS +K+ ++SFK I GTS  K AV+LLCS GVPC  V +  + L Y
Sbjct  304  DQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKGVPCTNVEVGDIDLRY  363

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  EC NV P LSG   P  C
Sbjct  364  GGADGPATFECSNVTPKLSGTQFPKAC  390



>ref|XP_003522977.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  245  LGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  305  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G   +A ++C NVKPT++GK
Sbjct  365  NG--AAATAKCANVKPTITGK  383



>ref|XP_003522976.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  245  LGKYDSEEPVAGFLVKNCTLNGTDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  305  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQEGVVLVCSSGVPCEGVEMADIDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G   +A ++C NVKPT++GK
Sbjct  365  NG--AAATAKCANVKPTITGK  383



>ref|XP_003522975.1| PREDICTED: polygalacturonase-like [Glycine max]
Length=389

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y +E+PV G  VK+C L+ T NGVRIKTWP +P  +  + MHFED+ M+NV+NPI+I
Sbjct  245  LGKYDSEEPVAGFLVKNCTLNETDNGVRIKTWPNTPGAITITDMHFEDLTMNNVTNPIII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS ++  V L+CSSGVPC  V ++ + L +
Sbjct  305  DQEYCPWNQCSKQNPSKIKISKVSFKNIKGTSGSQDGVVLVCSSGVPCEGVEMADIDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G   +A ++C NVKPT++GK
Sbjct  365  NG--AAATAKCANVKPTITGK  383



>ref|XP_006492955.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  259  LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  318

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  319  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  378

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  379  GIDDKGPAISSCSNVKPTLVGKQIPATC  406



>emb|CDY71093.1| BnaCnng71300D, partial [Brassica napus]
Length=257

 Score =   160 bits (404),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG Y +E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILI
Sbjct  101  LGLYGHEEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILI  160

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y
Sbjct  161  DQEYCPWNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITY  220

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L GK  P  C
Sbjct  221  NGKDGPATFQCSNVSPKLVGKQCPKAC  247



>ref|XP_006495222.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=407

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  259  LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  318

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  319  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  378

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  379  GIDDKGPAISSCSNVKPTLVGKQIPATC  406



>gb|ABE77145.1| putative polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 107/147 (73%), Gaps = 2/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LI
Sbjct  256  LGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLI  315

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPW QC   +PSK+KI++VSFK I GT++T  A+K++C+ G+ C++VVLS + L+ 
Sbjct  316  DQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKL  375

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S C NV+PT++    P  C
Sbjct  376  SG-KGTLTSHCANVQPTITRVPPPLAC  401



>ref|XP_006489998.1| PREDICTED: exopolygalacturonase-like [Citrus sinensis]
Length=402

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y  E+ V+G+TV +C  + T NGVRIKTWP S +G AS   FED+ M+NV NPI+ID
Sbjct  254  LGKYKKEEDVVGLTVINCTFTGTSNGVRIKTWPDSEDGKASNFTFEDLFMNNVENPIVID  313

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q+YCP NQC   VPS++KI++V F+ I GTS TK AV+++CS  +PC  V +  + L Y 
Sbjct  314  QEYCPHNQCNIKVPSRVKISNVRFRNIRGTSLTKEAVRIVCSKEIPCQNVEIGDINLVYN  373

Query  594  GTN--GSAISECDNVKPTLSGKNSPAIC  517
            G +  G AIS C NVKPTL GK  PA C
Sbjct  374  GIDDKGPAISSCSNVKPTLVGKQIPATC  401



>ref|XP_004293444.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=405

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 107/147 (73%), Gaps = 2/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+NV+NP+LI
Sbjct  256  LGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNNVANPVLI  315

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPW QC   +PSK+KI++VSFK I GT++T  A+K++C+ G+ C++VVLS + L+ 
Sbjct  316  DQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKL  375

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S C NV+PT++    P  C
Sbjct  376  SG-KGTLTSHCANVQPTIARVPPPLAC  401



