BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25849_g1_i4 len=2746 path=[25640:0-156 7325:157-231 7400:232-256
25906:257-423 19504:424-515 26164:516-541 26190:542-633
26280:634-641 26288:642-755 26401:756-768 20870:769-1021
26662:1022-1066 26707:1067-1132 26772:1133-1152 22056:1153-1202
26840:1203-1226 21494:1227-1318 20958:1319-1375 27011:1376-1382
27018:1383-1514 27148:1515-1533 27167:1534-1570 27204:1571-1576
27210:1577-1617 37494:1618-1674 27306:1675-1680 27312:1681-1730
27362:1731-1753 27385:1754-1874 27504:1875-1884 27514:1885-1963
27593:1964-2006 27636:2007-2077 27706:2078-2100 @21590@!:2101-2353
27978:2354-2745]

Length=2746
                                                                      Score     E

ref|XP_009775444.1|  PREDICTED: GPI transamidase component PIG-S ...    819   0.0      
ref|XP_006340007.1|  PREDICTED: GPI transamidase component PIG-S-...    818   0.0      
ref|XP_009610376.1|  PREDICTED: GPI transamidase component PIG-S ...    818   0.0      
ref|XP_004247074.1|  PREDICTED: GPI transamidase component PIG-S ...    803   0.0      
ref|XP_011098455.1|  PREDICTED: GPI transamidase component PIG-S        761   0.0      
ref|XP_009610377.1|  PREDICTED: GPI transamidase component PIG-S ...    759   0.0      
gb|EYU40618.1|  hypothetical protein MIMGU_mgv1a003001mg                757   0.0      
emb|CDP03894.1|  unnamed protein product                                749   0.0      
ref|XP_010326289.1|  PREDICTED: uncharacterized protein LOC101252...    746   0.0      
ref|XP_010326290.1|  PREDICTED: uncharacterized protein LOC101252...    744   0.0      
ref|XP_008358453.1|  PREDICTED: GPI transamidase component PIG-S-...    744   0.0      
ref|XP_009370673.1|  PREDICTED: GPI transamidase component PIG-S-...    744   0.0      
ref|XP_007199759.1|  hypothetical protein PRUPE_ppa003075mg             744   0.0      
ref|XP_009334908.1|  PREDICTED: GPI transamidase component PIG-S-...    743   0.0      
ref|XP_002268712.1|  PREDICTED: GPI transamidase component PIG-S        742   0.0      Vitis vinifera
ref|XP_008235456.1|  PREDICTED: GPI transamidase component PIG-S        741   0.0      
ref|XP_010247099.1|  PREDICTED: GPI transamidase component PIG-S        724   0.0      
ref|XP_004138391.1|  PREDICTED: GPI transamidase component PIG-S-...    711   0.0      
ref|XP_008456783.1|  PREDICTED: GPI transamidase component PIG-S ...    707   0.0      
ref|XP_004491711.1|  PREDICTED: GPI transamidase component PIG-S-...    705   0.0      
ref|XP_010104188.1|  hypothetical protein L484_007028                   705   0.0      
gb|KDP26366.1|  hypothetical protein JCGZ_17524                         700   0.0      
ref|XP_010685048.1|  PREDICTED: GPI transamidase component PIG-S-...    700   0.0      
ref|XP_011024639.1|  PREDICTED: GPI transamidase component PIG-S        696   0.0      
ref|XP_010036801.1|  PREDICTED: GPI transamidase component PIG-S        693   0.0      
gb|KEH22621.1|  GPI transamidase component PIG-S, related protein       692   0.0      
ref|XP_004160758.1|  PREDICTED: GPI transamidase component PIG-S-...    692   0.0      
ref|XP_003551396.1|  PREDICTED: GPI transamidase component PIG-S-...    686   0.0      
ref|XP_004290191.1|  PREDICTED: GPI transamidase component PIG-S-...    686   0.0      
emb|CBI18338.3|  unnamed protein product                                682   0.0      
ref|XP_007140652.1|  hypothetical protein PHAVU_008G130400g             679   0.0      
ref|XP_002303053.2|  GPI transamidase component PIG-S-related fam...    677   0.0      Populus trichocarpa [western balsam poplar]
gb|KHN41386.1|  GPI transamidase component PIG-S                        676   0.0      
ref|XP_006443579.1|  hypothetical protein CICLE_v10019403mg             671   0.0      
ref|XP_009775445.1|  PREDICTED: uncharacterized protein LOC104225...    668   0.0      
ref|XP_009610378.1|  PREDICTED: GPI transamidase component PIG-S ...    668   0.0      
ref|XP_003530854.1|  PREDICTED: GPI transamidase component PIG-S-...    666   0.0      
ref|XP_007049729.1|  GPI transamidase component PIG-S-related           665   0.0      
ref|XP_002521070.1|  conserved hypothetical protein                     666   0.0      Ricinus communis
ref|XP_010547097.1|  PREDICTED: GPI transamidase component PIG-S        633   0.0      
gb|KHG09836.1|  GPI transamidase component PIG-S                        630   0.0      
gb|EPS64887.1|  hypothetical protein M569_09890                         625   0.0      
ref|XP_010486259.1|  PREDICTED: GPI transamidase component PIG-S-...    624   0.0      
ref|XP_010449609.1|  PREDICTED: GPI transamidase component PIG-S-...    622   0.0      
ref|XP_010464327.1|  PREDICTED: GPI transamidase component PIG-S-...    622   0.0      
ref|XP_006407861.1|  hypothetical protein EUTSA_v10020331mg             620   0.0      
ref|XP_002884631.1|  hypothetical protein ARALYDRAFT_896875             619   0.0      
ref|XP_008456784.1|  PREDICTED: GPI transamidase component PIG-S ...    616   0.0      
gb|KFK38171.1|  hypothetical protein AALP_AA3G078200                    616   0.0      
emb|CDY24640.1|  BnaA05g30390D                                          616   0.0      
ref|NP_187374.2|  GPI transamidase component PIG-S-related protein      613   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147102.1|  PREDICTED: GPI transamidase component PIG-S        612   0.0      
ref|XP_006297237.1|  hypothetical protein CARUB_v10013242mg             612   0.0      
emb|CDY39557.1|  BnaCnng09260D                                          606   0.0      
ref|NP_001189834.1|  GPI transamidase component PIG-S-related pro...    601   0.0      
ref|XP_010927561.1|  PREDICTED: GPI transamidase component PIG-S ...    596   0.0      
ref|XP_008797152.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    594   0.0      
ref|XP_002862513.1|  hypothetical protein ARALYDRAFT_497414             590   0.0      
ref|XP_009382913.1|  PREDICTED: GPI transamidase component PIG-S        571   0.0      
ref|XP_006850328.1|  hypothetical protein AMTR_s00020p00225970          561   0.0      
ref|XP_003564879.1|  PREDICTED: GPI transamidase component PIG-S        561   0.0      
ref|XP_006646583.1|  PREDICTED: GPI transamidase component PIG-S-...    560   0.0      
ref|NP_001045136.1|  Os01g0907300                                       557   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AAF20228.1|AC012395_15  unknown protein                              553   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ86955.1|  predicted protein                                      552   0.0      
ref|XP_002456805.1|  hypothetical protein SORBIDRAFT_03g043190          551   0.0      Sorghum bicolor [broomcorn]
emb|CDM83192.1|  unnamed protein product                                547   3e-180   
ref|NP_001169646.1|  uncharacterized protein LOC100383527               540   1e-177   Zea mays [maize]
ref|XP_004970974.1|  PREDICTED: GPI transamidase component PIG-S-...    532   2e-174   
gb|EMT19287.1|  hypothetical protein F775_28862                         493   1e-160   
ref|XP_010927563.1|  PREDICTED: GPI transamidase component PIG-S ...    489   5e-159   
dbj|BAB92563.1|  P0497A05.6                                             449   3e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010927566.1|  PREDICTED: GPI transamidase component PIG-S ...    416   1e-131   
ref|XP_010927564.1|  PREDICTED: GPI transamidase component PIG-S ...    416   1e-131   
ref|XP_002986510.1|  hypothetical protein SELMODRAFT_124120             358   6e-109   
ref|XP_002964929.1|  hypothetical protein SELMODRAFT_439141             353   1e-106   
emb|CAN78378.1|  hypothetical protein VITISV_011026                     344   8e-105   Vitis vinifera
ref|XP_001781543.1|  predicted protein                                  321   1e-92    
ref|NP_974245.1|  GPI transamidase component PIG-S-related protein      295   3e-86    Arabidopsis thaliana [mouse-ear cress]
gb|KHN10979.1|  GPI transamidase component PIG-S                        281   1e-84    
gb|EAY76889.1|  hypothetical protein OsI_04848                          283   3e-81    Oryza sativa Indica Group [Indian rice]
dbj|BAD82743.1|  GPI transamidase component PIG-S-like                  220   2e-60    Oryza sativa Japonica Group [Japonica rice]
gb|AAX09335.1|  putative phosphatidylinositol glycan class S            196   6e-55    Fragaria x ananassa
gb|EXX63719.1|  Gpi17p                                                  195   1e-51    
gb|ESA06742.1|  hypothetical protein GLOINDRAFT_82294                   194   1e-50    
gb|EXX63718.1|  Gpi17p                                                  194   1e-50    
gb|EXX63717.1|  Gpi17p                                                  194   2e-49    
gb|KFM06755.1|  GPI transamidase component PIG-S                        187   8e-48    
ref|XP_009276577.1|  PREDICTED: GPI transamidase component PIG-S        187   2e-47    
gb|EPB90456.1|  hypothetical protein HMPREF1544_02664                   184   1e-46    
ref|XP_003227327.1|  PREDICTED: GPI transamidase component PIG-S        185   3e-46    
emb|CEI98339.1|  hypothetical protein RMCBS344292_12448                 180   3e-46    
ref|XP_005526004.1|  PREDICTED: GPI transamidase component PIG-S        184   4e-46    
gb|KFR13682.1|  GPI transamidase component PIG-S                        182   5e-46    
emb|CEI98251.1|  hypothetical protein RMCBS344292_12366                 178   1e-45    
gb|KFW11937.1|  GPI transamidase component PIG-S                        181   2e-45    
ref|XP_009583865.1|  PREDICTED: GPI transamidase component PIG-S        181   2e-45    
ref|XP_009092990.1|  PREDICTED: GPI transamidase component PIG-S        182   2e-45    
ref|XP_010571939.1|  PREDICTED: GPI transamidase component PIG-S        182   2e-45    
ref|XP_005056850.1|  PREDICTED: GPI transamidase component PIG-S ...    181   7e-45    
ref|XP_005056851.1|  PREDICTED: GPI transamidase component PIG-S ...    180   9e-45    
gb|KFW86448.1|  GPI transamidase component PIG-S                        177   2e-44    
gb|EOB08427.1|  GPI transamidase component PIG-S                        177   2e-44    
gb|KFQ97046.1|  GPI transamidase component PIG-S                        178   2e-44    
ref|XP_007444162.1|  PREDICTED: GPI transamidase component PIG-S        179   2e-44    
ref|XP_009936570.1|  PREDICTED: GPI transamidase component PIG-S-...    181   2e-44    
gb|KFP82666.1|  GPI transamidase component PIG-S                        177   2e-44    
emb|CEG75172.1|  hypothetical protein RMATCC62417_10263                 176   2e-44    
gb|KFO07645.1|  GPI transamidase component PIG-S                        177   3e-44    
ref|XP_005240581.1|  PREDICTED: GPI transamidase component PIG-S        177   3e-44    
emb|CEG81534.1|  hypothetical protein RMATCC62417_15725                 178   4e-44    
ref|XP_008167230.1|  PREDICTED: GPI transamidase component PIG-S        176   6e-44    
emb|CEG81533.1|  hypothetical protein RMATCC62417_15725                 177   7e-44    
gb|KGL93425.1|  GPI transamidase component PIG-S                        176   7e-44    
ref|XP_009901702.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    177   8e-44    
gb|KFQ34302.1|  GPI transamidase component PIG-S                        176   1e-43    
ref|XP_010310364.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    176   1e-43    
ref|XP_005009955.1|  PREDICTED: GPI transamidase component PIG-S        176   1e-43    
ref|XP_010720178.1|  PREDICTED: GPI transamidase component PIG-S        175   2e-43    
ref|XP_010181345.1|  PREDICTED: GPI transamidase component PIG-S        176   2e-43    
ref|XP_005493745.1|  PREDICTED: uncharacterized protein LOC102069598    181   2e-43    
gb|KFV08773.1|  GPI transamidase component PIG-S                        174   3e-43    
ref|XP_415817.4|  PREDICTED: GPI transamidase component PIG-S           175   3e-43    Gallus gallus [bantam]
ref|XP_009883540.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    175   3e-43    
gb|KFV56129.1|  GPI transamidase component PIG-S                        170   4e-43    
ref|XP_009976073.1|  PREDICTED: GPI transamidase component PIG-S        174   7e-43    
emb|CEG75171.1|  hypothetical protein RMATCC62417_10263                 174   8e-43    
gb|KFP21197.1|  GPI transamidase component PIG-S                        173   9e-43    
ref|XP_008928818.1|  PREDICTED: GPI transamidase component PIG-S-...    177   1e-42    
ref|XP_009969001.1|  PREDICTED: GPI transamidase component PIG-S        170   1e-42    
ref|XP_002194822.1|  PREDICTED: sperm-associated antigen 5              178   2e-42    Taeniopygia guttata
emb|CEG75170.1|  hypothetical protein RMATCC62417_10263                 174   2e-42    
ref|XP_005154498.1|  PREDICTED: GPI transamidase component PIG-S        176   2e-42    
gb|KFV69518.1|  GPI transamidase component PIG-S                        172   2e-42    
gb|EMP37809.1|  GPI transamidase component PIG-S                        172   2e-42    
emb|CEG75169.1|  hypothetical protein RMATCC62417_10263                 174   2e-42    
ref|XP_009643348.1|  PREDICTED: GPI transamidase component PIG-S        172   2e-42    
ref|XP_010291837.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    172   3e-42    
ref|XP_006274286.1|  PREDICTED: GPI transamidase component PIG-S        172   4e-42    
ref|XP_009701857.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    171   5e-42    
ref|XP_009075478.1|  PREDICTED: GPI transamidase component PIG-S        171   5e-42    
ref|XP_005439956.1|  PREDICTED: GPI transamidase component PIG-S        172   7e-42    
ref|XP_003287188.1|  hypothetical protein DICPUDRAFT_54711              168   1e-41    
ref|XP_007057840.1|  PREDICTED: GPI transamidase component PIG-S        171   1e-41    
ref|XP_008042282.1|  hypothetical protein TRAVEDRAFT_172621             171   1e-41    
gb|ELU07676.1|  hypothetical protein CAPTEDRAFT_220035                  169   1e-41    
ref|XP_006463300.1|  hypothetical protein AGABI2DRAFT_208009            170   1e-41    
ref|XP_006825320.1|  PREDICTED: GPI transamidase component PIG-S-...    171   2e-41    
ref|XP_006131127.1|  PREDICTED: GPI transamidase component PIG-S        171   2e-41    
ref|XP_007332678.1|  hypothetical protein AGABI1DRAFT_108623            170   2e-41    
gb|KFP01852.1|  GPI transamidase component PIG-S                        169   3e-41    
gb|KFU87707.1|  GPI transamidase component PIG-S                        167   3e-41    
ref|XP_001507200.1|  PREDICTED: GPI transamidase component PIG-S        170   3e-41    Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008493364.1|  PREDICTED: GPI transamidase component PIG-S        169   3e-41    
ref|XP_009993417.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    167   4e-41    
gb|KFQ81338.1|  GPI transamidase component PIG-S                        168   5e-41    
emb|CDS10776.1|  hypothetical protein LRAMOSA11262                      168   7e-41    
emb|CDH48220.1|  gpi transamidase component pig-s-like                  168   1e-40    
ref|XP_006674957.1|  hypothetical protein BATDEDRAFT_7967               165   2e-40    
ref|NP_001087430.1|  phosphatidylinositol glycan anchor biosynthe...    167   3e-40    Xenopus laevis [clawed frog]
ref|NP_001106424.1|  phosphatidylinositol glycan anchor biosynthe...    167   4e-40    Xenopus tropicalis [western clawed frog]
ref|XP_009058874.1|  hypothetical protein LOTGIDRAFT_123335             166   8e-40    
ref|XP_009487271.1|  PREDICTED: GPI transamidase component PIG-S        163   9e-40    
gb|KFQ64436.1|  GPI transamidase component PIG-S                        163   1e-39    
ref|XP_001415830.1|  predicted protein                                  163   1e-39    Ostreococcus lucimarinus CCE9901
gb|KFH63482.1|  hypothetical protein MVEG_10891                         166   1e-39    
ref|XP_010007983.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    163   1e-39    
gb|KFP61112.1|  GPI transamidase component PIG-S                        162   3e-39    
ref|XP_010118137.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    158   4e-39    
gb|KFO64172.1|  GPI transamidase component PIG-S                        162   5e-39    
ref|XP_006005797.1|  PREDICTED: GPI transamidase component PIG-S ...    163   6e-39    
ref|XP_009463456.1|  PREDICTED: GPI transamidase component PIG-S        162   6e-39    
ref|XP_006005796.1|  PREDICTED: GPI transamidase component PIG-S ...    163   6e-39    
ref|XP_001375860.1|  PREDICTED: GPI transamidase component PIG-S ...    163   7e-39    Monodelphis domestica
ref|XP_010160735.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    160   8e-39    
emb|CCM04395.1|  predicted protein                                      162   1e-38    
ref|XP_007485656.1|  PREDICTED: GPI transamidase component PIG-S ...    163   1e-38    
emb|CEF96649.1|  Phosphatidylinositol-glycan biosynthesis class S...    161   2e-38    
ref|XP_010199273.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    157   2e-38    
ref|XP_008330935.1|  PREDICTED: GPI transamidase component PIG-S        161   3e-38    
ref|XP_009549961.1|  hypothetical protein HETIRDRAFT_157379             160   3e-38    
gb|KDQ07435.1|  hypothetical protein BOTBODRAFT_180713                  160   3e-38    
ref|XP_003074319.1|  putative phosphatidylinositol glycan class S...    161   4e-38    
ref|XP_003416997.1|  PREDICTED: GPI transamidase component PIG-S        160   5e-38    
ref|XP_009807266.1|  PREDICTED: GPI transamidase component PIG-S        158   6e-38    
ref|XP_010149468.1|  PREDICTED: GPI transamidase component PIG-S        156   7e-38    
ref|XP_007852141.1|  gpi transamidase component pig-s                   159   7e-38    
ref|XP_008638620.1|  PREDICTED: GPI transamidase component PIG-S-...    162   7e-38    
gb|KFP78042.1|  GPI transamidase component PIG-S                        154   1e-37    
ref|XP_005093987.1|  PREDICTED: GPI transamidase component PIG-S-...    159   1e-37    
ref|XP_009871948.1|  PREDICTED: GPI transamidase component PIG-S        154   2e-37    
gb|KFQ46054.1|  GPI transamidase component PIG-S                        155   3e-37    
emb|CDO70983.1|  hypothetical protein BN946_scf184830.g15               155   5e-37    
ref|XP_005583289.1|  PREDICTED: GPI transamidase component PIG-S ...    155   7e-37    
ref|XP_004605349.1|  PREDICTED: GPI transamidase component PIG-S        157   8e-37    
ref|XP_003770093.1|  PREDICTED: GPI transamidase component PIG-S        156   2e-36    
ref|XP_002611905.1|  hypothetical protein BRAFLDRAFT_249423             152   2e-36    Branchiostoma floridae
ref|NP_001127081.1|  GPI transamidase component PIG-S                   154   2e-36    Pongo abelii [orang utan]
ref|XP_001107461.1|  PREDICTED: GPI transamidase component PIG-S-...    155   2e-36    Macaca mulatta [rhesus macaque]
ref|XP_007183950.1|  PREDICTED: GPI transamidase component PIG-S ...    155   2e-36    
ref|XP_636197.1|  phosphatidylinositol glycan, class S                  153   3e-36    Dictyostelium discoideum AX4
gb|EHH24634.1|  hypothetical protein EGK_08327                          155   3e-36    
ref|XP_010791814.1|  PREDICTED: GPI transamidase component PIG-S        155   3e-36    
ref|XP_003912553.1|  PREDICTED: GPI transamidase component PIG-S        155   3e-36    
ref|XP_004267181.1|  PREDICTED: GPI transamidase component PIG-S        155   3e-36    
ref|XP_781371.3|  PREDICTED: GPI transamidase component PIG-S-like      154   4e-36    Strongylocentrotus purpuratus [purple urchin]
ref|XP_003277168.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    154   5e-36    
gb|KFQ35328.1|  GPI transamidase component PIG-S                        149   5e-36    
ref|XP_010746523.1|  PREDICTED: GPI transamidase component PIG-S        154   5e-36    
ref|XP_002748296.1|  PREDICTED: GPI transamidase component PIG-S ...    154   6e-36    Callithrix jacchus [common marmoset]
ref|XP_004399710.1|  PREDICTED: GPI transamidase component PIG-S ...    152   6e-36    
ref|XP_008008982.1|  PREDICTED: GPI transamidase component PIG-S        154   8e-36    
ref|XP_002912373.1|  PREDICTED: GPI transamidase component PIG-S-...    154   8e-36    
ref|XP_006731646.1|  PREDICTED: GPI transamidase component PIG-S ...    152   8e-36    
ref|XP_003931469.1|  PREDICTED: GPI transamidase component PIG-S ...    153   1e-35    
ref|XP_008995450.1|  PREDICTED: GPI transamidase component PIG-S ...    153   1e-35    
ref|XP_003996538.1|  PREDICTED: GPI transamidase component PIG-S        153   1e-35    
ref|XP_008944491.1|  PREDICTED: GPI transamidase component PIG-S        148   1e-35    
gb|AAH07301.2|  PIGS protein                                            152   2e-35    Homo sapiens [man]
tpe|CBF80962.1|  TPA: GPI transamidase component PIG-S, putative ...    153   2e-35    
emb|CCJ31432.1|  unnamed protein product                                152   2e-35    
ref|XP_004399709.1|  PREDICTED: GPI transamidase component PIG-S ...    152   2e-35    
ref|XP_007384351.1|  hypothetical protein PUNSTDRAFT_103264             152   2e-35    
ref|XP_004042046.1|  PREDICTED: GPI transamidase component PIG-S ...    152   2e-35    
dbj|BAG59572.1|  unnamed protein product                                152   2e-35    Homo sapiens [man]
ref|XP_004684919.1|  PREDICTED: GPI transamidase component PIG-S        152   2e-35    
ref|XP_010863992.1|  PREDICTED: GPI transamidase component PIG-S ...    151   2e-35    
ref|XP_006731645.1|  PREDICTED: GPI transamidase component PIG-S ...    152   2e-35    
ref|XP_010370628.1|  PREDICTED: GPI transamidase component PIG-S        152   3e-35    
ref|XP_008580868.1|  PREDICTED: GPI transamidase component PIG-S ...    152   3e-35    
ref|XP_008580866.1|  PREDICTED: GPI transamidase component PIG-S ...    152   3e-35    
ref|XP_007121814.1|  PREDICTED: GPI transamidase component PIG-S ...    152   3e-35    
ref|XP_007869409.1|  hypothetical protein GLOTRDRAFT_80455              151   3e-35    
ref|XP_004042045.1|  PREDICTED: GPI transamidase component PIG-S ...    152   3e-35    
ref|NP_149975.1|  GPI transamidase component PIG-S                      152   3e-35    Homo sapiens [man]
ref|XP_007301576.1|  hypothetical protein STEHIDRAFT_53681              151   3e-35    
gb|AAQ89470.1|  PIGS                                                    152   3e-35    Homo sapiens [man]
ref|XP_004341418.1|  Phosphatidylinositol glycan anchor biosynthe...    152   3e-35    
ref|XP_005402806.1|  PREDICTED: GPI transamidase component PIG-S        152   4e-35    
ref|XP_007452479.1|  PREDICTED: GPI transamidase component PIG-S ...    151   4e-35    
ref|XP_010340344.1|  PREDICTED: GPI transamidase component PIG-S ...    151   4e-35    
ref|XP_007259680.1|  PREDICTED: GPI transamidase component PIG-S-...    151   4e-35    
ref|XP_007367509.1|  hypothetical protein DICSQDRAFT_108434             151   4e-35    
gb|KFP31331.1|  GPI transamidase component PIG-S                        146   4e-35    
ref|XP_006874268.1|  PREDICTED: GPI transamidase component PIG-S        151   4e-35    
gb|KDR80088.1|  hypothetical protein GALMADRAFT_136636                  151   5e-35    
ref|XP_005425543.1|  PREDICTED: GPI transamidase component PIG-S        150   5e-35    
ref|XP_007452478.1|  PREDICTED: GPI transamidase component PIG-S ...    151   5e-35    
ref|XP_009430805.1|  PREDICTED: GPI transamidase component PIG-S ...    150   6e-35    
ref|XP_004747056.1|  PREDICTED: GPI transamidase component PIG-S        151   6e-35    
gb|KDQ58611.1|  hypothetical protein JAAARDRAFT_47014                   150   7e-35    
ref|XP_003971341.1|  PREDICTED: GPI transamidase component PIG-S-...    150   9e-35    
ref|XP_004664667.1|  PREDICTED: GPI transamidase component PIG-S ...    149   1e-34    
ref|XP_511797.2|  PREDICTED: GPI transamidase component PIG-S iso...    150   1e-34    Pan troglodytes
ref|XP_010082419.1|  PREDICTED: GPI transamidase component PIG-S        145   1e-34    
ref|XP_004706984.1|  PREDICTED: GPI transamidase component PIG-S        150   1e-34    
ref|XP_004635471.1|  PREDICTED: GPI transamidase component PIG-S        150   1e-34    
ref|XP_010640618.1|  PREDICTED: GPI transamidase component PIG-S ...    150   1e-34    
ref|XP_003469779.1|  PREDICTED: GPI transamidase component PIG-S        150   1e-34    
gb|EPS98289.1|  hypothetical protein FOMPIDRAFT_1126904                 149   1e-34    
ref|XP_001272633.1|  GPI transamidase component PIG-S, putative         150   1e-34    Aspergillus clavatus NRRL 1
ref|XP_003131808.2|  PREDICTED: GPI transamidase component PIG-S-...    149   1e-34    
ref|XP_007771441.1|  hypothetical protein CONPUDRAFT_167417             149   2e-34    
ref|XP_004013275.1|  PREDICTED: GPI transamidase component PIG-S        150   2e-34    
ref|NP_001279117.1|  phosphatidylinositol glycan anchor biosynthe...    149   2e-34    
ref|XP_006212019.1|  PREDICTED: GPI transamidase component PIG-S ...    149   2e-34    
ref|XP_010863991.1|  PREDICTED: GPI transamidase component PIG-S ...    149   2e-34    
ref|XP_004664666.1|  PREDICTED: GPI transamidase component PIG-S ...    149   2e-34    
gb|KFV15856.1|  GPI transamidase component PIG-S                        144   2e-34    
tpg|DAA18952.1|  TPA: GPI transamidase component PIG-S                  149   2e-34    
dbj|BAC11615.1|  unnamed protein product                                149   2e-34    Homo sapiens [man]
ref|XP_006977533.1|  PREDICTED: GPI transamidase component PIG-S        149   2e-34    
ref|XP_009293904.1|  PREDICTED: GPI transamidase component PIG-S ...    149   2e-34    
ref|XP_003797202.1|  PREDICTED: GPI transamidase component PIG-S ...    148   2e-34    
ref|XP_007530771.1|  PREDICTED: GPI transamidase component PIG-S        149   2e-34    
ref|XP_007894692.1|  PREDICTED: GPI transamidase component PIG-S        149   3e-34    
ref|XP_001504193.1|  PREDICTED: GPI transamidase component PIG-S        149   3e-34    Equus caballus [domestic horse]
ref|XP_006212018.1|  PREDICTED: GPI transamidase component PIG-S ...    149   3e-34    
ref|XP_010814115.1|  PREDICTED: GPI transamidase component PIG-S ...    149   3e-34    
ref|XP_010859721.1|  PREDICTED: GPI transamidase component PIG-S        149   3e-34    
ref|NP_001029388.1|  GPI transamidase component PIG-S                   149   3e-34    
ref|NP_001070082.1|  GPI transamidase component PIG-S                   149   3e-34    
ref|XP_005077072.1|  PREDICTED: GPI transamidase component PIG-S        149   3e-34    
ref|XP_004433437.1|  PREDICTED: GPI transamidase component PIG-S ...    148   4e-34    
ref|XP_007935561.1|  PREDICTED: GPI transamidase component PIG-S        148   4e-34    
ref|XP_006925065.1|  PREDICTED: GPI transamidase component PIG-S        148   4e-34    
ref|NP_001231268.1|  GPI transamidase component PIG-S                   148   4e-34    
ref|XP_662754.1|  hypothetical protein AN5150.2                         150   4e-34    
ref|XP_003797201.1|  PREDICTED: GPI transamidase component PIG-S ...    148   4e-34    
ref|XP_004433436.1|  PREDICTED: GPI transamidase component PIG-S ...    148   4e-34    
ref|XP_008290722.1|  PREDICTED: GPI transamidase component PIG-S        148   5e-34    
ref|XP_005349514.1|  PREDICTED: GPI transamidase component PIG-S        148   6e-34    
ref|XP_008146031.1|  PREDICTED: GPI transamidase component PIG-S ...    147   6e-34    
ref|XP_006042254.1|  PREDICTED: GPI transamidase component PIG-S        147   6e-34    
ref|NP_001006602.1|  GPI transamidase component PIG-S                   147   7e-34    
ref|XP_008064896.1|  PREDICTED: GPI transamidase component PIG-S        147   8e-34    
gb|KDE06579.1|  hypothetical protein MVLG_03075                         147   8e-34    
gb|EKC21003.1|  GPI transamidase component PIG-S                        147   8e-34    
ref|XP_006165507.1|  PREDICTED: GPI transamidase component PIG-S ...    147   9e-34    
dbj|BAG37159.1|  unnamed protein product                                147   1e-33    
ref|XP_008146030.1|  PREDICTED: GPI transamidase component PIG-S ...    147   1e-33    
ref|XP_006095584.1|  PREDICTED: GPI transamidase component PIG-S        147   1e-33    
gb|ELV12094.1|  GPI transamidase component PIG-S                        147   1e-33    
ref|XP_005693414.1|  PREDICTED: GPI transamidase component PIG-S        147   1e-33    
ref|XP_006165506.1|  PREDICTED: GPI transamidase component PIG-S ...    147   1e-33    
ref|XP_003514925.1|  PREDICTED: GPI transamidase component PIG-S        147   1e-33    
ref|XP_009954896.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    145   2e-33    
ref|XP_001881283.1|  predicted protein                                  145   2e-33    
dbj|GAD93477.1|  GPI transamidase component PIG-S, putative             146   2e-33    
ref|XP_006533534.1|  PREDICTED: GPI transamidase component PIG-S ...    145   2e-33    
gb|KEP55018.1|  phosphatidylinositol glycan, class S protein            145   2e-33    
dbj|BAE31882.1|  unnamed protein product                                146   3e-33    
ref|XP_008269255.1|  PREDICTED: GPI transamidase component PIG-S        145   3e-33    
dbj|BAE20546.1|  unnamed protein product                                145   3e-33    
ref|NP_958808.1|  GPI transamidase component PIG-S                      145   3e-33    
gb|EMD35422.1|  hypothetical protein CERSUDRAFT_116191                  145   3e-33    
ref|XP_005876960.1|  PREDICTED: GPI transamidase component PIG-S ...    145   4e-33    
ref|XP_005876961.1|  PREDICTED: GPI transamidase component PIG-S ...    145   4e-33    
ref|XP_006891017.1|  PREDICTED: GPI transamidase component PIG-S        145   4e-33    
ref|XP_005502186.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    144   5e-33    
gb|KFQ14708.1|  GPI transamidase component PIG-S                        144   6e-33    
gb|EUC65516.1|  GPI transamidase component PIG-S                        144   6e-33    
gb|EPQ14345.1|  GPI transamidase component PIG-S                        145   6e-33    
ref|XP_003446869.1|  PREDICTED: GPI transamidase component PIG-S-...    144   7e-33    
ref|XP_005327878.1|  PREDICTED: GPI transamidase component PIG-S        144   8e-33    
ref|XP_008838815.1|  PREDICTED: GPI transamidase component PIG-S        144   9e-33    
ref|XP_005805903.1|  PREDICTED: GPI transamidase component PIG-S-...    144   9e-33    
ref|XP_007556359.1|  PREDICTED: GPI transamidase component PIG-S        144   1e-32    
gb|ERE67890.1|  GPI transamidase component PIG-S-like protein           146   1e-32    
gb|EFW15899.1|  GPI transamidase component PIG-S                        144   1e-32    
ref|XP_007352358.1|  hypothetical protein AURDEDRAFT_116108             143   2e-32    
gb|EAS29574.2|  GPI transamidase component PIG-S                        144   2e-32    
ref|XP_004594070.1|  PREDICTED: GPI transamidase component PIG-S        143   2e-32    
ref|XP_008425362.1|  PREDICTED: GPI transamidase component PIG-S        143   2e-32    
ref|XP_002113280.1|  hypothetical protein TRIADDRAFT_57269              143   2e-32    
ref|XP_003065149.1|  hypothetical protein CPC735_020320                 144   2e-32    
ref|XP_005751092.1|  PREDICTED: GPI transamidase component PIG-S-...    143   2e-32    
ref|XP_006032921.1|  PREDICTED: GPI transamidase component PIG-S        144   2e-32    
ref|XP_005945429.1|  PREDICTED: GPI transamidase component PIG-S-...    143   2e-32    
ref|XP_006768081.1|  PREDICTED: GPI transamidase component PIG-S        143   2e-32    
ref|XP_004450003.1|  PREDICTED: GPI transamidase component PIG-S ...    143   3e-32    
ref|XP_003175479.1|  hypothetical protein MGYG_03004                    143   3e-32    
gb|EDP49285.1|  GPI transamidase component PIG-S, putative              143   3e-32    
ref|XP_750611.1|  GPI transamidase component PIG-S                      143   3e-32    
ref|XP_004550039.1|  PREDICTED: GPI transamidase component PIG-S-...    142   3e-32    
dbj|GAM29059.1|  hypothetical protein SAMD00019534_122350               140   4e-32    
ref|XP_006184989.1|  PREDICTED: GPI transamidase component PIG-S ...    141   5e-32    
ref|XP_006800217.1|  PREDICTED: GPI transamidase component PIG-S-...    144   5e-32    
emb|CCO27828.1|  GPI transamidase component PIG-S AltName: Full=P...    141   5e-32    
ref|XP_005888247.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    142   5e-32    
ref|XP_006184988.1|  PREDICTED: GPI transamidase component PIG-S ...    141   7e-32    
ref|XP_001257834.1|  GPI transamidase component PIG-S, putative         142   7e-32    
ref|XP_007076111.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    141   8e-32    
gb|EGD99139.1|  GPI transamidase component PIG-S                        140   8e-32    
ref|XP_001240827.1|  hypothetical protein CIMG_07990                    144   9e-32    
gb|KEY80321.1|  GPI transamidase component PIG S                        141   1e-31    
gb|KFV71940.1|  GPI transamidase component PIG-S                        139   1e-31    
ref|XP_009664548.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    142   2e-31    
ref|XP_008693784.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    140   3e-31    
dbj|BAE90528.1|  unnamed protein product                                138   3e-31    
ref|XP_010210480.1|  PREDICTED: GPI transamidase component PIG-S        135   3e-31    
ref|XP_003023635.1|  hypothetical protein TRV_02210                     139   4e-31    
ref|XP_010977283.1|  PREDICTED: GPI transamidase component PIG-S        139   4e-31    
ref|XP_003012431.1|  hypothetical protein ARB_01390                     139   5e-31    
ref|XP_004076509.1|  PREDICTED: GPI transamidase component PIG-S-...    139   5e-31    
ref|XP_002849224.1|  glycosyl Phosphatidyl Inositol 17                  139   6e-31    
ref|XP_007392950.1|  hypothetical protein PHACADRAFT_192749             138   7e-31    
ref|XP_009558570.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    138   7e-31    
gb|EZF36085.1|  hypothetical protein H101_00412                         138   9e-31    
ref|XP_001818490.1|  GPI transamidase component PIG-S                   138   1e-30    
gb|EFA85563.1|  phosphatidylinositol glycan                             136   1e-30    
ref|XP_002373730.1|  GPI transamidase component PIG-S, putative         138   1e-30    
gb|EZF85492.1|  hypothetical protein H110_03498                         137   1e-30    
ref|XP_002412041.1|  GPI transamidase component PIG-S, putative         137   1e-30    
ref|XP_011109867.1|  hypothetical protein H072_3907                     138   2e-30    
ref|XP_007875458.1|  hypothetical protein PNEG_03375                    137   2e-30    
ref|XP_548290.4|  PREDICTED: GPI transamidase component PIG-S           137   2e-30    
ref|XP_003234228.1|  GPI transamidase component PIG-S                   137   2e-30    
gb|EKD00839.1|  hypothetical protein A1Q2_04849                         136   2e-30    
ref|XP_005963728.1|  PREDICTED: LOW QUALITY PROTEIN: GPI transami...    137   2e-30    
gb|EJT52784.1|  hypothetical protein A1Q1_01824                         136   2e-30    
ref|XP_004857050.1|  PREDICTED: GPI transamidase component PIG-S ...    137   2e-30    
ref|XP_004901057.1|  PREDICTED: GPI transamidase component PIG-S        137   3e-30    
gb|EHB13310.1|  GPI transamidase component PIG-S                        137   3e-30    
gb|EZF23883.1|  hypothetical protein H100_03497                         136   3e-30    
gb|ETE57520.1|  GPI transamidase component PIG-S                        132   4e-30    
gb|EIT79136.1|  GPI transamidase complex protein                        135   6e-30    
ref|XP_002124261.1|  PREDICTED: GPI transamidase component PIG-S-...    135   7e-30    
ref|XP_010135191.1|  PREDICTED: GPI transamidase component PIG-S        134   9e-30    
emb|CDR44852.1|  RHTO0S10e01794g1_1                                     133   1e-29    
gb|ELU43284.1|  GPI transamidase component PIG-S                        134   1e-29    
ref|XP_004450004.1|  PREDICTED: GPI transamidase component PIG-S ...    134   2e-29    
gb|KDQ31894.1|  hypothetical protein PLEOSDRAFT_1034608                 132   3e-29    
ref|XP_004314069.1|  PREDICTED: GPI transamidase component PIG-S        133   4e-29    
ref|XP_003332372.2|  hypothetical protein PGTG_13757                    132   4e-29    
gb|EKG21381.1|  Phosphatidylinositol-glycan biosynthesis class S ...    132   6e-29    
ref|XP_009013726.1|  hypothetical protein HELRODRAFT_75695              127   6e-29    
ref|XP_001537505.1|  conserved hypothetical protein                     132   6e-29    
ref|XP_774588.1|  hypothetical protein CNBF2680                         133   7e-29    
ref|XP_002483512.1|  GPI transamidase component PIG-S, putative         132   8e-29    
gb|KEQ74495.1|  hypothetical protein M436DRAFT_71916                    132   9e-29    
gb|EAW51100.1|  phosphatidylinositol glycan, class S, isoform CRA_b     127   9e-29    
gb|EMS18611.1|  phosphatidylinositol glycan, class S                    130   1e-28    
gb|EGU11817.1|  hypothetical protein RTG_02061                          133   1e-28    
emb|CAG00518.1|  unnamed protein product                                132   1e-28    
ref|XP_007272070.1|  hypothetical protein FOMMEDRAFT_115195             130   2e-28    
ref|XP_003358227.3|  PREDICTED: GPI transamidase component PIG-S-...    130   2e-28    
ref|XP_001730598.1|  hypothetical protein MGL_2394                      130   2e-28    
gb|KEQ94071.1|  hypothetical protein AUEXF2481DRAFT_6129                131   2e-28    
ref|XP_007739368.1|  hypothetical protein A1O5_00559                    131   2e-28    
gb|AFR96095.2|  phosphatidylinositol glycan, class S                    131   3e-28    
gb|EGC42710.1|  GPI transamidase component PIG-S                        130   3e-28    
ref|XP_004356422.1|  phosphatidylinositol glycan                        129   4e-28    
gb|EMF16404.1|  hypothetical protein SEPMUDRAFT_55705                   129   4e-28    
dbj|GAA99413.1|  hypothetical protein E5Q_06111                         129   5e-28    
emb|CDM33465.1|  Phosphatidylinositol-glycan biosynthesis class S...    130   5e-28    
ref|XP_003194866.1|  hypothetical protein CGB_F4040C                    130   6e-28    
gb|KGQ01082.1|  hypothetical protein PAAG_12207                         130   6e-28    
ref|XP_007313966.1|  hypothetical protein SERLADRAFT_457890             128   9e-28    
gb|KEQ86919.1|  hypothetical protein M438DRAFT_372528                   129   9e-28    
ref|XP_009508135.1|  PREDICTED: GPI transamidase component PIG-S        122   1e-27    
ref|XP_010757382.1|  hypothetical protein PADG_01260                    129   1e-27    
ref|XP_011117076.1|  hypothetical protein AOL_s00004g124                128   1e-27    
emb|CCX13587.1|  Similar to GPI transamidase component PIG-S; acc...    127   4e-27    
ref|XP_002791621.1|  conserved hypothetical protein                     128   5e-27    
gb|EKV07914.1|  GPI transamidase component PIG-S, putative              125   6e-27    
gb|EYE99650.1|  putative GPI transamidase component PIG-S               126   6e-27    
dbj|GAA85526.1|  GPI transamidase component PIG-S                       126   6e-27    
gb|KGO44144.1|  Phosphatidylinositol-glycan biosynthesis class S ...    125   9e-27    
dbj|GAM38552.1|  hypothetical protein TCE0_033r09360                    125   1e-26    
gb|EGE82410.1|  GPI transamidase component PIG-S                        125   2e-26    
ref|XP_002622422.1|  GPI transamidase component PIG-S                   125   2e-26    
gb|KDR07999.1|  GPI transamidase component PIG-S                        124   3e-26    
ref|XP_007920914.1|  hypothetical protein MYCFIDRAFT_97278              123   3e-26    
ref|XP_002562391.1|  Pc18g05640                                         125   4e-26    
gb|KGO41261.1|  Phosphatidylinositol-glycan biosynthesis class S ...    124   4e-26    
ref|XP_002841510.1|  hypothetical protein                               124   4e-26    
ref|XP_008723194.1|  hypothetical protein G647_01573                    124   4e-26    
ref|XP_007404852.1|  hypothetical protein MELLADRAFT_76444              123   5e-26    
gb|KGO77318.1|  Phosphatidylinositol-glycan biosynthesis class S ...    124   5e-26    
gb|AAH01319.2|  PIGS protein                                            118   8e-26    
ref|XP_003401873.1|  PREDICTED: GPI transamidase component PIG-S-...    122   1e-25    
ref|XP_001392001.2|  GPI transamidase component PIG-S                   122   2e-25    
ref|XP_002542757.1|  conserved hypothetical protein                     122   2e-25    
ref|XP_003692575.1|  PREDICTED: GPI transamidase component PIG-S-...    121   2e-25    
gb|EJU02454.1|  hypothetical protein DACRYDRAFT_107371                  121   2e-25    
gb|KFM69763.1|  GPI transamidase component PIG-S                        121   2e-25    
ref|XP_006559628.1|  PREDICTED: GPI transamidase component PIG-S-...    120   3e-25    
ref|XP_397105.3|  PREDICTED: GPI transamidase component PIG-S-lik...    120   3e-25    
ref|XP_002675191.1|  predicted protein                                  121   4e-25    
ref|XP_011067778.1|  PREDICTED: GPI transamidase component PIG-S ...    120   5e-25    
ref|XP_007007171.1|  hypothetical protein TREMEDRAFT_64966              122   5e-25    
ref|XP_007753724.1|  hypothetical protein A1O7_01497                    120   5e-25    
ref|XP_006607244.1|  PREDICTED: GPI transamidase component PIG-S-...    120   5e-25    
ref|XP_006607243.1|  PREDICTED: GPI transamidase component PIG-S-...    120   7e-25    
gb|KFX45117.1|  GPI transamidase component PIG-S like                   120   8e-25    
ref|XP_011067777.1|  PREDICTED: GPI transamidase component PIG-S ...    119   9e-25    
gb|EGI69864.1|  GPI transamidase component PIG-S                        119   9e-25    
gb|KEQ60150.1|  hypothetical protein M437DRAFT_11764                    119   9e-25    
gb|EPX73902.1|  pig-S                                                   119   1e-24    
emb|CAK39692.1|  unnamed protein product                                121   1e-24    
gb|EHA24300.1|  hypothetical protein ASPNIDRAFT_209342                  120   1e-24    
emb|CDR39477.1|  CYFA0S03e03796g1_1                                     119   1e-24    
ref|XP_007720198.1|  hypothetical protein A1O1_01094                    119   1e-24    
gb|EPS30483.1|  hypothetical protein PDE_05434                          119   2e-24    
ref|XP_002150637.1|  GPI transamidase component PIG-S, putative         120   2e-24    
gb|EUN27980.1|  hypothetical protein COCVIDRAFT_97071                   118   4e-24    
ref|XP_311969.5|  AGAP002933-PA                                         118   4e-24    
gb|EZA59527.1|  GPI transamidase component PIG-S                        117   4e-24    
ref|XP_007710704.1|  hypothetical protein COCCADRAFT_92047              117   4e-24    
emb|CDK25356.1|  unnamed protein product                                117   4e-24    
ref|XP_007698681.1|  hypothetical protein COCSADRAFT_86986              117   8e-24    
ref|NP_594335.1|  pig-S (predicted)                                     116   9e-24    
dbj|BAE20638.1|  unnamed protein product                                115   2e-23    
gb|ETO26819.1|  hypothetical protein RFI_10316                          115   2e-23    
gb|KFB45365.1|  AGAP002933-PA-like protein                              113   2e-23    
ref|XP_007777880.1|  hypothetical protein W97_01787                     115   2e-23    
ref|XP_003027546.1|  hypothetical protein SCHCODRAFT_61066              114   3e-23    
ref|XP_009152777.1|  phosphatidylinositol glycan, class S               115   3e-23    
ref|XP_003740894.1|  PREDICTED: GPI transamidase component PIG-S-...    114   3e-23    
ref|XP_003295344.1|  hypothetical protein PTT_00485                     115   4e-23    
gb|AEZ67828.1|  AGAP002933-PA                                           117   4e-23    
ref|XP_007685436.1|  hypothetical protein COCMIDRAFT_88394              114   5e-23    
ref|XP_007678112.1|  hypothetical protein BAUCODRAFT_41570              113   6e-23    
ref|XP_009530242.1|  hypothetical protein PHYSODRAFT_512683             113   8e-23    
gb|EMD89805.1|  hypothetical protein COCHEDRAFT_1177782                 113   1e-22    
ref|XP_007736047.1|  hypothetical protein A1O3_07751                    113   1e-22    
ref|XP_571325.1|  hypothetical protein                                  113   2e-22    
ref|XP_008030808.1|  hypothetical protein SETTUDRAFT_122912             114   2e-22    
ref|XP_007585540.1|  putative gpi transamidase component pig-s pr...    112   2e-22    
ref|XP_001937626.1|  GPI transamidase component PIG-S                   112   2e-22    
ref|XP_002900103.1|  conserved hypothetical protein                     111   3e-22    
gb|EME48927.1|  hypothetical protein DOTSEDRAFT_49301                   111   3e-22    
ref|XP_007183952.1|  PREDICTED: GPI transamidase component PIG-S ...    111   5e-22    
ref|XP_007183951.1|  PREDICTED: GPI transamidase component PIG-S ...    111   5e-22    
gb|EFZ14930.1|  hypothetical protein SINV_13263                         110   6e-22    
gb|EPY51556.1|  pig-S                                                   110   7e-22    
ref|XP_007881605.1|  hypothetical protein PFL1_05878                    111   7e-22    
ref|XP_004365648.1|  conserved hypothetical protein                     110   9e-22    
ref|XP_007183949.1|  PREDICTED: GPI transamidase component PIG-S ...    111   1e-21    