>ref|XP_008222765.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   164 bits (414),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LGRY  E+ V G+ VK+C L+NT NGVRIKTWP SP+   AS +H+E++ M NVSNPILI
Sbjct  249  LGRYKEEKAVTGIIVKNCTLTNTQNGVRIKTWPDSPSSSTASDIHYENIIMVNVSNPILI  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ +C    PSK+KIN+VSFK I G+S T +AVKL+CS G+PC  V L+ + L Y
Sbjct  309  DQLYCPYTRCDQKPPSKVKINNVSFKNIKGSSFTPLAVKLVCSRGLPCENVKLTDIDLTY  368

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G   S C NVKPT++G      C
Sbjct  369  GGDQGPLTSLCSNVKPTITGMKKALAC  395



>ref|XP_007143497.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
 gb|ESW15491.1| hypothetical protein PHAVU_007G0766000g, partial [Phaseolus vulgaris]
Length=247

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 99/145 (68%), Gaps = 4/145 (3%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LG+Y  E+PV G+TVK C L  T NGVRIKTWP  P  +  + M FED+ MDNV NP++I
Sbjct  61   LGKYKEEEPVEGITVKGCTLKGTTNGVRIKTWPNEPGTITVNDMKFEDITMDNVQNPVII  120

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP NQC  G PSK+KI+ VS K I GTSATK  + L CSSGVPC  V +  V L Y
Sbjct  121  DQEYCPNNQCSKGTPSKVKISKVSIKGIKGTSATKEGIILACSSGVPCEGVEIGDVTLTY  180

Query  597  KGTNGSAISECDNVKPTLSGKNSPA  523
             G   +A   C NVKPT++GK +PA
Sbjct  181  NGAPVTAT--CTNVKPTITGK-APA  202



>ref|XP_004490643.1| PREDICTED: polygalacturonase-like [Cicer arietinum]
Length=394

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPA-SPNGVASGMHFEDVKMDNVSNPILI  778
            LG+YPNE PV+ + VK+C L+NT NGVRIKTWP  S   +AS +HFED+ M NVSNPI+I
Sbjct  247  LGKYPNEDPVVDLIVKNCTLNNTDNGVRIKTWPGTSVISIASHLHFEDIVMVNVSNPIII  306

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQQYCPWNQC    PSKIKI  V FK I GTSAT+  V L+CS GVPC  VVLS + L +
Sbjct  307  DQQYCPWNQCSKQSPSKIKIRKVIFKNIRGTSATQEGVSLICSRGVPCEAVVLSDINLSF  366

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G+  +A  +C NV P +  K
Sbjct  367  NGSEVTA--KCANVNPKIRRK  385



>ref|XP_009134996.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 emb|CDX74029.1| BnaA03g30180D [Brassica napus]
Length=395

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY NEQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILI
Sbjct  240  LGRYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  SGADGPATFQCSNVSPKLMGTQSPKAC  386



>gb|ABN13878.1| polygalacturonase [Brassica rapa subsp. oleifera]
Length=395

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY NEQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILI
Sbjct  240  LGRYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIILKNVMNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  SGADGPATFQCSNVSPKLMGTQSPKAC  386



>emb|CDY54512.1| BnaC07g49180D [Brassica napus]
Length=397

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG Y  E+ V G+ V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILI
Sbjct  241  LGLYVKEEDVTGIRVVNCTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILI  300

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y
Sbjct  301  DQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVEIGDINIQY  360

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV PTL G   P  C
Sbjct  361  TGADGPATFQCSNVSPTLMGTQVPKAC  387



>ref|XP_008231346.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231347.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231348.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
 ref|XP_008231349.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y +E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+H+ED+ M NVSNPIL+
Sbjct  249  LGKYKDEKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILV  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ QC+   PSK+KI++VSFK I G+S T +AVKL+C++G+PC  V L+ + L Y
Sbjct  309  DQLYCPYTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTY  368

Query  597  KGTNGSAISECDNVKPTLSG  538
             G  G   S C NVKPT++G
Sbjct  369  GGDKGPLTSMCSNVKPTITG  388



>gb|ABG38468.1| pollen-expressed protein MF9c [Brassica oleracea]
Length=395

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY NEQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILI
Sbjct  240  LGRYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  SGADGPATFQCSNVSPKLMGTQSPKAC  386



>emb|CDY07974.1| BnaC03g35490D [Brassica napus]
Length=395

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY NEQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILI
Sbjct  240  LGRYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  NGADGPATFQCSNVSPKLMGTQSPKAC  386



>gb|ABL63521.1| pollen-specific protein MF9l [Brassica oleracea var. alboglabra]
Length=395

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY NEQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NV NPILI
Sbjct  240  LGRYGNEQDVSGIRVINCTLQQTDNGLRIKTWPSAACSTTASDIHFENIIVKNVMNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLANISFKQIRGTSGNKDAVKLLCSRGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  NGADGPATFQCSNVSPKLMGTQSPKAC  386



>ref|XP_004253347.1| PREDICTED: polygalacturonase-like [Solanum lycopersicum]
Length=403

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 0/146 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG  P E+PV+GV VK+C L +T NGVRIKTWPAS  GV S +HFED+ + NVSNPI+ID
Sbjct  244  LGGNPGEKPVVGVFVKNCTLVSTDNGVRIKTWPASHPGVVSDIHFEDIIVQNVSNPIVID  303

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCP  +C   +PS++KI+ VS + I GTS T+ A+ L CS G PC  V +  V + Y 
Sbjct  304  QVYCPSGKCNKDLPSQVKISKVSIQNIKGTSRTQNAISLTCSKGSPCEGVEVGDVDISYS  363

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G  G A S C+N+KPT  GK +PA+C
Sbjct  364  GKEGPAKSSCENIKPTFKGKQTPAVC  389



>gb|KHN46909.1| Polygalacturonase [Glycine soja]
Length=390

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+YP E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++I
Sbjct  244  LGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVII  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ V+FK I GTS TK  V L+CS GVPC  V L+ V L +
Sbjct  304  DQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTF  363

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G     +++C NVKP ++GK     C
Sbjct  364  NG--APIVAKCANVKPIVTGKAPACTC  388



>ref|XP_003544118.1| PREDICTED: polygalacturonase-like isoform X1 [Glycine max]
Length=392

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+YP E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++I
Sbjct  246  LGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVII  305

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ V+FK I GTS TK  V L+CS GVPC  V L+ V L +
Sbjct  306  DQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTF  365

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G     +++C NVKP ++GK     C
Sbjct  366  NG--APIVAKCANVKPIVTGKAPACTC  390



>ref|XP_002526193.1| hypothetical protein RCOM_0764760 [Ricinus communis]
 gb|EEF36197.1| hypothetical protein RCOM_0764760 [Ricinus communis]
Length=392

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 95/137 (69%), Gaps = 0/137 (0%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG+Y NE+PV GV VK C L NT NG+RIK+WP   +G A+ +HFED+ M+NVSN ILID
Sbjct  246  LGKYKNEEPVSGVYVKKCDLINTTNGIRIKSWPGLYSGTATDLHFEDISMNNVSNAILID  305

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            Q YCPWN C +   S +KI+ V+F  I GTS+    VKLLCS G+PC  V L+ + + YK
Sbjct  306  QMYCPWNHCNSKASSNVKISKVTFSNIKGTSSIPTIVKLLCSKGLPCEGVELNNINVVYK  365

Query  594  GTNGSAISECDNVKPTL  544
            G  G A SEC NVKP +
Sbjct  366  GPEGPAKSECTNVKPKI  382



>ref|XP_008462134.1| PREDICTED: exopolygalacturonase-like [Cucumis melo]
Length=508

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 106/156 (68%), Gaps = 9/156 (6%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V GV VK CKL NT NGVRIKTWP S +   AS +HFED++M NVSNPI+I
Sbjct  242  LGKYTKEREVTGVAVKSCKLINTWNGVRIKTWPDSASAYTASDLHFEDIEMVNVSNPIII  301

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            +Q+YC  NQC   +PSKIKI +VSFK I GTSAT VAVK +CS  +PC  V ++ + L Y
Sbjct  302  NQEYCSSNQCNNKIPSKIKILNVSFKNIRGTSATSVAVKFICSKDLPCEGVEVADIDLAY  361

Query  597  KGTNG--------SAISECDNVKPTLSGKNSPAICD  514
             G  G        S +S+C NVK T++GK +P + D
Sbjct  362  NGVEGQTTSHCWKSIVSQCANVKYTVTGKQNPQLDD  397



>ref|XP_006595658.1| PREDICTED: polygalacturonase-like isoform X2 [Glycine max]
Length=386