>ref|XP_009775444.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Nicotiana 
sylvestris]
Length=611

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/604 (72%), Positives = 523/604 (87%), Gaps = 12/604 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEISEA   S++  N  SE++  +DFDP TMRKTKPG KRLFLTLT+F SFLI LPFLL
Sbjct  12    MAEISEALTSSSDPPNTMSEEA--SDFDPKTMRKTKPGLKRLFLTLTVFFSFLIALPFLL  69

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             +SIEI+RAPLPF+DID L+ ++E++PL +PC+F+ VF+N D+ T    +EL  LI S MQ
Sbjct  70    QSIEIYRAPLPFEDIDLLSSAMEKNPLQYPCQFRAVFINFDYITD--INELGLLINSNMQ  127

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI-VWKCGALSGLDFEKSLDNTDD  1812
             KLTS   P CGTC +N+TVA+T++SSS NCI+SE++++  W+CGAL+G D     ++ D+
Sbjct  128   KLTSKVIPACGTCGNNYTVAVTVDSSS-NCIHSESENVGKWQCGALNGFDKLNDDEDFDE  186

Query  1811  FLESLLDsrssrvytvvvvnrdeev---ravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             +LES+LDS++ ++YTVVVV R+ +    R VVGKYRHAWIVGK S +++ EK+ EIFV+V
Sbjct  187   YLESVLDSKNRKLYTVVVVKRNADEEEGRVVVGKYRHAWIVGKDSVKKAAEKMAEIFVKV  246

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V ALR
Sbjct  247   FVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDALR  306

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+AD+SVESQVLYHTPK+S+S WD+KQGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKV
Sbjct  307   PVADISVESQVLYHTPKASYSYWDDKQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKV  366

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             LHFV+YVPS +ECPL+L  PNGE+S TNGFISPMWGG++VWNPP+CS+N ++Q L +HKI
Sbjct  367   LHFVLYVPSAKECPLKLQFPNGEISMTNGFISPMWGGIIVWNPPACSENLQIQHLPKHKI  426

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             SSE+LKK+ EVFMGQLRQLFGL S++ YVGA ATS LLTS KGF +WELD +SR HTCFN
Sbjct  427   SSEDLKKISEVFMGQLRQLFGLKSENHYVGAFATSVLLTSAKGFAEWELDVLSRYHTCFN  486

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SLSN S+G  D SAVSSR+A
Sbjct  487   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLSNVSLGYSDASAVSSRKA  546

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             R+LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LAV+REWKR K EN+KYLAW
Sbjct  547   RALAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVLLAVIREWKRYKVENRKYLAW  606

Query  563   KAKV  552
             KAK+
Sbjct  607   KAKL  610



>ref|XP_006340007.1| PREDICTED: GPI transamidase component PIG-S-like [Solanum tuberosum]
Length=610

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/604 (74%), Positives = 518/604 (86%), Gaps = 12/604 (2%)
 Frame = -3

Query  2345  AMAEISEAPSAEDN-NQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             AMAEISEAP++ D  N KSE+     FDP TMRKTKPG KRLFLTLT+FISFLI LPFLL
Sbjct  10    AMAEISEAPTSSDPPNTKSEE---EHFDPKTMRKTKPGLKRLFLTLTVFISFLIALPFLL  66

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KSIEI+RAPLPF+DID L+  +E++ LLFPC+FQVVFVN D  T    ++L  LI S MQ
Sbjct  67    KSIEIYRAPLPFEDIDLLSTEMEKNHLLFPCQFQVVFVNFDDITA--VNDLGLLIDSHMQ  124

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSE--NQDIVWKCGALSGLDFEKSLD-NT  1818
             KLTS  SP CG C +N TVA+T++S+S NCI+SE  N +  W+CG L+G D     D + 
Sbjct  125   KLTSENSPPCGACGNNVTVAVTIDSNS-NCIHSESGNGNSKWQCGMLNGFDKVNDHDEDF  183

Query  1817  DDFLESLLDsrssrvytvvvvnrdee-vravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             D++LES+LDS++ +VYTVVV+NR +E VR VVGKYRHAWIVG  S +++VEK+ EIF++V
Sbjct  184   DEYLESVLDSKNRKVYTVVVMNRKQEDVRIVVGKYRHAWIVGNDSVEKAVEKMAEIFIKV  243

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V ALR
Sbjct  244   FVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDALR  303

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+AD+SVESQVLYHTPKSS+S WD+ QGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKV
Sbjct  304   PVADISVESQVLYHTPKSSYSYWDDTQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKV  363

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             LHFV+YVPS +ECPL+L LPNGE+S TNGFISPMWGG++VWNPP+C +N +MQ L RHKI
Sbjct  364   LHFVLYVPSAKECPLKLQLPNGEISMTNGFISPMWGGIIVWNPPACVENFQMQHLSRHKI  423

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             SSE+LK + EVFMGQLRQLFGL S+SLYVG  ATS LLTS+KGF +WELD +SR HTCFN
Sbjct  424   SSEDLKMISEVFMGQLRQLFGLKSESLYVGGFATSVLLTSDKGFAEWELDVLSRHHTCFN  483

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SL N S+G  D SAVSSR+A
Sbjct  484   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLGNVSLGYSDASAVSSRKA  543

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             R+LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LAV+REWKR K EN+KYLAW
Sbjct  544   RALAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVLLAVMREWKRYKVENRKYLAW  603

Query  563   KAKV  552
             K KV
Sbjct  604   KVKV  607



>ref|XP_009610376.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Nicotiana 
tomentosiformis]
Length=610

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/602 (72%), Positives = 522/602 (87%), Gaps = 9/602 (1%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISEAP++  +   +     +DFDP TMRKTKPG KRLFLTLT+F SFLI LPFLLKS
Sbjct  12    MAEISEAPTSSSDPPNTMSEEASDFDPKTMRKTKPGLKRLFLTLTVFFSFLIALPFLLKS  71

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             IEI+RAPLPF+DID L+ ++E++PL +PC+F+ VF+N D  T    +EL  LI S MQKL
Sbjct  72    IEIYRAPLPFEDIDLLSSAMEKNPLQYPCQFRAVFINFDDITD--INELGLLINSNMQKL  129

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI-VWKCGALSGLDFEKSLDNTDDFL  1806
             TS  +P CGTC +N+TVA+T++SSS NC++SE++++  W+CGAL+G D + + ++ D++L
Sbjct  130   TSKDTPACGTCGNNYTVAVTVDSSS-NCVHSESENVGKWQCGALNGFD-KLNDEDFDEYL  187

Query  1805  ESLLDsrssrvytvvvvnrde---evravVGKYRHAWIVGKLSEQesvekvveifvevfV  1635
             ES+LDS++ ++YTVVVV R+    E+R VVGKYRHAWIVGK S +++VEK+ EIFV+VFV
Sbjct  188   ESVLDSKNRKLYTVVVVKRNADEEEMRVVVGKYRHAWIVGKDSVEKAVEKMAEIFVKVFV  247

Query  1634  NGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPI  1455
             NGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDFQELD++LLAP+V ALRP+
Sbjct  248   NGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFQELDEILLAPVVDALRPV  307

Query  1454  ADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLH  1275
             AD+SVESQVLYHTPK S+S WD+KQGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKVLH
Sbjct  308   ADISVESQVLYHTPKVSYSYWDDKQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKVLH  367

Query  1274  FVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISS  1098
             FV+YVPS +ECPL+L  PNGE+S  NGFISPMWGG++VWNPP+CS+N ++Q L +HKISS
Sbjct  368   FVLYVPSAKECPLKLQFPNGEISMANGFISPMWGGIIVWNPPACSENLQIQHLPKHKISS  427

Query  1097  EELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLL  918
             E+LKK+ EVFMGQLRQLFGL S++ YVGA ATS LLTS KGF +WELD +SR HTCFNLL
Sbjct  428   EDLKKISEVFMGQLRQLFGLKSENHYVGAFATSVLLTSAKGFAEWELDVLSRHHTCFNLL  487

Query  917   QCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARS  738
             QCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SLSN S+G  D SAVSSR+AR+
Sbjct  488   QCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLSNVSLGYSDASAVSSRKARA  547

Query  737   LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LAV+REW+R K EN+K+LAWKA
Sbjct  548   LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVLLAVIREWRRYKVENRKFLAWKA  607

Query  557   KV  552
             K+
Sbjct  608   KL  609



>ref|XP_004247074.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Solanum 
lycopersicum]
Length=610

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/604 (72%), Positives = 511/604 (85%), Gaps = 12/604 (2%)
 Frame = -3

Query  2345  AMAEISEAPSAEDN-NQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             AMAEISEA ++ D  N KSE   V +FDP TMRKTKPG KRLFLTLT+FISFLI LPFLL
Sbjct  10    AMAEISEATTSSDPLNTKSE---VENFDPKTMRKTKPGLKRLFLTLTVFISFLIALPFLL  66

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KSIEI+RAPLPF+DID L+  +E++  +FPC+FQ VFVN D  T    +EL  LI S MQ
Sbjct  67    KSIEIYRAPLPFEDIDLLSTEMEKNHSVFPCQFQAVFVNFDEITA--VNELGLLIDSHMQ  124

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSE--NQDIVWKCGALSGLDFEKSLD-NT  1818
             KLTS  SP CGTC +N TVA+T++S+S NCI+ E  N +  W+CG L+G D     D + 
Sbjct  125   KLTSENSPPCGTCGNNVTVAVTIDSNS-NCIHRESGNGNGKWQCGMLNGFDKVNDHDEDF  183

Query  1817  DDFLESLLDsrssrvytvvvvnrdee-vravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             D++LES+LDS S +VYTVVV+NR +E VR VVGKYRHAWIVG  S ++++EK+ EIF++V
Sbjct  184   DEYLESVLDSTSRKVYTVVVINRKQEDVRIVVGKYRHAWIVGNDSVEKAIEKMAEIFIKV  243

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V ALR
Sbjct  244   FVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDALR  303

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+AD+SVESQVLYHTPKSS+S WD+ QGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKV
Sbjct  304   PVADISVESQVLYHTPKSSYSYWDDTQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKV  363

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             LHFV+YVPS +ECPL+L LPNGE+S TNGFISPMWGG++VWNPP+C +N +MQ L +HKI
Sbjct  364   LHFVLYVPSAKECPLKLQLPNGEISMTNGFISPMWGGIIVWNPPACVENFQMQHLSKHKI  423

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             SSE+LK + EVFMGQLRQLFGL S S Y G   TS LLTS+KGF +WELD +SR HTCFN
Sbjct  424   SSEDLKMISEVFMGQLRQLFGLKSKSFYAGGFTTSVLLTSDKGFAEWELDVLSRHHTCFN  483

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SL N S+G  D SAVSSR+A
Sbjct  484   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLGNVSLGYSDASAVSSRKA  543

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             R+LAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LAV+REWKR K E++KYL+W
Sbjct  544   RALAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVLLAVIREWKRYKVESRKYLSW  603

Query  563   KAKV  552
             K KV
Sbjct  604   KVKV  607



>ref|XP_011098455.1| PREDICTED: GPI transamidase component PIG-S [Sesamum indicum]
Length=616

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/612 (68%), Positives = 484/612 (79%), Gaps = 19/612 (3%)
 Frame = -3

Query  2348  PAMAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             PA A+ISEAP    + ++ E+    DFD  TMRKT+PG KR  LTLT+ +SFL+GLPF L
Sbjct  10    PATADISEAPLTSASERQREEP---DFDEETMRKTRPGLKRFTLTLTVLLSFLLGLPFFL  66

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+R+PLPF++ID L+ ++E +PL FPC+FQ VFV+     + TA+ELS  I S MQ
Sbjct  67    KSVEIYRSPLPFREIDDLSAAVESNPLHFPCQFQAVFVDFG-VPSFTANELSMSIESHMQ  125

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLD-FEKSLDNTDD  1812
              L +  S  CG C +N TV++TLES S +C+YS N D+ WKCG L+ L+ FE S    D+
Sbjct  126   NLAAKDSTFCGACSNNSTVSVTLESGS-DCLYS-NNDLQWKCGGLNELNKFEGSGKYDDE  183

Query  1811  ----FLESLL-------DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvek  1665
                 +L+SLL                VV     EEVRAVVGKYRHAWI+G++SE+ +V+K
Sbjct  184   LFDYYLKSLLADNGSRGHGGKVYTVIVVRKEEMEEVRAVVGKYRHAWIMGRVSEEAAVKK  243

Query  1664  vveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLL  1485
             V EIFV+VFVNGGKEEG I GEFMPVGADGR+VLSFNLLNADP DW YDW+FQE+DD LL
Sbjct  244   VAEIFVKVFVNGGKEEGCISGEFMPVGADGRIVLSFNLLNADPRDWTYDWEFQEIDDNLL  303

Query  1484  APIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTST  1305
             API+ AL+P+ADV VESQVLYHTPKSSFS WD+  GSYIF+  DLPFFVNSNEWHLDTS 
Sbjct  304   APIIDALKPLADVRVESQVLYHTPKSSFSYWDDTLGSYIFTRNDLPFFVNSNEWHLDTSV  363

Query  1304  AAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM  1125
             AAGGRSK+LHFVVYVPS  ECPL L LPNG +SKTNGFISPMWG VVVWNP +C K++EM
Sbjct  364   AAGGRSKILHFVVYVPSATECPLLLQLPNGAISKTNGFISPMWGSVVVWNPSACLKDTEM  423

Query  1124  QP-LRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFI  948
             +P +RHKIS E+LKK+FEVF+GQLRQLFGL S  L   A+ T RLLTSE GFT+WELD +
Sbjct  424   EPHVRHKISPEDLKKIFEVFLGQLRQLFGLKSKGLLGDASGTLRLLTSEAGFTEWELDVL  483

Query  947   SRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDG  768
             SRQHTCFNLLQC TTLGSLSRLVQSLPRMII DEIGKQVK+SL++AK +LSN S G YD 
Sbjct  484   SRQHTCFNLLQCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLESAKLALSNVSGGVYDA  543

Query  767   SAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
             SAVSSRQARS AEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LA LRE KR KQ
Sbjct  544   SAVSSRQARSFAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVLLAALRERKRYKQ  603

Query  587   ENKKYLAWKAKV  552
             E++KY AWKAK 
Sbjct  604   ESRKYNAWKAKT  615



>ref|XP_009610377.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Nicotiana 
tomentosiformis]
Length=583

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/567 (72%), Positives = 489/567 (86%), Gaps = 9/567 (2%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISEAP++  +   +     +DFDP TMRKTKPG KRLFLTLT+F SFLI LPFLLKS
Sbjct  12    MAEISEAPTSSSDPPNTMSEEASDFDPKTMRKTKPGLKRLFLTLTVFFSFLIALPFLLKS  71

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             IEI+RAPLPF+DID L+ ++E++PL +PC+F+ VF+N D  T    +EL  LI S MQKL
Sbjct  72    IEIYRAPLPFEDIDLLSSAMEKNPLQYPCQFRAVFINFDDITD--INELGLLINSNMQKL  129

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI-VWKCGALSGLDFEKSLDNTDDFL  1806
             TS  +P CGTC +N+TVA+T++SSS NC++SE++++  W+CGAL+G D + + ++ D++L
Sbjct  130   TSKDTPACGTCGNNYTVAVTVDSSS-NCVHSESENVGKWQCGALNGFD-KLNDEDFDEYL  187

Query  1805  ESLLDsrssrvytvvvvnrde---evravVGKYRHAWIVGKLSEQesvekvveifvevfV  1635
             ES+LDS++ ++YTVVVV R+    E+R VVGKYRHAWIVGK S +++VEK+ EIFV+VFV
Sbjct  188   ESVLDSKNRKLYTVVVVKRNADEEEMRVVVGKYRHAWIVGKDSVEKAVEKMAEIFVKVFV  247

Query  1634  NGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPI  1455
             NGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDFQELD++LLAP+V ALRP+
Sbjct  248   NGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFQELDEILLAPVVDALRPV  307

Query  1454  ADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLH  1275
             AD+SVESQVLYHTPK S+S WD+KQGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKVLH
Sbjct  308   ADISVESQVLYHTPKVSYSYWDDKQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKVLH  367

Query  1274  FVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISS  1098
             FV+YVPS +ECPL+L  PNGE+S  NGFISPMWGG++VWNPP+CS+N ++Q L +HKISS
Sbjct  368   FVLYVPSAKECPLKLQFPNGEISMANGFISPMWGGIIVWNPPACSENLQIQHLPKHKISS  427

Query  1097  EELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLL  918
             E+LKK+ EVFMGQLRQLFGL S++ YVGA ATS LLTS KGF +WELD +SR HTCFNLL
Sbjct  428   EDLKKISEVFMGQLRQLFGLKSENHYVGAFATSVLLTSAKGFAEWELDVLSRHHTCFNLL  487

Query  917   QCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARS  738
             QCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SLSN S+G  D SAVSSR+AR+
Sbjct  488   QCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLSNVSLGYSDASAVSSRKARA  547

Query  737   LAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             LAEDAFYHPSMMSVSYYSFEHCFAVYS
Sbjct  548   LAEDAFYHPSMMSVSYYSFEHCFAVYS  574



>gb|EYU40618.1| hypothetical protein MIMGU_mgv1a003001mg [Erythranthe guttata]
Length=617

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/613 (66%), Positives = 485/613 (79%), Gaps = 22/613 (4%)
 Frame = -3

Query  2348  PAMAEISEAPSAEDNN-QKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFL  2172
             PAMAEISEAPS      QK+E     +FD  TMRKTKPG KR  LTLT+ +SFL GLPFL
Sbjct  10    PAMAEISEAPSTSAAEIQKAEA----EFDSETMRKTKPGLKRFALTLTVLLSFLSGLPFL  65

Query  2171  LKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQM  1992
              KS+EI+R+PLPF++ID L+ ++E +PL FPC+F+VVFV+    T+STA+ELS  I S M
Sbjct  66    WKSVEIYRSPLPFREIDDLSAAVELNPLQFPCRFEVVFVDFGR-TSSTANELSVSIESHM  124

Query  1991  QKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGL--DFEKSLDNT  1818
             +KL    SP CG C  N TV++ LES+S +C +  + D  WKCGAL+GL   +E S ++ 
Sbjct  125   RKLAEKDSPSCGACNYNSTVSVALESAS-DC-FRTDGDFNWKCGALNGLMNKYEASREDG  182

Query  1817  ----DDFLESLLDsrssr-------vytvvvvnrdeevravVGKYRHAWIVGKLSEQesv  1671
                 DD+L+SLL+   S           VV    ++ V AVVGKYRHAWI+G +S++E+V
Sbjct  183   GELFDDYLKSLLNDNGSSSNGGKVYTVIVVRREEEKHVSAVVGKYRHAWIIGNISKEEAV  242

Query  1670  ekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDM  1491
             +KV E+FV  FVNGGKEEGSI GEFMPVG+DGR+VLSFNLLNA+P+DW YDW+FQE+DD 
Sbjct  243   KKVAEVFVNTFVNGGKEEGSIGGEFMPVGSDGRIVLSFNLLNANPNDWTYDWEFQEIDDN  302

Query  1490  LLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDT  1311
             +L+PIV+AL+P+AD+ VESQVLYHTPKSSFS WD+K  SYI++ KDLPFFVNSNEWHLDT
Sbjct  303   ILSPIVEALKPLADIRVESQVLYHTPKSSFSYWDDKLESYIYTTKDLPFFVNSNEWHLDT  362

Query  1310  STAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS  1131
             S AAGGRSK+LHFVVYVPS EECPL L LPNGE+SKTNGFISPMWG V VWNP +C K+ 
Sbjct  363   SVAAGGRSKILHFVVYVPSAEECPLLLQLPNGEISKTNGFISPMWGSVAVWNPSACFKDL  422

Query  1130  EMQP-LRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELD  954
             +M    RHKI  E+L K FE+F+GQLRQLFGLNS + +  A+ T RLLTSE+GF++WELD
Sbjct  423   KMDTRARHKIPREDLTKTFEIFIGQLRQLFGLNSKNHFADASGTLRLLTSERGFSEWELD  482

Query  953   FISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNY  774
             F+SRQHTCFNLLQC TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK ++SN S G Y
Sbjct  483   FLSRQHTCFNLLQCTTTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAVSNVSYGMY  542

Query  773   DGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRC  594
             D SAV SR ARS AEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPV+LHV+LA +REWKR 
Sbjct  543   DASAVFSRHARSFAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVSLHVVLAAVREWKRY  602

Query  593   KQENKKYLAWKAK  555
             K E++KY  WKAK
Sbjct  603   KLESRKYNTWKAK  615



>emb|CDP03894.1| unnamed protein product [Coffea canephora]
Length=558

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/574 (70%), Positives = 470/574 (82%), Gaps = 25/574 (4%)
 Frame = -3

Query  2255  MRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPC  2076
             MRKTKPG KRL LTL++ +SFLIGLPFLLKS+EI+R+ LPF+DIDSL+ +IE +P+LFPC
Sbjct  1     MRKTKPGVKRLILTLSVLLSFLIGLPFLLKSVEIYRSQLPFRDIDSLSAAIESNPILFPC  60

Query  2075  KFQVVFVNL-DHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
              F  VFVN    S++S+ ++L F I S+MQKL   K+P+CG C SN++V++TL+SS    
Sbjct  61    HFHAVFVNFPAASSSSSGNQLGFSIYSRMQKLF-PKTPLCGAC-SNYSVSVTLDSS----  114

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDN----TDDFLESLLDsrssrvytvvvvnrdeevra  1731
                         G L G  ++++LDN     D++LES+L         VV     EEVRA
Sbjct  115   ------------GLLDGFKYDRNLDNFDENLDEYLESVLSKDGKYTVVVVNREDVEEVRA  162

Query  1730  vVGKYRHAWIVGKL-SEQesvekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFN  1554
             VVGK+RHAWI G++ + +E V+++ EIFV+VFVNGGKEEGSIHGEFMPVGADGRVVLSFN
Sbjct  163   VVGKFRHAWIEGRIENAEELVQRIAEIFVKVFVNGGKEEGSIHGEFMPVGADGRVVLSFN  222

Query  1553  LLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGS  1374
             LLNADP DW+YDWDFQ ++++LLAPIV+ALRP+ADVSVESQVLYHTPKSSFS WDEK  S
Sbjct  223   LLNADPRDWVYDWDFQSMEEILLAPIVEALRPLADVSVESQVLYHTPKSSFSYWDEKLTS  282

Query  1373  YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNG  1194
             ++FS KDLPFFVNSNEWHLDTSTAAGGRSKVL FVVY+PS  ECPL L LPNGELS TNG
Sbjct  283   HVFSTKDLPFFVNSNEWHLDTSTAAGGRSKVLQFVVYIPSSRECPLFLQLPNGELSLTNG  342

Query  1193  FISPMWGGVVVWNPPSCSKNSE-MQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYV  1017
             FISPMWGGVVVWNPP+C   SE   PLRH +S +++KKVFE+F GQLRQLFGL SDS+  
Sbjct  343   FISPMWGGVVVWNPPACLNISESTHPLRHTMSLKDMKKVFEIFTGQLRQLFGLKSDSMVT  402

Query  1016  GATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
              A+  S LL SE+GF +WE D +SRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK
Sbjct  403   SASGMSILLASERGFAKWERDVLSRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  462

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             QVKFSL+AAK +L+NAS+G YD SAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS
Sbjct  463   QVKFSLEAAKLTLTNASLGIYDASAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  522

Query  656   PFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             PFFLPV+LHV+LAVLREWKR KQE KKYLAWK K
Sbjct  523   PFFLPVSLHVLLAVLREWKRYKQEQKKYLAWKNK  556



>ref|XP_010326289.1| PREDICTED: uncharacterized protein LOC101252113 isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/607 (69%), Positives = 492/607 (81%), Gaps = 13/607 (2%)
 Frame = -3

Query  2345  AMAEISEAPSAEDN-NQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             AMAEISEA ++ D  N KSE   V +FDP TMRKTKPG KRLFLTLT+FISFLI LPFLL
Sbjct  10    AMAEISEATTSSDPLNTKSE---VENFDPKTMRKTKPGLKRLFLTLTVFISFLIALPFLL  66

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KSIEI+RAPLPF+DID L+  +E++  +FPC+FQ VFVN D  T    +EL  LI S MQ
Sbjct  67    KSIEIYRAPLPFEDIDLLSTEMEKNHSVFPCQFQAVFVNFDEITA--VNELGLLIDSHMQ  124

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSE--NQDIVWKCGALSGLDFEKSLD-NT  1818
             KLTS  SP CGTC +N TVA+T++S+S NCI+ E  N +  W+CG L+G D     D + 
Sbjct  125   KLTSENSPPCGTCGNNVTVAVTIDSNS-NCIHRESGNGNGKWQCGMLNGFDKVNDHDEDF  183

Query  1817  DDFLESLLDsrssrvytvvvvnrdee-vravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             D++LES+LDS S +VYTVVV+NR +E VR VVGKYRHAWIVG  S ++++EK+ EIF++V
Sbjct  184   DEYLESVLDSTSRKVYTVVVINRKQEDVRIVVGKYRHAWIVGNDSVEKAIEKMAEIFIKV  243

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V ALR
Sbjct  244   FVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDALR  303

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+AD+SVESQVLYHTPKSS+S WD+ QGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKV
Sbjct  304   PVADISVESQVLYHTPKSSYSYWDDTQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKV  363

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             LHFV+YVPS +ECPL+L LPNGE+S TNGFISPMWGG++VWNPP+C +N +MQ L +HKI
Sbjct  364   LHFVLYVPSAKECPLKLQLPNGEISMTNGFISPMWGGIIVWNPPACVENFQMQHLSKHKI  423

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             SSE+LK + EVFMGQLRQLFGL S S Y G   TS LLTS+KGF +WELD +SR HTCFN
Sbjct  424   SSEDLKMISEVFMGQLRQLFGLKSKSFYAGGFTTSVLLTSDKGFAEWELDVLSRHHTCFN  483

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SL N S+G  D SAVSSR+A
Sbjct  484   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLGNVSLGYSDASAVSSRKA  543

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             R+LAEDAFYHPSMMSVSYYSFEHCFAVYS  F+ +  H              EN K + W
Sbjct  544   RALAEDAFYHPSMMSVSYYSFEHCFAVYSVSFMSLN-HSFCQFHCMCFLQSLENGKDIKW  602

Query  563   KAKVN*H  543
             KA+   H
Sbjct  603   KAESTFH  609



>ref|XP_010326290.1| PREDICTED: uncharacterized protein LOC101252113 isoform X3 [Solanum 
lycopersicum]
Length=609

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/584 (71%), Positives = 485/584 (83%), Gaps = 14/584 (2%)
 Frame = -3

Query  2345  AMAEISEAPSAEDN-NQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             AMAEISEA ++ D  N KSE   V +FDP TMRKTKPG KRLFLTLT+FISFLI LPFLL
Sbjct  10    AMAEISEATTSSDPLNTKSE---VENFDPKTMRKTKPGLKRLFLTLTVFISFLIALPFLL  66

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KSIEI+RAPLPF+DID L+  +E++  +FPC+FQ VFVN D  T    +EL  LI S MQ
Sbjct  67    KSIEIYRAPLPFEDIDLLSTEMEKNHSVFPCQFQAVFVNFDEITA--VNELGLLIDSHMQ  124

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSE--NQDIVWKCGALSGLDFEKSLD-NT  1818
             KLTS  SP CGTC +N TVA+T++S+S NCI+ E  N +  W+CG L+G D     D + 
Sbjct  125   KLTSENSPPCGTCGNNVTVAVTIDSNS-NCIHRESGNGNGKWQCGMLNGFDKVNDHDEDF  183

Query  1817  DDFLESLLDsrssrvytvvvvnrdee-vravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             D++LES+LDS S +VYTVVV+NR +E VR VVGKYRHAWIVG  S ++++EK+ EIF++V
Sbjct  184   DEYLESVLDSTSRKVYTVVVINRKQEDVRIVVGKYRHAWIVGNDSVEKAIEKMAEIFIKV  243

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V ALR
Sbjct  244   FVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDALR  303

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+AD+SVESQVLYHTPKSS+S WD+ QGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKV
Sbjct  304   PVADISVESQVLYHTPKSSYSYWDDTQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKV  363

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             LHFV+YVPS +ECPL+L LPNGE+S TNGFISPMWGG++VWNPP+C +N +MQ L +HKI
Sbjct  364   LHFVLYVPSAKECPLKLQLPNGEISMTNGFISPMWGGIIVWNPPACVENFQMQHLSKHKI  423

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             SSE+LK + EVFMGQLRQLFGL S S Y G   TS LLTS+KGF +WELD +SR HTCFN
Sbjct  424   SSEDLKMISEVFMGQLRQLFGLKSKSFYAGGFTTSVLLTSDKGFAEWELDVLSRHHTCFN  483

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK SL N S+G  D SAVSSR+A
Sbjct  484   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLSLGNVSLGYSDASAVSSRKA  543

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFF--LPVALHVILA  618
             R+LAEDAFYHPSMMSVSYYSFEHCFAVYS  F  L  A H  LA
Sbjct  544   RALAEDAFYHPSMMSVSYYSFEHCFAVYSMKFRSLDTAHHHWLA  587



>ref|XP_008358453.1| PREDICTED: GPI transamidase component PIG-S-like [Malus domestica]
Length=605

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/606 (64%), Positives = 468/606 (77%), Gaps = 12/606 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEI+E   P +E       Q+  +DFDP TMRK KPG KRL +T+++  SF++G+P + 
Sbjct  1     MAEITEPLLPPSEIPQTSKPQAPADDFDPKTMRKAKPGLKRLIITVSVLFSFILGIPLIY  60

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+RAPLPF++IDSL+  I+ +PLLFPC+FQ +F+  D  ++ T  E S L  ++M 
Sbjct  61    KSVEIYRAPLPFREIDSLSAEIDSNPLLFPCRFQAIFIGFDWESSITTLESSIL--TKMT  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDF  1809
             K TS ++P C TC  N TV++ L+S SS C+ S       KCGA   +DF+ + +  D+ 
Sbjct  119   KFTS-QTPQCXTCSPNHTVSVVLDSDSS-CLQSRTGPCSTKCGAFKAIDFDGADEAVDEA  176

Query  1808  LESLLDsrssrvytvvvvnrdee-----vravVGKYRHAWIVGKLSEQesvekvveifve  1644
             LES+    S       V +         VRAVVGKYRHAWI G++SE E+V +  E+FV+
Sbjct  177   LESVFGGCSGSGSGGEVYSVVVVNREHEVRAVVGKYRHAWIAGRVSEAEAVSRAAEMFVK  236

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VFVNGGKEEG I GEFMPVGADG VVLSFNLLNADP DW+YDWDFQ +D  LLAPI++A+
Sbjct  237   VFVNGGKEEGLIQGEFMPVGADGMVVLSFNLLNADPRDWVYDWDFQTIDKTLLAPIIEAM  296

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
             +P+A++SVESQVLYHTPKSS S WD+K  SYIFS KDLPFFVNSNEWHLDTS AAGGRSK
Sbjct  297   KPVANISVESQVLYHTPKSSLSYWDDKWESYIFSTKDLPFFVNSNEWHLDTSIAAGGRSK  356

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM-QPLRHK  1107
             +LHFVVY+PSE+ECPL L LP+GE SKTN FISPMWGGV+V NP SC K+SE   P +H 
Sbjct  357   MLHFVVYIPSEKECPLLLQLPDGEXSKTNSFISPMWGGVIVLNPQSCQKDSESNHPAKHT  416

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             IS ++L+KVFEVFMGQ RQLFG  SD +Y GA+ TS LL SE+GFT WELD +SR HTCF
Sbjct  417   ISHQDLQKVFEVFMGQFRQLFGFKSDDVYXGASGTSSLLASERGFTLWELDVLSRMHTCF  476

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NL  C TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK + +NAS G YD SAVSSRQ
Sbjct  477   NLHSCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAQTNASRGVYDASAVSSRQ  536

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             ARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQENKKYLA
Sbjct  537   ARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAALREWRRYKQENKKYLA  596

Query  566   WKAKVN  549
             WK KVN
Sbjct  597   WKTKVN  602



>ref|XP_009370673.1| PREDICTED: GPI transamidase component PIG-S-like [Pyrus x bretschneideri]
Length=605

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/606 (64%), Positives = 469/606 (77%), Gaps = 12/606 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEI+E   P  E       Q   +DFDP TMRKTKPG KRL +T+++  SF++G+P + 
Sbjct  1     MAEITEPLLPPNEIPQTSKPQEPADDFDPKTMRKTKPGLKRLIITVSVLFSFILGIPLIY  60

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+RAPLPF++IDSL+  I+ +PLLFPC+FQ +F+  D  ++ T  E S L  ++M 
Sbjct  61    KSVEIYRAPLPFREIDSLSAEIDSNPLLFPCRFQAIFIGFDWESSITTLESSIL--TKMT  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDF  1809
             K TS ++P CGTC  N TV+  L+S SS C+ S+      KCGA   +DF+ + +  D+ 
Sbjct  119   KFTS-QTPQCGTCSPNHTVSAVLDSDSS-CLQSQTGPCSTKCGAFKAIDFDGADEAVDEA  176

Query  1808  LESLLDsrssrvytvvvvnrdee-----vravVGKYRHAWIVGKLSEQesvekvveifve  1644
             LES+    S       V +         VRAVVGKYRHAWI G++SE E+V +  E+FV+
Sbjct  177   LESVFGGCSGSGSGGEVYSVVVVNREHEVRAVVGKYRHAWIAGRVSEAEAVSRAAEMFVK  236

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VFVNGGKEEG I GEFMPVGADG VVLSFNLLNADP DW+YDWDFQ +D  LLAPI++A+
Sbjct  237   VFVNGGKEEGLIQGEFMPVGADGMVVLSFNLLNADPRDWVYDWDFQTVDKTLLAPIIEAM  296

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
             +P+A++SVESQVLYHTPKSS S WD+K  SYIFS KDLPFFV+SNEWHLDTS AAGGRSK
Sbjct  297   KPVANISVESQVLYHTPKSSLSYWDDKWESYIFSTKDLPFFVSSNEWHLDTSIAAGGRSK  356

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM-QPLRHK  1107
             +LHFVVY+PSE+ECPL L LP+GE+SKTN FISPMWGGV+V NP SC K+ E   P +H 
Sbjct  357   MLHFVVYIPSEKECPLLLQLPDGEISKTNSFISPMWGGVIVLNPQSCQKDPESNHPAKHT  416

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             I  ++L+KVFEVFMGQ RQLFG  SD +YVGA+ TS LLTSE+GFT WELD +SR HTCF
Sbjct  417   ILHQDLQKVFEVFMGQFRQLFGFKSDDVYVGASGTSSLLTSERGFTLWELDVLSRMHTCF  476

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NL  C TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK + +NAS G YD SAVSSRQ
Sbjct  477   NLHSCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAQTNASRGVYDASAVSSRQ  536

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             ARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQENKKYLA
Sbjct  537   ARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAALREWRRYKQENKKYLA  596

Query  566   WKAKVN  549
             WK KVN
Sbjct  597   WKTKVN  602



>ref|XP_007199759.1| hypothetical protein PRUPE_ppa003075mg [Prunus persica]
 gb|EMJ00958.1| hypothetical protein PRUPE_ppa003075mg [Prunus persica]
Length=606

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/607 (65%), Positives = 478/607 (79%), Gaps = 14/607 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEI+E   P+ E       Q    DFDP TMRKTKPG KRL LT+++  SF++G+PF+ 
Sbjct  1     MAEITEPLLPAKEAPETSKPQEPALDFDPKTMRKTKPGVKRLILTVSVLFSFVLGVPFIY  60

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+RAPLPF++I+SL+  I+  P  FPC+ Q +F+  D  ++    E S L  +QM 
Sbjct  61    KSVEIYRAPLPFREIESLSAQIDSKPFQFPCRLQAIFIGFDWKSSIATLESSIL--TQMT  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDF  1809
             KLTS ++P CGTC  N TV++ L+ S+S C+ S       +CGA+  ++ +   +  D+ 
Sbjct  119   KLTS-QTPQCGTCSPNHTVSVILK-SNSQCLQSRTTSCSPECGAIRSIELDGDDEAVDEV  176