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 3/147 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+YP E+PV  + VK+C L+NT NGVRIKTWP+SP     + MHFED+ M +V NP++I
Sbjct  240  LGKYPEEEPVEQLLVKNCTLTNTDNGVRIKTWPSSPGASPITDMHFEDITMVDVMNPVII  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ V+FK I GTS TK  V L+CS GVPC  V L+ V L +
Sbjct  300  DQEYCPWNQCSKQAPSKIKISKVTFKNIQGTSKTKEGVTLICSKGVPCEDVELNNVALTF  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G     +++C NVKP ++GK     C
Sbjct  360  NG--APIVAKCANVKPIVTGKAPACTC  384



>sp|P35337.1|PGLR_BRANA RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Brassica napus]
 gb|AAA70402.1| polygalacturonase [Brassica napus]
Length=397

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY  EQ V  +TVK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILI
Sbjct  240  LGRYGWEQDVTDITVKNCTLEGTSNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY
Sbjct  300  DQEYCPWNQCNKNKPSTIKLVDITFRNIRGTSENKDAVKLLCSKGHPCENVEIGDINIEY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G    EC NV P L G  +P  C
Sbjct  360  TGPDGPPTFECTNVTPKLVGAQNPKAC  386



>ref|XP_008231357.1| PREDICTED: exopolygalacturonase-like, partial [Prunus mume]
Length=308

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y +E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+ +ED+ M NVSNPIL+
Sbjct  149  LGKYKDEKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIRYEDIIMVNVSNPILV  208

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ QC+   PSK+KI++VSFK I G+S T +AVKL+C++G+PC  V L+ + L Y
Sbjct  209  DQLYCPYTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELTDIDLTY  268

Query  597  KGTNGSAISECDNVKPTLSG  538
             G  G   S C NVKPT++G
Sbjct  269  GGDKGPLTSMCSNVKPTITG  288



>ref|XP_008466943.1| PREDICTED: polygalacturonase-like, partial [Cucumis melo]
Length=211

 Score =   156 bits (394),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNG-VASGMHFEDVKMDNVSNPILI  778
            LG+Y  E+ V+GVTVK CK+ NT NGVRIKTWP S    +AS MHFED++M+NVSNPI+I
Sbjct  101  LGKYTKEKDVVGVTVKACKIFNTTNGVRIKTWPDSAVAFMASDMHFEDIEMENVSNPIII  160

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKV  625
            DQ+YCPWNQC   VPSKIKI++VSFK I GTSAT VAVKL+CS  +PC  V
Sbjct  161  DQEYCPWNQCNRKVPSKIKISNVSFKNIRGTSATPVAVKLVCSKSIPCEGV  211



>gb|KFK38252.1| hypothetical protein AALP_AA3G089100 [Arabis alpina]
Length=394

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVASGMHFEDVKMDNVSNPILI  778
            LGRY  EQ V G+TVK+C L +T NG+RIKTWP+S  +  AS +HFED+ + +VSNPILI
Sbjct  240  LGRYGMEQDVSGITVKNCTLQSTDNGLRIKTWPSSACSTTASDIHFEDIILKDVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + + Y
Sbjct  300  DQEYCPWNQCNKQKSSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIRY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P + G   P  C
Sbjct  360  NGADGPATFQCSNVSPKIMGTQIPKAC  386



>ref|XP_009365183.1| PREDICTED: exopolygalacturonase-like [Pyrus x bretschneideri]
Length=401

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVA-SGMHFEDVKMDNVSNPIL  781
            LGR  +E+PV G+ +K+C +SNT NGVRIKTWPASP  G A S +HFED+ MDNV NP++
Sbjct  250  LGRTEDEEPVSGIFIKNCTISNTDNGVRIKTWPASPAKGTAVSDVHFEDIIMDNVKNPVV  309

Query  780  IDQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLE  601
            IDQ+YCP   C   V SK+KI++VSFK I G+S+  V VKLLCS  +PC  V LS + L 
Sbjct  310  IDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLT  369

Query  600  YKGTNGSAISECDNVKPTLSGKNSPAIC  517
            Y G  GS  SEC +VKPT++    P  C
Sbjct  370  YTGDKGSLTSECKHVKPTINNVAKPLAC  397