Query  1808  LESLL-------DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveif  1650
             LES+L             VY+VVVVNR EEVRAVVGKYRHAWIVG++SE E+V    EIF
Sbjct  177   LESVLGGCSGSNSGSGGEVYSVVVVNRGEEVRAVVGKYRHAWIVGRVSEAEAVSWAAEIF  236

Query  1649  vevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQ  1470
             V+VFVNGGKEEG IHGEFMPVGADG VVLSFNLLNADP DW+YDWDFQ +D+ LLAPI++
Sbjct  237   VKVFVNGGKEEGLIHGEFMPVGADGTVVLSFNLLNADPRDWVYDWDFQSVDETLLAPIIE  296

Query  1469  ALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGR  1290
             A++P+A++SVESQVLYH PKSS S WD+K  SYIFS KDLPFFVNSNEWHLDTS AAGGR
Sbjct  297   AMKPVANISVESQVLYHMPKSSLSYWDDKWDSYIFSTKDLPFFVNSNEWHLDTSIAAGGR  356

Query  1289  SKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSE-MQPLR  1113
             SK+LHFV+Y+PS +ECPL L LP+GE+SKTN FISPMWGGV+VWNP +C K+SE  +P R
Sbjct  357   SKMLHFVIYIPSAKECPLLLQLPDGEISKTNSFISPMWGGVIVWNPQTCRKDSESKRPSR  416

Query  1112  HKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHT  933
             H IS ++L+KVFEVFMGQ RQLFG  SD+LYVGA+ TS LL SE+GFT WELD +SR HT
Sbjct  417   HTISHQDLQKVFEVFMGQFRQLFGFKSDNLYVGASGTSSLLASERGFTVWELDVLSRMHT  476

Query  932   CFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSS  753
             CFNL  C TTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK + SNAS G Y+ SAVSS
Sbjct  477   CFNLHSCATTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLAQSNASHGIYNASAVSS  536

Query  752   RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKY  573
             RQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA +REW+R KQENKKY
Sbjct  537   RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAAVREWRRHKQENKKY  596

Query  572   LAWKAKV  552
             LAWK KV
Sbjct  597   LAWKTKV  603



>ref|XP_009334908.1| PREDICTED: GPI transamidase component PIG-S-like [Pyrus x bretschneideri]
Length=605

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/606 (64%), Positives = 468/606 (77%), Gaps = 12/606 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEI+E   P  E       Q   +DFDP TMRKTKPG KRL +T+++  SF++G+P + 
Sbjct  1     MAEITEPLLPPNEIPQTSKPQEPADDFDPKTMRKTKPGLKRLIITVSVLFSFILGIPLIY  60

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+RAPLPF++ID L+  I+ +PLLFPC+FQ +F+  D  ++ T  E S L  ++M 
Sbjct  61    KSVEIYRAPLPFREIDFLSAEIDSNPLLFPCRFQAIFIGFDWESSITTLESSIL--TKMT  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDF  1809
             K TS ++P CGTC  N TV+  L+S SS C+ S+      KCGA   +DF+ + +  D+ 
Sbjct  119   KFTS-QTPQCGTCSPNHTVSAGLDSDSS-CLQSQTGPCSTKCGAFKAIDFDGADEAVDEA  176

Query  1808  LESLLDsrssrvytvvvvnrdee-----vravVGKYRHAWIVGKLSEQesvekvveifve  1644
             LES+    S       V +         VRAVVGKYRHAWI G++SE E+V +  E+FV+
Sbjct  177   LESVFGGCSGSGSGGEVYSVVVVNREHEVRAVVGKYRHAWIAGRVSEAEAVSRAAEMFVK  236

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VFVNGGKEEG I GEFMPVGADG VVLSFNLLNADP DW+YDWDFQ +D  LLAPI++A+
Sbjct  237   VFVNGGKEEGLIQGEFMPVGADGMVVLSFNLLNADPRDWVYDWDFQTVDKTLLAPIIEAM  296

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
             +P+A++SVESQVLYHTPKSS S WD+K  SYIFS KDLPFFVNSNEWHLDTS AAGGRSK
Sbjct  297   KPVANISVESQVLYHTPKSSLSYWDDKWESYIFSTKDLPFFVNSNEWHLDTSIAAGGRSK  356

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM-QPLRHK  1107
             +LHFVVY+PSE+ECPL L LP+GE+SKTN FISPMWGGV+V NP SC K+ E   P +H 
Sbjct  357   MLHFVVYIPSEKECPLLLQLPDGEISKTNSFISPMWGGVIVLNPQSCQKDPESNHPAKHT  416

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             I  ++L+KVFEVFMGQ RQLFG  SD +YVGA+ TS LLTSE+GFT WELD +SR HTCF
Sbjct  417   ILHQDLQKVFEVFMGQFRQLFGFKSDDVYVGASGTSSLLTSERGFTLWELDVLSRMHTCF  476

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NL  C TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK + +NAS G YD SAVSSRQ
Sbjct  477   NLHSCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAQTNASRGVYDASAVSSRQ  536

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             ARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQENKKYLA
Sbjct  537   ARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAALREWRRYKQENKKYLA  596

Query  566   WKAKVN  549
             WK KVN
Sbjct  597   WKTKVN  602



>ref|XP_002268712.1| PREDICTED: GPI transamidase component PIG-S [Vitis vinifera]
Length=611

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/606 (67%), Positives = 474/606 (78%), Gaps = 21/606 (3%)
 Frame = -3

Query  2342  MAEISEAPSAEDNN----QKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPF  2175
             MAE SE+P    +         Q+ V+DFDP TMRKTKPG KRLFLTLT+  SF +G PF
Sbjct  1     MAEFSESPKDRPSEISELPDESQNSVSDFDPCTMRKTKPGLKRLFLTLTVLFSFFLGSPF  60

Query  2174  LLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQ  1995
             LLKSIEI+R+PLPF+DIDSL+ S+  SPLLFPC FQ +FV  D+     A EL   I  +
Sbjct  61    LLKSIEIYRSPLPFRDIDSLSDSVGSSPLLFPCHFQAIFVGFDNFD---AYELGISIKHE  117

Query  1994  MQKLTSAKSPVCGTCL-SNFTVAITLESSSSNCI--YSENQDIVWKCGALSGLDFEKSLD  1824
             M+KLT  K PVCGTC  SN+TV++T++S S  C   Y+     +W+CGA+   D     D
Sbjct  118   MKKLT--KHPVCGTCSDSNYTVSVTVDSGS-GCARNYNAESTCMWRCGAIGEFDLGGGGD  174

Query  1823  NTD--DFLESLLDsrs--srvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvve  1656
             +    +FL S+L S     +VY+VVVVNR  EVRAVVGKYRHAWI+G + E+     V  
Sbjct  175   DDGVDEFLGSVLGSCEGFRKVYSVVVVNRGGEVRAVVGKYRHAWIIGGVLEEGMNAMVAR  234

Query  1655  ifvevf---VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLL  1485
             +        VNGGKEEGSIHGEFMPVGADGR+VLSFNLLNADP DWIY WDFQ +D++LL
Sbjct  235   VAETFVKVFVNGGKEEGSIHGEFMPVGADGRIVLSFNLLNADPTDWIYGWDFQRIDEILL  294

Query  1484  APIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTST  1305
             AP+++AL P+A++SVESQVLYHTPKSSFS WDEK  SYIFS KDLPFFVNSNEWHLDTS 
Sbjct  295   APVIKALGPVANISVESQVLYHTPKSSFSYWDEKWDSYIFSTKDLPFFVNSNEWHLDTSI  354

Query  1304  AAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM  1125
             AAGGRSK+L FVVY+PS +ECPL L LPNGE+S TN FISPMWGGV VWNPP CS++SE 
Sbjct  355   AAGGRSKILQFVVYIPSAKECPLLLQLPNGEISVTNAFISPMWGGVAVWNPPGCSRDSES  414

Query  1124  Q-PLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFI  948
             + P RH IS ++L+KVFE+FMGQLRQLFGL SDSLY GA+ T+ LL SE+GFT+WELD +
Sbjct  415   KHPARHTISPQDLQKVFEIFMGQLRQLFGLKSDSLYAGASGTTNLLASERGFTEWELDVL  474

Query  947   SRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDG  768
             SRQHTCFNL+ C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAK + SNAS+G YD 
Sbjct  475   SRQHTCFNLVSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKLTQSNASLGIYDA  534

Query  767   SAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
             SAVSSRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA  REW+R KQ
Sbjct  535   SAVSSRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVLLAAFREWRRYKQ  594

Query  587   ENKKYL  570
             E  KYL
Sbjct  595   ETAKYL  600



>ref|XP_008235456.1| PREDICTED: GPI transamidase component PIG-S [Prunus mume]
Length=606

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/607 (65%), Positives = 478/607 (79%), Gaps = 14/607 (2%)
 Frame = -3

Query  2342  MAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             MAEI+E   P+ E       Q    DFDP TMRKTKPG KRL LT+++  SF++G+PF+ 
Sbjct  1     MAEITEPLLPATEAPETSKPQEPALDFDPKTMRKTKPGVKRLILTVSVLFSFVLGVPFIY  60

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+RAPLPF++I+SL+  I+  P  FPC+ Q +F+  D  ++    E S L  SQM 
Sbjct  61    KSVEIYRAPLPFREIESLSAEIDSKPFQFPCRLQAIFIGFDWKSSVATLESSIL--SQMT  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDF  1809
             KLTS ++P CGTC  N TV++ L +S+S C+ S       +CGA+  ++ +   +  D+ 
Sbjct  119   KLTS-QTPQCGTCSPNHTVSVVL-NSNSYCLQSRTASCSPECGAIRSVELDGDDEAVDEA  176

Query  1808  LESLL-------DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveif  1650
             LES+L             VY+VVVVNR EEVRAVVGKYRHAWIVG++SE E+V +  EIF
Sbjct  177   LESVLGGCSGSNSGSGGEVYSVVVVNRGEEVRAVVGKYRHAWIVGRVSEAEAVSRAAEIF  236

Query  1649  vevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQ  1470
             V+VFVNGGKEEG IHGEFMPVGADG VVLSFNLLNADP DW+YDWDFQ +D+ LLAPI++
Sbjct  237   VKVFVNGGKEEGLIHGEFMPVGADGTVVLSFNLLNADPRDWVYDWDFQSVDETLLAPIIE  296

Query  1469  ALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGR  1290
             A++P+A++SVESQVLYH PKSS S WD+K  SYIFS KDLPFFVNSNEWHLDTS A GGR
Sbjct  297   AMKPVANISVESQVLYHMPKSSLSFWDDKWDSYIFSTKDLPFFVNSNEWHLDTSIATGGR  356

Query  1289  SKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLR  1113
             SK+LHFV+Y+PS +ECPL L LP+GE+SKTN FISPMWGGV+VWNP +C K+SE + P R
Sbjct  357   SKMLHFVIYIPSAKECPLLLQLPDGEISKTNSFISPMWGGVIVWNPQTCRKDSESKHPSR  416

Query  1112  HKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHT  933
             H IS ++L+KVFEVFMGQ RQLFG  SD+LYVGA+ TS LL SE+GFT WELD +SR HT
Sbjct  417   HTISHQDLQKVFEVFMGQFRQLFGFKSDNLYVGASGTSSLLASERGFTVWELDVLSRMHT  476

Query  932   CFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSS  753
             CFNL  C TTLGSLSRLVQSLPRMIIMDEIGKQVK+SL+AAK + +NAS G Y+ SAVSS
Sbjct  477   CFNLHSCATTLGSLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLAQTNASHGVYNASAVSS  536

Query  752   RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKY  573
             RQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA +REW+R KQENKKY
Sbjct  537   RQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAAVREWRRHKQENKKY  596

Query  572   LAWKAKV  552
             LAWK KV
Sbjct  597   LAWKTKV  603



>ref|XP_010247099.1| PREDICTED: GPI transamidase component PIG-S [Nelumbo nucifera]
Length=610

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/610 (65%), Positives = 469/610 (77%), Gaps = 19/610 (3%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISEA     N    E   V DFDP TMRKTKPG KRL L L++  SF +G PFLLKS
Sbjct  1     MAEISEARETATNTSHGET--VTDFDPKTMRKTKPGLKRLILILSVLFSFFLGAPFLLKS  58

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNL--DHSTTSTASELSFLITSQMQ  1989
             IEI+R+PLPF++ID L   +E  PL  PC+FQVVF+     +S  S A EL  LI  +M+
Sbjct  59    IEIYRSPLPFREIDMLLNHLESKPLSLPCRFQVVFLGFYGHNSDESRADELGLLIRERMR  118

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQ-DIVWKCGALSGLDFEKSLDNT--  1818
             KLT    PVCG C +N+ V++ ++SS  +CI + N    +W+CG      F +SL +   
Sbjct  119   KLT-GNDPVCGGCGNNYPVSVMVDSSL-DCIPNRNDAGCLWRCGNGDVSGFLESLRDDEA  176

Query  1817  -DDFLESLLDs------rssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvv  1659
              D+ LESLL         S +VYTVVVVNRD+E R VVGK+RHAWIVGK+SE ++V    
Sbjct  177   FDELLESLLQRDGGCSDSSGKVYTVVVVNRDKETRVVVGKHRHAWIVGKVSEMDAVSITA  236

Query  1658  eifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAP  1479
             +IFV+ F+NGGK+EG +  EFMPVGADGRVVLSF+LLNADPHDWIYDWDFQE+D+ +LAP
Sbjct  237   DIFVKFFMNGGKKEGLVRAEFMPVGADGRVVLSFSLLNADPHDWIYDWDFQEIDETMLAP  296

Query  1478  IVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAA  1299
             +++AL P+AD SVESQVLYHTPKSSFS WDEK  SYIFS KDLPFFVNSNEWHLDTS AA
Sbjct  297   VIEALAPVADTSVESQVLYHTPKSSFSYWDEKLASYIFSTKDLPFFVNSNEWHLDTSIAA  356

Query  1298  GGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM--  1125
             GGRSK+L FV+Y+PS +ECPL L LPNGE+S TNGFISPMWGGVVVWN P+C K+ E   
Sbjct  357   GGRSKILQFVIYIPSAKECPLLLQLPNGEISTTNGFISPMWGGVVVWNSPNCLKDQESGN  416

Query  1124  QPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFIS  945
               +R  IS+++L+KVFEVF+GQLRQLFGLNSD+L V  +  S  L S+ GFT+WELD +S
Sbjct  417   HTIR-TISTQDLEKVFEVFIGQLRQLFGLNSDNLKVAGSGISNFLASQSGFTEWELDVLS  475

Query  944   RQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGS  765
             R HTCFNLL C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL AA  +  NAS+G YD S
Sbjct  476   RHHTCFNLLSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLKAASLAQENASLGIYDAS  535

Query  764   AVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQE  585
             AVSSRQ+R LAEDAF+HPS+MSVSYYSFEHCFA+Y+PFFLPV LH+ILA L+EW+R K+E
Sbjct  536   AVSSRQSRVLAEDAFFHPSIMSVSYYSFEHCFAIYTPFFLPVTLHIILAALKEWRRYKKE  595

Query  584   NKKYLAWKAK  555
               KYLAWKAK
Sbjct  596   QAKYLAWKAK  605



>ref|XP_004138391.1| PREDICTED: GPI transamidase component PIG-S-like [Cucumis sativus]
 gb|KGN45842.1| hypothetical protein Csa_6G014620 [Cucumis sativus]
Length=609

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/608 (63%), Positives = 475/608 (78%), Gaps = 15/608 (2%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISE       +  S ++ ++ FDP TMR TKPG KRL LT+++F SFL+GLPFL KS
Sbjct  1     MAEISEPSKPPQLDSGSSEAGLSQFDPKTMRNTKPGFKRLILTISVFSSFLLGLPFLWKS  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPFKDID+L+  IE SPL FPC F+V+F   D S  S A +L   I  +M KL
Sbjct  61    VEIYRAPLPFKDIDALSSHIESSPLQFPCTFRVIFFGFD-SMASRAEQLKSSILDEMTKL  119

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNC--IYSENQDIVWKCGALSGLDFEKSLDN----  1821
             +S KS +CG+C +N+ V++ +E S S+C    ++     W+CGALS  DF  SL+N    
Sbjct  120   SS-KSSLCGSCSNNYAVSVVIE-SGSDCSQTRTDASSCSWRCGALSASDFAASLENGLQS  177

Query  1820  TDDFLESLLD-----srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvve  1656
              DDFLE  L      +   RVY+VVV+N+ E V+A +GKYRH WIVG++SE E++ KV E
Sbjct  178   ADDFLEVALGGCYKPASGGRVYSVVVMNKGENVKATIGKYRHGWIVGRVSEAEAIAKVAE  237

Query  1655  ifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPI  1476
              FV++F NGG E+G I GEFMPVGADG++ LSFNLLNADP DWIYDWDFQ++D+++L P+
Sbjct  238   TFVKLFGNGGTEDGLIPGEFMPVGADGKIFLSFNLLNADPDDWIYDWDFQKVDEVILKPL  297

Query  1475  VQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAG  1296
             ++ L PIA+VSVESQVLYHTP SSFS WD KQ SYIF+ KDLPFFVNSNEWHLDTS AAG
Sbjct  298   IEELTPIANVSVESQVLYHTPTSSFSYWDNKQESYIFNTKDLPFFVNSNEWHLDTSIAAG  357

Query  1295  GRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL  1116
             GRSK+LHFVVY+PS  ECPL L LP+G++S+TNGFISP WGGV+VWNP  C ++ E + L
Sbjct  358   GRSKILHFVVYIPSARECPLLLQLPDGQISETNGFISPTWGGVIVWNPKGCLRDHESKLL  417

Query  1115  -RHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQ  939
              RH I   EL+K+ EVF+GQ RQLFGL S+  +VG + T  +LTS+KGFT+WE+DF+SRQ
Sbjct  418   HRHMILYPELEKIVEVFLGQFRQLFGLKSNPQHVGLSGTFNILTSQKGFTEWEMDFLSRQ  477

Query  938   HTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAV  759
             H+CFNL  C ++LGSLSRLVQSLPRMII+DEIGKQVK+SL+AA  +  NAS+G +D +A+
Sbjct  478   HSCFNLHSCASSLGSLSRLVQSLPRMIIIDEIGKQVKYSLEAANLAQKNASMGVFDAAAI  537

Query  758   SSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENK  579
             SSRQARSLAEDAF+HPS+MSVSY+SFEHCFAVYSPFFLPVALHVILA +REWKR KQE+K
Sbjct  538   SSRQARSLAEDAFFHPSIMSVSYFSFEHCFAVYSPFFLPVALHVILAAVREWKRYKQEHK  597

Query  578   KYLAWKAK  555
             KY+A+ AK
Sbjct  598   KYIAFLAK  605



>ref|XP_008456783.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Cucumis 
melo]
Length=609

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/607 (63%), Positives = 471/607 (78%), Gaps = 13/607 (2%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EISE       +  S ++ ++ FDP TMR TKPG KRL LT+++F SFL+GLPFL K+
Sbjct  1     MGEISEPSEPPQLDSGSSEAGLSQFDPKTMRNTKPGLKRLILTISVFSSFLLGLPFLWKT  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPFKDID+L+  IE SPL FPC F+V+F   D S  S A +L   I  +M KL
Sbjct  61    VEIYRAPLPFKDIDALSYHIESSPLQFPCTFRVLFFGFD-SIASRAEQLKSSILDEMTKL  119

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSS-NCIYSENQDIVWKCGALSGLDFEKSLDN----T  1818
             +S KS + G+C +N+ V++ +ES S  +   ++     W+CGALS  DF  SL+N     
Sbjct  120   SS-KSSLYGSCSNNYAVSVVIESGSECSQTRTDASSCPWRCGALSASDFAASLENGFQSA  178

Query  1817  DDFLESLLD-----srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvvei  1653
             DDFLE  L      +   RVY+VVV+N+ E V A +GKYRH WIVG++SE ++  KV E 
Sbjct  179   DDFLEVALGGCSKPASGVRVYSVVVMNKGENVVATIGKYRHGWIVGRVSEADATAKVAET  238

Query  1652  fvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIV  1473
             FV++F NGG E G I GEFMPVGADG++ LSFNLLNADP DWIYDWDFQ++D+++L P++
Sbjct  239   FVKLFGNGGTEGGLIPGEFMPVGADGKIFLSFNLLNADPDDWIYDWDFQKVDEVILKPLI  298

Query  1472  QALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGG  1293
             + L PIA+VSVESQVLYHTP SSFS WD KQ SYIF+ KDLPFFVNSNEWHLDTS AAGG
Sbjct  299   EELAPIANVSVESQVLYHTPTSSFSYWDNKQESYIFNTKDLPFFVNSNEWHLDTSIAAGG  358

Query  1292  RSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLR  1113
             RSK+LHFVVYVPS  ECPL L LP+G++S+TNGFISP WGGV+VWNP  C ++ E + LR
Sbjct  359   RSKILHFVVYVPSARECPLLLELPDGQISETNGFISPTWGGVIVWNPKGCLRDHESKQLR  418

Query  1112  -HKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQH  936
              H IS+ EL+K+ EVF+GQ RQLFGL S+  +VG + T  +LTS+KGFT+WE+DF+SRQH
Sbjct  419   RHMISNPELEKIVEVFLGQFRQLFGLKSNPQHVGLSGTFNILTSQKGFTEWEMDFLSRQH  478

Query  935   TCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS  756
             +CFNL  C ++LGSLSRLVQSLPRMII+DEIGKQVK+SL+AA  +  NAS+G +D +A+S
Sbjct  479   SCFNLHSCASSLGSLSRLVQSLPRMIIIDEIGKQVKYSLEAANLAQKNASMGVFDAAAIS  538

Query  755   SRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             SRQARSLAEDAF+HPS+MSVSY+SFEHCFAVYSPFFLPVALHVILA LREWKR KQE+KK
Sbjct  539   SRQARSLAEDAFFHPSIMSVSYFSFEHCFAVYSPFFLPVALHVILAALREWKRYKQEHKK  598

Query  575   YLAWKAK  555
             YLA+ AK
Sbjct  599   YLAFLAK  605



>ref|XP_004491711.1| PREDICTED: GPI transamidase component PIG-S-like [Cicer arietinum]
Length=587

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/603 (63%), Positives = 471/603 (78%), Gaps = 28/603 (5%)
 Frame = -3

Query  2342  MAEISEAP-----SAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLP  2178
             MAEIS++P     S  +N Q       ++FD  TMRKTKPG KRL +++T+ ISF++G P
Sbjct  1     MAEISDSPPDSTKSMSENIQTHTTDSTSEFDSKTMRKTKPGIKRLIMSVTVLISFILGFP  60

Query  2177  FLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITS  1998
             FL KSIEI+RAPLPF  IDS +  IE +PLLFPC+F+ +FV  +   +    E+   I S
Sbjct  61    FLWKSIEIYRAPLPFDQIDSFSSIIESNPLLFPCRFRAIFVGFNFRVSQF--EVGAEIRS  118

Query  1997  QMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNT  1818
             +M +LT   S  CG C  N++V+             E +++ ++ G L+G D     +  
Sbjct  119   KMSELTPGASR-CG-CDGNYSVSA-----------DEVKNVDFE-GKLTGSD-----EEA  159

Query  1817  DDFLESLLDsrss-rvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvev  1641
             D+F++S+++     + Y+V+VVN  EEVR V+GKYRHAWIVGK+SE+E+V +V EIF +V
Sbjct  160   DEFVKSVVNVYGEDKTYSVLVVNEGEEVRTVIGKYRHAWIVGKVSEEEAVLRVAEIFSKV  219

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGG E+GSI GEFMPVG+DGR+VLSF+LLNADP DWIYDWDF E+D  LL P+++AL+
Sbjct  220   FVNGGSEDGSIRGEFMPVGSDGRIVLSFSLLNADPRDWIYDWDFGEIDHTLLQPVIEALQ  279

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             PIADV+VESQVLYH PKSSFS WD+K GS+IFS +DLPFFVNSNEWHLDTS AAGGRSKV
Sbjct  280   PIADVTVESQVLYHVPKSSFSYWDDKHGSHIFSTEDLPFFVNSNEWHLDTSVAAGGRSKV  339

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLRHKI  1104
             L  VVY+ S +ECPLQL LPNGE+SKTNGFISPMWGGVVVWNP SC K+ + + P+RH I
Sbjct  340   LQLVVYITSAKECPLQLELPNGEISKTNGFISPMWGGVVVWNPQSCIKDLQSKDPVRHMI  399

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             S ++L+K+FEV MGQLRQL GL SD LYVG + TS LL SE+GFT+WELD +SR+H CFN
Sbjct  400   SPQDLEKLFEVLMGQLRQLLGLKSDHLYVGESGTSILLGSERGFTEWELDVLSRKHFCFN  459

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             LL C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAKS+ +NA++G YD SAVSSRQ+
Sbjct  460   LLSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKSAQTNATVGMYDASAVSSRQS  519

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             RSLAEDAF HPS+MS+SYYSFEHCFA+Y+PFFLPV +HV+LA LREWKR KQEN+KYLAW
Sbjct  520   RSLAEDAFLHPSIMSISYYSFEHCFAIYAPFFLPVIMHVLLAALREWKRYKQENRKYLAW  579

Query  563   KAK  555
             K K
Sbjct  580   KTK  582



>ref|XP_010104188.1| hypothetical protein L484_007028 [Morus notabilis]
 gb|EXB99120.1| hypothetical protein L484_007028 [Morus notabilis]
Length=590

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/613 (62%), Positives = 480/613 (78%), Gaps = 41/613 (7%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAE+SE   AE +  +     V++FDP +MRKTKPG KRL LTL++ +SFL+G PFL KS
Sbjct  1     MAEVSEPAIAETSRPEEP---VSEFDPKSMRKTKPGLKRLILTLSVLLSFLLGFPFLWKS  57

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPF++ID  +  ++ +PLLFPC FQ + +  +   + ++ +L F I+     L
Sbjct  58    VEIYRAPLPFREIDHFSAQLDSAPLLFPCHFQAILIGFNSKPSISSDDLQFAISD----L  113

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLE  1803
             TS ++P CG C +++TV+++++S                  A+  +DF+   +  D+ LE
Sbjct  114   TS-QTPQCGACSASYTVSVSVDSD-----------------AICAVDFDSDDEAVDELLE  155

Query  1802  SLLD--srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNG  1629
             S L   +   +VY+VVVVNRDE+VRAVVGKYRHAWI G++SE  ++ +  EIFV+VFVNG
Sbjct  156   STLGGPAGERKVYSVVVVNRDEDVRAVVGKYRHAWISGRVSEAAALSRAAEIFVKVFVNG  215

Query  1628  GKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIAD  1449
             GKEEG IHGEFMPVGADGR+VLSFNLLNA+P+D +YDW+FQ++++ +LAP+++ALRP+A+
Sbjct  216   GKEEGLIHGEFMPVGADGRIVLSFNLLNANPNDGVYDWEFQKIEETVLAPVIEALRPVAN  275

Query  1448  VSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFV  1269
             +SVESQVLYHTPK SFS WD K  SYIF+ KDLPFFVNSNEWHLDTS AAGGRSK+LHFV
Sbjct  276   ISVESQVLYHTPKFSFSYWDHKWSSYIFNTKDLPFFVNSNEWHLDTSVAAGGRSKILHFV  335

Query  1268  VYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNP--PSCSKNSEMQPLRHKISSE  1095
             VYVPS +E PL L LPNGE+SKTNGFISPMWGGV+VWNP  P  + +S+ QP+RHKIS +
Sbjct  336   VYVPSADEWPLLLQLPNGEVSKTNGFISPMWGGVIVWNPEDPGDTPDSK-QPVRHKISYQ  394

Query  1094  ELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQ  915
             +L+KVFEV MGQLRQLFGL SD+L+VG++ TSRLL S++GFT WELD +SRQHTCFNL  
Sbjct  395   DLQKVFEVSMGQLRQLFGLKSDNLFVGSSGTSRLLASDRGFTLWELDVLSRQHTCFNLHS  454

Query  914   CGTTLGSLSRLVQSLPRMIIMDEIGKQ-----------VKFSLDAAKSSLSNASIGNYDG  768
             C TTLGSLSRLVQSLPRMIIMDEIGKQ           V +SL+ AK +  NAS+G YD 
Sbjct  455   CATTLGSLSRLVQSLPRMIIMDEIGKQVTCPDGLFTQAVHYSLEVAKLAQVNASLGVYDA  514

Query  767   SAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
             SAV+SRQARSLAEDAFYHPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQ
Sbjct  515   SAVASRQARSLAEDAFYHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVLLAALREWRRHKQ  574

Query  587   ENKKYLAWKAKVN  549
             ENKKYLAWK K+N
Sbjct  575   ENKKYLAWKTKIN  587



>gb|KDP26366.1| hypothetical protein JCGZ_17524 [Jatropha curcas]
Length=617

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/614 (62%), Positives = 474/614 (77%), Gaps = 22/614 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSF-------VNDFDPNTMRKTKPGRKRlfltltifisflig  2184
             MAEISE P A +   +  ++        ++DFDP TMR TKPG KR+FLTL++ +SFL+G
Sbjct  1     MAEISEPPIAAERKSEVPETPEISPGDPLSDFDPKTMRTTKPGLKRIFLTLSVLLSFLLG  60

Query  2183  LPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLI  2004
              PFL KS+EI+R+PLPF D++ L+  IE +PL FPC FQ +F+N + +        S L 
Sbjct  61    FPFLWKSVEIYRSPLPFDDMEKLSKEIESNPLQFPCHFQAIFINSNSNVNPQYLHSSIL-  119

Query  2003  TSQMQKLTSAKSPVCGTCLSNFTVAITLESSSS-NCIYS--ENQDIVWKCGALSGLD-FE  1836
              SQM KL   ++  CGTC SNF++++T+ESS+  +C  S   N   ++KCG +  ++   
Sbjct  120   -SQMTKL-RPQTFQCGTCSSNFSLSVTVESSTDRDCKQSLHVNPSCLYKCGVIPVINFDF  177

Query  1835  KSLDNTDDFLESLLDsr------ssrvytvvvvnrdeevravVGKYRHAWIVGK-LSEQe  1677
                D  D+ L+S+L+              V+  +  + VRA VGK+RHAWIVG+ L  + 
Sbjct  178   GDDDGVDEALKSVLEDSCSGFGGKVYSVVVLYQDDVKGVRAAVGKHRHAWIVGRDLEAEA  237

Query  1676  svekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELD  1497
             +VE+V EIFV+VF NGG++EGSIHGEFMPVGADGR+VLSFNLLNA+P DWIYDWDFQ +D
Sbjct  238   TVERVAEIFVKVFANGGRDEGSIHGEFMPVGADGRIVLSFNLLNANPGDWIYDWDFQRID  297

Query  1496  DMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHL  1317
             ++LLAP+++AL P+A++SVESQVLYHTPKSSFS WDEK GSYIFS+KDLPFFVNSNEWHL
Sbjct  298   EILLAPVIEALEPLANISVESQVLYHTPKSSFSSWDEKLGSYIFSVKDLPFFVNSNEWHL  357

Query  1316  DTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSK  1137
             DTS AAGGRSK+L FVVYVPS +ECPL L LP G++S TN FISPMWGGV+VW+PP+C K
Sbjct  358   DTSIAAGGRSKILQFVVYVPSAKECPLLLQLPTGKISATNSFISPMWGGVMVWDPPTCLK  417

Query  1136  NSEMQ-PLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWE  960
             +SE + P RH IS+E+L+K+FEVFMGQ RQLFGL S S++VGA  +  LL SE+GFT+WE
Sbjct  418   DSESKLPGRHIISTEDLEKIFEVFMGQFRQLFGLKSGSIFVGAHGSCNLLASERGFTEWE  477

Query  959   LDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIG  780
             LD + RQHTCFNL    TTLGSLSRLVQSLPRMII++EIGKQVKFSL++AK +  NA++G
Sbjct  478   LDVLLRQHTCFNLHSSATTLGSLSRLVQSLPRMIIIEEIGKQVKFSLESAKLAQLNATLG  537

Query  779   NYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWK  600
              YD SAVSSRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LRE K
Sbjct  538   VYDASAVSSRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSIHVLLAALRELK  597

Query  599   RCKQENKKYLAWKA  558
             R KQEN KYL WKA
Sbjct  598   RYKQENAKYLLWKA  611



>ref|XP_010685048.1| PREDICTED: GPI transamidase component PIG-S-like [Beta vulgaris 
subsp. vulgaris]
Length=624

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/609 (63%), Positives = 468/609 (77%), Gaps = 23/609 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EIS   S   +  + E      FD +TMRKTKPG KR+ +TL++  SFL+G+PFLLKS
Sbjct  22    MTEISPGDSKLPSENQPES-----FDSSTMRKTKPGIKRISITLSVLFSFLLGIPFLLKS  76

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+R+PLPFK +DSL+  IE  PLLFPC+FQVVF+  D    + A EL F I  +M+++
Sbjct  77    VEIYRSPLPFKYMDSLSSVIESEPLLFPCRFQVVFLGFDE--LNDADELGFSIAERMREV  134

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSEN--QDIVWKCGALSGLDFEKSLDNTDDF  1809
                   VCG+C +NFTV+++LE   S C+ SEN       +CG L   DF    D+ D+ 
Sbjct  135   V-GDDRVCGSCQTNFTVSVSLELEHS-CVQSENGGNGCSLQCGLLKDADFGAKWDD-DEL  191

Query  1808  LESLLDsrss----------rvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvv  1659
             ++ L+D   S          +VY+VVVV RDE+VRAVVGK+RH WI+GK+SE E+VE++ 
Sbjct  192   VDELVDDALSINQKCSSDNGKVYSVVVVKRDEKVRAVVGKHRHGWIIGKVSEAEAVERIA  251

Query  1658  eifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAP  1479
             EIFV VF+NGGKEEGSIH EFMPVGADGRVVLSF+LLNADPHDWIYDWDFQ L +  L P
Sbjct  252   EIFVRVFINGGKEEGSIHSEFMPVGADGRVVLSFSLLNADPHDWIYDWDFQRLYETQLTP  311

Query  1478  IVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAA  1299
             +V+A+  IA +SVESQ+LYHTPKS FS WD+  G+YI++ KDLPFFVNSNEWHLDTS+ A
Sbjct  312   VVEAMASIAIISVESQILYHTPKSFFSHWDDHTGAYIYNTKDLPFFVNSNEWHLDTSSGA  371

Query  1298  GGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQP  1119
             GGRSK+LH VVYVPS +ECPL L LPNGE+S TNGFISPMWGGV+VWNP  CS +S+ + 
Sbjct  372   GGRSKILHVVVYVPSAKECPLSLQLPNGEISATNGFISPMWGGVIVWNPSGCSSHSQTKG  431

Query  1118  -LRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISR  942
               RH I  ++L+ + E+F+GQLRQLFGL S++LYVG++ T  LL SEKGFT+WELD ++R
Sbjct  432   HARHSIPFKDLENIVEIFLGQLRQLFGLKSETLYVGSSGTVNLLASEKGFTKWELDLLAR  491

Query  941   QHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSA  762
              HTCFNL  C TTLGSLSRLVQSLPRMII DEIGKQVK+SLDAA  +  NA++G YD SA
Sbjct  492   HHTCFNLQSCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLDAADFARRNATLGAYDDSA  551

Query  761   VSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQEN  582
             V SRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPVA+HV+LA ++EWKR KQE 
Sbjct  552   VLSRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVAMHVLLAAVKEWKRYKQEK  611

Query  581   KKYLAWKAK  555
              KYL WKAK
Sbjct  612   MKYLTWKAK  620



>ref|XP_011024639.1| PREDICTED: GPI transamidase component PIG-S [Populus euphratica]
Length=608

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/604 (64%), Positives = 463/604 (77%), Gaps = 14/604 (2%)
 Frame = -3

Query  2336  EISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIE  2157
             EI+E+P+              +FD  TMR+TKPG KRLFLT T+ +SFL+G PFL KS+E
Sbjct  4     EITESPNHPPPETPPTPPSEPEFDSKTMRRTKPGLKRLFLTFTVLVSFLLGFPFLFKSVE  63

Query  2156  IHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTS---TASELSFLITSQMQK  1986
             I+R+PLPF+DIDSL+  +  +P LFPC FQ + V  D  ++S      EL   I S++ K
Sbjct  64    IYRSPLPFQDIDSLSNDVVSNPFLFPCHFQAILVPFDPKSSSIDLNLDELELSIRSKITK  123

Query  1985  LTS-AKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNT-DD  1812
             L S   +  CG C +NFT+++TL+    +C  S ++   +KCGA+  +D +   D + D+
Sbjct  124   LASKGIASQCGACTNNFTLSLTLDDG--DCTQSSSK--FYKCGAIRAVDLDFGDDESVDE  179

Query  1811  FLESL-LDs--rssrvytvvvvnrdeevravVGKYRHAWIVGK-LSEQesvekvveifve  1644
              LES  LDS  +   V  VV  +  E V+ VVGKYRHAWIVG+    +E  E++ EIFV 
Sbjct  180   ALESAGLDSGGKVYSVVVVVNGDGVEGVKVVVGKYRHAWIVGRDWGVEEVAERLAEIFVR  239

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VFVNGG+EEG IHGEFMPVGADG++VLSFNLLNADP DW YDWDFQ++D+ LLAP++ AL
Sbjct  240   VFVNGGREEGLIHGEFMPVGADGKIVLSFNLLNADPSDWTYDWDFQKIDETLLAPMIDAL  299

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
              PIA++SVESQVLYHTPK S S WDEK G YIFS KDLPFFVNSNEWHLDTS AAGGRSK
Sbjct  300   GPIANISVESQVLYHTPKFSVSSWDEKLGGYIFSTKDLPFFVNSNEWHLDTSIAAGGRSK  359

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHK  1107
             +L FVVYVPS +ECPL L LPNGE+SKTN FISPMWGGV+VWNP SCS++S+ + L RH 
Sbjct  360   ILQFVVYVPSAKECPLLLQLPNGEISKTNAFISPMWGGVMVWNPQSCSRDSDSELLVRHI  419

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             +S E+L+K+FEVF+GQ RQLFGL S SL+VGA  T  LL SEKGFT+WELD +SRQHTCF
Sbjct  420   MSPEDLQKIFEVFVGQFRQLFGLKSGSLHVGAMGTYSLLASEKGFTEWELDVLSRQHTCF  479

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             N+    TTLGSLS+LVQSLPRMIIMDEIGKQVKFSL+AAK +  NAS+G YD SAVSSRQ
Sbjct  480   NIHSSATTLGSLSKLVQSLPRMIIMDEIGKQVKFSLEAAKLARVNASLGFYDASAVSSRQ  539

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             ARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQE  KYL 
Sbjct  540   ARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVLLAALREWRRYKQEKAKYLL  599

Query  566   WKAK  555
             WKAK
Sbjct  600   WKAK  603



>ref|XP_010036801.1| PREDICTED: GPI transamidase component PIG-S [Eucalyptus grandis]
 gb|KCW48446.1| hypothetical protein EUGRSUZ_K02143 [Eucalyptus grandis]
 gb|KCW48447.1| hypothetical protein EUGRSUZ_K02143 [Eucalyptus grandis]
Length=606

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/604 (61%), Positives = 463/604 (77%), Gaps = 10/604 (2%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEI+E+     +    +     +FDP TMR+TKPG KRL LTL++ +SFLIG PFL KS
Sbjct  1     MAEIAESSDTSPDPPAPKSDRREEFDPETMRRTKPGAKRLVLTLSVLVSFLIGFPFLWKS  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTS--TASELSFLITSQMQ  1989
             +EI+RAPL F DIDSL+  +E  PL FPC F+ VFV  D  +     A +L   I ++M 
Sbjct  61    VEIYRAPLLFDDIDSLSKRMESEPLQFPCNFRAVFVGFDFGSEDFDRADDLKSSIANRMD  120

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSEN--QDIVWKCGALSGLDFEKSLDNTD  1815
                S  S  CGTC SN++V++ +ES+S +C+ S    +   ++CGA+S +DF    ++ D
Sbjct  121   GFVSGTSQ-CGTCSSNYSVSVVMESNS-HCVQSRGGRRSCPYQCGAISSVDFASDDESID  178

Query  1814  DFLESLLDsr----ssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifv  1647
               LE +L       + +VYTVVVVN D   +AV+GKYRHAWIVG+  E+++VE + EIFV
Sbjct  179   GSLERVLGGECSGLAGKVYTVVVVNEDAGDKAVIGKYRHAWIVGRTQEEKAVENIAEIFV  238

Query  1646  evfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQA  1467
             +VF NGGKEEG IHGEFMPVGADGR+VLSFNLLN DP DWIYDWDF  +++ +L+P+V+A
Sbjct  239   KVFSNGGKEEGLIHGEFMPVGADGRIVLSFNLLNTDPQDWIYDWDFNTIEEHMLSPLVEA  298

Query  1466  LRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRS  1287
             L PIA+++VESQVLYHTPKS ++ WD++  S+I    DLPFFVNSNEWHLDTSTAAGGRS
Sbjct  299   LGPIANITVESQVLYHTPKSCYASWDDELKSFILKTGDLPFFVNSNEWHLDTSTAAGGRS  358

Query  1286  KVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHK  1107
             KVL  V+Y+PS +ECPL L LPN E+SK NG+ISPMWGGVVVWNP +C ++ E  P  HK
Sbjct  359   KVLQLVLYIPSAKECPLNLQLPNREISKANGYISPMWGGVVVWNPKNCLQDPEKYPAWHK  418

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             IS ++L+K+FEVF+ Q+RQL GL SD+L++G +  S +L SEKGFT+WELD ++RQHTCF
Sbjct  419   ISPQDLQKIFEVFVAQIRQLIGLKSDNLFIGTSGRSIMLASEKGFTEWELDALTRQHTCF  478

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NL  C TTL SLSRLVQSLPRMII DEIGKQVK S++AAK + S+AS G YD +AVSSRQ
Sbjct  479   NLRSCATTLSSLSRLVQSLPRMIIKDEIGKQVKLSMEAAKQAESDASHGIYDAAAVSSRQ  538

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             +R+LAEDAF+HPS+MS+SYYSFEHCFAVYSPFFLPV+LHV+LA LREWKR ++ENKKY A
Sbjct  539   SRALAEDAFFHPSIMSISYYSFEHCFAVYSPFFLPVSLHVVLAALREWKRYQRENKKYFA  598

Query  566   WKAK  555
             WKA+
Sbjct  599   WKAR  602



>gb|KEH22621.1| GPI transamidase component PIG-S, related protein [Medicago truncatula]
Length=590

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/601 (62%), Positives = 462/601 (77%), Gaps = 23/601 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVND----FDPNTMRKTKPGRKRlfltltifisfligLPF  2175
             MAEIS++P       ++ Q+ + D    FD  TMRKTKPG KRLF+TLT+ ISF++G P 
Sbjct  1     MAEISDSPPEPKTTDENPQTPIADSASQFDSKTMRKTKPGVKRLFITLTVLISFILGFPL  60

Query  2174  LLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQ  1995
             L KSIEI+RAPLPF  I+S +  IE SPLLFPCKF+ +F+  +   ++  +EL   I S+
Sbjct  61    LWKSIEIYRAPLPFDRIESFSSKIESSPLLFPCKFRAIFIGFNFRGSN--NELRDAIRSK  118

Query  1994  MQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTD  1815
             M +     S  CG C  ++TV++   S   N +     D         G    ++ +  D
Sbjct  119   MIEFNRGNSQ-CG-CNGDYTVSVVERSDEINAV-----DF--------GGKLRRNDEEAD  163

Query  1814  DFLESLLDsrssrvytvvvvnr-deevravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
             + ++++++         VVV   ++EV+AV+GKYRH WIVGK+ E+E+V +V EIF +VF
Sbjct  164   ELVKNMVNVYGEEKVYSVVVVNGEDEVKAVIGKYRHGWIVGKVLEEEAVLRVAEIFGKVF  223

Query  1637  VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRP  1458
             VNGG E+G I  EFMPVG+DGR+VLSF+LLNADP DW+YDWDF ++D+ LL P+++AL+P
Sbjct  224   VNGGSEDGLIRSEFMPVGSDGRIVLSFSLLNADPRDWVYDWDFGQIDETLLKPVIEALQP  283

Query  1457  IADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVL  1278
             IADV+VESQVLYHTPKSSFS WD++ GS+IFS +DLPFFVNSNEWHLDTS AAGGRSKVL
Sbjct  284   IADVTVESQVLYHTPKSSFSSWDDEHGSHIFSTQDLPFFVNSNEWHLDTSVAAGGRSKVL  343

Query  1277  HFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLRHKIS  1101
               VVY+PS +ECPLQL L NGE+SKTNGFISPMWGGVVVWNP SC K+ E + P+RH IS
Sbjct  344   QLVVYIPSAKECPLQLELANGEISKTNGFISPMWGGVVVWNPQSCIKDLESKDPVRHMIS  403

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
              ++L+K+FEV MGQLRQL GL SD LYVG + TS LL SE+GFT+WELD +SR+H CFNL
Sbjct  404   PQDLQKLFEVLMGQLRQLLGLKSDDLYVGESGTSILLGSERGFTEWELDVLSRKHFCFNL  463

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
             L C T LGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAKS+ +NA+IG YD SAVSSRQ+R
Sbjct  464   LSCATALGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKSAQNNATIGMYDASAVSSRQSR  523

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             SLAEDAF+HPS+MS+SYYSFEHCFA+YSPFFLPV +H++LAVLREWKR KQEN+KYLAWK
Sbjct  524   SLAEDAFFHPSIMSISYYSFEHCFAIYSPFFLPVTMHILLAVLREWKRYKQENRKYLAWK  583

Query  560   A  558
              
Sbjct  584   G  584



>ref|XP_004160758.1| PREDICTED: GPI transamidase component PIG-S-like [Cucumis sativus]
Length=630

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/629 (60%), Positives = 473/629 (75%), Gaps = 36/629 (6%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISE       +  S ++ ++ FDP TMR TKPG KRL LT+++F SFL+GLPFL KS
Sbjct  1     MAEISEPSKPPQLDSGSSEAGLSQFDPKTMRNTKPGFKRLILTISVFSSFLLGLPFLWKS  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPFKDID+L+  IE SPL FPC F+V+F   D S  S A +L   I  +M KL
Sbjct  61    VEIYRAPLPFKDIDALSSHIESSPLQFPCTFRVIFFGFD-SMASRAEQLKSSILDEMTKL  119

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNC--IYSENQDIVWKCGALSGLDFEKSLDN----  1821
             +S KS +CG+C +N+ V++ +E S S+C    ++     W+CGALS  DF  SL+N    
Sbjct  120   SS-KSSLCGSCSNNYAVSVVIE-SGSDCSQTRTDASSCSWRCGALSASDFAASLENGLQS  177

Query  1820  TDDFLESLLD-----srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvve  1656
              DDFLE  L      +   RVY+VVV+N+ E V+A +GKYRH WIVG++SE E++ KV E
Sbjct  178   ADDFLEVALGGCYKPASGGRVYSVVVMNKGENVKATIGKYRHGWIVGRVSEAEAIAKVAE  237

Query  1655  ifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPI  1476
              FV++F NGG E+G I GEFMPVGADG++ LSFNLLNADP DWIYDWDFQ++D+++L P+
Sbjct  238   TFVKLFGNGGTEDGLIPGEFMPVGADGKIFLSFNLLNADPDDWIYDWDFQKVDEVILKPL  297

Query  1475  VQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFF---------------  1341
             ++ L PIA+VSVESQVLYHTP SSFS WD KQ SYIF+ KDLPF                
Sbjct  298   IEELTPIANVSVESQVLYHTPTSSFSYWDNKQESYIFNTKDLPFLLNVFVIRIEFISVSI  357

Query  1340  ------VNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPM  1179
                   VNSNEWHLDTS AAGGRSK+LHFVVY+PS  ECPL L LP+G++S+TNGFISP 
Sbjct  358   CLLTLPVNSNEWHLDTSIAAGGRSKILHFVVYIPSARECPLLLQLPDGQISETNGFISPT  417

Query  1178  WGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
             WGGV+VWNP  C ++ E + L RH I   EL+K+ EVF+GQ RQLFGL S+  +VG + T
Sbjct  418   WGGVIVWNPKGCLRDHESKLLHRHMILYPELEKIVEVFLGQFRQLFGLKSNPQHVGLSGT  477

Query  1001  SRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFS  822
               +LTS+KGFT+WE+DF+SRQH+CFNL  C ++LGSLSRLVQSLPRMII+DEIGKQVK+S
Sbjct  478   FNILTSQKGFTEWEMDFLSRQHSCFNLHSCASSLGSLSRLVQSLPRMIIIDEIGKQVKYS  537

Query  821   LDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLP  642
             L+AA  +  NAS+G +D +A+SSRQARSLAEDAF+HPS+MSVSY+SFEHCFAV SPFFLP
Sbjct  538   LEAANLAQKNASMGVFDAAAISSRQARSLAEDAFFHPSIMSVSYFSFEHCFAVNSPFFLP  597

Query  641   VALHVILAVLREWKRCKQENKKYLAWKAK  555
             VALHVILA +REWKR KQE+KKY+A+ AK
Sbjct  598   VALHVILAAVREWKRYKQEHKKYIAFLAK  626



>ref|XP_003551396.1| PREDICTED: GPI transamidase component PIG-S-like [Glycine max]
Length=587

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/603 (61%), Positives = 458/603 (76%), Gaps = 25/603 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEIS++PS   + +++ Q+   + D  T R TKPG KRL +++T+  SF++G P L KS
Sbjct  1     MAEISDSPSTSKSAEENTQTQTPESDLKTTRNTKPGVKRLIISVTVLFSFILGFPLLWKS  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             IEI+RAPLPF  ID+ +  IE  PL FPC FQ +F+  D     +  ++   I  +M  L
Sbjct  61    IEIYRAPLPFDRIDAFSSQIESKPLSFPCHFQAIFIGFDFDFKVSHDDVGAAIARKMSDL  120

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLE  1803
             +      CG C  N++VA+ ++                  G ++  DF + L  +D+  +
Sbjct  121   SHGGG--CGGCGGNYSVAVAVDR-----------------GDINAFDFGEKLRGSDEDAD  161

Query  1802  SLL-----DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
              L+     +      Y+VVVVN + EVR+VVGKYRHAWIVG++ E+E+V  V E+FV+VF
Sbjct  162   ELVKSVVSEYGGGNAYSVVVVNEEGEVRSVVGKYRHAWIVGRVEEEEAVLHVAEVFVKVF  221

Query  1637  VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRP  1458
             VNGG  EGS+  EFMPVGADGR+VLSF+LLNADP DWIYDW+F+E+D+ LL P+++AL+P
Sbjct  222   VNGGDVEGSVRSEFMPVGADGRIVLSFSLLNADPRDWIYDWNFREIDETLLRPVIEALQP  281

Query  1457  IADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVL  1278
             IA+++VESQVLYHTPKSSFS WD+K GS++F  +DLPFFVNSNEWHLDTS AAGGRSKVL
Sbjct  282   IANITVESQVLYHTPKSSFSYWDDKHGSHMFRTEDLPFFVNSNEWHLDTSVAAGGRSKVL  341

Query  1277  HFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSE-MQPLRHKIS  1101
               VVY+PS +ECPLQL LPNGE+SKTNGFISPMWGGVVVWNP SC K+ E M P+RH IS
Sbjct  342   QLVVYIPSAKECPLQLELPNGEISKTNGFISPMWGGVVVWNPQSCIKDFESMDPVRHTIS  401

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
              ++L K+FEV MGQLRQL GL SD+LYVG + TS LL SE+GFT+WELD +SR+H CFNL
Sbjct  402   PQDLLKLFEVLMGQLRQLLGLKSDNLYVGESGTSILLGSERGFTEWELDVLSRKHICFNL  461

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
               C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAK + SNASIG Y+ SAVSSRQ+R
Sbjct  462   HSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKFAQSNASIGIYNASAVSSRQSR  521

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             SLAEDAF+HPS+MS+SYYSFEHCFA+YSPFFLPV +HV+LA LREWKR KQEN+KYLA K
Sbjct  522   SLAEDAFFHPSIMSISYYSFEHCFAIYSPFFLPVTMHVLLAALREWKRYKQENRKYLASK  581

Query  560   AKV  552
             AKV
Sbjct  582   AKV  584



>ref|XP_004290191.1| PREDICTED: GPI transamidase component PIG-S-like [Fragaria vesca 
subsp. vesca]
Length=588

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/608 (62%), Positives = 454/608 (75%), Gaps = 35/608 (6%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEI+E P    N          DFDP TMRKTKPG KRL LT+++  SF++G+P + KS
Sbjct  1     MAEITE-PLIPANQTPP------DFDPETMRKTKPGLKRLILTVSVLFSFILGVPLIYKS  53

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPF +IDSL+  I+ +PLLFPC+F  + V  D  ++  + E S L   QM +L
Sbjct  54    VEIYRAPLPFLEIDSLSAEIDSNPLLFPCRFLAILVGFDSESSIASLESSIL--HQMTEL  111

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLE  1803
             T  ++P CGTC  N +V++ L+                    L  +DF+   +  D+ L+
Sbjct  112   TR-QTPQCGTCSPNHSVSVVLDPDDHPL--------------LGAVDFDADDEAVDEALD  156

Query  1802  SLLDsr----------ssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvvei  1653
               L++                 VVV    +E RAVVGKYR+AWIVG++SE+E+V K  E+
Sbjct  157   EALEAVFRGGWGSGDRGEVYTVVVVNRGGDEARAVVGKYRNAWIVGRVSEEEAVAKAAEV  216

Query  1652  fvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIV  1473
             FV+VFVNGGKEEG IHGEFMPVGADG +VLSFNLLNADP DW+YDWDFQ +D  LLAPI+
Sbjct  217   FVKVFVNGGKEEGLIHGEFMPVGADGTLVLSFNLLNADPRDWVYDWDFQTVDATLLAPII  276

Query  1472  QALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGG  1293
             +A++P+A++SVESQVLYH PKSS S WD+K  SY+FS KDLPFFVNSNEWHLDTS AAGG
Sbjct  277   EAMKPVANISVESQVLYHVPKSSLSYWDDKWDSYVFSTKDLPFFVNSNEWHLDTSIAAGG  336

Query  1292  RSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PL  1116
             RSK+LHFVVY+PS +ECPL L LP+G++S TN FISPMWGGV+V NP +C K+SE +   
Sbjct  337   RSKMLHFVVYIPSAKECPLLLQLPDGQISMTNSFISPMWGGVIVLNPQTCRKDSESKHSS  396

Query  1115  RHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQH  936
             RH I  E+L+KVFEVFMGQ RQLF   SD+LYVGA+ T  LL SEKGFT WELD +SR H
Sbjct  397   RHTIMHEDLQKVFEVFMGQFRQLFSFRSDNLYVGASGTYNLLPSEKGFTVWELDVLSRMH  456

Query  935   TCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS  756
             TCFNL  C TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK + +NAS+G YD SAVS
Sbjct  457   TCFNLHSCATTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAQTNASLGIYDASAVS  516

Query  755   SRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             SRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HVILA LREW+R K+ENKK
Sbjct  517   SRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVILAALREWRRYKKENKK  576

Query  575   YLAWKAKV  552
             YL WKAK+
Sbjct  577   YLVWKAKM  584



>emb|CBI18338.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/568 (62%), Positives = 417/568 (73%), Gaps = 65/568 (11%)
 Frame = -3

Query  2255  MRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPC  2076
             MRKTKPG KRLFLTLT+  SF +G PFLLKSIEI+R+PLPF+DIDSL+ S+  SPLLFPC
Sbjct  1     MRKTKPGLKRLFLTLTVLFSFFLGSPFLLKSIEIYRSPLPFRDIDSLSDSVGSSPLLFPC  60

Query  2075  KFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCI  1896
              FQ +FV                                    SN+TV++T++S S  C 
Sbjct  61    HFQAIFVGD----------------------------------SNYTVSVTVDSGS-GCA  85

Query  1895  --YSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvnrdeevravVG  1722
               Y+     +W+C     + +   + N    + +++                       G
Sbjct  86    RNYNAESTCMWRCEGFRKV-YSVVVVNRGGEVRAVV-----------------------G  121

Query  1721  KYRHAWIVGKLSEQesvekvveifvevf---VNGGKEEGSIHGEFMPVGADGRVVLSFNL  1551
             KYRHAWI+G + E+     V  +        VNGGKEEGSIHGEFMPVGADGR+VLSFNL
Sbjct  122   KYRHAWIIGGVLEEGMNAMVARVAETFVKVFVNGGKEEGSIHGEFMPVGADGRIVLSFNL  181

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             LNADP DWIY WDFQ +D++LLAP+++AL P+A++SVESQVLYHTPKSSFS WDEK  SY
Sbjct  182   LNADPTDWIYGWDFQRIDEILLAPVIKALGPVANISVESQVLYHTPKSSFSYWDEKWDSY  241

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             IFS KDLPFFVNSNEWHLDTS AAGGRSK+L FVVY+PS +ECPL L LPNGE+S TN F
Sbjct  242   IFSTKDLPFFVNSNEWHLDTSIAAGGRSKILQFVVYIPSAKECPLLLQLPNGEISVTNAF  301

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQ-PLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVG  1014
             ISPMWGGV VWNPP CS++SE + P RH IS ++L+KVFE+FMGQLRQLFGL SDSLY G
Sbjct  302   ISPMWGGVAVWNPPGCSRDSESKHPARHTISPQDLQKVFEIFMGQLRQLFGLKSDSLYAG  361

Query  1013  ATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQ  834
             A+ T+ LL SE+GFT+WELD +SRQHTCFNL+ C TTLGSLSRLVQSLPRMIIMDEIGKQ
Sbjct  362   ASGTTNLLASERGFTEWELDVLSRQHTCFNLVSCATTLGSLSRLVQSLPRMIIMDEIGKQ  421

Query  833   VKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSP  654
             VKFSL+AAK + SNAS+G YD SAVSSRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSP
Sbjct  422   VKFSLEAAKLTQSNASLGIYDASAVSSRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSP  481

Query  653   FFLPVALHVILAVLREWKRCKQENKKYL  570
             FFLPV++HV+LA  REW+R KQE  KYL
Sbjct  482   FFLPVSMHVLLAAFREWRRYKQETAKYL  509



>ref|XP_007140652.1| hypothetical protein PHAVU_008G130400g [Phaseolus vulgaris]
 gb|ESW12646.1| hypothetical protein PHAVU_008G130400g [Phaseolus vulgaris]
Length=597

 Score =   679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/597 (61%), Positives = 455/597 (76%), Gaps = 33/597 (6%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEIS++PS     +++ Q+     D  T R TKPG KRL +++++ ISF++G P L KS
Sbjct  19    MAEISDSPSTSKPVEENTQTHAPQIDSKTTRNTKPGVKRLIISVSVLISFILGFPLLWKS  78

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             IEI+RAPLPF  IDS +  +E +PL FPC+FQ VF+  D    ++  E+   IT +M  L
Sbjct  79    IEIYRAPLPFDRIDSFSSQVESTPLSFPCRFQAVFIGFDFK--ASRREVGAAITRKMSDL  136

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSL----DNTD  1815
                     G C  N++VA+ +                   G +S  +F   L    + +D
Sbjct  137   GR------GGCGGNYSVAVEM-------------------GDVSAFEFGGKLRSDDEESD  171

Query  1814  DFLESLLDsrss-rvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
             + + S+++       Y+VVVVN + EVR+VVGKYRHAWIVG++ E+E+V +V EIFV+VF
Sbjct  172   ELVRSVVNEYGGGHAYSVVVVNEEGEVRSVVGKYRHAWIVGRVEEEEAVLRVAEIFVKVF  231

Query  1637  VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRP  1458
             VNGG EEGS+  EFMPVGADGR+VLSF+LLNADP DWIYDW+F+E+D+  L P+++AL+P
Sbjct  232   VNGGDEEGSVRSEFMPVGADGRIVLSFSLLNADPRDWIYDWNFREIDETFLQPVIEALQP  291

Query  1457  IADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVL  1278
             IA++SVESQVLYHTPKSSFS WD+K  S+IF+ KDLPFFVNSNEWHLDTS AAGGRSKVL
Sbjct  292   IANISVESQVLYHTPKSSFSYWDDKHDSHIFTTKDLPFFVNSNEWHLDTSVAAGGRSKVL  351

Query  1277  HFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLRHKIS  1101
               VVY+PS +ECPLQL LPNG++SKTNGFISPMWGGVVVWNP SC K+ E + P+R  IS
Sbjct  352   QLVVYIPSAKECPLQLKLPNGDISKTNGFISPMWGGVVVWNPQSCIKDLESKDPVRITIS  411

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
              ++L+ +FEV MGQLRQL GL SD+LYVG + TS LL SE+GFT+WELD +SR+H CFNL
Sbjct  412   RQDLQMLFEVLMGQLRQLLGLKSDNLYVGESGTSILLGSERGFTEWELDVLSRKHICFNL  471

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
             L C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAK + SNASIG YD SAVSSRQ+R
Sbjct  472   LSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKYAQSNASIGIYDASAVSSRQSR  531

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYL  570
             SLAEDAF+HPS+MS+SYYSFEHCFA+YSPFFLPV +HV+LA LREWKR KQE++KYL
Sbjct  532   SLAEDAFFHPSIMSISYYSFEHCFAIYSPFFLPVIMHVLLAALREWKRYKQESRKYL  588



>ref|XP_002303053.2| GPI transamidase component PIG-S-related family protein [Populus 
trichocarpa]
 gb|EEE82326.2| GPI transamidase component PIG-S-related family protein [Populus 
trichocarpa]
Length=584

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/600 (63%), Positives = 451/600 (75%), Gaps = 30/600 (5%)
 Frame = -3

Query  2336  EISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIE  2157
             EI+E+P               +FD  TMR+TKPG KRLFLT T+ +SFL+G PFL KS+E
Sbjct  4     EITESPHDPPPETPPTPPSEPEFDSKTMRRTKPGLKRLFLTFTVLVSFLLGFPFLFKSVE  63

Query  2156  IHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTS  1977
             I+R+PLPF DIDSL+  +  +P LFPC FQ + +      T  AS+    I SQ      
Sbjct  64    IYRSPLPFHDIDSLSNDVVSNPFLFPCHFQAILI------TKLASKG---IASQ------  108

Query  1976  AKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNT-DDFLES  1800
                  CG C +NFT+++TL+     C  S ++   +KCGA+  +D +   D + D+ LES
Sbjct  109   -----CGACTNNFTLSLTLDDG--GCTQSSSK--FYKCGAIRAVDLDFGDDESVDEALES  159

Query  1799  L-LDs--rssrvytvvvvnrdeevravVGKYRHAWIVGK-LSEQesvekvveifvevfVN  1632
               LDS  +   V  VV  +  E V+ VVGKYRHAWIVG+    +E  E++ EIFV VFVN
Sbjct  160   AGLDSGGKVYSVVVVVNGDGVEGVKVVVGKYRHAWIVGRDWGVEEVAERLAEIFVRVFVN  219

Query  1631  GGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIA  1452
             GG+EEG IHGEFMPVGADGR+VLSFNLLN DP DW YDWDF+++D+ LLAP++ AL PIA
Sbjct  220   GGREEGLIHGEFMPVGADGRIVLSFNLLNGDPSDWTYDWDFRKIDETLLAPMIDALGPIA  279

Query  1451  DVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHF  1272
             ++SVESQVLYHTPK S S WDEK G YIFS KDLPFFVNSNEWHLDTS AAGGRSK+L F
Sbjct  280   NISVESQVLYHTPKFSVSSWDEKLGGYIFSTKDLPFFVNSNEWHLDTSIAAGGRSKILQF  339

Query  1271  VVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSE  1095
             VVYVPS +ECPL L LPNGE+SKTN FISPMWGGV+VWNP SCS++S+ + L RH +S E
Sbjct  340   VVYVPSAKECPLLLQLPNGEISKTNAFISPMWGGVMVWNPQSCSRDSDSELLVRHIMSPE  399

Query  1094  ELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQ  915
             +L+KVFEVF+GQ RQLFGL S SL+VG   T  LL SEKGFT+WELD +SRQHTCFN+  
Sbjct  400   DLQKVFEVFVGQFRQLFGLKSGSLHVGVMGTYSLLASEKGFTEWELDVLSRQHTCFNIHS  459

Query  914   CGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSL  735
               TTLGSLS+LVQSLPRMIIMDEIGKQVKFSL+AAK +  NAS+G YD SAVSSRQARSL
Sbjct  460   SATTLGSLSKLVQSLPRMIIMDEIGKQVKFSLEAAKLARVNASLGFYDASAVSSRQARSL  519

Query  734   AEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             AEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LREW+R KQE  KYL WKAK
Sbjct  520   AEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVLLAALREWRRYKQEKAKYLLWKAK  579



>gb|KHN41386.1| GPI transamidase component PIG-S [Glycine soja]
Length=563

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/603 (60%), Positives = 446/603 (74%), Gaps = 49/603 (8%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEIS++PS   + +++ Q+   +FD  T R TKPG KRL +++T+  SF++G P L KS
Sbjct  1     MAEISDSPSTSKSAEENTQTQTPEFDLKTTRNTKPGVKRLIISVTVLFSFILGFPLLWKS  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             IEI+RAPLPF  ID+ +  IE  PL FPC FQ +F+  D     +  ++   I  +M   
Sbjct  61    IEIYRAPLPFDRIDAFSSQIESKPLSFPCHFQAIFIGFDFDFKVSHGDVGATIARKM---  117

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLE  1803
                                                     G ++  DF + L  +D+  +
Sbjct  118   ----------------------------------------GDINAFDFGEKLRGSDEDAD  137

Query  1802  SLL-----DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
              L+     +      Y+VVVVN + EVR+VVGKYRHAWIVG++ E+E+V  V E+FV+VF
Sbjct  138   ELVKSVVSEYGGGNAYSVVVVNEEGEVRSVVGKYRHAWIVGRVEEEEAVLHVAEVFVKVF  197

Query  1637  VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRP  1458
             VNGG  EGS+  EFMPVGADGR+VLSF+LLNADP DWIYDW+F+E+D+ LL P+++AL+P
Sbjct  198   VNGGDVEGSVRSEFMPVGADGRIVLSFSLLNADPRDWIYDWNFREIDETLLRPVIEALQP  257

Query  1457  IADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVL  1278
             IA+++VESQVLYHTPKSSFS WD+K GS++F  +DLPFFVNSNEWHLDTS AAGGRSKVL
Sbjct  258   IANITVESQVLYHTPKSSFSYWDDKHGSHMFRTEDLPFFVNSNEWHLDTSVAAGGRSKVL  317

Query  1277  HFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSE-MQPLRHKIS  1101
               VVY+PS +ECPLQL LPNGE+SKTNGFISPMWGGVVVWNP SC K+ E M P+RH IS
Sbjct  318   QLVVYIPSAKECPLQLELPNGEISKTNGFISPMWGGVVVWNPQSCIKDFESMDPVRHTIS  377

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
              ++L K+FEV MGQLRQL GL SD+LYVG + TS LL SE+GFT+WELD +SR+H CFNL
Sbjct  378   PQDLLKLFEVLMGQLRQLLGLKSDNLYVGESGTSILLGSERGFTEWELDVLSRKHICFNL  437

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
               C TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAK + SNASIG Y+ SAVSSRQ+R
Sbjct  438   HSCATTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKFAQSNASIGIYNASAVSSRQSR  497

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             SLAEDAF+HPS+MS+SYYSFEHCFA+YSPFFLPV +HV+LA LREWKR KQEN+KYLA K
Sbjct  498   SLAEDAFFHPSIMSISYYSFEHCFAIYSPFFLPVTMHVLLAALREWKRYKQENRKYLASK  557

Query  560   AKV  552
             AKV
Sbjct  558   AKV  560



>ref|XP_006443579.1| hypothetical protein CICLE_v10019403mg [Citrus clementina]
 ref|XP_006479257.1| PREDICTED: GPI transamidase component PIG-S-like [Citrus sinensis]
 gb|ESR56819.1| hypothetical protein CICLE_v10019403mg [Citrus clementina]
 gb|KDO65961.1| hypothetical protein CISIN_1g007618mg [Citrus sinensis]
Length=596

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/607 (60%), Positives = 449/607 (74%), Gaps = 25/607 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M+EIS  P   DN Q +     +  DPN+ R TKPG KRL LTL++  S ++G PFL KS
Sbjct  1     MSEIS--PEVPDNRQDAP----SHVDPNSTRITKPGVKRLVLTLSVLFSLVLGFPFLWKS  54

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLL-FPCKFQVVFVNLDHSTTSTASELSFLITSQMQK  1986
             +EI+R+ LPF +I  +    E +P L FPC+FQ VF+N + + +    +LS L   ++ +
Sbjct  55    VEIYRSSLPFGEISEM----ESNPSLSFPCRFQAVFINFNSNPSPNHLQLSIL--DKITE  108

Query  1985  LTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI--VWKCGALSGLDFEKSLD---N  1821
             LTS  S  CG C ++  +++T++S SS C  +   D    ++CGA+S +DF+ S D    
Sbjct  109   LTSNSSQ-CGACANDLALSVTVDSISS-CTQTHPTDNSNYYRCGAISAVDFDFSNDDDDG  166

Query  1820  TDDFLESLLDsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifv--  1647
              D+ LES+L  ++     VV    +     V GKYRHAWIVG + E+E    +V      
Sbjct  167   VDELLESVLGVKNVYSVVVVNGGGEGIRAVV-GKYRHAWIVGSVEEEEEESVLVSRVAEI  225

Query  1646  --evfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIV  1473
               ++FVNGG E G IHGEFMPVGAD R+VLSFNLLNA+P+DW+YDWDFQ +D+ LLAPI+
Sbjct  226   FVKMFVNGGTENGLIHGEFMPVGADRRIVLSFNLLNAEPNDWVYDWDFQRVDETLLAPII  285

Query  1472  QALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGG  1293
             + L PIA++SVESQVLYHTPKSSFS WDEK  SYIFS KDLPFFVNSNEWHLDTS AAGG
Sbjct  286   KVLGPIANISVESQVLYHTPKSSFSYWDEKWKSYIFSTKDLPFFVNSNEWHLDTSIAAGG  345

Query  1292  RSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLR  1113
             RSK+L FVVYVPS +ECPL LLLP GE+SKTNGFISPMWGGVVVWNPP C  +    P R
Sbjct  346   RSKILQFVVYVPSAKECPLSLLLPTGEISKTNGFISPMWGGVVVWNPPGCLNSETNHPSR  405

Query  1112  HKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHT  933
             H +S E+L+ VFEVFMGQ RQLFGL S++LY+GA+ T  LL S KGFT+WELD +SRQ  
Sbjct  406   HTMSREDLQAVFEVFMGQFRQLFGLKSNNLYIGASGTYHLLPSGKGFTEWELDVLSRQFA  465

Query  932   CFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSS  753
             CFNL  C TTLGSLSRLVQSLPRMIIMDEIGK V+FSL+AAK + SNAS+G+ + SAVSS
Sbjct  466   CFNLHSCATTLGSLSRLVQSLPRMIIMDEIGKLVQFSLEAAKLAQSNASLGDNESSAVSS  525

Query  752   RQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKY  573
              QARSLAEDAF+HPS+MS+SYYSFEHCFA+YSPFFLPV++HV+LA LREWKR KQE  KY
Sbjct  526   GQARSLAEDAFFHPSIMSISYYSFEHCFAIYSPFFLPVSMHVLLAALREWKRYKQEKAKY  585

Query  572   LAWKAKV  552
              AWKAKV
Sbjct  586   TAWKAKV  592



>ref|XP_009775445.1| PREDICTED: uncharacterized protein LOC104225366 isoform X2 [Nicotiana 
sylvestris]
Length=552

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/605 (63%), Positives = 463/605 (77%), Gaps = 71/605 (12%)
 Frame = -3

Query  2345  AMAEISEA--PSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFL  2172
              MAEISEA   S++  N  SE++  +DFDP TMRKTKPG KRLFLTLT+F SFLI LPFL
Sbjct  11    TMAEISEALTSSSDPPNTMSEEA--SDFDPKTMRKTKPGLKRLFLTLTVFFSFLIALPFL  68

Query  2171  LKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQM  1992
             L+SIEI+RAPLPF+DID L+ ++E++PL +PC+F+ VF+N D+ T    +EL  LI S M
Sbjct  69    LQSIEIYRAPLPFEDIDLLSSAMEKNPLQYPCQFRAVFINFDYITD--INELGLLINSNM  126

Query  1991  QKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI-VWKCGALSGLDFEKSLDNTD  1815
             QKLTS   P CGTC +N+TVA+T++SSS NCI+SE++++  W+CGAL+G D     ++ D
Sbjct  127   QKLTSKVIPACGTCGNNYTVAVTVDSSS-NCIHSESENVGKWQCGALNGFDKLNDDEDFD  185

Query  1814  DFLESLLDsrssrvytvvvvnrdeev---ravVGKYRHAWIVGKLSEQesvekvveifve  1644
             ++LES+LDS++ ++YTVVVV R+ +    R VVGKYRHAWIVGK S +++ EK+ EIFV+
Sbjct  186   EYLESVLDSKNRKLYTVVVVKRNADEEEGRVVVGKYRHAWIVGKDSVKKAAEKMAEIFVK  245

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VFVNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDF+ELD++LLAP+V AL
Sbjct  246   VFVNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFKELDEILLAPVVDAL  305

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
             RP+AD+SVESQVLYHTPK+S+S WD+KQGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSK
Sbjct  306   RPVADISVESQVLYHTPKASYSYWDDKQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSK  365

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHK  1107
             VLHFV+YVPS +ECPL+L  PNGE+S TNGFISPMWGG++VWNPP+CS+N ++Q L +HK
Sbjct  366   VLHFVLYVPSAKECPLKLQFPNGEISMTNGFISPMWGGIIVWNPPACSENLQIQHLPKHK  425

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             ISSE+LKK+ EVFMGQLRQLFGL S++ YVGA ATS LLTS KGF +WELD +SR HTCF
Sbjct  426   ISSEDLKKISEVFMGQLRQLFGLKSENHYVGAFATSVLLTSAKGFAEWELDVLSRYHTCF  485

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQ                             
Sbjct  486   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQ-----------------------------  516

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
                        P  + VS               L V L VI    REWKR K EN+KYLA
Sbjct  517   -----------PFFLPVS---------------LHVLLAVI----REWKRYKVENRKYLA  546

Query  566   WKAKV  552
             WKAK+
Sbjct  547   WKAKL  551



>ref|XP_009610378.1| PREDICTED: GPI transamidase component PIG-S isoform X3 [Nicotiana 
tomentosiformis]
Length=551

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/603 (63%), Positives = 462/603 (77%), Gaps = 68/603 (11%)
 Frame = -3

Query  2345  AMAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLK  2166
              MAEISEAP++  +   +     +DFDP TMRKTKPG KRLFLTLT+F SFLI LPFLLK
Sbjct  11    TMAEISEAPTSSSDPPNTMSEEASDFDPKTMRKTKPGLKRLFLTLTVFFSFLIALPFLLK  70

Query  2165  SIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQK  1986
             SIEI+RAPLPF+DID L+ ++E++PL +PC+F+ VF+N D  T    +EL  LI S MQK
Sbjct  71    SIEIYRAPLPFEDIDLLSSAMEKNPLQYPCQFRAVFINFDDITD--INELGLLINSNMQK  128

Query  1985  LTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI-VWKCGALSGLDFEKSLDNTDDF  1809
             LTS  +P CGTC +N+TVA+T++SSS NC++SE++++  W+CGAL+G D + + ++ D++
Sbjct  129   LTSKDTPACGTCGNNYTVAVTVDSSS-NCVHSESENVGKWQCGALNGFD-KLNDEDFDEY  186

Query  1808  LESLLDsrssrvytvvvvnrde---evravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
             LES+LDS++ ++YTVVVV R+    E+R VVGKYRHAWIVGK S +++VEK+ EIFV+VF
Sbjct  187   LESVLDSKNRKLYTVVVVKRNADEEEMRVVVGKYRHAWIVGKDSVEKAVEKMAEIFVKVF  246

Query  1637  VNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRP  1458
             VNGGKEEGSI GEFMPVGADG+VVLSF+LLN+DPHDW+YDWDFQELD++LLAP+V ALRP
Sbjct  247   VNGGKEEGSIRGEFMPVGADGKVVLSFSLLNSDPHDWVYDWDFQELDEILLAPVVDALRP  306

Query  1457  IADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVL  1278
             +AD+SVESQVLYHTPK S+S WD+KQGSYIFS KDLPFFVNSNEWHLDTSTAAGGRSKVL
Sbjct  307   VADISVESQVLYHTPKVSYSYWDDKQGSYIFSTKDLPFFVNSNEWHLDTSTAAGGRSKVL  366

Query  1277  HFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKIS  1101
             HFV+YVPS +ECPL+L  PNGE+S  NGFISPMWGG++VWNPP+CS+N ++Q L +HKIS
Sbjct  367   HFVLYVPSAKECPLKLQFPNGEISMANGFISPMWGGIIVWNPPACSENLQIQHLPKHKIS  426

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
             SE+LKK+ EVFMGQLRQLFGL S++ YVGA ATS LLTS KGF +WELD +SR HTCFNL
Sbjct  427   SEDLKKISEVFMGQLRQLFGLKSENHYVGAFATSVLLTSAKGFAEWELDVLSRHHTCFNL  486

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
             LQCGTTLGSLSRLVQSLPRMIIMDEIGKQ                               
Sbjct  487   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQ-------------------------------  515

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
                      P  + VS               L V L VI    REW+R K EN+K+LAWK
Sbjct  516   ---------PFFLPVS---------------LHVLLAVI----REWRRYKVENRKFLAWK  547

Query  560   AKV  552
             AK+
Sbjct  548   AKL  550



>ref|XP_003530854.1| PREDICTED: GPI transamidase component PIG-S-like [Glycine max]
Length=579

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/599 (61%), Positives = 457/599 (76%), Gaps = 25/599 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEIS +P   +  +++ Q+      P T R TKPG KRL +++T+  SF++G P L KS
Sbjct  1     MAEISNSPPTSNPVEENTQT------PKTTRNTKPGVKRLIISVTVLFSFILGFPLLWKS  54

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             ++I+RAPLPF  +DS +  IE  PL FPC+F  +F+  D   ++    +   I  +M  L
Sbjct  55    VKIYRAPLPFDRVDSFSSQIESKPLSFPCRFLAIFIGFDFMVSN--GNVGAAIERKMSDL  112

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLE  1803
             +      CG C  N++V++ +     + +Y          G L G D     ++ D+ ++
Sbjct  113   SHGGD--CGGCGGNYSVSVAVGGGGIDAVYF--------GGKLRGND-----EDADELVK  157

Query  1802  SLL-DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGG  1626
             S++ +     +Y+VVVVN + EVR+VVGK+RHAWIVG++ E+E+V +  EIFVEVFVNG 
Sbjct  158   SVVSEYGGGNMYSVVVVNEEGEVRSVVGKHRHAWIVGRVEEEEAVWRAAEIFVEVFVNGR  217

Query  1625  KEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADV  1446
              EEGS+  EFMPVGADGR+VLSF+LLNADP DWIYDW+F+E+D+ LL P+++AL+PIA++
Sbjct  218   DEEGSVRSEFMPVGADGRIVLSFSLLNADPRDWIYDWNFREIDETLLWPVIEALQPIANI  277

Query  1445  SVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVV  1266
             +VESQVLYHTPKSSFS WD+K GS+IF  +DLPFFVNSNEWHLDTS AAGGRSKVL  VV
Sbjct  278   TVESQVLYHTPKSSFSNWDDKHGSHIFRTEDLPFFVNSNEWHLDTSVAAGGRSKVLQLVV  337

Query  1265  YVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLRHKISSEEL  1089
             Y+PS +ECPLQL L +GE+SKTNGFISPMWGGVVVWNP SC K+ E + P+RH ISS++L
Sbjct  338   YIPSAKECPLQLELSSGEISKTNGFISPMWGGVVVWNPRSCIKDLESRDPVRHTISSQDL  397

Query  1088  KKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCG  909
             +K+FEV MGQLRQL GL SD+LYVG +  S LL SE+GFT+WELD +SR+H CFNL  C 
Sbjct  398   QKLFEVLMGQLRQLLGLKSDNLYVGKSGASILLGSERGFTEWELDVLSRKHICFNLQSCA  457

Query  908   TTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAE  729
             TTLGSLSRLVQSLPRMIIMDEIGKQVKFSL+AAKS+ SNASIG YD SAVSSRQ+RSLAE
Sbjct  458   TTLGSLSRLVQSLPRMIIMDEIGKQVKFSLEAAKSAQSNASIGIYDASAVSSRQSRSLAE  517

Query  728   DAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAKV  552
             DAF+HPS+MS+SYYSFEHCFA+YSPFFLPV +HV+LA LREWKR KQE KKYLA K KV
Sbjct  518   DAFFHPSIMSISYYSFEHCFAIYSPFFLPVTMHVLLAALREWKRYKQEKKKYLASKDKV  576



>ref|XP_007049729.1| GPI transamidase component PIG-S-related [Theobroma cacao]
 gb|EOX93886.1| GPI transamidase component PIG-S-related [Theobroma cacao]
Length=582

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/605 (59%), Positives = 443/605 (73%), Gaps = 33/605 (5%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EISE P               + DP  MRKTKPG KRLFLT ++  SFL+G PFL KS
Sbjct  1     MPEISEVP---------------ELDPKIMRKTKPGLKRLFLTHSVLFSFLLGFPFLWKS  45

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+R+PLPF++IDSL+  +  + LLFP  F  +F+  D    S A  L + I S++ KL
Sbjct  46    VEIYRSPLPFREIDSLSTHLRSNTLLFPLHFHAIFIGFD----SDADRLRYSILSEISKL  101

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCI---YSENQDIVWKCGALSGLDFEKSLD-NTD  1815
             TS        C +N+++++T++S S  C+    +      ++CG+++ +DF+   D   D
Sbjct  102   TSQNL----KCFNNYSLSVTVDSGS-RCLRAPITSPHSCPYQCGSITAIDFDPVDDVAVD  156

Query  1814  DFLESLLDsrssrvytvvvvnrdeevravVGKYRHAWIV--GKLSEQesvekvveifvev  1641
             + L S+   +      VVV   +E      GKYRHAW+V  G +  + +  KV E+ V+V
Sbjct  157   ERLGSVFGRKIKEYSVVVVKGENERAVV--GKYRHAWMVVGGGMEVEMAAMKVAEVLVKV  214

Query  1640  fVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALR  1461
             FVNGG+EEGSI  EFMPVGADG +VLSFNLLNADP DW+YDWDFQ++D+ LLAP++ AL 
Sbjct  215   FVNGGREEGSIRTEFMPVGADGNIVLSFNLLNADPRDWVYDWDFQKIDETLLAPMIGALG  274

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
             P+A++SVESQVLYHTPK+SFS W++K  S++FS KDLPFFVNSNEWHLDTS AAGGRSK+
Sbjct  275   PVANISVESQVLYHTPKASFSYWNQKLESHVFSTKDLPFFVNSNEWHLDTSIAAGGRSKI  334

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKI  1104
             L FVVYVPS +ECPL L LPNGE+SKTNGFISPMWGGV+VWNP SC KNSE +   RH I
Sbjct  335   LQFVVYVPSAKECPLLLQLPNGEISKTNGFISPMWGGVMVWNPQSCLKNSENKTTARHAI  394

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
               ++L+ +FEVF+GQ RQLFG  S ++Y G +    L+ SE+GFT+WELD +SRQHTCFN
Sbjct  395   PLQDLENMFEVFIGQFRQLFGFRSVNVYAGGSGIWNLVPSERGFTEWELDVLSRQHTCFN  454