>ref|XP_008245812.1| PREDICTED: exopolygalacturonase-like [Prunus mume]
Length=408

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+Y +E+ V G+ VK+C L+NT NGVRIKT+P SP+   ASG+H+ED+ M NVSNPIL+
Sbjct  249  LGKYKDEKDVTGIIVKNCTLTNTDNGVRIKTFPDSPSPSTASGIHYEDIIMVNVSNPILV  308

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ YCP+ QC+   PSK+KI++VSFK I G+S T +AVKL+C++G+PC  V L  + L Y
Sbjct  309  DQLYCPYTQCEQKPPSKVKISNVSFKNIKGSSFTPLAVKLVCTTGIPCENVELIDIDLTY  368

Query  597  KGTNGSAISECDNVKPTLSG  538
             G  G   S C NVKPT++G
Sbjct  369  GGDKGPLTSMCSNVKPTIAG  388



>gb|AAP37458.1| polygalacturonase [Fragaria x ananassa]
Length=405

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY NE  V G+ ++ C LSNTLNGVRIKT+PASP    AS +HFE + M+ V+NP+LI
Sbjct  256  LGRYDNEDDVSGLNIRDCTLSNTLNGVRIKTFPASPKATTASDIHFEKITMNYVANPVLI  315

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPW QC   +PSK+KI++VSFK I GT++T  A+K++C+ G+ C++VVLS + L+ 
Sbjct  316  DQEYCPWGQCNKQIPSKVKISNVSFKNIIGTTSTAEALKIVCAKGLHCDQVVLSDIDLKL  375

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G  G+  S C NV+PT++    P  C
Sbjct  376  SG-KGTLTSHCANVQPTITRVPPPLAC  401



>dbj|BAC42591.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAO63309.1| At3g07830 [Arabidopsis thaliana]
Length=225

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILI
Sbjct  69   LGRYGHEQDVSGIRVINCTLQETDNGLRIKTWPSAACSTTASNIHFENIILRNVSNPILI  128

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ ++SF+ I GTS  K AVKLLCS G PC  V +  + ++Y
Sbjct  129  DQEYCPWNQCNKQKSSSIKLANISFRRIRGTSGNKDAVKLLCSKGYPCENVQVGDINIQY  188

Query  597  KGTNGSAISECDNVKPTLSGKNSPAICD  514
             G +G A   C NV+P L G   P  C+
Sbjct  189  TGADGPATFMCSNVRPKLVGTQFPKACN  216



>ref|XP_006407792.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49245.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=382

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +E+ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILI
Sbjct  226  LGRYGHEEDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILI  285

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC KV +  + + Y
Sbjct  286  DQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAY  345

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  346  SGADGPATFQCSNVSPQLLGSQSPKAC  372



>ref|XP_006407793.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
 gb|ESQ49246.1| hypothetical protein EUTSA_v10020872mg [Eutrema salsugineum]
Length=396

 Score =   160 bits (406),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +E+ V G+ V +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILI
Sbjct  240  LGRYGHEEDVSGIRVVNCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC KV +  + + Y
Sbjct  300  DQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQKVEIGDIDIAY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  SGADGPATFQCSNVSPQLLGSQSPKAC  386



>ref|XP_010548800.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LGRY NE PV G+ +K+C L  T NG+RIKT+P+S + +  S +HFED+ + NV NPILI
Sbjct  244  LGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVFNPILI  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS +K+ ++SFK I GTS  K AV+LLCS  VPC  V +  + L Y
Sbjct  304  DQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGDIDLRY  363

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P LSG   P  C
Sbjct  364  GGADGPATFQCSNVTPKLSGTQFPKAC  390



>ref|XP_010548798.1| PREDICTED: polygalacturonase-like [Tarenaya hassleriana]
Length=401

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LGRY NE PV G+ +K+C L  T NG+RIKT+P+S + +  S +HFED+ + NV NPILI
Sbjct  244  LGRYTNEGPVAGIWIKNCTLQETDNGLRIKTYPSSASSITVSDIHFEDIIVKNVFNPILI  303

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS +K+ ++SFK I GTS  K AV+LLCS  VPC  V +  + L Y
Sbjct  304  DQEYCPWNKCNKAKPSTVKLVNISFKRIRGTSGNKDAVRLLCSKAVPCTNVEVGDIDLRY  363