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             L  C TTL SLSRLVQSLPRMIIMDEIGKQVK+SL+AAK + SNASIG Y  S  SSRQA
Sbjct  455   LHSCATTLASLSRLVQSLPRMIIMDEIGKQVKYSLEAAKLAQSNASIGGYGFSTTSSRQA  514

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             RSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LRE KR KQE  KYLAW
Sbjct  515   RSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHVVLAALRELKRYKQEKAKYLAW  574

Query  563   KAKVN  549
             KAK N
Sbjct  575   KAKAN  579



>ref|XP_002521070.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41221.1| conserved hypothetical protein [Ricinus communis]
Length=619

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/611 (61%), Positives = 462/611 (76%), Gaps = 18/611 (3%)
 Frame = -3

Query  2351  VPA--MAEISEAP-SAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligL  2181
             +PA   +E+SE P +  + ++ +E    + F+  +MRKTKPG KRL LTL++ +SFLIG 
Sbjct  10    IPAEHQSEMSEPPPTLSEISENTETPPESKFESESMRKTKPGLKRLILTLSVLVSFLIGF  69

Query  2180  PFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLIT  2001
             PFL KS+EI+R+PLPF ++++L+  IE +PL FP  FQ +F+  + S +    +LS  IT
Sbjct  70    PFLWKSVEIYRSPLPFSEMETLSKEIESNPLQFPFHFQAIFITSNPSMSPHYLQLS--IT  127

Query  2000  SQMQKLTSAKSPVCGTCL--SNFTVAITLESSSSNCIYSENQDIVWKCGALSG--LDFEK  1833
             SQ+ KLTS + P CG C   +NFT+++ +   S    +++N      CGA++   LDF  
Sbjct  128   SQITKLTSKRPPHCGACSGNNNFTLSVRVCDQS----HTDNHSQSSLCGAITAADLDFGG  183

Query  1832  SLD-NTDDFLESLLDsrssrvytvvvv--nrdeevravVGKYRHAWIVGK-LSEQesvek  1665
               D   D+ L S+L +       VV       E V+ VVGKYRHAWIVG+ L  +E VEK
Sbjct  184   HDDERVDEALGSVLSNGKVFSVVVVDRDDGEVEGVKVVVGKYRHAWIVGRDLEIEEMVEK  243

Query  1664  vveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLL  1485
             VVEIFV VF NGGKEEG IH EFMPVG+DGR+VLSFNLLNA+P DWIYDWDFQ +D+ LL
Sbjct  244   VVEIFVNVFGNGGKEEGLIHQEFMPVGSDGRIVLSFNLLNANPRDWIYDWDFQRIDETLL  303

Query  1484  APIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTST  1305
             AP+++AL PIA++SVESQVLY+TPKSSFS WDEK  SYIF   DLPF VNSNEWHLDTS 
Sbjct  304   APVIEALGPIANISVESQVLYYTPKSSFSSWDEKLSSYIFGANDLPFLVNSNEWHLDTSI  363

Query  1304  AAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM  1125
             AAGGRSK+L FVVYVPS +ECPL L LPNG++S TNGFISPMWGGV+VWN PSC K+SE 
Sbjct  364   AAGGRSKILQFVVYVPSADECPLLLKLPNGQISATNGFISPMWGGVMVWNSPSCLKDSES  423

Query  1124  Q-PLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFI  948
             + P RH IS+++L+KVFEVFMGQ RQLFGL S+S+Y GA  +  LL SE+GFT+WELDF+
Sbjct  424   ELPGRHVISTQDLQKVFEVFMGQFRQLFGLTSNSIYAGAYGSYNLLASERGFTEWELDFL  483

Query  947   SRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDG  768
             SRQHTCFNL    TTL SLS+LVQSLPRMII DEIGKQV FSL +A+ +  N S+G YD 
Sbjct  484   SRQHTCFNLHSSATTLRSLSKLVQSLPRMIITDEIGKQVMFSLQSAELAQINVSLGVYDA  543

Query  767   SAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
             SAVSSR ARSLAEDAF+HPS+MSVSYYSFEHCFAVYSPFFLPV++H++LA LRE +R K+
Sbjct  544   SAVSSRNARSLAEDAFFHPSIMSVSYYSFEHCFAVYSPFFLPVSMHILLAALRELRRYKK  603

Query  587   ENKKYLAWKAK  555
             EN KYL WKAK
Sbjct  604   ENAKYLLWKAK  614



>ref|XP_010547097.1| PREDICTED: GPI transamidase component PIG-S [Tarenaya hassleriana]
Length=605

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/608 (58%), Positives = 436/608 (72%), Gaps = 27/608 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EIS+ P    N  +     +++FDP TMR TKPG KRL +T ++ + FL+G PFL KS
Sbjct  1     MEEISDPP----NPTREISEPMSEFDPKTMRTTKPGAKRLLITTSVLVCFLLGFPFLWKS  56

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+R+PLPF DIDSL+  IE SPL FPC F  +FV      +   S L   I   + + 
Sbjct  57    VEIYRSPLPFHDIDSLSGQIESSPLQFPCTFHAIFVGF---RSMNPSNLRSAILDGVTQF  113

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNC---IYSENQDIVWKCGALSGLDFEKSLDN--T  1818
             T  +S  CG+C  NF++++T++    +C   I  +     ++CG + G DF   L++   
Sbjct  114   TH-RSSGCGSC--NFSLSVTVQDPDDHCTETIVRDPSKCSYRCGVIKGNDFGIGLEDAAV  170

Query  1817  DDFLESLLDsrssrvytvvvvnrdee--------vravVGKYRHAWIVGKLSEQe---sv  1671
             D+ L  +    +     +  V    +        VRAVVGK+RHAWIVG   E+     V
Sbjct  171   DESLNDIFGGCTGHGGKIYSVVVVNKDLGNGEGEVRAVVGKHRHAWIVGSGLEERYGDMV  230

Query  1670  ekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDM  1491
              KV EIFV+VF+ GG+EE SI+GEFMPVG+DG+VVLSFNLLN++P DW+YDWDFQ +D+ 
Sbjct  231   AKVSEIFVKVFMKGGREESSINGEFMPVGSDGKVVLSFNLLNSNPRDWVYDWDFQRIDET  290

Query  1490  LLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDT  1311
             LL+P+++AL P+A++SVESQVLYHTPKSSF+ WDEK  S+IF + DLPFFVNSNEWHLDT
Sbjct  291   LLSPVIKALEPVANISVESQVLYHTPKSSFASWDEKLRSHIFRMSDLPFFVNSNEWHLDT  350

Query  1310  STAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS  1131
             S  AGGRSK+L FVVY+PS  ECPLQL LPNGE+SKTNGFISPMWGGV+VWNP +C K S
Sbjct  351   SVGAGGRSKILQFVVYIPSAGECPLQLQLPNGEMSKTNGFISPMWGGVIVWNPANCDKGS  410

Query  1130  EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDF  951
                P R  I  + L+K+FEVF+GQ RQLFG  S++ Y     T  +L SE+GFT+WELD 
Sbjct  411   G-SPARTSIPPQNLEKIFEVFLGQFRQLFGFKSEATYTSGLGTFEILPSERGFTEWELDV  469

Query  950   ISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYD  771
             +SRQHTCFNL  C  TLGSLSRLVQSLPRMII DEIG+QVKFSL AAK + SNAS+G Y 
Sbjct  470   LSRQHTCFNLQSCANTLGSLSRLVQSLPRMIIKDEIGEQVKFSLKAAKMAQSNASLGAYG  529

Query  770   GSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCK  591
              SA SSR+ARSLAEDAF+HPS+MSVSY+SFEHCFAVYSPFFLPV++HVILA LREWKR K
Sbjct  530   SSASSSREARSLAEDAFFHPSIMSVSYFSFEHCFAVYSPFFLPVSMHVILAALREWKRYK  589

Query  590   QENKKYLA  567
             QE  KYL 
Sbjct  590   QEKAKYLT  597



>gb|KHG09836.1| GPI transamidase component PIG-S [Gossypium arboreum]
Length=604

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/612 (58%), Positives = 448/612 (73%), Gaps = 25/612 (4%)
 Frame = -3

Query  2342  MAEISEAPSAE-----DNNQKSEQSFVND--FDPNTMRKTKPGRKRlfltltifisflig  2184
             MAEISEA  ++     D++ K+ Q   ++  FDP  MRK+KPG KRLFLT ++  SFL+G
Sbjct  1     MAEISEAQDSDSSKLLDSDSKAPQRPDSEPEFDPKLMRKSKPGLKRLFLTFSVLFSFLLG  60

Query  2183  LPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLI  2004
              PFL KS+EI+R+PLPF++IDSL+  +    LLFP  F  +FV  D    S    L   I
Sbjct  61    FPFLWKSVEIYRSPLPFREIDSLSTQLRSDTLLFPLHFHALFVGFD----SDPDRLRRSI  116

Query  2003  TSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIY---SENQDIVWKCGALSGLDFEK  1833
              S++ KLTS ++P C     N+T+++T++  S  C+    S      ++CG+++   F +
Sbjct  117   LSEITKLTS-QNPKCS---DNYTLSVTVDLGS-RCLRGPTSSPHSSSYQCGSVTAAAFVQ  171

Query  1832  SLD-NTDDFLESLLDsrssrvytvvvvnrdeevravVGKYRHAWIV--GKLSEQesvekv  1662
             + D   D+ L S+   ++      VV    E      GKYRHAW+V    +    +  KV
Sbjct  172   NDDVAVDERLASVFGGKTKEYSVAVVKGGSERAVV--GKYRHAWMVVGDGIDVGMAAVKV  229

Query  1661  veifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLA  1482
              E+ V+VF+NGG+EEG I  EFMPVGADG++VLSFN+LNADPHDW+YDWDF+++DD LL 
Sbjct  230   AEVLVKVFINGGREEGLIRNEFMPVGADGKIVLSFNMLNADPHDWVYDWDFEKIDDTLLT  289

Query  1481  PIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTA  1302
             P+++AL P+A++SVESQVLYHTPK+SFS W++K  SY+FS KDLPFFVNSNEWHLDTS A
Sbjct  290   PMIEALGPVANISVESQVLYHTPKASFSYWNQKLESYVFSTKDLPFFVNSNEWHLDTSIA  349

Query  1301  AGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQ  1122
             AGGRSK+L F VYVPS +ECPL L LPNGE+SKTNGFISPMWGGV+VWNP  C K+SE +
Sbjct  350   AGGRSKILQFAVYVPSAKECPLLLQLPNGEISKTNGFISPMWGGVIVWNPQGCLKDSEFK  409

Query  1121  P-LRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFIS  945
             P  ++ I  ++L+ +FEVF+GQ RQLFG  S ++Y GA+    LL SE+GFT+WELD +S
Sbjct  410   PSAKNIIPIQDLENMFEVFIGQFRQLFGFKSLNVYTGASGDWNLLPSERGFTEWELDVLS  469

Query  944   RQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGS  765
             RQHTCFNL  C TTLGSLSRLVQSLPRMII DEIGKQVK SL+AAK +LSNAS G Y+ S
Sbjct  470   RQHTCFNLHSCATTLGSLSRLVQSLPRMIIKDEIGKQVKLSLEAAKLALSNASSGVYESS  529

Query  764   AVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQE  585
             A SS QARSLAEDAF+ PS+MSVSYYSFEHCFAVYSPFFLPV++HV+LA LRE KR KQE
Sbjct  530   AASSSQARSLAEDAFFDPSIMSVSYYSFEHCFAVYSPFFLPVSMHVVLAALRELKRYKQE  589

Query  584   NKKYLAWKAKVN  549
               KYLAWKAK N
Sbjct  590   KAKYLAWKAKAN  601



>gb|EPS64887.1| hypothetical protein M569_09890, partial [Genlisea aurea]
Length=590

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/600 (59%), Positives = 441/600 (74%), Gaps = 28/600 (5%)
 Frame = -3

Query  2348  PAMAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLL  2169
             PAMAE+SE+ +    + + +  F  +FDP TMR+TKPG KR  L++++ +SF++GLPFLL
Sbjct  1     PAMAEVSESAAQVLYSAEGDAKF--EFDPKTMRRTKPGFKRFTLSVSVLLSFILGLPFLL  58

Query  2168  KSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQ  1989
             KS+EI+R+PLPF +ID L+ ++E SPL FPC F+ VF+      TS   ELS +I S+  
Sbjct  59    KSVEIYRSPLPFGEIDELSAAVELSPLHFPCNFRAVFIGFG-GFTSNPEELSAVIQSE--  115

Query  1988  KLTSAKSPVCGTCLSNFTVAITLESSS--SNCIYSENQDIVWKCGALSGLDFEKSLDNTD  1815
              LT++ S  CG C  + TV++TL S S  S+  Y  N    WKC +L+ L   +     D
Sbjct  116   -LTASDSTSCGACDYSSTVSVTLVSGSGCSHSAYIPN----WKCESLNELIRNQESGKLD  170

Query  1814  D--FLES--LLD-------srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesve  1668
             D  F E   LLD            V+ +     + +VR+V+GKYRHAWI+G++S +E+V+
Sbjct  171   DESFDEQLHLLDYRECRKCQAFYTVFVIRREEEEGKVRSVIGKYRHAWILGEVSAEEAVK  230

Query  1667  kvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDML  1488
             KV EIFV+ FVNG KEE  I GEFMPVGADGR VLSF+LLNADPHDWIYDWDFQ +++ +
Sbjct  231   KVAEIFVKGFVNGWKEEAPIGGEFMPVGADGRTVLSFSLLNADPHDWIYDWDFQRIEEDI  290

Query  1487  LAPIVQALRPIADVSVESQ-VLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDT  1311
             L P+V+AL+P+AD+ +ESQ VLYHTPKSS S WD+K  SY F+  DLPFFVNSNEWHLDT
Sbjct  291   LMPVVEALKPLADIKIESQVVLYHTPKSSLSQWDDKLRSYTFTKNDLPFFVNSNEWHLDT  350

Query  1310  STAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS  1131
             S  AGGRSK+LHFVVYVPS  ECPL   LPN E+S TNGFISPMWGGVVVWNP  C   +
Sbjct  351   SIEAGGRSKILHFVVYVPSAAECPLLFRLPNEEVSSTNGFISPMWGGVVVWNPSRCLNET  410

Query  1130  EMQP-LRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATS-RLLTSEKGFTQWEL  957
                P    KI SE+++K+FEVF+ Q RQLFGL S   ++   + S  LLT  +GFTQWE+
Sbjct  411   RTGPHFNQKIPSEDIRKIFEVFLAQFRQLFGLKSSHNHLLDQSESLELLTDRRGFTQWEM  470

Query  956   DFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGN  777
             D +SRQHTCFNL Q  TTLGSLSRLVQSLPRMII DEIGKQVK+SL+AAK +LSNAS G 
Sbjct  471   DVLSRQHTCFNLHQSVTTLGSLSRLVQSLPRMIIKDEIGKQVKYSLEAAKQALSNASDGF  530

Query  776   Y-DGSAV-SSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREW  603
             Y D S+V SSR+ARSL+EDAFYHPSM+SVSY+SFEHCFAVYSPFFLPV+LHVILA L+EW
Sbjct  531   YHDSSSVASSRKARSLSEDAFYHPSMVSVSYFSFEHCFAVYSPFFLPVSLHVILAALKEW  590



>ref|XP_010486259.1| PREDICTED: GPI transamidase component PIG-S-like [Camelina sativa]
Length=605

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/591 (58%), Positives = 432/591 (73%), Gaps = 27/591 (5%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF DIDSL+  IE +
Sbjct  20    EFDPKTMRSTKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQIEST  79

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV  +   ++    L   I   + +LT  +S  CG+C  NF++++T+++
Sbjct  80    PLRFPCNFHAVFVGFE---STDPDNLRSQIQDGINQLTH-QSTQCGSC--NFSLSVTVQN  133

Query  1913  SSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs------------rss  1779
              +  C   +        ++CG ++  +F   LD+T D  ESL D                
Sbjct  134   PADQCSETLAHNPSTCSYRCGVITRNEFGVGLDDTVD--ESLNDVFSGCSENSGKTYSVV  191

Query  1778  rvytvvvvnrdeevravVGKYRHAWIVGKLSEQe---svekvveifvevfVNGGKEEGSI  1608
              V        DE ++AVVGK RHAW+VG   E+     V  V EIFV+VF+NGG++E SI
Sbjct  192   VVNKENANGEDEVLKAVVGKRRHAWVVGSGLEERYGDIVAGVSEIFVKVFMNGGRDEESI  251

Query  1607  HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV  1428
             HGEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +DD LLAP+ +AL PIA++SVESQV
Sbjct  252   HGEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDDALLAPVTKALAPIANISVESQV  311

Query  1427  LYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEE  1248
             LYHTPKSSFS WDEK   YIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +
Sbjct  312   LYHTPKSSFSAWDEKLQGYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGK  371

Query  1247  ECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVF  1068
             ECPL L LPNGE+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ IS +EL+++ E+F
Sbjct  372   ECPLLLQLPNGEISKTNGFISPMWGGVIVWNPENCDKDSE-SPSRNTISPQELEQIVEIF  430

Query  1067  MGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLS  888
             +GQ RQLFG  S+++Y     T ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLS
Sbjct  431   LGQFRQLFGFKSEAIYTSGLGTYKILPSERGFTEWELDVLSRKHTCFNLHSCSTTLGSLS  490

Query  887   RLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPS  708
             RLV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+ F+HPS
Sbjct  491   RLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENVFFHPS  550

Query  707   MMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             +MSVSY+S+EHCFAVYSPFFLPV  H++LAV REWKR +QE  KYL W  +
Sbjct  551   IMSVSYFSYEHCFAVYSPFFLPVVAHIVLAVNREWKRYRQEKAKYLTWLTR  601



>ref|XP_010449609.1| PREDICTED: GPI transamidase component PIG-S-like [Camelina sativa]
Length=605

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/591 (58%), Positives = 434/591 (73%), Gaps = 27/591 (5%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF DIDSL+  IE +
Sbjct  20    EFDPKTMRSTKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQIEST  79

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV  +   +    +L   I   + +LT  +S  CG+C  NF++++T+++
Sbjct  80    PLQFPCNFHAVFVGFE---SKDPDKLRSQIQDGINQLTH-QSSQCGSC--NFSISVTVQN  133

Query  1913  SSSNC--IYSENQDIV-WKCGALSGLDFEKSLDNTDDFLESLLDs------------rss  1779
              +  C    + N  +  ++CG +   +F   LD+T D  ESL D                
Sbjct  134   QADQCSETLAYNPSMCSYRCGVIKRNEFGVGLDDTVD--ESLNDVFSGCSENSGKTYSVV  191

Query  1778  rvytvvvvnrdeevravVGKYRHAWIVGKLSEQes---vekvveifvevfVNGGKEEGSI  1608
              V        DE ++AVVGK RHAW+VG   E+     V +V EIFV+VF+NGG++E SI
Sbjct  192   VVNKENANGEDEVIKAVVGKRRHAWVVGSGLEESYGDIVARVSEIFVKVFMNGGRDEESI  251

Query  1607  HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV  1428
             HGEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +DD LLAP+ +AL PIA++SVESQV
Sbjct  252   HGEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDDALLAPVTKALAPIANISVESQV  311

Query  1427  LYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEE  1248
             LYHTPKSSFS WDEK  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +
Sbjct  312   LYHTPKSSFSSWDEKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGK  371

Query  1247  ECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVF  1068
             ECPL L LPNGE+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ IS ++L+++ E+F
Sbjct  372   ECPLLLQLPNGEISKTNGFISPMWGGVIVWNPENCDKDSE-SPSRNTISPQDLEQIVEIF  430

Query  1067  MGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLS  888
             +GQ RQLFG  S+++Y     T ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLS
Sbjct  431   LGQFRQLFGFKSEAIYTSGLGTYKILPSERGFTEWELDVLSRKHTCFNLHSCSTTLGSLS  490

Query  887   RLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPS  708
             RLV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS
Sbjct  491   RLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPS  550

Query  707   MMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             +MSVSY+S+EHCFAVYSPFFLPV  H++ A LREWK  +QE  KYL W  +
Sbjct  551   IMSVSYFSYEHCFAVYSPFFLPVVAHIVFAALREWKGYRQEKAKYLTWLTR  601



>ref|XP_010464327.1| PREDICTED: GPI transamidase component PIG-S-like [Camelina sativa]
Length=605

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/591 (58%), Positives = 433/591 (73%), Gaps = 27/591 (5%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF DIDSL+  IE +
Sbjct  20    EFDPKTMRSTKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQIEST  79

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC    VFV  +   +     L   I   + +LT  +S  CG+C  N ++++T+++
Sbjct  80    PLRFPCNLHAVFVGFE---SKDPDNLRSQIQDGINQLTH-QSSQCGSC--NVSISVTVQN  133

Query  1913  SSSNCIYSENQD---IVWKCGALSGLDFEKSLDNTDDFLESLLDs------------rss  1779
              +  C+ +   +     ++CG +   +F   LD+T D  ESL D                
Sbjct  134   LAEQCLETLAHNPSTCSYRCGVIIRNEFGVGLDDTVD--ESLNDVFSGCSENSGKTYSVV  191

Query  1778  rvytvvvvnrdeevravVGKYRHAWIVGKLSEQe---svekvveifvevfVNGGKEEGSI  1608
              V        DE ++AVVGK RHAW+VG   E+     V +V EIFV+VF+NGG++E SI
Sbjct  192   VVNKENANGEDEVIKAVVGKRRHAWVVGSGLEERYGDIVARVSEIFVKVFMNGGRDEESI  251

Query  1607  HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV  1428
             HGEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +DD LLAP+ +AL PIA++SVESQV
Sbjct  252   HGEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDDALLAPVTKALAPIANISVESQV  311

Query  1427  LYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEE  1248
             LYHTPKSSFS WDEK  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +
Sbjct  312   LYHTPKSSFSSWDEKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGK  371

Query  1247  ECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVF  1068
             ECPL L LPNGE+SKTNGFISPMWGGV+VWNP SC K+SE  P+R+ IS ++L+++ E+F
Sbjct  372   ECPLLLQLPNGEISKTNGFISPMWGGVIVWNPESCDKDSE-SPIRNTISPQDLEQIVEIF  430

Query  1067  MGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLS  888
             +GQ RQLFG  S+++Y     T ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLS
Sbjct  431   LGQFRQLFGFKSEAIYTSGLGTYKILPSERGFTEWELDVLSRKHTCFNLHSCSTTLGSLS  490

Query  887   RLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPS  708
             RLV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS
Sbjct  491   RLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPS  550

Query  707   MMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             +MSVSY+S+EHCFAVYSPFFLPV  H++LA  REWKR +QE  KYL W  +
Sbjct  551   IMSVSYFSYEHCFAVYSPFFLPVVGHIVLAAFREWKRYRQEKAKYLTWLTR  601



>ref|XP_006407861.1| hypothetical protein EUTSA_v10020331mg [Eutrema salsugineum]
 gb|ESQ49314.1| hypothetical protein EUTSA_v10020331mg [Eutrema salsugineum]
Length=604

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/613 (57%), Positives = 438/613 (71%), Gaps = 30/613 (5%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EIS+      N        + +FDP TMR +KPG KRLF+T T+  SFL+GLPFL K+
Sbjct  1     MEEISD----HLNPTSDTSGLMPEFDPKTMRSSKPGLKRLFITTTVLFSFLLGLPFLWKT  56

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+R+PLPF DIDSL+  IE +PL FPC F  VFV      ++   +L   I   +++L
Sbjct  57    VEIYRSPLPFHDIDSLSNQIESTPLRFPCSFHAVFVGFQ---STDPDKLRSEIQDGIKQL  113

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDD  1812
             T   S  CG+C  +F++++T+++   +C   + S+     ++CG +    F    D   D
Sbjct  114   TQPSSQ-CGSC--DFSLSVTVQNPDDHCSETLTSDPSMCSYRCGVIKRNVFGAGSDVAVD  170

Query  1811  FLESLLD-----------srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvek  1665
               ESL D             S  V      N ++EV+AVVGK RHAWIVG   E+   + 
Sbjct  171   --ESLADVFSGCSGHGGKMYSVVVVNEENANGEDEVKAVVGKRRHAWIVGSGLEERYGDV  228

Query  1664  vveif---vevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDD  1494
             V  +    V+VF+NGG EEGSIHGEFMPVG+DGR+VLSF+LLN++P DWIYDWDFQ +D+
Sbjct  229   VARVSEIFVKVFMNGGMEEGSIHGEFMPVGSDGRIVLSFSLLNSNPRDWIYDWDFQRIDE  288

Query  1493  MLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLD  1314
              LLAP+ +AL PIA++SVESQVLYHTPKSSFS WDEK  SYIF   DLPFFVNSNEWHLD
Sbjct  289   ALLAPVTKALAPIANISVESQVLYHTPKSSFSSWDEKIQSYIFKTSDLPFFVNSNEWHLD  348

Query  1313  TSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKN  1134
             TS  A GRSK+L FVVY+PS +ECPL L LPNGE+SKTNGFISPMWGGV+VWNP +C  +
Sbjct  349   TSAGASGRSKILQFVVYIPSGKECPLHLQLPNGEISKTNGFISPMWGGVIVWNPGNCEND  408

Query  1133  SEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELD  954
             SE +P R+ IS ++L+++ EVF+GQ RQLFG  S+++Y     + ++L SE+GFT+WELD
Sbjct  409   SE-RPSRNTISPQDLERIVEVFLGQFRQLFGFKSEAIYTSGLGSYKILPSERGFTEWELD  467

Query  953   FISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNY  774
              +SR+HTCFNL  C TTLGSLSRLVQSLPRMII DEIG+QVK+S+ AAK + SNAS G Y
Sbjct  468   VLSRKHTCFNLHSCSTTLGSLSRLVQSLPRMIIKDEIGEQVKYSMKAAKLAQSNASTGGY  527

Query  773   DGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRC  594
               SA SSR+ARSLAE+AF+HPS+MSVSY+S+EHCFAVYSPFFLPV  HV+LA LREWKR 
Sbjct  528   SSSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVYSPFFLPVVGHVVLAALREWKRY  587

Query  593   KQENKKYLAWKAK  555
             KQE  KY  W A+
Sbjct  588   KQEKAKYSTWLAR  600



>ref|XP_002884631.1| hypothetical protein ARALYDRAFT_896875 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60890.1| hypothetical protein ARALYDRAFT_896875 [Arabidopsis lyrata subsp. 
lyrata]
Length=599

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/603 (57%), Positives = 436/603 (72%), Gaps = 26/603 (4%)
 Frame = -3

Query  2312  EDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPF  2133
             E+ + +       +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF
Sbjct  2     EETSDRLNPGITPEFDPKTMRSTKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPF  61

Query  2132  KDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGT  1953
              DIDSL+  IE +PL FPC F  VFV      ++    L   I   + +LT   S  CG+
Sbjct  62    HDIDSLSDQIESTPLRFPCNFHAVFVGF---PSTDPDNLRSQIQDGINQLTHQNSQ-CGS  117

Query  1952  CLSNFTVAITLESSSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs--  1788
             C  NF++++T+++    C   +   +    ++CG +    F   +D+T D  ESL D   
Sbjct  118   C--NFSLSVTVQNRDDQCSETLAHSSTTCSYRCGVIKRNVFGVGVDDTVD--ESLNDVFS  173

Query  1787  ---------rssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQe---svekvveifve  1644
                       S  V      N  +EV+AVVGK RHAWIVG   E+     V +V EIFV+
Sbjct  174   GCSEESGKVYSVVVVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDMVARVSEIFVK  233

Query  1643  vfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             VF+ GG++E SI GEFMPVG+DGR+VLSF+LLN++P DW+YDWDFQ +D+ LLAP+ +AL
Sbjct  234   VFMTGGRDEDSIQGEFMPVGSDGRIVLSFSLLNSNPRDWVYDWDFQRIDEALLAPVTKAL  293

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
              PIA++SVESQVLYHTPKSSFS WD+K  SYIF   DLPFFVNSNEWHLDTS  A GRSK
Sbjct  294   APIANISVESQVLYHTPKSSFSSWDKKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSK  353

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKI  1104
             +L FVVY+PS +ECPL L LPNGE+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ I
Sbjct  354   ILQFVVYIPSGKECPLLLQLPNGEISKTNGFISPMWGGVIVWNPGNCDKDSE-SPSRNTI  412

Query  1103  SSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFN  924
             S ++L+++ E+F+GQ RQLFG  S+++Y     T ++L SE+GFT+WELD +SR+HTCFN
Sbjct  413   SPQDLEQIVEIFLGQFRQLFGFKSEAIYTSGLGTYKILPSERGFTEWELDVLSRKHTCFN  472

Query  923   LLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQA  744
             L  C TTLGSLSRLV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+A
Sbjct  473   LHSCSTTLGSLSRLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREA  532

Query  743   RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             RSLAE+AF+HPS+MSVSY+S+EHCFAVYSPFFLPVA HV+LA LREW+R KQE  KYL W
Sbjct  533   RSLAENAFFHPSIMSVSYFSYEHCFAVYSPFFLPVAGHVVLAALREWRRYKQEKAKYLTW  592

Query  563   KAK  555
               +
Sbjct  593   LTR  595



>ref|XP_008456784.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Cucumis 
melo]
Length=565

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/558 (60%), Positives = 425/558 (76%), Gaps = 13/558 (2%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             M EISE       +  S ++ ++ FDP TMR TKPG KRL LT+++F SFL+GLPFL K+
Sbjct  1     MGEISEPSEPPQLDSGSSEAGLSQFDPKTMRNTKPGLKRLILTISVFSSFLLGLPFLWKT  60

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+RAPLPFKDID+L+  IE SPL FPC F+V+F   D S  S A +L   I  +M KL
Sbjct  61    VEIYRAPLPFKDIDALSYHIESSPLQFPCTFRVLFFGFD-SIASRAEQLKSSILDEMTKL  119

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSS-NCIYSENQDIVWKCGALSGLDFEKSLDN----T  1818
             +S KS + G+C +N+ V++ +ES S  +   ++     W+CGALS  DF  SL+N     
Sbjct  120   SS-KSSLYGSCSNNYAVSVVIESGSECSQTRTDASSCPWRCGALSASDFAASLENGFQSA  178

Query  1817  DDFLESLLD-----srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvvei  1653
             DDFLE  L      +   RVY+VVV+N+ E V A +GKYRH WIVG++SE ++  KV E 
Sbjct  179   DDFLEVALGGCSKPASGVRVYSVVVMNKGENVVATIGKYRHGWIVGRVSEADATAKVAET  238

Query  1652  fvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIV  1473
             FV++F NGG E G I GEFMPVGADG++ LSFNLLNADP DWIYDWDFQ++D+++L P++
Sbjct  239   FVKLFGNGGTEGGLIPGEFMPVGADGKIFLSFNLLNADPDDWIYDWDFQKVDEVILKPLI  298

Query  1472  QALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGG  1293
             + L PIA+VSVESQVLYHTP SSFS WD KQ SYIF+ KDLPFFVNSNEWHLDTS AAGG
Sbjct  299   EELAPIANVSVESQVLYHTPTSSFSYWDNKQESYIFNTKDLPFFVNSNEWHLDTSIAAGG  358

Query  1292  RSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-  1116
             RSK+LHFVVYVPS  ECPL L LP+G++S+TNGFISP WGGV+VWNP  C ++ E + L 
Sbjct  359   RSKILHFVVYVPSARECPLLLELPDGQISETNGFISPTWGGVIVWNPKGCLRDHESKQLR  418

Query  1115  RHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQH  936
             RH IS+ EL+K+ EVF+GQ RQLFGL S+  +VG + T  +LTS+KGFT+WE+DF+SRQH
Sbjct  419   RHMISNPELEKIVEVFLGQFRQLFGLKSNPQHVGLSGTFNILTSQKGFTEWEMDFLSRQH  478

Query  935   TCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS  756
             +CFNL  C ++LGSLSRLVQSLPRMII+DEIGKQVK+SL+AA  +  NAS+G +D +A+S
Sbjct  479   SCFNLHSCASSLGSLSRLVQSLPRMIIIDEIGKQVKYSLEAANLAQKNASMGVFDAAAIS  538

Query  755   SRQARSLAEDAFYHPSMM  702
             SRQARSLAEDAF+HPS++
Sbjct  539   SRQARSLAEDAFFHPSII  556



>gb|KFK38171.1| hypothetical protein AALP_AA3G078200 [Arabis alpina]
Length=598

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/584 (59%), Positives = 431/584 (74%), Gaps = 23/584 (4%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR +KPG KRLF+T T+  SFLIGL FL KS+EI+R+PLPF DIDSL+  IE +
Sbjct  17    EFDPKTMRSSKPGLKRLFITATVLFSFLIGLLFLWKSVEIYRSPLPFNDIDSLSDQIEST  76

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV      ++   +L   I   + +LT  +S  CG+C  NF++++T+++
Sbjct  77    PLRFPCSFHAVFVGF---RSTNPEKLRSEIEDGVNQLTH-QSSQCGSC--NFSLSVTVQN  130

Query  1913  SSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs-----------rssrvyt  1767
                +C  S++    ++CG +    F   LD+T D  ESL D             S  V  
Sbjct  131   PDDHCSESDSSTCSYRCGVIKRDVFGVGLDDTVD--ESLNDVFSGCSGDSGKLYSVVVVN  188

Query  1766  vvvvnrdeevravVGKYRHAWIVGKLSEQe---svekvveifvevfVNGGKEEGSIHGEF  1596
                 N ++EV+AVVGK RHAWIVG   E+     V +V EIFV+VF+NGG+EE SI GEF
Sbjct  189   RENGNGEDEVKAVVGKRRHAWIVGSGLEERYGDVVGRVSEIFVKVFMNGGREEDSIQGEF  248

Query  1595  MPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHT  1416
             MPVG+DGR+VLSF+LLN++P DW+YDWDFQ +D+  LAP+ +AL PIA++SVESQVLYHT
Sbjct  249   MPVGSDGRIVLSFSLLNSNPRDWVYDWDFQRIDESFLAPVTKALAPIANISVESQVLYHT  308

Query  1415  PKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPL  1236
             PKSSFS WD++  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS EECPL
Sbjct  309   PKSSFSSWDDELKSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGEECPL  368

Query  1235  QLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQL  1056
              L LPNGE+SKTNGFISPMWGGV+VWNP +C K+S   P R+ IS ++L+++ EVF+GQ 
Sbjct  369   HLQLPNGEISKTNGFISPMWGGVIVWNPRNCDKDSG-SPSRNTISPQDLEQIVEVFLGQF  427

Query  1055  RQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
             RQLFG  S+++Y     T ++L S+KGFT+WELD +SR+HTCFNL  C TTLGSLSRLVQ
Sbjct  428   RQLFGFKSEAIYTSGLGTYQILPSKKGFTEWELDVLSRKHTCFNLQSCSTTLGSLSRLVQ  487

Query  875   SLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSV  696
             SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAEDAF+HPS+MSV
Sbjct  488   SLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAEDAFFHPSIMSV  547

Query  695   SYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             SY+S+EHCFAVYSPFFLPV  HV LA  REW+R KQE  KYL W
Sbjct  548   SYFSYEHCFAVYSPFFLPVLGHVFLAAWREWRRYKQEKAKYLTW  591



>emb|CDY24640.1| BnaA05g30390D [Brassica napus]
Length=603

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/584 (59%), Positives = 417/584 (71%), Gaps = 25/584 (4%)
 Frame = -3

Query  2267  DPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPL  2088
             DP TMR +KPG KRLF+T T+  SFL GLPFL KS+EI+R+ LPF DIDSL+  I+ +PL
Sbjct  22    DPKTMRSSKPGLKRLFITTTVLFSFLSGLPFLWKSVEIYRSQLPFHDIDSLSDQIKSTPL  81

Query  2087  LFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSS  1908
              FPC F  VFV      ++   +L   I   + +LT   S  CG+C  N ++++T++S  
Sbjct  82    RFPCTFHAVFVGF---RSNDPDQLRSEIQDGVNQLTGGSSQ-CGSC--NVSISVTVQSPD  135

Query  1907  SNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs------------rssrvytv  1764
               C  +      ++CG +    F   LD+  D  ESL D                 V   
Sbjct  136   ELCSETFPSTCSYRCGVIKRDAFGGGLDDEVD--ESLDDVFGGCSGGIGKMYSVVVVNKE  193

Query  1763  vvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfV---NGGKEEG-SIHGEF  1596
                   +EV+AVVGK RHAWIVG   E+   E V  +   +     NGG+EEG SI GEF
Sbjct  194   KGNGGGDEVKAVVGKRRHAWIVGSGLEERYGEVVGRVSEVLVKVFMNGGREEGDSIRGEF  253

Query  1595  MPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHT  1416
             MPVG+DGR+VLSF+LLN++P DWIYDWDFQ +D+ LLAP+ +AL PIAD+SVESQVLYHT
Sbjct  254   MPVGSDGRLVLSFSLLNSNPRDWIYDWDFQRIDEALLAPVTKALAPIADISVESQVLYHT  313

Query  1415  PKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPL  1236
             PKSSFS WDEK  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +ECPL
Sbjct  314   PKSSFSSWDEKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKECPL  373

Query  1235  QLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQL  1056
              L LPNGE+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ IS ++L+K+ EVF+GQ 
Sbjct  374   HLQLPNGEISKTNGFISPMWGGVIVWNPRNCDKDSE-SPSRNTISPQDLEKIVEVFLGQF  432

Query  1055  RQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
             RQLFG  S++ Y     + ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLSRLVQ
Sbjct  433   RQLFGFKSEATYTSGFGSYKILPSERGFTEWELDVLSRKHTCFNLHSCATTLGSLSRLVQ  492

Query  875   SLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSV  696
             SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+MSV
Sbjct  493   SLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSIMSV  552

Query  695   SYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             SY+S+EHCFAVYSPFFLPVA HV+LA LREWKR KQE  KYL W
Sbjct  553   SYFSYEHCFAVYSPFFLPVAGHVVLAALREWKRYKQEKAKYLTW  596



>ref|NP_187374.2| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
 gb|AAL32707.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91117.1| unknown protein [Arabidopsis thaliana]
 gb|AEE74508.1| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
Length=599

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/590 (58%), Positives = 432/590 (73%), Gaps = 26/590 (4%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF DIDSL+  +E +
Sbjct  15    EFDPKTMRSTKPGLKRLFITSSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQLEST  74

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV      ++    L   I   + +LT  +S  CG+C  +F++++T+++
Sbjct  75    PLRFPCNFHAVFVGF---RSTDPDNLRSQIQDGINQLTH-QSSQCGSC--DFSLSVTVQN  128

Query  1913  SSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLD-----------srssr  1776
                 C   +   +    ++CG +    F   LD+T D  ESL D             S  
Sbjct  129   REDQCSDTLAHSSTTCSYRCGVIKRNGFSVGLDDTVD--ESLNDVFSGCSENSGKMYSVV  186

Query  1775  vytvvvvnrdeevravVGKYRHAWIVGKLSEQes---vekvveifvevfVNGGKEEGSIH  1605
             V      N  +EV+AVVGK RHAWIVG   E+     V +V EIFV+VF+NGG+EE SI 
Sbjct  187   VVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDIVARVSEIFVQVFMNGGREEDSIQ  246

Query  1604  GEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVL  1425
             GEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +D+ LLAP+ +AL PIA+++VESQVL
Sbjct  247   GEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDEALLAPVTKALAPIANITVESQVL  306

Query  1424  YHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEE  1245
             YHTPKSSFS WD+K  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +E
Sbjct  307   YHTPKSSFSSWDKKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKE  366

Query  1244  CPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFM  1065
             CPL L LPN E+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ IS ++L+++ E+F+
Sbjct  367   CPLLLQLPNVEISKTNGFISPMWGGVIVWNPGNCDKDSE-SPSRNTISLQDLEQIVEIFL  425

Query  1064  GQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSR  885
             GQ RQLFG  S++ Y     T ++LTSE+GFT+WELD +SR+HTCFNL  C TTLGSLSR
Sbjct  426   GQFRQLFGFKSEAKYTTGLGTYKILTSERGFTEWELDVLSRKHTCFNLHSCSTTLGSLSR  485

Query  884   LVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
             LV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+
Sbjct  486   LVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSI  545

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             MSVSY+S+EHCFAVYSPFFLPV  HV+LA +REWKR KQE  KYL W  +
Sbjct  546   MSVSYFSYEHCFAVYSPFFLPVVGHVVLAAVREWKRYKQEKAKYLTWLTR  595



>ref|XP_009147102.1| PREDICTED: GPI transamidase component PIG-S [Brassica rapa]
Length=603

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/586 (58%), Positives = 417/586 (71%), Gaps = 25/586 (4%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             + DP TMR +KPG KRL +T T+  SFL GLPFL KS+EI+R+ LPF DIDSL+  I+ +
Sbjct  20    ELDPKTMRSSKPGLKRLLITTTVLFSFLSGLPFLWKSVEIYRSQLPFHDIDSLSDQIKST  79

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VF+      ++   +L   I   + +LT   S  CG+C  N ++++T++S
Sbjct  80    PLRFPCTFHAVFIGFG---SNDPDQLRSEIQDGVNQLTGGSSQ-CGSC--NVSISVTVQS  133

Query  1913  SSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs------------rssrvy  1770
                 C  +      ++CG +    F   LD+  D  ESL D                 V 
Sbjct  134   PDELCSETFPSTCSYRCGVIKRDSFGGGLDDEVD--ESLDDVFGGCSGGIGKMYSVVVVN  191

Query  1769  tvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevf---VNGGKEEG-SIHG  1602
                     +EV+AVVGK RHAWIVG   E+   E V  +        +NGG+EEG SI G
Sbjct  192   KEKGNGGGDEVKAVVGKRRHAWIVGSGLEERYGEVVGRVSEVFVNVFMNGGREEGDSIRG  251