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P LSG   P  C
Sbjct  364  GGADGPATFQCSNVTPKLSGTQFPKAC  390



>ref|XP_010464425.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NV+NPILI
Sbjct  240  LGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIILKNVNNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSRGYPCQNVEIGNVDIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P LSG  +P  C
Sbjct  360  TGADGPATFQCSNVSPKLSGIQNPKAC  386



>emb|CDY05701.1| BnaC02g38360D [Brassica napus]
Length=397

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG Y +E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILI
Sbjct  241  LGLYGHEEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILQNVSNPILI  300

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y
Sbjct  301  DQEYCPWNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITY  360

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L GK  P  C
Sbjct  361  NGKDGPATFQCSNVSPKLVGKQCPKAC  387



>ref|XP_009129707.1| PREDICTED: polygalacturonase-like [Brassica rapa]
 ref|XP_009102886.1| PREDICTED: polygalacturonase-like [Brassica rapa]
Length=397

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG Y +E+ V GV V +C L NT NGVRIKTWP A+ +  ASG+HFE++ + NVSNPILI
Sbjct  241  LGLYGHEEDVTGVKVVNCTLRNTDNGVRIKTWPSAACSTTASGIHFENIILHNVSNPILI  300

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS IK+ D+ FK I G+S  K AVKLLCS G PC  V +  + + Y
Sbjct  301  DQEYCPWNRCNKNKPSSIKLVDIKFKNIKGSSGNKDAVKLLCSKGFPCKNVEIGDIDITY  360

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L GK  P  C
Sbjct  361  NGKDGPATFQCSNVSPKLVGKQCPKAC  387



>sp|Q39786.1|PGLR_GOSHI RecName: Full=Polygalacturonase; Short=PG; AltName: Full=Pectinase; 
Flags: Precursor [Gossypium hirsutum]
 gb|AAA82167.1| polygalacturonase [Gossypium hirsutum]
Length=407

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/146 (51%), Positives = 101/146 (69%), Gaps = 1/146 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVASGMHFEDVKMDNVSNPILID  775
            LG++ NE+PV G+ + +C ++NT NG RIKTWP    G  S +HFED+ M+NVS+PILID
Sbjct  251  LGKFQNEEPVEGIKISNCTITNTSNGARIKTWPGEHGGAVSEIHFEDITMNNVSSPILID  310

Query  774  QQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEYK  595
            QQYCPWN+CK    SK+K++++SFK I GTSA   A+K +CS   PC  V L+ + +++ 
Sbjct  311  QQYCPWNKCKKNEESKVKLSNISFKNIRGTSALPEAIKFICSGSSPCQNVELADIDIKHN  370

Query  594  GTNGSAISECDNVKPTLSGKNSPAIC  517
            G    A S+C NVKP  SGK +P  C
Sbjct  371  GAE-PATSQCLNVKPITSGKLNPIPC  395



>ref|XP_003527123.1| PREDICTED: polygalacturonase-like [Glycine max]
 gb|KHN05204.1| Polygalacturonase [Glycine soja]
Length=389

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 101/141 (72%), Gaps = 3/141 (2%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGVA-SGMHFEDVKMDNVSNPILI  778
            LGRY NE+ V G+ VK+C L+NT NG+RIKTWP++P  +  + MHFED+ M+NVSNP++I
Sbjct  245  LGRYDNEEAVEGLLVKNCTLNNTDNGLRIKTWPSTPLTITVTDMHFEDITMENVSNPVII  304

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PSKIKI+ VSFK I GTS TK  V  +CSS  PC  V ++ V L +
Sbjct  305  DQEYCPWNQCSKKNPSKIKISKVSFKNIKGTSGTKEGVIFICSSVAPCEGVEMTDVDLTF  364

Query  597  KGTNGSAISECDNVKPTLSGK  535
             G   +  ++C NVKP ++GK
Sbjct  365  NG--AATTAKCANVKPVITGK  383



>ref|XP_010458152.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NVSNPILI
Sbjct  240  LGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  +P  C
Sbjct  360  TGADGPATFQCSNVSPKLLGTQNPKAC  386



>ref|XP_002884668.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60927.1| polygalacturonase 3 [Arabidopsis lyrata subsp. lyrata]
Length=391

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HFED+ + NVSNPILI
Sbjct  240  LGRYGHEQDVSGIKIINCTLQETDNGLRIKTWPSAACSTTASDIHFEDIIVKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK+ ++SFK I GTS  K AVKLLCS G PC  V +  + ++Y
Sbjct  300  DQEYCPWNQCNKQKASTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGDIDIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  SP  C
Sbjct  360  NGADGPATFQCSNVSPKLLGSQSPKAC  386



>ref|XP_008366919.1| PREDICTED: LOW QUALITY PROTEIN: exopolygalacturonase-like [Malus 
domestica]
Length=447

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPN-GVASGMHFEDVKMDNVSNPILI  778
            LG+YP+E+PV+GV VK+C L+NT NGVRIKTWP SP    AS +HF+ + M NVSNPI I
Sbjct  271  LGKYPDEEPVVGVRVKNCTLTNTQNGVRIKTWPGSPTFTTASHIHFQXIXMVNVSNPISI  330

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP+  C    PSK+KI+D+SF  I G+SAT VAVKL+CS  +PC+ V L+ V L Y
Sbjct  331  DQEYCPYTYCGKDDPSKVKISDISFTNIKGSSATPVAVKLMCSRKIPCDGVGLTDVDLTY  390

Query  597  KGTNGSAISECDNVKPTLS  541
             G+ G   S+C  VKP ++
Sbjct  391  IGSKGPLTSQCAYVKPYIT  409



>ref|XP_004295347.1| PREDICTED: polygalacturonase-like [Fragaria vesca subsp. vesca]
Length=412

 Score =   160 bits (405),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LG+Y NE+PV G+ VK+C +S T NGVR+KTWP  P+ + AS +HFED+ MDNV NPI++
Sbjct  252  LGKYDNEEPVAGIFVKNCTISKTQNGVRVKTWPNGPSAITASDIHFEDIIMDNVQNPIVL  311

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCP++QC     SKIKI++VSFK I GTSAT + VK+ CS   PC++VV+S + L+ 
Sbjct  312  DQEYCPYDQCDKSASSKIKISNVSFKNIRGTSATALGVKVACSKSNPCDQVVMSDIDLKL  371

Query  597  KGTNGSAISECDNVKPTLS  541
             G  G   S+C N KPT++
Sbjct  372  SGA-GELTSQCTNTKPTIT  389



>emb|CDY22139.1| BnaC01g39620D [Brassica napus]
Length=359

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY  EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILI
Sbjct  202  LGRYGWEQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILI  261

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY
Sbjct  262  DQEYCPWNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEY  321

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G    EC NV P L G  +P  C
Sbjct  322  TGPDGPPTFECTNVTPKLVGTQNPKAC  348



>ref|XP_010486355.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=396

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ V G+ + +C L  T NG+RIKTWP A+ +  AS +HF+D+ + NVSNPILI
Sbjct  240  LGRYGHEQDVSGIRIINCTLQQTDNGLRIKTWPSAACSTTASDIHFQDIIVKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK I GTS  K AVKLLCS G PC  V +  V ++Y
Sbjct  300  DQEYCPWNQCNKQKPSTIKLVNISFKNIRGTSGNKDAVKLLCSKGYPCQNVEIGNVDIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G  +P  C
Sbjct  360  TGADGPATFQCSNVSPKLLGTQNPKAC  386



>ref|XP_010442229.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ VMG+ + +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILI
Sbjct  240  LGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK++ +SFK I GTS  K AVKLLCS G PC  V L  + ++Y
Sbjct  300  DQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G++G A  +C NV P L G   P  C
Sbjct  360  TGSDGPATFQCSNVSPKLMGTQVPKAC  386



>ref|XP_006395214.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
 gb|ESQ32500.1| hypothetical protein EUTSA_v10004361mg [Eutrema salsugineum]
Length=396

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASPNGV-ASGMHFEDVKMDNVSNPILI  778
            LGRY +E+ V G+ V +C L NT NGVRIKTWP++     AS +HFE++ + NVSNPILI
Sbjct  239  LGRYGHEEDVTGIRVVNCTLQNTDNGVRIKTWPSAKCATTASEIHFENILLKNVSNPILI  298