Query  1601  EFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLY  1422
             EFMPVG+DGR+VLSF+LLN++P DWIYDWDFQ +D+ LLAP+ +AL PIAD+SVESQVLY
Sbjct  252   EFMPVGSDGRLVLSFSLLNSNPRDWIYDWDFQRIDEGLLAPVTKALAPIADISVESQVLY  311

Query  1421  HTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEEC  1242
             HTPKSSFS WDEK  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +EC
Sbjct  312   HTPKSSFSSWDEKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKEC  371

Query  1241  PLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMG  1062
             PL L LPNGE+SKTNGFISPMWG V+VWNP +C K+SE  P R+ IS ++L+++ EVF+G
Sbjct  372   PLHLQLPNGEISKTNGFISPMWGSVIVWNPRNCDKDSE-SPSRNMISPQDLEQIVEVFLG  430

Query  1061  QLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRL  882
             Q RQLFG  S+++Y     + ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLSRL
Sbjct  431   QFRQLFGFKSEAIYTSELGSYKILPSERGFTEWELDVLSRKHTCFNLHSCATTLGSLSRL  490

Query  881   VQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             VQSLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+M
Sbjct  491   VQSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSIM  550

Query  701   SVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             SVSY+S+EHCFAVYSPFFLPVA HV+LA LREWKR KQE  KYL W
Sbjct  551   SVSYFSYEHCFAVYSPFFLPVAGHVVLAALREWKRYKQEKAKYLTW  596



>ref|XP_006297237.1| hypothetical protein CARUB_v10013242mg, partial [Capsella rubella]
 gb|EOA30135.1| hypothetical protein CARUB_v10013242mg, partial [Capsella rubella]
Length=616

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/612 (56%), Positives = 440/612 (72%), Gaps = 26/612 (4%)
 Frame = -3

Query  2339  AEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSI  2160
              E  E  S   N        + +FDP TMR +KPG KRLF+T ++  SFL+G+PFL KS+
Sbjct  10    GEPMEGTSGSLNPTTDTSGIMPEFDPKTMRSSKPGLKRLFITTSVLFSFLLGVPFLWKSV  69

Query  2159  EIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLT  1980
             EI+R+PLPF DIDSL+  IE +PL FPC F  VFV      ++ A  L   I   + +LT
Sbjct  70    EIYRSPLPFHDIDSLSDQIESTPLRFPCNFHAVFVGF---RSTDADNLRSQIQDGINQLT  126

Query  1979  SAKSPVCGTCLSNFTVAITLESSSSNCIYSENQD---IVWKCGALSGLDFEKSLDNTDDF  1809
                SP CG+C  +F++++T+++ +  C  +   +     ++CG +   DF   LD+T D 
Sbjct  127   HL-SPQCGSC--SFSLSVTIQNPAEQCSETLGHNPSSCSYRCGMIKSNDFGVGLDDTVD-  182

Query  1808  LESLLD-----------srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekv  1662
              ESL D             S  V      N ++EV+AVVGK RHAWIVG   E+ + + V
Sbjct  183   -ESLNDVFSGCSANSRKMYSVVVVNKENANGEDEVKAVVGKRRHAWIVGSGLEERNDDMV  241

Query  1661  veif---vevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDM  1491
               +    V++F+NGG++E SIHGEFMPVG+DGR+VLSF+LLN++P DW+YDWDFQ +DD 
Sbjct  242   SRVSEIFVKMFMNGGRDEDSIHGEFMPVGSDGRIVLSFSLLNSNPRDWVYDWDFQRIDDA  301

Query  1490  LLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDT  1311
             LLAP+ +AL PIA++SVESQVLYHTPKSSFS WDE+  SYIF   DLPFFVNSNEWHLDT
Sbjct  302   LLAPVTKALAPIANISVESQVLYHTPKSSFSSWDEQLQSYIFRTSDLPFFVNSNEWHLDT  361

Query  1310  STAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS  1131
             S  A GRSK+L FVVY+PS  ECPL L LPNGE+SKTNGFISPMWGGV+VWNP +C K+S
Sbjct  362   SAGASGRSKILQFVVYIPSGSECPLLLQLPNGEISKTNGFISPMWGGVIVWNPGNCDKDS  421

Query  1130  EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDF  951
             E  P+R+ IS ++++++ E+F+GQ RQLFG  S+++Y     T ++L SE+GFT+WELD 
Sbjct  422   E-SPIRNTISPQDIEQIVEIFLGQFRQLFGFKSEAIYTSVLGTYKILPSERGFTEWELDV  480

Query  950   ISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYD  771
             +SR+HTCFNL  C TTL SLS+LV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y 
Sbjct  481   LSRKHTCFNLHSCSTTLSSLSKLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYS  540

Query  770   GSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCK  591
              SA SSR+ARSLAE+AF+HPS+MSVSY+S+EHCFAVYSPFFLPV  HV+LA LREWKR +
Sbjct  541   SSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVYSPFFLPVVAHVVLAALREWKRYR  600

Query  590   QENKKYLAWKAK  555
             QE  KYL W  +
Sbjct  601   QEKAKYLTWLTR  612



>emb|CDY39557.1| BnaCnng09260D [Brassica napus]
Length=599

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/580 (59%), Positives = 422/580 (73%), Gaps = 21/580 (4%)
 Frame = -3

Query  2267  DPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPL  2088
             D  TMR +KPG KRL +T T+  SFL GLPFL KS+EI+R+ LPF DIDSL+  ++ +PL
Sbjct  22    DLETMRSSKPGLKRLLITTTVLFSFLSGLPFLWKSVEIYRSQLPFHDIDSLSDQVKSAPL  81

Query  2087  LFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSS  1908
              FPC F  VFV      ++   +L   I   + +L   +S  CG+C  N ++++T++S  
Sbjct  82    RFPCTFHAVFVGFG---SNDPDQLRSEIQDGVNQLI-GESSQCGSC--NVSISVTVQSPD  135

Query  1907  SNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDs--------rssrvytvvvvn  1752
               C  +      ++CG +    F + LD+  D  ESL D                VV   
Sbjct  136   ELCSETFPSTCSYRCGVIKRDSFGRGLDDAVD--ESLDDVFSGCSGGIGKMYSVVVVNKE  193

Query  1751  rdeevravVGKYRHAWIVGKLSEQe---svekvveifvevfVNGGKEEG-SIHGEFMPVG  1584
               +EV+AVVGK RHAWIVG   E+     V +V E+FV+VF+NGG+EEG SI GEFMPVG
Sbjct  194   NGDEVKAVVGKRRHAWIVGSGLEERFGEVVGRVSEVFVKVFMNGGREEGDSIRGEFMPVG  253

Query  1583  ADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSS  1404
             +DGR+VLSF+LLN++P DWIYDWDFQ +D+ LLAP+ +AL PIA++SVESQVLYHTPKSS
Sbjct  254   SDGRLVLSFSLLNSNPRDWIYDWDFQRIDEALLAPVTKALAPIANISVESQVLYHTPKSS  313

Query  1403  FSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
             FS WDEK  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +ECPL L L
Sbjct  314   FSSWDEKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKECPLHLQL  373

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLF  1044
             PN E+SKTNGFISPMWGGV+VWNP SC K+SE  P  + IS ++L+K+ EVF+GQ RQLF
Sbjct  374   PNEEISKTNGFISPMWGGVIVWNPRSCDKDSE-SPSTNTISPQDLEKIVEVFLGQFRQLF  432

Query  1043  GLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
             G  S++ Y     + ++L SE+GFT+WELD +SR+HTCFNL  C TTLGSLSRLVQSLPR
Sbjct  433   GFKSEATYTSELGSYKILPSERGFTEWELDVLSRKHTCFNLRSCATTLGSLSRLVQSLPR  492

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             MII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+MSVSY+S
Sbjct  493   MIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSIMSVSYFS  552

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAW  564
             +EHCFAVYSPFFLPVA HV+LA LREW+R KQE  KYL W
Sbjct  553   YEHCFAVYSPFFLPVAGHVVLAALREWRRYKQEKAKYLTW  592



>ref|NP_001189834.1| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
 gb|AEE74510.1| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
Length=591

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/590 (57%), Positives = 425/590 (72%), Gaps = 34/590 (6%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  S      FLL  +EI+R+PLPF DIDSL+  +E +
Sbjct  15    EFDPKTMRSTKPGLKRLFITSSVLFS------FLL--VEIYRSPLPFHDIDSLSDQLEST  66

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV      ++    L   I   + +LT  +S  CG+C  +F++++T+++
Sbjct  67    PLRFPCNFHAVFVGF---RSTDPDNLRSQIQDGINQLTH-QSSQCGSC--DFSLSVTVQN  120

Query  1913  SSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLD-----------srssr  1776
                 C   +   +    ++CG +    F   LD+T D  ESL D             S  
Sbjct  121   REDQCSDTLAHSSTTCSYRCGVIKRNGFSVGLDDTVD--ESLNDVFSGCSENSGKMYSVV  178

Query  1775  vytvvvvnrdeevravVGKYRHAWIVGKLSEQe---svekvveifvevfVNGGKEEGSIH  1605
             V      N  +EV+AVVGK RHAWIVG   E+     V +V EIFV+VF+NGG+EE SI 
Sbjct  179   VVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDIVARVSEIFVQVFMNGGREEDSIQ  238

Query  1604  GEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVL  1425
             GEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +D+ LLAP+ +AL PIA+++VESQVL
Sbjct  239   GEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDEALLAPVTKALAPIANITVESQVL  298

Query  1424  YHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEE  1245
             YHTPKSSFS WD+K  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FVVY+PS +E
Sbjct  299   YHTPKSSFSSWDKKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGKE  358

Query  1244  CPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFM  1065
             CPL L LPN E+SKTNGFISPMWGGV+VWNP +C K+SE  P R+ IS ++L+++ E+F+
Sbjct  359   CPLLLQLPNVEISKTNGFISPMWGGVIVWNPGNCDKDSE-SPSRNTISLQDLEQIVEIFL  417

Query  1064  GQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSR  885
             GQ RQLFG  S++ Y     T ++LTSE+GFT+WELD +SR+HTCFNL  C TTLGSLSR
Sbjct  418   GQFRQLFGFKSEAKYTTGLGTYKILTSERGFTEWELDVLSRKHTCFNLHSCSTTLGSLSR  477

Query  884   LVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
             LV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+
Sbjct  478   LVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSI  537

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
             MSVSY+S+EHCFAVYSPFFLPV  HV+LA +REWKR KQE  KYL W  +
Sbjct  538   MSVSYFSYEHCFAVYSPFFLPVVGHVVLAAVREWKRYKQEKAKYLTWLTR  587



>ref|XP_010927561.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Elaeis 
guineensis]
Length=608

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/579 (57%), Positives = 423/579 (73%), Gaps = 18/579 (3%)
 Frame = -3

Query  2261  NTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLF  2082
             +T R  +PG KRL LTL++ +SFL GLPFLLKS EI+R+PLPF+ IDSL+  ++      
Sbjct  23    STRRTARPGTKRLLLTLSVLLSFLSGLPFLLKSTEIYRSPLPFRSIDSLSSRLQSDHPTL  82

Query  2081  PCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSN  1902
             PC+FQ V +  D +    A  L  LI+  + K TS   PV G C  NF+V++T++S +  
Sbjct  83    PCRFQAVLLRPD-ADRFLADRLGSLISEDLVKRTS-NDPVSGGCGKNFSVSVTIDSGA-G  139

Query  1901  CIYSE---NQDIVWKCGALSGLDFEKSLDNTDDFLESLL----------Dsrssrvytvv  1761
             C+ S        +W+CG           ++ D+ L+S L            R   V  + 
Sbjct  140   CVRSSVGAGDACLWRCGVADFSGLGGGDEDVDELLDSALREGSECLGSGGGRVYTVVVIE  199

Query  1760  vvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI-HGEFMPVG  1584
                  E V+ VVGK+RHAW+VGK+SE E+V  + +IFVE+F+NGGK+ G I   EFMPVG
Sbjct  200   RDVAGEGVQVVVGKHRHAWLVGKVSEPEAVSMIGKIFVEIFMNGGKKAGEIGKAEFMPVG  259

Query  1583  ADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSS  1404
             ADG VVLSF+LLNADP DW+Y+W+FQ+++ ++LAP+V+AL PIA+++VESQVLYHTPKSS
Sbjct  260   ADGSVVLSFSLLNADPSDWVYNWEFQKIEKIMLAPVVEALAPIANITVESQVLYHTPKSS  319

Query  1403  FSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
              S WD+K GSYIF+++DLPFFVNSNEWHLDTS  A G+SKVL FVVYVPS  ECPL L L
Sbjct  320   ISYWDKKLGSYIFTMRDLPFFVNSNEWHLDTSITAAGQSKVLQFVVYVPSARECPLVLQL  379

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLRQL  1047
             P+GE SKTNGFISPMWGG+VVWNPP CSK+S+   L ++ IS++EL+K+F+VF+GQLR L
Sbjct  380   PDGETSKTNGFISPMWGGIVVWNPPMCSKDSQRTYLAKNIISTQELQKIFQVFIGQLRLL  439

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLP  867
             FGL S+ L       SR L SE+GFT+WELD + R HTCFNLL C TTL SLS+LVQSLP
Sbjct  440   FGLRSNYLDATEMGISRFLNSERGFTEWELDLLYRHHTCFNLLSCATTLESLSKLVQSLP  499

Query  866   RMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
             RMIIMDEIGKQVKFSL+AA  +L NAS+G YD SAVS+R+AR+LAEDAF+HPS+MS+SY 
Sbjct  500   RMIIMDEIGKQVKFSLEAASLALRNASLGIYDASAVSARKARALAEDAFFHPSIMSISYS  559

Query  686   SFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYL  570
             S EH FA+Y PFF PV+LHV+LA ++E KR K+E  KYL
Sbjct  560   SIEHYFAIYMPFFAPVSLHVLLAAIKELKRYKRERAKYL  598



>ref|XP_008797152.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S 
[Phoenix dactylifera]
Length=610

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/603 (57%), Positives = 427/603 (71%), Gaps = 20/603 (3%)
 Frame = -3

Query  2318  SAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPL  2139
             S +  N +   +   D D +T R T+PG KRL LTL++ +SFL GLPFLLKS EI+R+PL
Sbjct  5     SGDAPNPRPPSAAAADGD-STRRTTRPGTKRLLLTLSVLLSFLSGLPFLLKSTEIYRSPL  63

Query  2138  PFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVC  1959
             PF+ IDSL+  ++      PC+FQ V +         A  L  LI+  +   TS   PVC
Sbjct  64    PFRSIDSLSSRLQSDHPTLPCRFQAVLLR-PEGDRFLADRLESLISEDLVNRTS-NDPVC  121

Query  1958  GTCLSNFTVAITLESSSSNCIYSEN---QDIVWKCGALSGLDFEKSLDNTDDFLESLL--  1794
             G C  NF+V++T++SS+  C+ S +      +W+CG           ++ D+ L+S L  
Sbjct  122   GGCGKNFSVSVTIDSSA-GCVRSSDGAGDACLWRCGVADSSGLGGGDEDVDELLDSALRE  180

Query  1793  --------DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevf  1638
                       R   V  +      E VR VVGK+RHAW+VGK+S+ E V  + +IFVE+F
Sbjct  181   GGECLGSGSGRVYTVVVIEREIGGEGVRVVVGKHRHAWMVGKVSDAEVVSVIGKIFVEIF  240

Query  1637  VNGGKEEGS--IHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQAL  1464
             +N GK  G   + GEFMPVGADG VVLSF+LLNADP DW+Y W+FQ++  ++LAPIV+AL
Sbjct  241   MNSGKTIGEMXVKGEFMPVGADGGVVLSFSLLNADPSDWVYYWEFQKIVKIMLAPIVEAL  300

Query  1463  RPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSK  1284
              PIA++SVESQVLYHTPKSS S WD+K GSYIFS++DLPFFVNSNEWHLDTS AA GRSK
Sbjct  301   APIANISVESQVLYHTPKSSISYWDKKLGSYIFSMRDLPFFVNSNEWHLDTSIAAAGRSK  360

Query  1283  VLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHK-  1107
             VL FVVYVPS  ECPL L LP+GE SKTNGFISPMWGGVVVWNPP C K+S+   L    
Sbjct  361   VLQFVVYVPSARECPLVLQLPDGETSKTNGFISPMWGGVVVWNPPMCLKDSQRTHLTESI  420

Query  1106  ISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCF  927
             IS+++L+K+F+VF+GQLR LFGL S+ L       SR L SE+GFT+WELD + R H CF
Sbjct  421   ISTQDLQKIFQVFIGQLRLLFGLRSNYLDATEMGISRFLNSERGFTEWELDLLYRHHACF  480

Query  926   NLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQ  747
             NLL C TTL SLS+LVQSLPRMIIMDEIGKQVKFSL+AA  +L NAS+G YD SAVS+R+
Sbjct  481   NLLSCATTLESLSKLVQSLPRMIIMDEIGKQVKFSLEAASLALRNASLGIYDASAVSARK  540

Query  746   ARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             AR+LAEDAF+HPS+MS+SY S EH FA+Y PFF PVALHV+LA ++E KR K+E  KYLA
Sbjct  541   ARALAEDAFFHPSIMSISYSSIEHYFAIYMPFFAPVALHVLLAAIKELKRYKRERAKYLA  600

Query  566   WKA  558
             + A
Sbjct  601   FSA  603



>ref|XP_002862513.1| hypothetical protein ARALYDRAFT_497414 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38771.1| hypothetical protein ARALYDRAFT_497414 [Arabidopsis lyrata subsp. 
lyrata]
Length=589

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/559 (57%), Positives = 402/559 (72%), Gaps = 26/559 (5%)
 Frame = -3

Query  2180  PFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLIT  2001
             PFL KS+EI+R+PLPF DIDSL+  IE +PL FPC F  VFV      ++    L   I 
Sbjct  36    PFLWKSVEIYRSPLPFHDIDSLSDQIESTPLRFPCNFHAVFVGF---RSTDPDNLRSQIQ  92

Query  2000  SQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC---IYSENQDIVWKCGALSGLDFEKS  1830
               + +LT   S  CG+C  NF++++T+++    C   +   +    ++CG +    F   
Sbjct  93    DGINQLTHQNSQ-CGSC--NFSLSVTVQNRDDQCSETLAHSSTTCSYRCGVIKRNVFGVG  149

Query  1829  LDNTDDFLESLLD-----------srssrvytvvvvnrdeevravVGKYRHAWIVGKLSE  1683
             +D+T D  ESL D             S  V      N ++EV+AVVGK RHAWIVG   E
Sbjct  150   VDDTVD--ESLNDVFSGCSEESGKMYSVVVVNKENANGEDEVKAVVGKGRHAWIVGNGLE  207

Query  1682  Qesvekvveif---vevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWD  1512
             +   + V  +    V+VF+NGG+EE SI GEFMPVG+DGR+VLSF+LLN++P DW+YDWD
Sbjct  208   ERYGDMVARVSEIFVKVFMNGGREEDSIQGEFMPVGSDGRIVLSFSLLNSNPRDWVYDWD  267

Query  1511  FQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNS  1332
             FQ +D+ LLAP+ +AL PIA++SVESQVLYHTPKSSFS WD+K  SYIF    LPFFVNS
Sbjct  268   FQRIDEALLAPVTKALAPIANISVESQVLYHTPKSSFSSWDKKLQSYIFRTSALPFFVNS  327

Query  1331  NEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNP  1152
             NEWHLDTS  A GRSK+L FVVY+PS +ECPL L LPNGE+SKTNGFISP+WGGV+VWNP
Sbjct  328   NEWHLDTSAGASGRSKILQFVVYIPSGKECPLLLQLPNGEISKTNGFISPIWGGVIVWNP  387

Query  1151  PSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGF  972
              +C K+SE    R+ IS ++L+++ E+F+GQ RQLFG  S++ Y     T ++L S++GF
Sbjct  388   GNCDKDSESSS-RNTISPQDLEQIVEIFLGQFRQLFGFKSEAFYTSGLGTYKILPSDRGF  446

Query  971   TQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSN  792
             T+WELD +S +HTCFNL  C TTLGSLSRLV+SLPRMII DEIG+QVK+SL AAK + SN
Sbjct  447   TEWELDVLSTKHTCFNLHSCSTTLGSLSRLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSN  506

Query  791   ASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             AS+G Y  SA SSR+ARSLAE+AF+HPS+MSVSY+S+EHCFAVYSPFFLPVA HV+LA L
Sbjct  507   ASLGEYSSSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVYSPFFLPVAGHVVLAAL  566

Query  611   REWKRCKQENKKYLAWKAK  555
             REWKR KQE  KYL W  +
Sbjct  567   REWKRYKQEKAKYLTWLTR  585



>ref|XP_009382913.1| PREDICTED: GPI transamidase component PIG-S [Musa acuminata subsp. 
malaccensis]
Length=615

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/614 (53%), Positives = 421/614 (69%), Gaps = 24/614 (4%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKS  2163
             MAEISE          ++     +  P T R TKPGRKRLFLT ++ +SFL GLPF LKS
Sbjct  1     MAEISEDAPPPPAAAAADAGVQGEAAP-TRRSTKPGRKRLFLTFSVLLSFLSGLPFFLKS  59

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
              EIHR+PLPF+ ID+L+  ++  P   PC F+ VF+      T  A+ L   I + M + 
Sbjct  60    TEIHRSPLPFESIDALSRRLQFDPPSLPCHFRAVFLRSGADRT-LAARLQSAIAADMGRR  118

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQ---DIVWKCGALSGLDFEKSLDN-TD  1815
                +   CG C   F V++T++S    C+  +       +W CGA+S LD     D+  D
Sbjct  119   AGNRLS-CGGCGRGFAVSVTVDSGE-ECVSDDGGVAGSCLWTCGAVS-LDGSGEDDSAVD  175

Query  1814  DFLESLLDsr-----------ssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesve  1668
             + L+S++                    V+     E VR VVGK+RHAWIVGK+SE ++V 
Sbjct  176   ELLDSVMRGAGGKECVDAGGGRVYTVVVMEKEDVESVRVVVGKHRHAWIVGKVSETDTVS  235

Query  1667  kvveifvevfVNGGKEEGSIH---GEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELD  1497
              + ++FV+ F+NGGKE   +    GEF+PVGADG VVLSF+LLNADP DW+YDW+FQE+ 
Sbjct  236   IISKVFVKYFMNGGKEGRGMEKGIGEFVPVGADGTVVLSFSLLNADPSDWVYDWEFQEMS  295

Query  1496  DMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHL  1317
              ++LAP+ +AL PIA++S+ESQVLYHTPKSS S WDEK G YIFS++DLPFFVNSNEWHL
Sbjct  296   KIMLAPVAKALTPIANISIESQVLYHTPKSSNSYWDEKYGGYIFSLRDLPFFVNSNEWHL  355

Query  1316  DTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSK  1137
             DTS  A GRSKVL FVVYVPS  ECPL L LPNGE+SKTN FISPMWGG+V+WNPP C+ 
Sbjct  356   DTSVTAAGRSKVLQFVVYVPSAIECPLLLQLPNGEISKTNSFISPMWGGIVIWNPPQCTG  415

Query  1136  NSEMQPLR-HKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWE  960
             +S+ + L    +  +EL+K+F+VF+ QLR LFGL S+ +    T  S+ L SE+GFT WE
Sbjct  416   DSQKKHLEGSTLPPQELEKIFQVFIAQLRMLFGLTSNYIDSSETEISKFLDSERGFTDWE  475

Query  959   LDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIG  780
             LD + R H CFNL  C  TL SL++LVQSLPRMI+MDEIGKQVK+SL+AA  +  NAS+G
Sbjct  476   LDVLFRHHACFNLHSCVNTLESLAKLVQSLPRMIVMDEIGKQVKYSLEAASLAQMNASLG  535

Query  779   NYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWK  600
              YD SA SSR+A++LAEDAF+HPS+MS+SY S EH FA+Y PFF PV+LHV+LA ++E K
Sbjct  536   IYDASAASSRKAKALAEDAFFHPSIMSISYSSIEHYFAIYMPFFAPVSLHVLLAAIKELK  595

Query  599   RCKQENKKYLAWKA  558
             R K+E  KY+A+ A
Sbjct  596   RYKREKAKYMAFAA  609



>ref|XP_006850328.1| hypothetical protein AMTR_s00020p00225970 [Amborella trichopoda]
 gb|ERN11909.1| hypothetical protein AMTR_s00020p00225970 [Amborella trichopoda]
Length=601

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/584 (53%), Positives = 404/584 (69%), Gaps = 25/584 (4%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R T PG KRL LTL +F SF+IG PF LKS  I+RAPLPFK I+SL   +  +PLLFPC 
Sbjct  17    RTTLPGSKRLLLTLYVFFSFIIGAPFFLKSRAIYRAPLPFKSIESLDNHLSMNPLLFPCH  76

Query  2072  FQVVFVNL--DHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
             F  VF+    ++     A EL FL+  +MQ + S    VCG C  N++V++T++  S  C
Sbjct  77    FHTVFLGFGQENQNMGFAQELEFLMFQKMQHI-SGSDRVCGGCGDNYSVSVTVDYIS-GC  134

Query  1898  IYS---ENQDIVWKCGALSGLDFEKSLDNT---DDFLESLLDsr--------ssrvytvv  1761
               S   EN+ + W CG+L   + E+ L +    D+++ES L           ++    VV
Sbjct  135   FQSGALENE-VSWPCGSLDLSELEQILASDAAFDEYIESFLQRNGGLLKYRGNAYRVVVV  193

Query  1760  vvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI---HGEFMP  1590
                 +   R V+GK+RHAWI GK+SE ++V    ++FV  F+NGG  EG      GEFMP
Sbjct  194   NREMENSYRTVIGKHRHAWIYGKISEGDAVSLAAQLFVNFFMNGGIGEGLFSKGKGEFMP  253

Query  1589  VGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             + ADG VVLSF+LLNA+P+DW++DWDF+++D++ L+P+V+AL P+A++SVESQ+LYHTPK
Sbjct  254   IAADGSVVLSFSLLNANPNDWVFDWDFRKIDEIFLSPVVKALAPLANISVESQILYHTPK  313

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQL  1230
             +S+S WDE   SYIFS  DLPFFVNSNEW+LDTS  A G+SK+LHFVVYVPS +ECPL L
Sbjct  314   ASYSYWDENLASYIFSTNDLPFFVNSNEWYLDTSVGAAGQSKILHFVVYVPSADECPLVL  373

Query  1229  LLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLR  1053
              LP+G +S TNGF+SP WGG++VWNP SCS +S    L RH  SS++L +V EVFMGQLR
Sbjct  374   QLPDGTISSTNGFMSPTWGGIIVWNPTSCSTDSRSARLSRHTFSSQDLVQVMEVFMGQLR  433

Query  1052  QLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQS  873
              LFGL S + Y        ++ SEKGF +WELD + R H  +NL    TTL SLS+LVQS
Sbjct  434   LLFGLKSYTSY--DVDIQNIVASEKGFAEWELDVLVRHHAAYNLFSSATTLQSLSKLVQS  491

Query  872   LPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVS  693
             LP MI+MDEIGKQVK SL+AA  + +NAS+G YD + VSSR+AR  AE AF+HPS+MS+ 
Sbjct  492   LPSMIVMDEIGKQVKLSLEAANLAENNASLGMYDAAEVSSREARVWAEAAFFHPSIMSIL  551

Query  692   YYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             Y+ FEH  A+YSPFF+PVA+HV +A  +E  R ++E +KY AWK
Sbjct  552   YFPFEHHVAIYSPFFVPVAMHVFIAAFKETMRYRREREKYWAWK  595



>ref|XP_003564879.1| PREDICTED: GPI transamidase component PIG-S [Brachypodium distachyon]
Length=615

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/616 (51%), Positives = 412/616 (67%), Gaps = 28/616 (5%)
 Frame = -3

Query  2342  MAEIS--EAPSAEDNNQKSEQSFV--------NDFDPNTMRKTKPGRKRlfltltifisf  2193
             MAEI+  E P    ++   E S +         D D    R  KPG KRL LT ++ +SF
Sbjct  1     MAEIAGDETPPLPSSSGADESSVLPSTSSPTDADGDKPLPRTKKPGTKRLILTASVLVSF  60

Query  2192  ligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFV--NLDHSTTSTASE  2019
             ++GLPFLLKS EIHR+PLP   I  L+  ++ +P  FPC    VF+      S  S A  
Sbjct  61    IVGLPFLLKSTEIHRSPLPSDAIGDLSRRLQSNPPSFPCGLHAVFLRSGPGPSAASLADH  120

Query  2018  LSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDF  1839
             L   I++Q Q L      +  +   N +V++T++S  S    S      W+CG+++  D 
Sbjct  121   LEQTISTQPQGL------IASSTTGNLSVSVTVQSEGSCSSSSTAG-STWQCGSVNTADL  173

Query  1838  EKSLDNTDDFLESLL-----DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQes  1674
              +  +  DD L S L     D        VV  +   E R V+GK+RHAW+VGK+ + E+
Sbjct  174   VRGDEVFDDLLHSALGGGHVDGMKVYTVVVVESDDGNEPRVVIGKHRHAWVVGKVDDAEA  233

Query  1673  vekvveifvevfVNGGKEEGSI---HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQE  1503
             V  V ++F++ F+NGG E+G      GEFMPVG+DG VVLSF+LLNADP DW+YDW+F+ 
Sbjct  234   VSLVGKVFIKYFMNGGIEDGETGIGKGEFMPVGSDGNVVLSFSLLNADPSDWVYDWEFEN  293

Query  1502  LDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEW  1323
             + + +L P+V+ALRPIAD+++ESQVLYHTPKSS+S +D+K G  I S+ D+PFFVNSNEW
Sbjct  294   IGERMLTPVVEALRPIADINIESQVLYHTPKSSYSYFDDKLGGSILSMGDIPFFVNSNEW  353

Query  1322  HLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSC  1143
             HLDTS +A GRSKVL FVVY+PS  ECPL L LP+GELSKTN FISPMWGGVV+WNPP C
Sbjct  354   HLDTSISATGRSKVLQFVVYIPSARECPLYLQLPDGELSKTNAFISPMWGGVVIWNPPGC  413

Query  1142  SKNS-EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQ  966
             S  S +    R K+SS+EL +  E+F+GQLRQLFGL  + L  G    ++ + SEKGF Q
Sbjct  414   SLGSKKAHGTRTKMSSQELMETLEIFIGQLRQLFGLKPNHLTQGMDVATKFVVSEKGFAQ  473

Query  965   WELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNAS  786
             WELD + R H C +LL C TTL SLS LVQSLPRMI+MDEIGKQV+ SL+AA  +  NA+
Sbjct  474   WELDLLYRHHACSSLLSCLTTLESLSSLVQSLPRMIVMDEIGKQVELSLEAASLAQRNAT  533

Query  785   IGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLRE  606
             +G  D SAVS+R+AR+LAEDAF+HPS+MS+SY S EH FA+Y PFF PV+LHV+LA ++E
Sbjct  534   LGISDSSAVSARRARALAEDAFFHPSVMSISYASVEHYFAIYMPFFAPVSLHVLLAAIKE  593

Query  605   WKRCKQENKKYLAWKA  558
              KR K E  KYLA+ A
Sbjct  594   LKRYKVERGKYLAFLA  609



>ref|XP_006646583.1| PREDICTED: GPI transamidase component PIG-S-like [Oryza brachyantha]
Length=618

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/583 (52%), Positives = 402/583 (69%), Gaps = 17/583 (3%)
 Frame = -3

Query  2276  NDFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIER  2097
             +D D    R +KPGRKRLFLT ++ +SFLIGLP LLKS EIHR+PLP   I +L+  +  
Sbjct  37    DDGDKPPPRTSKPGRKRLFLTASVLLSFLIGLPLLLKSTEIHRSPLPSDAIAALSRRLHS  96

Query  2096  SPLLFPCKFQVVFVNLDHS--TTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAIT  1923
             +P  FPC    VF++   +    S A+ +   I++Q+  L +A +        N +V++T
Sbjct  97    NPPSFPCGLHAVFLSFGRAPLEASAANRIEREISTQLVDLPAASTA------GNISVSVT  150

Query  1922  LESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLL-----Dsrssrvytvvv  1758
             ++S+   C  S      W+CGA++ +D  +  +  D+ L S L     D         V 
Sbjct  151   VDSAG-GCFSSGKAASYWRCGAVTTVDLVRGDEVFDELLHSALGGGGADGMRVYTVVFVD  209

Query  1757  vnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGS---IHGEFMPV  1587
              +    +  V+GK+RHAW+VGK+ E E V  + ++FV+ F+NGG EEG    +  EFMPV
Sbjct  210   SDDGMGLSIVIGKHRHAWVVGKVDEGEVVSIIGKVFVKYFLNGGVEEGEAGIVKREFMPV  269

Query  1586  GADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKS  1407
             G+DG +VLSF+LLNADP DW+YDW+F+++ + +L P+++ALRPIA++++ESQVLYHTPKS
Sbjct  270   GSDGNIVLSFSLLNADPSDWVYDWEFEKIGERMLIPVIEALRPIANINIESQVLYHTPKS  329

Query  1406  SFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL  1227
             S+S +D+K G  + S+ D+PFFVNSNEWHLDTS +A GRSKVL FVVY+PS  ECPL L 
Sbjct  330   SYSYYDDKLGGNVLSVGDIPFFVNSNEWHLDTSISATGRSKVLQFVVYIPSARECPLYLQ  389

Query  1226  LPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQL  1047
             LP+GELSKTN FISPMWGGV++WNP  CS NS+      K+SS+EL +  E+F+GQLRQL
Sbjct  390   LPDGELSKTNAFISPMWGGVIIWNPLGCSLNSKPHGALDKMSSQELMETIEIFIGQLRQL  449

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLP  867
             FGL S          ++ +TS KGF QWELD + R H C NLL C TTL SLS LVQSLP
Sbjct  450   FGLKSSYHEQSMDGATKFITSPKGFAQWELDLLYRHHACSNLLSCLTTLESLSSLVQSLP  509

Query  866   RMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
             RMI+MDEIG+QV+ SL+AA  +  NASIG  D SAVS+ +AR+LAEDAF+HPS+MS+SY 
Sbjct  510   RMIVMDEIGRQVELSLEAANLAQRNASIGISDSSAVSATRARALAEDAFFHPSVMSISYA  569

Query  686   SFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             S EH FA+Y PFF PV+LHV+LAV++E KR K E  KY A+ A
Sbjct  570   SIEHYFAIYMPFFAPVSLHVLLAVIKELKRYKVERGKYSAFLA  612



>ref|NP_001045136.1| Os01g0907300 [Oryza sativa Japonica Group]
 dbj|BAD82742.1| putative phosphatidylinositol glycan class S [Oryza sativa Japonica 
Group]
 dbj|BAF07050.1| Os01g0907300 [Oryza sativa Japonica Group]
 gb|EEE55851.1| hypothetical protein OsJ_04471 [Oryza sativa Japonica Group]
Length=616

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/573 (53%), Positives = 395/573 (69%), Gaps = 15/573 (3%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R +KPGRKRL LT ++ +SFLIGLP LLKS EIHR+PLP   I +L+  +  +P  FPC 
Sbjct  45    RTSKPGRKRLVLTASVLLSFLIGLPLLLKSTEIHRSPLPSDAIAALSRRLHSNPPSFPCG  104

Query  2072  FQVVFV--NLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+    D S  S A+ +   I++Q+  L  A      +     +V++T+ES+   C
Sbjct  105   LHAVFLRSGRDPSEASVANRIEREISTQLVDLPDA------STAGKISVSVTVESAG-GC  157

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvn---rdeevrav  1728
               S      W+CGA++  D  +  +  D+ L+S L         V  V     D+  R V
Sbjct  158   SSSSKVASPWRCGAVTTADLGRGDEVFDELLDSALGDGGGDGMRVYTVVFVDSDDLKRIV  217

Query  1727  VGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEG---SIHGEFMPVGADGRVVLSF  1557
             +GK+RHAW+VGK+ E E V  + ++FV+ F+NGG EEG   ++  EFMPVG+DG +VLSF
Sbjct  218   IGKHRHAWVVGKVDEAEVVSIIGKVFVKYFMNGGVEEGEASTVKREFMPVGSDGNIVLSF  277

Query  1556  NLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQG  1377
             +LLNADP DW+YDW+F+ +   +L P+++ALRPIA++++ESQVLYHTPKSS+S  D+K G
Sbjct  278   SLLNADPSDWVYDWEFENIGQRMLTPVIEALRPIANINIESQVLYHTPKSSYSYSDDKLG  337

Query  1376  SYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTN  1197
               + S+ D+PFFVNSNEWHLDTS +A GRSKVL FVVY+PS  ECPL L LP+GELSKTN
Sbjct  338   GNVLSVGDIPFFVNSNEWHLDTSISATGRSKVLQFVVYIPSARECPLYLQLPDGELSKTN  397

Query  1196  GFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYV  1017
              FISPMWGGVV+WNPP CS  S+      K+SSEEL +  E+F+GQLRQLFGL S     
Sbjct  398   AFISPMWGGVVIWNPPGCSFGSKPHGALDKMSSEELMETIEIFIGQLRQLFGLKSSYHTQ  457

Query  1016  GATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  ++ +TS KGF QWELD + R H C NLL C TTL SLS LVQSLPRMI+MDEIG+
Sbjct  458   SMDGVTKFITSPKGFAQWELDLLYRHHACSNLLSCLTTLESLSSLVQSLPRMIVMDEIGR  517

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             QV+ SL+AA  +  NAS+G  D SAVS+ +AR+LAEDAF+HPS+MS+SY S EH FA+Y 
Sbjct  518   QVELSLEAASLAQRNASLGISDSSAVSATRARALAEDAFFHPSVMSISYASIEHYFAIYM  577

Query  656   PFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             PFF PV+LHV+LAV++E KR   E +KY A+ A
Sbjct  578   PFFAPVSLHVLLAVMKELKRYMVERRKYSAFLA  610



>gb|AAF20228.1|AC012395_15 unknown protein [Arabidopsis thaliana]
Length=605

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/606 (53%), Positives = 416/606 (69%), Gaps = 59/606 (10%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltif-----------------------isfligLPFLLKS  2163
             +FDP TMR TKPG KRLF+T ++                        +S + G+PFL KS
Sbjct  15    EFDPKTMRSTKPGLKRLFITSSVLFFGLLNSLSSEFSISLPLLYPFPVSEVSGVPFLWKS  74

Query  2162  IEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKL  1983
             +EI+R+PLPF DIDSL+  +E +PL FPC F  VFV      ++    L   I   + +L
Sbjct  75    VEIYRSPLPFHDIDSLSDQLESTPLRFPCNFHAVFVGF---RSTDPDNLRSQIQDGINQL  131

Query  1982  TSAKSPVCGTCLSNFTVAITLESSSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDD  1812
             T  +S  CG+C  +F++++T+++    C   +   +    ++CG +    F   LD+T D
Sbjct  132   TH-QSSQCGSC--DFSLSVTVQNREDQCSDTLAHSSTTCSYRCGVIKRNGFSVGLDDTVD  188

Query  1811  FLESLLD-----------srssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQes---  1674
               ESL D             S  V      N  +EV+AVVGK RHAWIVG   E+     
Sbjct  189   --ESLNDVFSGCSENSGKMYSVVVVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDI  246

Query  1673  vekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDD  1494
             V +V EIFV+VF+NGG+EE SI GEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +D+
Sbjct  247   VARVSEIFVQVFMNGGREEDSIQGEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDE  306

Query  1493  MLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLD  1314
              LLAP+ +AL PIA+++VESQVLYHTPKSSFS WD+K  SYIF   DLPFFVNSNEWHLD
Sbjct  307   ALLAPVTKALAPIANITVESQVLYHTPKSSFSSWDKKLQSYIFRTSDLPFFVNSNEWHLD  366

Query  1313  TSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKN  1134
             TS  A GRSK+L FVVY+PS +ECPL L LPN E+SKTNGFISPMWGGV+VWNP +C K+
Sbjct  367   TSAGASGRSKILQFVVYIPSGKECPLLLQLPNVEISKTNGFISPMWGGVIVWNPGNCDKD  426

Query  1133  SEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELD  954
             SE  P R+ IS ++L+++ E+F+GQ RQLFG  S++ Y     T ++LTSE+GFT+WELD
Sbjct  427   SE-SPSRNTISLQDLEQIVEIFLGQFRQLFGFKSEAKYTTGLGTYKILTSERGFTEWELD  485

Query  953   FISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNY  774
              +SR+HTCFNL  C TTLGSLSRLV+SLPRMII DEIG+QVK+SL AAK + SNAS+G Y
Sbjct  486   VLSRKHTCFNLHSCSTTLGSLSRLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGY  545

Query  773   DGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRC  594
               SA SSR+ARSLAE+AF+HPS+MSVSY+S+EHCFAVYS          +   L++++  
Sbjct  546   SSSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVYS----------VTLSLQQYENG  595

Query  593   KQENKK  576
             +  NK+
Sbjct  596   RDTNKR  601



>dbj|BAJ86955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=618

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/576 (52%), Positives = 393/576 (68%), Gaps = 18/576 (3%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R  KPG KRL LT ++ +SFL+GLP LLKS EIHR+PLP   I  L+  ++  P  FPC 
Sbjct  41    RTRKPGTKRLVLTASVLLSFLVGLPLLLKSTEIHRSPLPSDAIADLSRRLQSHPPSFPCG  100

Query  2072  FQVVFVNLDHST--TSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF++    +   S A +L   I++Q   L     P   T   N +V++T++S    C
Sbjct  101   LHAVFLHSGPGSPVASLADQLGLAISTQHHLL-----PASSTA-GNISVSVTVQSDG-GC  153

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLL-----Dsrssrvytvvvvnrdeevr  1734
               S      W+CG+++ +D  +  +  D+ L S L     D        +   +  +  R
Sbjct  154   TSSTATASPWRCGSVTAVDSLRGDEVFDELLHSALGGGDEDGMKVYTIVIAENDDGKGTR  213

Query  1733  avVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI---HGEFMPVGADGRVVL  1563
              V+GK+RHAW+VGK+ + ++V  + ++F++ F+NGG EEG      GEFMPVG+DG VVL
Sbjct  214   VVIGKHRHAWVVGKVDDAKAVSLISKVFIKYFMNGGIEEGETGIGKGEFMPVGSDGNVVL  273