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ ++SFK+I GTS  K AVKLLCS G PC  V +  + ++Y
Sbjct  299  DQEYCPWNQCNKQKPSTIKLVNISFKKIRGTSGNKDAVKLLCSKGYPCKNVEIGDINIKY  358

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A   C NV P L G   P  C
Sbjct  359  TGADGPATFSCSNVSPKLKGTQVPKAC  385



>ref|XP_008381794.1| PREDICTED: exopolygalacturonase-like [Malus domestica]
Length=401

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 2/148 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWPASP-NGVA-SGMHFEDVKMDNVSNPIL  781
            LGR  +E+PV G+ +K+C ++NT NGVRIKTWPASP  G A S +HF+D+ MDNV NP++
Sbjct  250  LGRTEDEEPVSGIFIKNCTITNTDNGVRIKTWPASPAKGTAVSDVHFZDIIMDNVKNPVV  309

Query  780  IDQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLE  601
            IDQ+YCP   C   V SK+KI++VSFK I G+S+  V VKLLCS  +PC  V LS + L 
Sbjct  310  IDQEYCPHKLCTPEVSSKVKISNVSFKNIKGSSSGPVGVKLLCSGKLPCENVELSNIDLT  369

Query  600  YKGTNGSAISECDNVKPTLSGKNSPAIC  517
            Y G  GS  SEC +VKPT++    P  C
Sbjct  370  YTGDKGSITSECKHVKPTINNVAKPLAC  397



>emb|CDY22140.1| BnaC01g39610D [Brassica napus]
Length=397

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 97/147 (66%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY  EQ V  + VK+C L  T NG+RIKTWP A+    A+G+HFED+ ++ VSNPILI
Sbjct  240  LGRYGWEQDVTDINVKNCTLEGTDNGLRIKTWPSAACTTTAAGIHFEDIILNKVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC    PS IK+ D++F+ I GTS  K AVKLLCS G PC  V +  + +EY
Sbjct  300  DQEYCPWNQCNKNKPSTIKLVDITFRNIRGTSGNKDAVKLLCSKGHPCENVEIGDINIEY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G    EC NV P L G  +P  C
Sbjct  360  TGPDGPPTFECTNVTPKLVGTQNPKAC  386



>ref|XP_010439352.1| PREDICTED: polygalacturonase-like [Camelina sativa]
Length=395

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LGRY +EQ VMG+ + +C L  T NG+RIKTWP A+ +  AS +HFE++ + NVSNPILI
Sbjct  240  LGRYGHEQDVMGIKIVNCTLQETDNGLRIKTWPTAACSTSASDIHFENILLKNVSNPILI  299

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWNQC     S IK++ +SFK I GTS  K AVKLLCS G PC  V L  + ++Y
Sbjct  300  DQEYCPWNQCDKKKASTIKLSKISFKNIRGTSGNKDAVKLLCSKGHPCQNVELGNINIKY  359

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV P L G   P  C
Sbjct  360  TGADGPATFQCSNVSPKLMGTQVPKAC  386



>emb|CDX86325.1| BnaA06g30420D [Brassica napus]
Length=397

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -1

Query  954  LGRYPNEQPVMGVTVKHCKLSNTLNGVRIKTWP-ASPNGVASGMHFEDVKMDNVSNPILI  778
            LG Y  E+ V G+ V +  L NT NGVRIKTWP A+ +  ASG+HFE++ + NV+NPILI
Sbjct  241  LGLYVKEEDVTGIRVVNSTLINTDNGVRIKTWPSAACSTTASGIHFENIILKNVTNPILI  300

Query  777  DQQYCPWNQCKTGVPSKIKINDVSFKEITGTSATKVAVKLLCSSGVPCNKVVLSGVKLEY  598
            DQ+YCPWN+C    PS IK+ D+SFK I GTS  K AVKLLCS G PC  V +  + ++Y
Sbjct  301  DQEYCPWNRCNKNKPSTIKLVDISFKHIRGTSGNKDAVKLLCSKGFPCKNVQIGDIDIKY  360

Query  597  KGTNGSAISECDNVKPTLSGKNSPAIC  517
             G +G A  +C NV PTL G   P  C
Sbjct  361  TGADGPATFQCSNVSPTLMGTQVPKAC  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280