Query  1562  SFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEK  1383
             SF+LLNADP+DW+YDW+F+ + + +L P+V+ALRPIAD+++ESQVLYHTPKSS+S  D+K
Sbjct  274   SFSLLNADPNDWVYDWEFKNIGERILTPVVEALRPIADINIESQVLYHTPKSSYSYSDDK  333

Query  1382  QGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSK  1203
              G  + S+ D+PFFVNSNEWHLDTS +A GRSKVL FVVY+PS  ECPL L LP+GELSK
Sbjct  334   LGGNVLSMGDIPFFVNSNEWHLDTSISATGRSKVLQFVVYIPSARECPLYLQLPDGELSK  393

Query  1202  TNGFISPMWGGVVVWNPPSCSKNS-EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
             TN FISPMWGGVV+WNPP CS  S E+   R ++SS+EL +  E+F+GQLRQLFGL  + 
Sbjct  394   TNAFISPMWGGVVIWNPPGCSLGSKEVHGTRRQMSSQELMETLEIFIGQLRQLFGLKPNY  453

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G    ++ L SEKGF QWELD + R H C NLL C  TL SLS LVQSLPRMI+MDE
Sbjct  454   HAQGMDVATKFLVSEKGFAQWELDLLYRHHACSNLLSCVATLESLSSLVQSLPRMIVMDE  513

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             IG+QV+ SL+AA  +  NA++G  D SAVS+ +AR+LAEDAF+HPS+MS+SY S EH FA
Sbjct  514   IGRQVELSLEAASLAQRNATLGIGDSSAVSATRARALAEDAFFHPSIMSISYASVEHYFA  573

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             +Y PFF PV LHV+LA ++E KR K E  K+ A+ A
Sbjct  574   IYMPFFAPVCLHVLLAAIKELKRYKVERAKHSAFLA  609



>ref|XP_002456805.1| hypothetical protein SORBIDRAFT_03g043190 [Sorghum bicolor]
 gb|EES01925.1| hypothetical protein SORBIDRAFT_03g043190 [Sorghum bicolor]
Length=617

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/578 (52%), Positives = 396/578 (69%), Gaps = 19/578 (3%)
 Frame = -3

Query  2255  MRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPC  2076
             +R TKPG KRL LT ++ +SFL+GLPFLLKS EIHR+PLP   I +LA  +  +P  FPC
Sbjct  41    LRTTKPGVKRLILTASVLLSFLVGLPFLLKSTEIHRSPLPSDAITALAHRLHSTPPSFPC  100

Query  2075  KFQVVFVNL--DHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSN  1902
                 VF+    D S  S +  L   I++Q+Q L     P   T   N +V++T+E +   
Sbjct  101   SLHAVFLRSVPDRSDASLSRRLEQSISAQLQLL-----PATSTA-GNVSVSVTVELAG-G  153

Query  1901  CIYSENQDIV--WKCGALSGLDFEKSLDNTDDFLESLL-----Dsrssrvytvvvvnrde  1743
             C  S +  +   W+CG ++  D     +  D+ L S L     D        VV     E
Sbjct  154   CSSSSSSSVGSDWQCGTVTSADLVIGDEVFDELLHSALGSGRGDGSRVYTVVVVETGDAE  213

Query  1742  evravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI---HGEFMPVGADGR  1572
              +R VVGK+RHAW+VGK  E ++V  + ++F + F+NGG EEG      GEFMPVG+DG 
Sbjct  214   GMRVVVGKHRHAWVVGKADEVKAVTVIGKVFAKYFMNGGIEEGEAGIGKGEFMPVGSDGN  273

Query  1571  VVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGW  1392
             VVLSF+LLNADP DW+YDWDF+++ + +L P+V+ALRPIA++++ESQVLYHTPKSS+S +
Sbjct  274   VVLSFSLLNADPSDWVYDWDFEKIGERMLNPVVEALRPIAEINIESQVLYHTPKSSYSYF  333

Query  1391  DEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
             D+K G  + S+ D+PFFVNSNEWHLDTS +A GRSK+L FVVY+PS  ECPL L LP+G 
Sbjct  334   DDKLGGNVLSMGDIPFFVNSNEWHLDTSISATGRSKILQFVVYIPSARECPLYLQLPDGG  393

Query  1211  LSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNS  1032
             LSKTN FISPMWGGV++WNPP CS +S+    R K+SS+EL +  E+F+GQLRQLFGL  
Sbjct  394   LSKTNAFISPMWGGVLIWNPPDCSLDSKTHGTRKKMSSQELMETLEIFIGQLRQLFGLKP  453

Query  1031  DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
               L       ++ + SEKGFT+WELD + R H   NLL C TTL SLS LV+SLPRMI+M
Sbjct  454   SYLSQDMDVPTKFVVSEKGFTEWELDLLYRHHAHSNLLSCLTTLESLSTLVRSLPRMIVM  513

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             DEIG+QV+ SL+AA  +  NA++G  D SAV + +AR+LAEDAF+HPS+MS+SY S EH 
Sbjct  514   DEIGRQVELSLEAANLAQGNATLGISDSSAVYATRARALAEDAFFHPSIMSISYASVEHY  573

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             FA+Y PFF PV+LHV+LA ++E KR K E  KY A+ A
Sbjct  574   FAIYMPFFAPVSLHVLLAAIKELKRYKAERAKYFAFLA  611



>emb|CDM83192.1| unnamed protein product [Triticum aestivum]
 emb|CDM85543.1| unnamed protein product [Triticum aestivum]
 emb|CDM85565.1| unnamed protein product [Triticum aestivum]
Length=618

 Score =   547 bits (1409),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 390/576 (68%), Gaps = 18/576 (3%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R  KPG KRL LT ++ +SFL+GLP LLKS EIHR+PLP   I  L+  ++  P  FPC 
Sbjct  41    RTRKPGTKRLVLTASVLVSFLVGLPLLLKSTEIHRSPLPSDAIADLSRRLQSHPPSFPCG  100

Query  2072  FQVVFVNLDHST--TSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+     +   S A +L   I++Q   L     P   T   + +V++T++S    C
Sbjct  101   LHAVFLRSGPGSPVASLADQLERAISTQHHLL-----PASSTA-GSISVSVTVQSDG-GC  153

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLL-----Dsrssrvytvvvvnrdeevr  1734
               S      W+CG+++  D  +  +  D+ L S L     D        +   +  +  R
Sbjct  154   TSSTASASPWRCGSVTAADSVRGDEVFDELLHSALGGGDGDGMKVYTVVIAEDDDGKGTR  213

Query  1733  avVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI---HGEFMPVGADGRVVL  1563
              V+GK+RHAW+VGK+ E E++  + ++F++ F+NGG EEG      GEFMPVG+DG VVL
Sbjct  214   VVIGKHRHAWVVGKVDEAEALSLIRKVFIKYFMNGGIEEGETGIGKGEFMPVGSDGNVVL  273

Query  1562  SFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEK  1383
             SF+LLNADP+DW+YDW+F+ + + +L P+V+ALRP+AD+++ESQVLYHTPKSS+S  D+K
Sbjct  274   SFSLLNADPNDWVYDWEFKNIGERILTPVVEALRPVADINIESQVLYHTPKSSYSYSDDK  333

Query  1382  QGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSK  1203
              G  + S+ D+PFFVNSNEWHLDTS +A GRSKVL FVVY+PS  ECPL L LP+GELSK
Sbjct  334   LGGNVLSMGDIPFFVNSNEWHLDTSISATGRSKVLQFVVYIPSARECPLYLQLPDGELSK  393

Query  1202  TNGFISPMWGGVVVWNPPSCSKNS-EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
             TN FISPMWGGVV+WNPP CS  S +    R ++SS+EL +  E+F+GQLRQLFGL  + 
Sbjct  394   TNAFISPMWGGVVIWNPPGCSLGSKKAHGTRRQMSSQELMETLEIFIGQLRQLFGLKPNY  453

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G    ++ L SEKGF QWELD + R H C NLL C  TL SLS LVQSLPRMI+MDE
Sbjct  454   HAHGMDVATKFLVSEKGFAQWELDLLYRHHACSNLLSCVATLESLSSLVQSLPRMIVMDE  513

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             IG+QV+ SL+AA  +  NA++G  D SAVS+ +AR+LAEDAF+HPS+MS+SY S EH FA
Sbjct  514   IGRQVELSLEAASLAQRNATLGIGDSSAVSATRARALAEDAFFHPSIMSISYASVEHYFA  573

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKA  558
             +Y PFF PV LHV+LA ++E KR K E  KY A+ A
Sbjct  574   IYMPFFAPVCLHVLLAAIKELKRYKVERAKYSAFLA  609



>ref|NP_001169646.1| uncharacterized protein LOC100383527 [Zea mays]
 gb|ACN34386.1| unknown [Zea mays]
 gb|AFW84252.1| hypothetical protein ZEAMMB73_520769 [Zea mays]
Length=616

 Score =   540 bits (1391),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 305/611 (50%), Positives = 404/611 (66%), Gaps = 20/611 (3%)
 Frame = -3

Query  2354  EVPAMAEISEAPSAEDNNQKSEQSFVNDFDPNTMRKTKPGRKRlfltltifisfligLPF  2175
             E P    IS   S + +   +  +  ++  P  +R TKPG KRL LT ++ +SFL+GLPF
Sbjct  8     EAPTPPTISGEVSGDPHTSAATPAGSSNKPP--LRATKPGVKRLILTASVLLSFLVGLPF  65

Query  2174  LLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTAS---ELSFLI  2004
             LLKS EIHR+PLP   I +LA  +  +P  FPC    VF+      +  AS    L   I
Sbjct  66    LLKSTEIHRSPLPSDAITALAHRLHSTPPSFPCALHAVFLRSVPGRSDDASLYRRLERSI  125

Query  2003  TSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLD  1824
             ++Q+Q L +       +   N +V++T+ES+      S +    W+CG +S  D     +
Sbjct  126   SAQLQLLAAT------STAGNVSVSVTVESAGGCSSSSGSVGSGWQCGTVSSADLVVGDE  179

Query  1823  NTDDFLESLL-----DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvv  1659
               D+ L S L     D        VV ++  + +R VVGK+RHAW+VGK  E ++V  + 
Sbjct  180   VFDELLHSALGSVGGDGSRVYTVVVVEIDDADGMRVVVGKHRHAWVVGKADEVKAVSVIG  239

Query  1658  eifvevfVNGGKEEGSI---HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDML  1488
             ++F + F+NGG EEG      GEFMPVG+DG VVLSF+LLNADP DW+YDWDF+++ + +
Sbjct  240   KVFAKYFMNGGIEEGEAGIGKGEFMPVGSDGNVVLSFSLLNADPSDWVYDWDFEKIGEKM  299

Query  1487  LAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTS  1308
             L P+V+ALRPIA++++ESQVLYHTPKSS+S +D+K G    S+ D+PFFVNSNEWHLDTS
Sbjct  300   LNPVVEALRPIAEINIESQVLYHTPKSSYSYFDDKLGGNFLSMGDIPFFVNSNEWHLDTS  359

Query  1307  TAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS-  1131
              +A GRSKVL FVVY+PS  ECPL L LP+G LSKTN FISPMWGGV++WN P CS  S 
Sbjct  360   ISATGRSKVLQFVVYIPSARECPLYLQLPDGGLSKTNAFISPMWGGVLIWNSPDCSLGSK  419

Query  1130  EMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDF  951
             +    + K+SS+EL +  E+F+GQLRQLFGL            ++ L SEKGFT+WELD 
Sbjct  420   KTHGTQKKMSSQELMEALEIFVGQLRQLFGLKPSYFSQDMDVPTKFLVSEKGFTEWELDL  479

Query  950   ISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYD  771
             + R H   NLL C TTL SLS LV SLPRMI+MDEIG+QV+ SL+AA  +  NA++G  D
Sbjct  480   LYRHHARSNLLSCLTTLESLSSLVHSLPRMIVMDEIGRQVELSLEAANLAQGNATLGISD  539

Query  770   GSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCK  591
              SAVS+ +AR+LAEDAF+HPS+MS+SY S EH FA+Y PFF PV+LHV+LA ++E KR K
Sbjct  540   SSAVSATRARALAEDAFFHPSIMSISYASVEHYFAIYMPFFAPVSLHVLLAAIKELKRYK  599

Query  590   QENKKYLAWKA  558
              E  KY A+ A
Sbjct  600   AERAKYSAFLA  610



>ref|XP_004970974.1| PREDICTED: GPI transamidase component PIG-S-like [Setaria italica]
Length=617

 Score =   532 bits (1370),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 296/573 (52%), Positives = 386/573 (67%), Gaps = 18/573 (3%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R TKPG KRL LT ++ +SFL+GLPFLLKS EIHR+PLP   I +LA  +  +P  FPC 
Sbjct  43    RTTKPGVKRLVLTASVLLSFLLGLPFLLKSTEIHRSPLPSDAITALAHRLHSNPPSFPCG  102

Query  2072  FQVVFV--NLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+    D S  S AS L   I++Q+Q L +A +       +          S   C
Sbjct  103   LHAVFLRSGSDPSDASLASRLERAISAQLQLLPAAST-------AGNVSVSVTVESVGGC  155

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLL-----Dsrssrvytvvvvnrdeevr  1734
               S +    W+CG ++  D     +  D+ L S L     D        VV     E +R
Sbjct  156   SSSGSVGSRWECGVVTTADLVLGDEVFDELLHSALGSGRGDGSRVYTVVVVETGDAEGMR  215

Query  1733  avVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI---HGEFMPVGADGRVVL  1563
              V+GK+RHAW+ GK+ E ++V  + ++FV+ F+NGG EEG      GEFMPVG+DG VVL
Sbjct  216   VVIGKHRHAWVAGKVDEAKAVSVIGKVFVKYFMNGGVEEGETGIGKGEFMPVGSDGNVVL  275

Query  1562  SFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEK  1383
             SF+LLNADP DW+YDW+F+++ + +L P+++ALRPIA++++ESQVLYHTPKSS+S  D+K
Sbjct  276   SFSLLNADPSDWVYDWEFEKIGERMLNPVIEALRPIAEINIESQVLYHTPKSSYSYSDDK  335

Query  1382  QGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSK  1203
              G  + S+ D+PFFVNSNEWHLDTS +A G+SKVL FVVY+PS +ECPL L LP+G LSK
Sbjct  336   LGGNVLSMGDIPFFVNSNEWHLDTSISATGQSKVLQFVVYIPSAKECPLYLQLPDGGLSK  395

Query  1202  TNGFISPMWGGVVVWNPPSCSKNSE-MQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
             TN FISPMWGGV++WNPP CS  S+     R K+SS+EL +  E+F+GQLRQLFGL    
Sbjct  396   TNAFISPMWGGVLIWNPPDCSLGSQKTHGTRKKMSSQELMETLEIFIGQLRQLFGLKPSY  455

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L       ++   SEKGFT+WELD + R H   NLL C TTL SLS LV SLPRMI+MDE
Sbjct  456   LSQDMDMPTKFAVSEKGFTEWELDLLYRHHASSNLLSCLTTLESLSSLVHSLPRMIVMDE  515

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             IG+QV+ SL+AA  +  NA++G  D SAVS+ +AR+LAE+AF+HPS+MS+SY S EH FA
Sbjct  516   IGRQVELSLEAANLAQRNATLGISDSSAVSATRARALAEEAFFHPSIMSISYASIEHYFA  575

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLA  567
             +Y PFF PV+LHV+LA ++E KR K E  KY A
Sbjct  576   IYMPFFAPVSLHVLLAAIKELKRYKAERAKYSA  608



>gb|EMT19287.1| hypothetical protein F775_28862 [Aegilops tauschii]
Length=536

 Score =   493 bits (1270),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 253/487 (52%), Positives = 332/487 (68%), Gaps = 14/487 (3%)
 Frame = -3

Query  1997  QMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNT  1818
             + +K  + +  +  + L +F V      S   C  S      W+CG L+  D  +  +  
Sbjct  43    RTRKPGTKRLVLTASVLLSFLVGSVPIQSGGGCTSSTAAASPWRCGLLTAADSVRDDEVF  102

Query  1817  DDFLESLL-----DsrssrvytvvvvnrdeevravVGKYRHAWIVGKLSEQesvekvvei  1653
             D+ L S L     D        +   +  +  R V+GK+RHAW+VGK+ E E++  +  +
Sbjct  103   DELLHSALGGRDGDGMKVYTIVIAEDDDGKGTRVVIGKHRHAWVVGKVDEAEALSLIGNV  162

Query  1652  fvevfVNGGKEEGSI---HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLA  1482
             F++ F+NGG EEG      GEFMPVG+DG VVLSF+LLNADP+DW+YDW+F+ + + +L 
Sbjct  163   FIKYFMNGGIEEGETGIGKGEFMPVGSDGNVVLSFSLLNADPNDWVYDWEFKNIGERILT  222

Query  1481  PIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTA  1302
             P+V+ALRP+AD+++ESQVLYHTPKSS+S  D+K G  + S+ D+PFFVNSNEWHLDTS +
Sbjct  223   PVVEALRPVADINIESQVLYHTPKSSYSYSDDKLGGNVLSMGDIPFFVNSNEWHLDTSIS  282

Query  1301  AGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNS-EM  1125
             A GRSKVL FVVY+PS  ECPL L LP+GELSKTN FISPMWGGVV+WNPP CS  S + 
Sbjct  283   ATGRSKVLQFVVYIPSARECPLYLQLPDGELSKTNAFISPMWGGVVIWNPPGCSVGSKKA  342

Query  1124  QPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFIS  945
                R ++SS+EL +  E+F+GQLRQLFGL  +    G    ++ L SEKGF QWELD + 
Sbjct  343   HGTRRQMSSQELMETLEIFIGQLRQLFGLKPNYHAQGMDVATKFLVSEKGFAQWELDLLY  402

Query  944   RQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGS  765
             R H C NLL C  TL SLS LVQSLPRMI+MDEIG+QV+ SL+AA  +  NA++G     
Sbjct  403   RHHACSNLLSCVATLESLSSLVQSLPRMIVMDEIGRQVELSLEAASLAQRNATLG-----  457

Query  764   AVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQE  585
              VS+ +AR+LAEDAF+HPS+MS+SY S EH FA+Y PFF PV LHV+LA ++E KR K E
Sbjct  458   IVSATRARALAEDAFFHPSIMSISYASVEHYFAIYMPFFAPVCLHVLLAAIKELKRYKVE  517

Query  584   NKKYLAW  564
               KY A+
Sbjct  518   RAKYSAF  524



>ref|XP_010927563.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   489 bits (1260),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 275/495 (56%), Positives = 352/495 (71%), Gaps = 18/495 (4%)
 Frame = -3

Query  2261  NTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLF  2082
             +T R  +PG KRL LTL++ +SFL GLPFLLKS EI+R+PLPF+ IDSL+  ++      
Sbjct  23    STRRTARPGTKRLLLTLSVLLSFLSGLPFLLKSTEIYRSPLPFRSIDSLSSRLQSDHPTL  82

Query  2081  PCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSN  1902
             PC+FQ V +  D +    A  L  LI+  + K TS   PV G C  NF+V++T++S +  
Sbjct  83    PCRFQAVLLRPD-ADRFLADRLGSLISEDLVKRTS-NDPVSGGCGKNFSVSVTIDSGA-G  139

Query  1901  CIYSE---NQDIVWKCGALSGLDFEKSLDNTDDFLESLL----------Dsrssrvytvv  1761
             C+ S        +W+CG           ++ D+ L+S L            R   V  + 
Sbjct  140   CVRSSVGAGDACLWRCGVADFSGLGGGDEDVDELLDSALREGSECLGSGGGRVYTVVVIE  199

Query  1760  vvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI-HGEFMPVG  1584
                  E V+ VVGK+RHAW+VGK+SE E+V  + +IFVE+F+NGGK+ G I   EFMPVG
Sbjct  200   RDVAGEGVQVVVGKHRHAWLVGKVSEPEAVSMIGKIFVEIFMNGGKKAGEIGKAEFMPVG  259

Query  1583  ADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSS  1404
             ADG VVLSF+LLNADP DW+Y+W+FQ+++ ++LAP+V+AL PIA+++VESQVLYHTPKSS
Sbjct  260   ADGSVVLSFSLLNADPSDWVYNWEFQKIEKIMLAPVVEALAPIANITVESQVLYHTPKSS  319

Query  1403  FSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
              S WD+K GSYIF+++DLPFFVNSNEWHLDTS  A G+SKVL FVVYVPS  ECPL L L
Sbjct  320   ISYWDKKLGSYIFTMRDLPFFVNSNEWHLDTSITAAGQSKVLQFVVYVPSARECPLVLQL  379

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLRQL  1047
             P+GE SKTNGFISPMWGG+VVWNPP CSK+S+   L ++ IS++EL+K+F+VF+GQLR L
Sbjct  380   PDGETSKTNGFISPMWGGIVVWNPPMCSKDSQRTYLAKNIISTQELQKIFQVFIGQLRLL  439

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLP  867
             FGL S+ L       SR L SE+GFT+WELD + R HTCFNLL C TTL SLS+LVQSLP
Sbjct  440   FGLRSNYLDATEMGISRFLNSERGFTEWELDLLYRHHTCFNLLSCATTLESLSKLVQSLP  499

Query  866   RMIIMDEIGKQVKFS  822
             RMIIMDEIGKQ  F+
Sbjct  500   RMIIMDEIGKQPFFA  514



>dbj|BAB92563.1| P0497A05.6 [Oryza sativa Japonica Group]
Length=557

 Score =   449 bits (1155),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 250/485 (52%), Positives = 326/485 (67%), Gaps = 15/485 (3%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R +KPGRKRL LT ++ +SFLIGLP LLKS EIHR+PLP   I +L+  +  +P  FPC 
Sbjct  45    RTSKPGRKRLVLTASVLLSFLIGLPLLLKSTEIHRSPLPSDAIAALSRRLHSNPPSFPCG  104

Query  2072  FQVVFV--NLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+    D S  S A+ +   I++Q+  L  A      +     +V++T+ES+   C
Sbjct  105   LHAVFLRSGRDPSEASVANRIEREISTQLVDLPDA------STAGKISVSVTVESAG-GC  157

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvn---rdeevrav  1728
               S      W+CGA++  D  +  +  D+ L+S L         V  V     D+  R V
Sbjct  158   SSSSKVASPWRCGAVTTADLGRGDEVFDELLDSALGDGGGDGMRVYTVVFVDSDDLKRIV  217

Query  1727  VGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEG---SIHGEFMPVGADGRVVLSF  1557
             +GK+RHAW+VGK+ E E V  + ++FV+ F+NGG EEG   ++  EFMPVG+DG +VLSF
Sbjct  218   IGKHRHAWVVGKVDEAEVVSIIGKVFVKYFMNGGVEEGEASTVKREFMPVGSDGNIVLSF  277

Query  1556  NLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQG  1377
             +LLNADP DW+YDW+F+ +   +L P+++ALRPIA++++ESQVLYHTPKSS+S  D+K G
Sbjct  278   SLLNADPSDWVYDWEFENIGQRMLTPVIEALRPIANINIESQVLYHTPKSSYSYSDDKLG  337

Query  1376  SYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTN  1197
               + S+ D+PFFVNSNEWHLDTS +A GRSKVL FVVY+PS  ECPL L LP+GELSKTN
Sbjct  338   GNVLSVGDIPFFVNSNEWHLDTSISATGRSKVLQFVVYIPSARECPLYLQLPDGELSKTN  397

Query  1196  GFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYV  1017
              FISPMWGGVV+WNPP CS  S+      K+SSEEL +  E+F+GQLRQLFGL S     
Sbjct  398   AFISPMWGGVVIWNPPGCSFGSKPHGALDKMSSEELMETIEIFIGQLRQLFGLKSSYHTQ  457

Query  1016  GATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  ++ +TS KGF QWELD + R H C NLL C TTL SLS LVQSLPRMI+MDEIG+
Sbjct  458   SMDGVTKFITSPKGFAQWELDLLYRHHACSNLLSCLTTLESLSSLVQSLPRMIVMDEIGR  517

Query  836   QVKFS  822
             Q  F+
Sbjct  518   QPFFA  522



>ref|XP_010927566.1| PREDICTED: GPI transamidase component PIG-S isoform X4 [Elaeis 
guineensis]
Length=467

 Score =   416 bits (1068),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 313/448 (70%), Gaps = 18/448 (4%)
 Frame = -3

Query  2261  NTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLF  2082
             +T R  +PG KRL LTL++ +SFL GLPFLLKS EI+R+PLPF+ IDSL+  ++      
Sbjct  23    STRRTARPGTKRLLLTLSVLLSFLSGLPFLLKSTEIYRSPLPFRSIDSLSSRLQSDHPTL  82

Query  2081  PCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSN  1902
             PC+FQ V +  D +    A  L  LI+  + K TS   PV G C  NF+V++T++S +  
Sbjct  83    PCRFQAVLLRPD-ADRFLADRLGSLISEDLVKRTS-NDPVSGGCGKNFSVSVTIDSGA-G  139

Query  1901  CIYSE---NQDIVWKCGALSGLDFEKSLDNTDDFLESLL----------Dsrssrvytvv  1761
             C+ S        +W+CG           ++ D+ L+S L            R   V  + 
Sbjct  140   CVRSSVGAGDACLWRCGVADFSGLGGGDEDVDELLDSALREGSECLGSGGGRVYTVVVIE  199

Query  1760  vvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI-HGEFMPVG  1584
                  E V+ VVGK+RHAW+VGK+SE E+V  + +IFVE+F+NGGK+ G I   EFMPVG
Sbjct  200   RDVAGEGVQVVVGKHRHAWLVGKVSEPEAVSMIGKIFVEIFMNGGKKAGEIGKAEFMPVG  259

Query  1583  ADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSS  1404
             ADG VVLSF+LLNADP DW+Y+W+FQ+++ ++LAP+V+AL PIA+++VESQVLYHTPKSS
Sbjct  260   ADGSVVLSFSLLNADPSDWVYNWEFQKIEKIMLAPVVEALAPIANITVESQVLYHTPKSS  319

Query  1403  FSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
              S WD+K GSYIF+++DLPFFVNSNEWHLDTS  A G+SKVL FVVYVPS  ECPL L L
Sbjct  320   ISYWDKKLGSYIFTMRDLPFFVNSNEWHLDTSITAAGQSKVLQFVVYVPSARECPLVLQL  379

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLRQL  1047
             P+GE SKTNGFISPMWGG+VVWNPP CSK+S+   L ++ IS++EL+K+F+VF+GQLR L
Sbjct  380   PDGETSKTNGFISPMWGGIVVWNPPMCSKDSQRTYLAKNIISTQELQKIFQVFIGQLRLL  439

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQW  963
             FGL S+ L       SR L SE+GFT+W
Sbjct  440   FGLRSNYLDATEMGISRFLNSERGFTEW  467



>ref|XP_010927564.1| PREDICTED: GPI transamidase component PIG-S isoform X3 [Elaeis 
guineensis]
 ref|XP_010927565.1| PREDICTED: GPI transamidase component PIG-S isoform X3 [Elaeis 
guineensis]
Length=473

 Score =   416 bits (1068),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 313/448 (70%), Gaps = 18/448 (4%)
 Frame = -3

Query  2261  NTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLF  2082
             +T R  +PG KRL LTL++ +SFL GLPFLLKS EI+R+PLPF+ IDSL+  ++      
Sbjct  23    STRRTARPGTKRLLLTLSVLLSFLSGLPFLLKSTEIYRSPLPFRSIDSLSSRLQSDHPTL  82

Query  2081  PCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSN  1902
             PC+FQ V +  D +    A  L  LI+  + K TS   PV G C  NF+V++T++S +  
Sbjct  83    PCRFQAVLLRPD-ADRFLADRLGSLISEDLVKRTS-NDPVSGGCGKNFSVSVTIDSGA-G  139

Query  1901  CIYSE---NQDIVWKCGALSGLDFEKSLDNTDDFLESLL----------Dsrssrvytvv  1761
             C+ S        +W+CG           ++ D+ L+S L            R   V  + 
Sbjct  140   CVRSSVGAGDACLWRCGVADFSGLGGGDEDVDELLDSALREGSECLGSGGGRVYTVVVIE  199

Query  1760  vvnrdeevravVGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSI-HGEFMPVG  1584
                  E V+ VVGK+RHAW+VGK+SE E+V  + +IFVE+F+NGGK+ G I   EFMPVG
Sbjct  200   RDVAGEGVQVVVGKHRHAWLVGKVSEPEAVSMIGKIFVEIFMNGGKKAGEIGKAEFMPVG  259

Query  1583  ADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSS  1404
             ADG VVLSF+LLNADP DW+Y+W+FQ+++ ++LAP+V+AL PIA+++VESQVLYHTPKSS
Sbjct  260   ADGSVVLSFSLLNADPSDWVYNWEFQKIEKIMLAPVVEALAPIANITVESQVLYHTPKSS  319

Query  1403  FSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
              S WD+K GSYIF+++DLPFFVNSNEWHLDTS  A G+SKVL FVVYVPS  ECPL L L
Sbjct  320   ISYWDKKLGSYIFTMRDLPFFVNSNEWHLDTSITAAGQSKVLQFVVYVPSARECPLVLQL  379

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPL-RHKISSEELKKVFEVFMGQLRQL  1047
             P+GE SKTNGFISPMWGG+VVWNPP CSK+S+   L ++ IS++EL+K+F+VF+GQLR L
Sbjct  380   PDGETSKTNGFISPMWGGIVVWNPPMCSKDSQRTYLAKNIISTQELQKIFQVFIGQLRLL  439

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQW  963
             FGL S+ L       SR L SE+GFT+W
Sbjct  440   FGLRSNYLDATEMGISRFLNSERGFTEW  467



>ref|XP_002986510.1| hypothetical protein SELMODRAFT_124120, partial [Selaginella 
moellendorffii]
 gb|EFJ12367.1| hypothetical protein SELMODRAFT_124120, partial [Selaginella 
moellendorffii]
Length=544

 Score =   358 bits (920),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 212/557 (38%), Positives = 323/557 (58%), Gaps = 38/557 (7%)
 Frame = -3

Query  2180  PFLLKSIEIHRAPLPFKDIDSLALS-IERSPLLFPCKFQVVFVNLDHSTTSTASELSFLI  2004
             PF  K  E++R PLP+++++         S     C+ Q+VF + + +    A       
Sbjct  3     PFWWKLTEVYRVPLPYREVEGFVTKQSSSSAARVHCQLQIVFFSKEETPDRDAK-----W  57

Query  2003  TSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI---VWKCG----ALSGL  1845
             + +++ +  A      T      VA+TL++    C++    D    +W+CG    +L   
Sbjct  58    SDRLEVVLRATREWSNTGSCEIEVAVTLDAKGL-CLHKRGGDRAKPLWECGRVPDSLHSQ  116

Query  1844  DFEKSLDNTDDFL-ESLLDsrssrvytvvvvnrdeevravVGKYRHAWIV---GKLSEQe  1677
             D     ++  D++ E      +  V     +++     AVVGKYRHAW+V     L   E
Sbjct  117   DSTSIDESLKDYIGEDRAGKYTILVLLDGELSQGGGAEAVVGKYRHAWVVFPPSLLGNDE  176

Query  1676  svekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELD  1497
              + +++     V + GGK   ++  + MP+ ADG  +LSF+LLNADP +WI++WDF  ++
Sbjct  177   QLTRIISETAGVLLAGGKSATAV-AKTMPLAADGSAILSFSLLNADPENWIFNWDFDSVE  235

Query  1496  DMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHL  1317
                L+P+V AL P+A +SVESQVLY+TP ++ S W+    S++   KDL FFVN+NEWHL
Sbjct  236   SQYLSPVVDALAPVARLSVESQVLYYTPAAARSQWNADIRSHVIESKDLSFFVNANEWHL  295

Query  1316  DTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKT---NGFISPMWGGVVVWNPPS  1146
             DTS AA GRSKVLHF +YVP  EECPL++ L +G ++ +   +GF SP WGGVV+WNPP 
Sbjct  296   DTSAAAAGRSKVLHFAIYVPPVEECPLRIKLSSGRITSSASIDGFTSPGWGGVVIWNPPG  355

Query  1145  C--SKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGF  972
             C  + NS    LR +++  +LK   EV + QLR LFGL        A   S L     GF
Sbjct  356   CLVADNST---LRQRLNVNDLKTTMEVVVAQLRTLFGLPPVPPRRKAPKLSILFNQRTGF  412

Query  971   TQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSL--  798
              +WELD + R+    ++    +TL SL +LV+SLP+M+I  EIG QV  SL+AA+ ++  
Sbjct  413   AEWELDLLLRRRVIADVNSTASTLASLLKLVESLPKMVIQQEIGVQVTTSLEAAEKAMDA  472

Query  797   SNAS---IGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV  627
              NAS   IGN+      S  A++ AE+AF+HPS+MS+ ++  EH FA+Y+PFF+PV LH 
Sbjct  473   GNASYEVIGNF------SATAKARAEEAFFHPSIMSLLHFPKEHQFAIYTPFFVPVLLHT  526

Query  626   ILAVLREWKRCKQENKK  576
             +++V++E  R  +++ +
Sbjct  527   VISVVKETMRYARKSSR  543



>ref|XP_002964929.1| hypothetical protein SELMODRAFT_439141 [Selaginella moellendorffii]
 gb|EFJ33767.1| hypothetical protein SELMODRAFT_439141 [Selaginella moellendorffii]
Length=569

 Score =   353 bits (906),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 216/565 (38%), Positives = 332/565 (59%), Gaps = 48/565 (8%)
 Frame = -3

Query  2180  PFLLKSIEIHRAPLPFKDIDSLAL-SIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLI  2004
             PF  K  E++R PLP+++++         S     C+ Q+VF + + +    A       
Sbjct  22    PFWWKLTEVYRVPLPYREVEGFVTKQSSSSAARVHCQLQIVFFSKEETPDRDAK-----W  76

Query  2003  TSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDI---VWKCGALSGLDFEK  1833
             + +++ +  A      +      VA+TL++    C++    D    +W+CG +  LD   
Sbjct  77    SDRLEVVLRATREWSSSGFCEIEVAVTLDAKGL-CLHKRGGDRAKPLWECGRV--LDSLH  133

Query  1832  SLDNT--DDFLESLLDsrssrvytvvv-----vnrdeevravVGKYRHAWIV---GKLSE  1683
             S D+T  D+ L++ +    +  YT++V     +++     AVVGKYRHAW+V     L  
Sbjct  134   SQDSTSIDESLKNYIGEDRAGKYTILVLLDGELSQGGGAEAVVGKYRHAWVVFPPSLLGN  193

Query  1682  QesvekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQE  1503
              E + +++     V + GGK   ++  + MP+ ADG  +LSF+LLNADP +WI++WDF  
Sbjct  194   DEQLTRIISETAGVLLAGGKPATAV-AKTMPLAADGSAILSFSLLNADPENWIFNWDFDS  252

Query  1502  LDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEW  1323
             ++   L+P+V AL P+A +SVESQVLY+TP ++ S W+    S++   KDL FFVN+NEW
Sbjct  253   VESQYLSPVVDALAPVARLSVESQVLYYTPAAARSQWNADIRSHVIESKDLSFFVNANEW  312

Query  1322  HLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKT---NGFISPM------WGG  1170
             HLDTS AA GRSKVLHF +YVP  EECPL++ L +G ++ +   +GF SP+      WGG
Sbjct  313   HLDTSAAAAGRSKVLHFAIYVPPVEECPLRIKLSSGRITSSASIDGFTSPLMPLMQGWGG  372

Query  1169  VVVWNPPSC--SKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSR  996
             VV+WNPP C  + NS    LR +++  +LK   EV + QLR LFGL        A   S 
Sbjct  373   VVIWNPPGCLVADNST---LRQRLNVNDLKTTMEVVVAQLRTLFGLPPVPPRRKAPKLSI  429

Query  995   LLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLD  816
             L     GF +WELD + R+    ++    +TL SL +LV+SLP+M+I  EIG QV  SL+
Sbjct  430   LCNQRTGFAEWELDLLLRRRVIADVNSTASTLASLLKLVESLPKMVIQQEIGVQVTTSLE  489

Query  815   AAKSSL--SNAS---IGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPF  651
             AA+ ++   NAS   IGN+      S  A++ AE+AF+HPS+MS+ ++  EH FA+Y+PF
Sbjct  490   AAEKAMDAGNASYQVIGNF------SATAKAWAEEAFFHPSIMSLLHFPKEHQFAMYTPF  543

Query  650   FLPVALHVILAVLREWKRCKQENKK  576
             F+PV LH +++V++E  R  +++ +
Sbjct  544   FVPVLLHTVISVVKETMRYARKSSR  568



>emb|CAN78378.1| hypothetical protein VITISV_011026 [Vitis vinifera]
Length=433

 Score =   344 bits (882),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 218/341 (64%), Positives = 259/341 (76%), Gaps = 17/341 (5%)
 Frame = -3

Query  2255  MRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPC  2076
             MRKTKPG KRLFLTLT+  SF +G PFLLKSIEI+R+PLPF+DIDSL+ S+   PLLFPC
Sbjct  1     MRKTKPGLKRLFLTLTVLFSFFLGSPFLLKSIEIYRSPLPFRDIDSLSDSVGSRPLLFPC  60

Query  2075  KFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCL-SNFTVAITLESSSSNC  1899
              FQ +FV  D+     A EL   I  +M+KLT  K PVCGTC  SN+TV++T++S S  C
Sbjct  61    HFQAIFVGFDNFD---AYELGISIKHEMKKLT--KHPVCGTCSDSNYTVSVTVDSGS-GC  114

Query  1898  I--YSENQDIVWKCGALSGLDFEKSLDNTD---DFLESLLDsrs--srvytvvvvnrdee  1740
                Y+     +W+CGA+   D      + D   +FL S+L S     +VY+VVVVNR  E
Sbjct  115   ARNYNAESTCMWRCGAIREFDLGGGGGDDDGVDEFLGSVLGSCEGFRKVYSVVVVNRGGE  174

Query  1739  vravVGKYRHAWIVGKLSEQ---esvekvveifvevfVNGGKEEGSIHGEFMPVGADGRV  1569
             VRAVVGKYRHAWI+G + E+     V +V E FV+VFVNGGKEEGSIHGEFMPVGADGR+
Sbjct  175   VRAVVGKYRHAWIIGGVLEEGMNAMVARVAETFVKVFVNGGKEEGSIHGEFMPVGADGRI  234

Query  1568  VLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWD  1389
             VLSFNLLNADP DWIY WDFQ +D++LLAP+++AL P+A++SVESQVLYHTPKSSFS WD
Sbjct  235   VLSFNLLNADPTDWIYGWDFQRIDEILLAPVIKALEPVANISVESQVLYHTPKSSFSYWD  294

Query  1388  EKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVV  1266
             EK  SYIFS KDLPFFVNSNEWHLDTS AAGGRSK+L FVV
Sbjct  295   EKWDSYIFSTKDLPFFVNSNEWHLDTSIAAGGRSKILQFVV  335


 Score =   149 bits (375),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = -3

Query  833  VKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSP  654
            VKFSL+AAK + SNAS+G YD SAVSSRQARSLAEDAF+HPS+MSVSYYSFEHCFAVYSP
Sbjct  335  VKFSLEAAKLTQSNASLGIYDASAVSSRQARSLAEDAFFHPSIMSVSYYSFEHCFAVYSP  394

Query  653  FFLPVALHVILAVLREWKRCKQENKKYL  570
            FFLPV++HV+LA  REW+R KQE  KYL
Sbjct  395  FFLPVSMHVLLAAFREWRRYKQETAKYL  422



>ref|XP_001781543.1| predicted protein [Physcomitrella patens]
 gb|EDQ53662.1| predicted protein [Physcomitrella patens]
Length=732

 Score =   321 bits (822),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 234/601 (39%), Positives = 334/601 (56%), Gaps = 44/601 (7%)
 Frame = -3

Query  2342  MAEISEAPSAEDNNQKSEQ------------SFVNDFDPNTMRKTKP-GRKRlfltltif  2202
             MAE+ E P A+     SE             +   D D     ++KP GRKRLF+T ++ 
Sbjct  64    MAEVEELPCADAATSGSEAHGSGHEGNPASATESGDVDAEASTRSKPPGRKRLFITFSVV  123

Query  2201  isfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS--PLLFPCKFQVVFVNLDHSTTST  2028
               FL+G+PF  KS E++RAPLPF  I+  A  +  S   L  PC   ++F     S    
Sbjct  124   FFFLLGVPFWWKSTEVYRAPLPFSAIEEHAAVVASSSLALALPCHLHIIFT----SAAPH  179

Query  2027  ASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGA---  1857
              +E    + S  +   S +    G    +F + +T ++  S      + +  W CG    
Sbjct  180   RNEGLMSVASLEKVAESFRQHAQGY---DFGIRVTWDADDSCVSVGSDVEWTWPCGLANS  236

Query  1856  -LSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvnrd-------eevravVGKYRHAWI  1701
              L  +D  ++ D  D+FL S    +SS       +           + R VVGK+RHAW+
Sbjct  237   DLLNVDL-RNDDYVDEFLWSFAKDKSSSAGGRYTLVVVERKPGEDAKERTVVGKHRHAWM  295

Query  1700  VGK-LS----EQesvekvveifvevfVNGGKEEGSIHGE-----FMPVGADGRVVLSFNL  1551
              G  LS    E     ++ E+ V  F NGG+   +   E      MP+ ADG  +LSF L
Sbjct  296   TGADLSVPDFEDGIASRIAEVAVIYFRNGGRVSKAGRAEDDQVPSMPLSADGEAILSFTL  355

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             LNA+P DWIYDWD +E+++  L P++  + P+A  SVESQVLY+TPK+  S W+E   ++
Sbjct  356   LNANPEDWIYDWDIEEVEERYLQPLIDVMEPVARFSVESQVLYYTPKAVSSHWNEALKAH  415

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             +   K LPFFVNSNEWHLDTS+AA GRSK+LHF +YVP+  ECPL + L +G +S TNGF
Sbjct  416   LVPFKQLPFFVNSNEWHLDTSSAATGRSKILHFAIYVPAANECPLHMQLSSGRISLTNGF  475

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGGV V+NPP C          +K+SS++L+ V  V + Q+R LFGL S  +    
Sbjct  476   TSPGWGGVTVYNPPGCGNLVSNNSGSYKLSSKDLEPVVGVIVAQIRALFGLPSMFVKNAK  535

Query  1010  TATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQV  831
             T+T  +  +  G   WE+D + R+ T  ++    +TL SLSRLV SLP M+I DEIG+ V
Sbjct  536   TSTYGVPAAVTGIADWEVDVLLRRRTAMDIQASASTLLSLSRLVSSLPNMVIKDEIGEHV  595

Query  830   KFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPF  651
             + SL  AK++ S + +G Y  +A ++R+ARS AE AF+ PS+MS+ Y+  EH  A+Y+  
Sbjct  596   QSSLAEAKAAQSQSLVGAYHAAAEAARKARSRAEAAFFQPSIMSLLYFPAEHQLAIYTVG  655

Query  650   F  648
             F
Sbjct  656   F  656



>ref|NP_974245.1| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
 gb|AEE74509.1| GPI transamidase component PIG-S-related protein [Arabidopsis 
thaliana]
Length=454

 Score =   295 bits (755),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 183/354 (52%), Positives = 238/354 (67%), Gaps = 25/354 (7%)
 Frame = -3

Query  2273  DFDPNTMRKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERS  2094
             +FDP TMR TKPG KRLF+T ++  SFL+G+PFL KS+EI+R+PLPF DIDSL+  +E +
Sbjct  15    EFDPKTMRSTKPGLKRLFITSSVLFSFLLGVPFLWKSVEIYRSPLPFHDIDSLSDQLEST  74

Query  2093  PLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLES  1914
             PL FPC F  VFV      ++    L   I   + +LT  +S  CG+C  +F++++T+++
Sbjct  75    PLRFPCNFHAVFVGF---RSTDPDNLRSQIQDGINQLTH-QSSQCGSC--DFSLSVTVQN  128

Query  1913  SSSNC---IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLD-----------srssr  1776
                 C   +   +    ++CG +    F   LD+T D  ESL D             S  
Sbjct  129   REDQCSDTLAHSSTTCSYRCGVIKRNGFSVGLDDTVD--ESLNDVFSGCSENSGKMYSVV  186

Query  1775  vytvvvvnrdeevravVGKYRHAWIVGKLSEQes---vekvveifvevfVNGGKEEGSIH  1605
             V      N  +EV+AVVGK RHAWIVG   E+     V +V EIFV+VF+NGG+EE SI 
Sbjct  187   VVNKENANGGDEVKAVVGKRRHAWIVGNGLEERYGDIVARVSEIFVQVFMNGGREEDSIQ  246

Query  1604  GEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVL  1425
             GEFMPVG+DG++VLSF+LLN++P DW+YDWDFQ +D+ LLAP+ +AL PIA+++VESQVL
Sbjct  247   GEFMPVGSDGKIVLSFSLLNSNPRDWVYDWDFQRIDEALLAPVTKALAPIANITVESQVL  306

Query  1424  YHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVY  1263
             YHTPKSSFS WD+K  SYIF   DLPFFVNSNEWHLDTS  A GRSK+L FV Y
Sbjct  307   YHTPKSSFSSWDKKLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVKY  360


 Score =   124 bits (311),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -3

Query  833  VKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSP  654
            VK+SL AAK + SNAS+G Y  SA SSR+ARSLAE+AF+HPS+MSVSY+S+EHCFAVYSP
Sbjct  358  VKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHPSIMSVSYFSYEHCFAVYSP  417

Query  653  FFLPVALHVILAVLREWKRCKQENKKYLAW  564
            FFLPV  HV+LA +REWKR KQE  KYL W
Sbjct  418  FFLPVVGHVVLAAVREWKRYKQEKAKYLTW  447



>gb|KHN10979.1| GPI transamidase component PIG-S [Glycine soja]
Length=182

 Score =   281 bits (718),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -3

Query  1181  MWGGVVVWNPPSCSKNSEMQ-PLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATA  1005
             MWGGVVVWNP SC K+ E + P+RH ISS++L+K+FEV MGQLRQL GL SD+LYVG + 
Sbjct  4     MWGGVVVWNPRSCIKDLESRDPVRHTISSQDLQKLFEVLMGQLRQLLGLKSDNLYVGKSG  63

Query  1004  TSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKF  825
              S LL SE+GFT+WELD +SR+H CFNL  C TTLGSLSRLVQSLPRMIIMDEIGKQVKF
Sbjct  64    ASILLGSERGFTEWELDVLSRKHICFNLQSCATTLGSLSRLVQSLPRMIIMDEIGKQVKF  123

Query  824   SLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             SL+AAKS+ SNASIG YD SAVSSRQ+RSLAEDAF+HPS+MS+SYYSFEHCFA+YS
Sbjct  124   SLEAAKSAQSNASIGIYDASAVSSRQSRSLAEDAFFHPSIMSISYYSFEHCFAIYS  179



>gb|EAY76889.1| hypothetical protein OsI_04848 [Oryza sativa Indica Group]
Length=507

 Score =   283 bits (724),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 194/528 (37%), Positives = 272/528 (52%), Gaps = 104/528 (20%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R +KPGRKRL LT ++ +S  + L    KS EIHR+PLP   I +L+  +  +P  FPC 
Sbjct  45    RTSKPGRKRLVLTASVLLSLPLLL----KSTEIHRSPLPSDAIAALSRRLHSNPPSFPCG  100

Query  2072  FQVVFV--NLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+    D S  S A+ +   I++Q+  L  A +          +V++T+ES+   C
Sbjct  101   LHAVFLRSGRDPSEASVANRIEREISTQLVDLPDAST------AGKISVSVTVESAG-GC  153

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvn---rdeevrav  1728
               S      W+CGA++  D  +  +  D+ L+S L         V  V     D+  R V
Sbjct  154   SSSSKVASPWRCGAVTTADLGRGDEVFDELLDSALGDGGGDGMRVYTVVFVDSDDLKRIV  213

Query  1727  VGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEGSIHGEFMPVGADGRVVLSFNLL  1548
             +GK+RHAW+VGK+ E                    E  SI G+                 
Sbjct  214   IGKHRHAWVVGKVDE-------------------AEVVSIIGK-----------------  237

Query  1547  NADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYI  1368
                    ++  +F+ +   +L P+++ALRPIA++++ESQVLYHTPKSS+S  D+K G  +
Sbjct  238   -------VFVKEFENIGQRMLTPVIEALRPIANINIESQVLYHTPKSSYSYSDDKLGGNV  290

Query  1367  FSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFI  1188
              S+ D+PFF+  ++             K  +FVVY+PS  ECPL L LP+GELSKTN FI
Sbjct  291   LSVGDIPFFLQDDQ-------------KFFNFVVYIPSARECPLYLQLPDGELSKTNAFI  337

Query  1187  SPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGAT  1008
             SPMWGGVV+WNPP CS  S+      K+SSEEL +  E+F+GQLRQLFGL S        
Sbjct  338   SPMWGGVVIWNPPGCSFGSKPHGALDKMSSEELMQTIEIFIGQLRQLFGLKSSYHTQSMD  397

Query  1007  ATSRLLTSEKGFTQWELDFISRQHTCFNLLQCG--------------------------T  906
               ++ +TS KGF Q        Q+    + Q G                           
Sbjct  398   GVTKFITSPKGFAQC------LQYAIICINQGGLLSKLEDPNYMSTAEILNVPDKILDAI  451

Query  905   TLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSA  762
              L S+  +VQSLPRMI+MDEIG+QV+ SL+AA  +  NAS+G  D SA
Sbjct  452   CLISICLIVQSLPRMIVMDEIGRQVELSLEAASLAQRNASLGISDSSA  499



>dbj|BAD82743.1| GPI transamidase component PIG-S-like [Oryza sativa Japonica 
Group]
Length=352

 Score =   220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 199/313 (64%), Gaps = 15/313 (5%)
 Frame = -3

Query  2252  RKTKPGRKRlfltltifisfligLPFLLKSIEIHRAPLPFKDIDSLALSIERSPLLFPCK  2073
             R +KPGRKRL LT ++ +SFLIGLP LLKS EIHR+PLP   I +L+  +  +P  FPC 
Sbjct  45    RTSKPGRKRLVLTASVLLSFLIGLPLLLKSTEIHRSPLPSDAIAALSRRLHSNPPSFPCG  104

Query  2072  FQVVFV--NLDHSTTSTASELSFLITSQMQKLTSAKSPVCGTCLSNFTVAITLESSSSNC  1899
                VF+    D S  S A+ +   I++Q+  L  A      +     +V++T+ES+   C
Sbjct  105   LHAVFLRSGRDPSEASVANRIEREISTQLVDLPDA------STAGKISVSVTVESAG-GC  157

Query  1898  IYSENQDIVWKCGALSGLDFEKSLDNTDDFLESLLDsrssrvytvvvvn---rdeevrav  1728
               S      W+CGA++  D  +  +  D+ L+S L         V  V     D+  R V
Sbjct  158   SSSSKVASPWRCGAVTTADLGRGDEVFDELLDSALGDGGGDGMRVYTVVFVDSDDLKRIV  217

Query  1727  VGKYRHAWIVGKLSEQesvekvveifvevfVNGGKEEG---SIHGEFMPVGADGRVVLSF  1557
             +GK+RHAW+VGK+ E E V  + ++FV+ F+NGG EEG   ++  EFMPVG+DG +VLSF
Sbjct  218   IGKHRHAWVVGKVDEAEVVSIIGKVFVKYFMNGGVEEGEASTVKREFMPVGSDGNIVLSF  277

Query  1556  NLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQG  1377
             +LLNADP DW+YDW+F+ +   +L P+++ALRPIA++++ESQVLYHTPKSS+S  D+K G
Sbjct  278   SLLNADPSDWVYDWEFENIGQRMLTPVIEALRPIANINIESQVLYHTPKSSYSYSDDKLG  337

Query  1376  SYIFSIKDLPFFV  1338
               + S+ D+PFFV
Sbjct  338   GNVLSVGDIPFFV  350



>gb|AAX09335.1| putative phosphatidylinositol glycan class S [Fragaria x ananassa]
Length=118

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = -3

Query  893  LSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYH  714
            LSRLVQSLPRMII DEIGKQVK+SL+AAK + +NAS+G YD SAVSSRQARSLAEDAF+H
Sbjct  1    LSRLVQSLPRMIIKDEIGKQVKYSLEAAKLAQTNASLGIYDASAVSSRQARSLAEDAFFH  60

Query  713  PSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAKVN  549
            PS+MSV YYSFEHCFAVYSPFFLPV++HVILA LREW+R K+E+KKYL WKAK+ 
Sbjct  61   PSIMSVGYYSFEHCFAVYSPFFLPVSMHVILAALREWRRYKKEHKKYLVWKAKMK  115



>gb|EXX63719.1| Gpi17p [Rhizophagus irregularis DAOM 197198w]
Length=362

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 188/336 (56%), Gaps = 18/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+L+N DP D + +WD +E  +  L   V  +  I++++V+SQ+  H  + +F  + +
Sbjct  36    VTFSLMNGDPSDLLVNWDIEEAVNKYLQLFVNKISVISNLTVDSQI-QHYARLTFEPFHK  94

Query  1385  KQGSYIFSIKDL-PFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
                +Y +   +L P F+N+ EW+L    +A      L+F++YVPS+++ PL +    G +
Sbjct  95    ADENYFYLTPELLPHFINAAEWNL---ASAVSSYPTLNFILYVPSKDQSPLYIQDSKGNI  151

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN--  1035
              ++N F+ P WGGV++ NP   +         H  S EELK +  +F+ QLR L G++  
Sbjct  152   MESNAFLIPRWGGVIIKNPDRSTG-------AHNFSLEELKSIMSIFITQLRGLLGVHDV  204

Query  1034  --SDSLYVGATATSRLLTS-EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
                    +  T     +T      T WE D ++R+    N++   TTL SLS+LV  +P 
Sbjct  205   WTEAKHALDVTTNIEFVTPPNTAVTMWEFDSLTRRRIAENIITSITTLKSLSQLVTEIPN  264

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             M+++D I  +V  +LD    S +N     Y+ +   S++A  LAE AF+ P+M+S+ Y+ 
Sbjct  265   MVVLDHIQTEVFLALDNLAKSCANLHNNQYNLALYHSKKAIELAESAFFDPTMVSMLYFP  324

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
              EH +A+Y P F+P+++ +++A+ RE K  K ENKK
Sbjct  325   DEHKYAIYMPLFVPISVPLLVALHREIKSFK-ENKK  359



>gb|ESA06742.1| hypothetical protein GLOINDRAFT_82294 [Rhizophagus irregularis 
DAOM 181602]
Length=411

 Score =   194 bits (492),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 188/336 (56%), Gaps = 18/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+L+N DP D + +WD +E  +  L   V  +  I++++V+SQ+  H  + +F  + +
Sbjct  85    VTFSLMNGDPSDLLVNWDIEEAVNKYLQLFVNKISVISNLTVDSQI-QHYARLTFEPFHK  143

Query  1385  KQGSYIFSIKDL-PFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
                +Y +   +L P F+N+ EW+L    +A      L+F++YVPS+++ PL +    G +
Sbjct  144   ADENYFYLTPELLPHFINAAEWNL---ASAVSSYPTLNFILYVPSKDQSPLYIQDSKGNI  200

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN--  1035
              ++N F+ P WGGV++ NP   +         H  S EELK +  +F+ QLR L G++  
Sbjct  201   MESNAFLIPRWGGVIIKNPDRSTG-------AHNFSLEELKSIMSIFITQLRGLLGVHDV  253

Query  1034  --SDSLYVGATATSRLLTS-EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
                    +  T     +T      T WE D ++R+    N++   TTL SLS+LV  +P 
Sbjct  254   WTEAKHALDVTTNIEFVTPPNTAVTMWEFDSLTRRRIAENIITSITTLKSLSQLVTEIPN  313

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             M+++D I  +V  +LD    S +N     Y+ +   S++A  LAE AF+ P+M+S+ Y+ 
Sbjct  314   MVVLDHIQTEVFLALDNLAKSCANLHNNQYNLALYHSKKAIELAESAFFDPTMVSMLYFP  373

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
              EH +A+Y P F+P+++ +++A+ RE K  K ENKK
Sbjct  374   DEHKYAIYMPLFVPISVPLLVALHREIKSFK-ENKK  408



>gb|EXX63718.1| Gpi17p [Rhizophagus irregularis DAOM 197198w]
Length=446

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 188/336 (56%), Gaps = 18/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+L+N DP D + +WD +E  +  L   V  +  I++++V+SQ+  H  + +F  + +
Sbjct  120   VTFSLMNGDPSDLLVNWDIEEAVNKYLQLFVNKISVISNLTVDSQI-QHYARLTFEPFHK  178

Query  1385  KQGSYIFSIKDL-PFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
                +Y +   +L P F+N+ EW+L    +A      L+F++YVPS+++ PL +    G +
Sbjct  179   ADENYFYLTPELLPHFINAAEWNL---ASAVSSYPTLNFILYVPSKDQSPLYIQDSKGNI  235

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN--  1035
              ++N F+ P WGGV++ NP   +         H  S EELK +  +F+ QLR L G++  
Sbjct  236   MESNAFLIPRWGGVIIKNPDRSTG-------AHNFSLEELKSIMSIFITQLRGLLGVHDV  288

Query  1034  --SDSLYVGATATSRLLTS-EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
                    +  T     +T      T WE D ++R+    N++   TTL SLS+LV  +P 
Sbjct  289   WTEAKHALDVTTNIEFVTPPNTAVTMWEFDSLTRRRIAENIITSITTLKSLSQLVTEIPN  348

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             M+++D I  +V  +LD    S +N     Y+ +   S++A  LAE AF+ P+M+S+ Y+ 
Sbjct  349   MVVLDHIQTEVFLALDNLAKSCANLHNNQYNLALYHSKKAIELAESAFFDPTMVSMLYFP  408

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
              EH +A+Y P F+P+++ +++A+ RE K  K ENKK
Sbjct  409   DEHKYAIYMPLFVPISVPLLVALHREIKSFK-ENKK  443



>gb|EXX63717.1| Gpi17p [Rhizophagus irregularis DAOM 197198w]
Length=550

 Score =   194 bits (493),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 188/336 (56%), Gaps = 18/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+L+N DP D + +WD +E  +  L   V  +  I++++V+SQ+  H  + +F  + +
Sbjct  224   VTFSLMNGDPSDLLVNWDIEEAVNKYLQLFVNKISVISNLTVDSQI-QHYARLTFEPFHK  282

Query  1385  KQGSYIFSIKDL-PFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
                +Y +   +L P F+N+ EW+L    +A      L+F++YVPS+++ PL +    G +
Sbjct  283   ADENYFYLTPELLPHFINAAEWNL---ASAVSSYPTLNFILYVPSKDQSPLYIQDSKGNI  339

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN--  1035
              ++N F+ P WGGV++ NP   +         H  S EELK +  +F+ QLR L G++  
Sbjct  340   MESNAFLIPRWGGVIIKNPDRSTG-------AHNFSLEELKSIMSIFITQLRGLLGVHDV  392

Query  1034  --SDSLYVGATATSRLLTS-EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
                    +  T     +T      T WE D ++R+    N++   TTL SLS+LV  +P 
Sbjct  393   WTEAKHALDVTTNIEFVTPPNTAVTMWEFDSLTRRRIAENIITSITTLKSLSQLVTEIPN  452

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             M+++D I  +V  +LD    S +N     Y+ +   S++A  LAE AF+ P+M+S+ Y+ 
Sbjct  453   MVVLDHIQTEVFLALDNLAKSCANLHNNQYNLALYHSKKAIELAESAFFDPTMVSMLYFP  512

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
              EH +A+Y P F+P+++ +++A+ RE K  K ENKK
Sbjct  513   DEHKYAIYMPLFVPISVPLLVALHREIKSFK-ENKK  547



>gb|KFM06755.1| GPI transamidase component PIG-S, partial [Aptenodytes forsteri]
Length=456

 Score =   187 bits (475),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 189/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  130   ITFSLLNPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  189

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  190   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  247

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  248   STNAFHSPRWGGIMVYNVETPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  304

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  305   L-----PPEFLLESPGNEGLANWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  359

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  ++G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  360   DDVASEVYRAVTSAQSAMAKLAVGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  419

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  420   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  454



>ref|XP_009276577.1| PREDICTED: GPI transamidase component PIG-S, partial [Aptenodytes 
forsteri]
Length=506

 Score =   187 bits (475),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 189/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  180   ITFSLLNPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  239

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  240   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  297

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  298   STNAFHSPRWGGIMVYNVETPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  354

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  355   L-----PPEFLLESPGNEGLANWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  409

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  ++G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  410   DDVASEVYRAVTSAQSAMAKLAVGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  469

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  470   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  504



>gb|EPB90456.1| hypothetical protein HMPREF1544_02664 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=479

 Score =   184 bits (467),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/334 (32%), Positives = 187/334 (56%), Gaps = 19/334 (6%)
 Frame = -3

Query  1562  SFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEK  1383
             +F+L+N +P +   DW+ ++  +  L+  ++ +  +++ +++SQ+  + P S    + E+
Sbjct  147   TFSLMNNNPENMKMDWEIRDAVNAYLSLFLKEVSVVSNFTIDSQIQNYAPLSLKPLYKER  206

Query  1382  QGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
              G    Y F  + LP FVNS EW+L  ST     S  ++FV+YVPS EE PL++    G+
Sbjct  207   VGKPSYYYFEPQHLPHFVNSAEWNL-ASTITSYPS--INFVLYVPSAEEAPLRIHDSKGQ  263

Query  1211  LSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN-  1035
                T+ F+ P WGG+V+ NPP  +         +  + ++L+ + ++F+ QLR L G++ 
Sbjct  264   PLLTSAFLIPRWGGIVIKNPPKAATE------EYTFTKKDLQPIMKIFISQLRSLIGVHD  317

Query  1034  -----SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSL  870
                  S+        T    T + G T  E D + R  T  N++   +TL SL++LV  +
Sbjct  318   LQSSISNKFPANYHVTFEPAT-KSGITTLEKDNLIRSRTLENVVNTISTLKSLAQLVDEI  376

Query  869   PRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSY  690
             P M++ D I  +V+ SLDA  +     S  +Y  +  SS +   LAE AF+ P+M+S+ Y
Sbjct  377   PNMVVEDHISIKVRQSLDALDAVSKGLSAEDYIKALQSSIETVELAEKAFFDPTMVSMLY  436

Query  689   YSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
             +  EH +A+Y P F+P+++ +I+A+L+E K+ KQ
Sbjct  437   FPDEHKYAIYMPLFVPISVPLIMALLKEIKKLKQ  470



>ref|XP_003227327.1| PREDICTED: GPI transamidase component PIG-S [Anolis carolinensis]
Length=559

 Score =   185 bits (469),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 105/333 (32%), Positives = 180/333 (54%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P+++ L P+A+ SV+SQ+LY+        +D 
Sbjct  233   ITFSLLNPDPRSHDVHWDIEGAIRRFVKPMLEKLSPVAEFSVDSQILYYAALGVTPRFDP  292

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  S+  LP  +N  E  L +S  A     VL+F++Y+P +   PL +   +G   
Sbjct  293   ASSSYRLSVHSLPHVINPVEARLGSS--AASLYPVLNFLLYIPEDLHSPLYIQGKDGSAV  350

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N    + N    P R  ++   +  V EVF+ QLR LFG++   
Sbjct  351   PTNAFHSPRWGGIMIYNVGPDTANETSFPKRVDVN---MVAVMEVFLAQLRLLFGVSQTP  407

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L  GA   +       G   WELD +    T  N+    TTL SL++L+  +  ++I D+
Sbjct  408   LPEGALLAN---PGNAGLCDWELDRLLWARTVENVATVSTTLTSLAQLLGKIGNIVIKDD  464

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++++A+ +L     G  + + ++S+ A + +E AF+HPS++ + Y+  +  FA
Sbjct  465   VASEVFHAVESAQGALQELEAGQLEAAFLASKAAVTSSERAFFHPSLLHLLYFPDDQKFA  524

Query  665   VYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             +Y P FLP+A+ ++L+   +LRE +  K+E  K
Sbjct  525   IYIPLFLPMAVPILLSMAKILRESRAAKKEAGK  557



>emb|CEI98339.1| hypothetical protein RMCBS344292_12448 [Rhizopus microsporus]
Length=343

 Score =   180 bits (456),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 183/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  12    ITVSLLNNNPENMRMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  71

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  72    RIGKPSYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEEAPLRIHDTKG  128

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +L  TN F+ P WGG+V+ NPP  + ++      +K++  +L+ + + F+ QLR L G+ 
Sbjct  129   QLLLTNSFLIPRWGGIVIKNPPRSAVDN------YKLTRTDLQPIMKTFLSQLRGLIGVK  182

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  183   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  237

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++ G+   S +A  LAE AF+ P+M
Sbjct  238   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMGALKHSIEAIELAEKAFFDPTM  294

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  295   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  325



>ref|XP_005526004.1| PREDICTED: GPI transamidase component PIG-S [Pseudopodoces humilis]
Length=556

 Score =   184 bits (468),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 187/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  230   ITFSLLNPDPKSHTVDWDIEGAVNRYVKPVLNKLSLVANFSVDSQILYYAVLGVTPRYDK  289

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  290   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPEHSHSPLYIQDKDGAPV  347

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  348   STNAFHSPRWGGIMVYNVEAPDSPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSQEE  404

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  405   V-----PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  459

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+  G+  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  460   DDVASEVYRAVASVQSAVTELSLGHLHGAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  519

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE +  K+E  K
Sbjct  520   FAIYIPLFLPMAVPILLSLAKIVRETRLRKKEPTK  554



>gb|KFR13682.1| GPI transamidase component PIG-S, partial [Opisthocomus hoazin]
Length=441

 Score =   182 bits (461),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 188/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D+
Sbjct  115   ITFSLLNPDPKSHAVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDK  174

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  175   ESSSFLLSTHSLPHVINPVEARLGSS--AASLHPVLNFLLYVPEHSHSPLYIQDKDGAPV  232

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  233   STNAFHSPRWGGIMIYNVEAPASPQVSLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  289

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  290   L-----PPEFLLESPGNEGLADWELDRLLWAHTMENIATVSTTLTSLAQLLDKIGNIVIK  344

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  345   DDVASEVYRAVASAQSAMAELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  404

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P +LP+++ ++L+   ++RE ++ K+E  K
Sbjct  405   FAIYIPLYLPMSVPILLSLAKIVRETRQRKKEPTK  439



>emb|CEI98251.1| hypothetical protein RMCBS344292_12366 [Rhizopus microsporus]
Length=342

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/331 (33%), Positives = 182/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  12    ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  71

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  72    RIGKPNYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  128

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  + +S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  129   QPLLTNSFLIPRWGGIVIKNPPRSAVDS------YKLTRTDLQPIMKTFLSQLRGLIGVK  182

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  183   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  237

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++ G+   S +A  LAE AF+ P+M
Sbjct  238   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMGALRHSIEAIELAEKAFFDPTM  294

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  295   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  325



>gb|KFW11937.1| GPI transamidase component PIG-S, partial [Fulmarus glacialis]
Length=493

 Score =   181 bits (460),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 187/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LL  DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  167   ITFSLLTPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  226

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  227   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  284

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  +   +    PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  285   STNAFHSPRWGGIMVYNVEAPVSSQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  341

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  342   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENVATVSTTLTSLAQLLDKIGNIVIK  396

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  397   DDVASEVYRAVASAQSAMAKLATGHLYSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  456

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  457   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  491



>ref|XP_009583865.1| PREDICTED: GPI transamidase component PIG-S, partial [Fulmarus 
glacialis]
Length=495

 Score =   181 bits (460),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 187/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LL  DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  169   ITFSLLTPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  228

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  229   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  286

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  +   +    PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  287   STNAFHSPRWGGIMVYNVEAPVSSQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  343

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  344   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENVATVSTTLTSLAQLLDKIGNIVIK  398

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  399   DDVASEVYRAVASAQSAMAKLATGHLYSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  458

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  459   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  493



>ref|XP_009092990.1| PREDICTED: GPI transamidase component PIG-S [Serinus canaria]
Length=547

 Score =   182 bits (462),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 187/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  221   ITFSLLNPDPKSHTVDWDIEGAVNCFVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  280

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  281   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  338

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  339   STNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  395

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +       + LL +   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  396   V-----PPTFLLENPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  450

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  451   DDVASEVYRAVASVQSAVTELSLGHLLAAFQASKEAVTCSERAFFDPSLLHLLYFPDDQK  510

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE +  K+E  K
Sbjct  511   FAIYIPLFLPMAVPILLSLAKIVRETRLRKKEPTK  545



>ref|XP_010571939.1| PREDICTED: GPI transamidase component PIG-S [Haliaeetus leucocephalus]
Length=553

 Score =   182 bits (462),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 188/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  227   ITFSLLNPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  286

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  287   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  344

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  345   STNAFHSPRWGGIMVYNVEAPASPQVSLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  401

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  402   L-----PPDFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  456

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  457   DDVASEVYQAVASAQSAMAELAAGHLHLAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  516

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  517   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  551



>ref|XP_005056850.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Ficedula 
albicollis]
Length=559

 Score =   181 bits (458),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 185/335 (55%), Gaps = 16/335 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  233   ITFSLLNPDPKSHTVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  292

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  293   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  350

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  351   STNAFHSPRWGGIMVYNVEVPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  407

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  408   V-----PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  462

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  463   DDVASEVYQAVASVQSAVTKLSLGHLQAAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  522

Query  671   FAVYSPFFLPVALHVILA---VLREWK-RCKQENK  579
             FA+Y P FLP+A+ ++L+   ++RE + R K+  K
Sbjct  523   FAIYIPLFLPMAVPILLSLAKIVRETRLRTKEPTK  557



>ref|XP_005056851.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Ficedula 
albicollis]
Length=553

 Score =   180 bits (457),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 185/335 (55%), Gaps = 16/335 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  227   ITFSLLNPDPKSHTVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  286

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  287   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  344

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  345   STNAFHSPRWGGIMVYNVEVPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  401

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  402   V-----PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  456

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  457   DDVASEVYQAVASVQSAVTKLSLGHLQAAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  516

Query  671   FAVYSPFFLPVALHVILA---VLREWK-RCKQENK  579
             FA+Y P FLP+A+ ++L+   ++RE + R K+  K
Sbjct  517   FAIYIPLFLPMAVPILLSLAKIVRETRLRTKEPTK  551



>gb|KFW86448.1| GPI transamidase component PIG-S, partial [Manacus vitellinus]
Length=435

 Score =   177 bits (449),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 181/330 (55%), Gaps = 15/330 (5%)
 Frame = -3

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             LN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S+
Sbjct  114   LNPDPKSHAVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDKESSSF  173

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             + S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F
Sbjct  174   LLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIHDKDGAPVSTNAF  231

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + L    
Sbjct  232   HSPRWGGIMVYNVEAPGSPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREEL----  284

Query  1010  TATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  
Sbjct  285   -PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVAS  343

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             +V  ++ + +++++  ++G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y 
Sbjct  344   EVYRAVASVQTAVAKLAVGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYI  403

Query  656   PFFLPVALHVILA---VLREWKRCKQENKK  576
             P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  404   PLFLPMAVPILLSLAKIVRETRQRKKEPTK  433



>gb|EOB08427.1| GPI transamidase component PIG-S, partial [Anas platyrhynchos]
Length=443

 Score =   177 bits (449),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/333 (30%), Positives = 182/333 (55%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +      + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  117   ITFSLLNPDPKSHDVDWDIEGAVGRYVQPVLDKLSVVANFSVDSQILYYAVLGVTPRFDK  176

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  177   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPV  234

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFG++ + 
Sbjct  235   PTNAFHSPRWGGIMIYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGISREE  291

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L       S      +G   WELD +   HT  N+    TTL SL++L+  +  ++I D+
Sbjct  292   LPPEFQVES---PGNEGLADWELDRLLWAHTVENIATVATTLTSLAQLLDQISNIVIKDD  348

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ + + +++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  349   VASEVYRAVASVQDAMAELAEGRLRSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFA  408

Query  665   VYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             +Y P FLP+A+ ++L+   +LRE ++ K+E  K
Sbjct  409   IYIPLFLPMAVPILLSLAKILREARQRKKEPSK  441



>gb|KFQ97046.1| GPI transamidase component PIG-S, partial [Nipponia nippon]
Length=493

 Score =   178 bits (452),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 186/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+ LN DP      WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  167   ITFSPLNPDPKSHAVHWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  226

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  227   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  284

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  285   STNAFHSPRWGGIMLYNVEAPASPQASLPLHVYV---DMVRVMEVFLAQLRLLFGLSREE  341

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  342   L-----PPEILLESPGNEGLADWELDRLLWAHTVENIATVSTTLNSLAQLLDKIGNIVIK  396

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  397   DDVASEVYRAVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  456

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  457   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  491



>ref|XP_007444162.1| PREDICTED: GPI transamidase component PIG-S [Python bivittatus]
Length=552

 Score =   179 bits (455),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/330 (32%), Positives = 180/330 (55%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P+++ L P+A+ SV+SQ+LY+        +D 
Sbjct  226   ITFSLLNPDPKAHDVHWDIEGALERYVKPLLEKLSPVAEFSVDSQILYYAALGVTPRFDA  285

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  S++ LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  286   GSSSYTLSVQSLPHVINPVEARLGSS--ASSLYPVLNFLLYVPERLHSPLYIRGKDGAAV  343

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P R  I   ++ +V +VF+ QLR LFG++S  
Sbjct  344   PTNAFHSPRWGGIMVYNVEPEAANETSLPRRVDI---DMVRVMKVFLAQLRLLFGISSGP  400

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                GA   S      +G   WELD +    T  N+    TTL SL++L+  +  ++I D+
Sbjct  401   APEGALMES---PGNEGLADWELDGLLWARTVENVATVSTTLTSLAQLLDKIGNIVIKDD  457

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++++A+ +++  S G+   +  +S+ A + +E AF+ PS++ + Y+  +  FA
Sbjct  458   VALEVCRAVESAQQAMAELSQGHLGPAFQASKAAATSSERAFFDPSLLHLLYFPDDQKFA  517

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ +     KQ  K+
Sbjct  518   IYIPLFLPMAVPILLSLAKMLWEKKQRQKE  547



>ref|XP_009936570.1| PREDICTED: GPI transamidase component PIG-S-like [Opisthocomus 
hoazin]
Length=731

 Score =   181 bits (460),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 189/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D+
Sbjct  405   ITFSLLNPDPKSHAVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDK  464

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  465   ESSSFLLSTHSLPHVINPVEARLGSSAAS--LHPVLNFLLYVPEHSHSPLYIQDKDGAPV  522

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  523   STNAFHSPRWGGIMIYNVEAPASPQVSLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  579

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  580   L-----PPEFLLESPGNEGLADWELDRLLWAHTMENIATVSTTLTSLAQLLDKIGNIVIK  634

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  635   DDVASEVYRAVASAQSAMAELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  694

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P +LP+++ ++L+   ++RE ++ K+E  K
Sbjct  695   FAIYIPLYLPMSVPILLSLAKIVRETRQRKKEPTK  729



>gb|KFP82666.1| GPI transamidase component PIG-S, partial [Acanthisitta chloris]
Length=472

 Score =   177 bits (450),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 179/320 (56%), Gaps = 15/320 (5%)
 Frame = -3

Query  1520  DWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFF  1341
             DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S   LP  
Sbjct  161   DWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDKESSSFLLSAHSLPHV  220

Query  1340  VNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVV  1161
             +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP WGG++V
Sbjct  221   INPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGTPVSTNAFHSPRWGGIMV  278

Query  1160  WNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTS-  984
             +N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + +         LL S 
Sbjct  279   YNVETPASTQTSLPLHVDV---DMARVMEVFLAQLRLLFGLSREEV-----PPEFLLESP  330

Query  983   -EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAK  807
               +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ + +
Sbjct  331   GNEGMADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVSSVQ  390

Query  806   SSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV  627
             S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ +
Sbjct  391   SAIAKLSMGHLHAAFQASKEAVTCSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPI  450

Query  626   ILA---VLREWKRCKQENKK  576
             +L+   ++RE ++CK+E  K
Sbjct  451   LLSLVKIVRETRQCKKEPIK  470



>emb|CEG75172.1| hypothetical protein RMATCC62417_10263 [Rhizopus microsporus]
Length=385

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 181/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  55    ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  114

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  115   RIGKPNYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  171

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  + +S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  172   QPLLTNSFLIPRWGGIVIKNPPRSAVDS------YKLTRADLQPIMKTFLSQLRGLIGVK  225

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  226   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  280

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++  +   S +A  LAE AF+ P+M
Sbjct  281   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMDALRHSIEAIELAEKAFFDPTM  337

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  338   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  368



>gb|KFO07645.1| GPI transamidase component PIG-S, partial [Balearica regulorum 
gibbericeps]
Length=465

 Score =   177 bits (449),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/329 (32%), Positives = 182/329 (55%), Gaps = 15/329 (5%)
 Frame = -3

Query  1547  NADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYI  1368
             +ADP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S+I
Sbjct  145   SADPKSHDVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKETSSFI  204

Query  1367  FSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFI  1188
              S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F 
Sbjct  205   LSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFH  262

Query  1187  SPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGAT  1008
             SP WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + L     
Sbjct  263   SPRWGGIMVYNVEAPGSPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----  314

Query  1007  ATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQ  834
                 LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +
Sbjct  315   PPDFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASE  374

Query  833   VKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSP  654
             V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P
Sbjct  375   VYRAVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIP  434

Query  653   FFLPVALHVILA---VLREWKRCKQENKK  576
              FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  435   LFLPMAVPILLSLAKIVREARQRKKEPTK  463



>ref|XP_005240581.1| PREDICTED: GPI transamidase component PIG-S [Falco peregrinus]
Length=474

 Score =   177 bits (449),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/332 (32%), Positives = 186/332 (56%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LL+ DP     DWD ++  D  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  148   ITFSLLSPDPKSHAVDWDIEDAVDRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  207

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A   + VL+F++YVP     PL +   +G   
Sbjct  208   ESSSFLLSAHSLPHVINPVEARLGSS--AASLNPVLNFLLYVPERSHSPLYIQDKDGAPV  265

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG+VV+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  266   STNAFHSPRWGGIVVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  322

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  323   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  377

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ AA+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  378   DDVASEVYRAVAAAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  437

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  438   FAIYIPLFLPMAVPILLSLAKIVREARQRQKE  469



>emb|CEG81534.1| hypothetical protein RMATCC62417_15725 [Rhizopus microsporus]
Length=523

 Score =   178 bits (451),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 181/323 (56%), Gaps = 14/323 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  193   ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  252

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  253   RTGKPSYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  309

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  +  S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  310   QPLLTNSFLIPRWGGIVIKNPPRSAVGS------YKLTRTDLQPIMKTFLSQLRGLIGVK  363

Query  1034  S-DSLYVGATATSRLLTSEK-GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
               D+L    +   +   +++ G T  E D + R  T  N+    +TL SL +LV  +P M
Sbjct  364   DLDALGKSISFPVKFEAAKRTGITALEKDNLIRTRTLENVANTISTLKSLGQLVDEIPNM  423

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
             ++ D I  +V+ SL+   +   +    ++ G+   S +A  LAE AF+ P+M+S+ Y+  
Sbjct  424   VVQDHISSKVQQSLNCLNAVRQSLEHEDFMGALRHSIEAIELAEKAFFDPTMVSMLYFPD  483

Query  680   EHCFAVYSPFFLPVALHVILAVL  612
             EH +A+Y P F+P ++ +I A++
Sbjct  484   EHKYAIYMPLFVPTSVPLISALI  506



>ref|XP_008167230.1| PREDICTED: GPI transamidase component PIG-S [Chrysemys picta 
bellii]
Length=452

 Score =   176 bits (446),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 182/335 (54%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  +A+ SV+SQ+LY+        +D+
Sbjct  126   ITFSLLNPDPKSHDVHWDIEAAVNSYVQPFLDKLGSVANFSVDSQILYYAVLGVSPRFDK  185

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S+I S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  186   ASSSFILSALSLPHVINPVEARLGSS--ATSLYPVLNFLLYVPERVHSPLYIQDKDGAAV  243

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + +    PLR  +   ++ +V EVF+ QLR LFG++   
Sbjct  244   GTNAFHSPRWGGIMVYNIDHPAPDKAPLPLRVDV---DMVRVMEVFLAQLRLLFGISQVP  300

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   KG T WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  301   L-----PEEFLLESPGNKGLTDWELDRLLWTRTVENIATVSTTLTSLAQLLDKIGNIVIK  355

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A++++   + G    +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  356   DDVASEVYHAVASAQTAMLELASGRLGSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  415

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   +LRE K+ K+E  K
Sbjct  416   FAIYIPLFLPMAVPILLSLVKILREAKQSKKEPMK  450



>emb|CEG81533.1| hypothetical protein RMATCC62417_15725 [Rhizopus microsporus]
Length=540

 Score =   177 bits (450),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 181/323 (56%), Gaps = 14/323 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  210   ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  269

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  270   RTGKPSYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  326

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  +  S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  327   QPLLTNSFLIPRWGGIVIKNPPRSAVGS------YKLTRTDLQPIMKTFLSQLRGLIGVK  380

Query  1034  S-DSLYVGATATSRLLTSEK-GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
               D+L    +   +   +++ G T  E D + R  T  N+    +TL SL +LV  +P M
Sbjct  381   DLDALGKSISFPVKFEAAKRTGITALEKDNLIRTRTLENVANTISTLKSLGQLVDEIPNM  440

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
             ++ D I  +V+ SL+   +   +    ++ G+   S +A  LAE AF+ P+M+S+ Y+  
Sbjct  441   VVQDHISSKVQQSLNCLNAVRQSLEHEDFMGALRHSIEAIELAEKAFFDPTMVSMLYFPD  500

Query  680   EHCFAVYSPFFLPVALHVILAVL  612
             EH +A+Y P F+P ++ +I A++
Sbjct  501   EHKYAIYMPLFVPTSVPLISALI  523



>gb|KGL93425.1| GPI transamidase component PIG-S, partial [Charadrius vociferus]
Length=489

 Score =   176 bits (447),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 184/335 (55%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             L  ++LN DP     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  163   LGTDVLNPDPKSHAVEWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  222

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  223   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGASV  280

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  281   NTNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  337

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  338   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  392

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+ +++  + G+   +  +S+ A + +E AF+ PS++ + Y+  +  
Sbjct  393   DDVASEVYRAVASAQKAMAELAAGHLHSAFQASKDAVTSSERAFFDPSLLHLLYFPDDQK  452

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  453   FAIYIPLFLPMAVPILLSLAKIVREARQRKKEPTK  487



>ref|XP_009901702.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S 
[Picoides pubescens]
Length=555

 Score =   177 bits (450),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 103/336 (31%), Positives = 184/336 (55%), Gaps = 17/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+L N  P     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  229   ITFSLPNPXPKSHTVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++     LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ESSSFLLGAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHTPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +   +  PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  347   STNAFHSPRWGGIMVYNVETPASPQDSLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  403

Query  1025  LYVGATATSRLLTSEKG---FTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMII  855
             L       + LL    G      WELD +   HT  N+    TTL SL++L+  +  ++I
Sbjct  404   L------PAELLMESPGNEVLADWELDRLLWAHTIENIATVSTTLTSLAQLLDKIGNIVI  457

Query  854   MDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH  675
              D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  + 
Sbjct  458   KDDVASEVYRAVASAQSAMAKLAAGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQ  517

Query  674   CFAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
              FA+Y P FLPVA+ ++L+   ++RE  + K+E  K
Sbjct  518   KFAIYIPLFLPVAVPILLSLAKIVRETMQHKKEPSK  553



>gb|KFQ34302.1| GPI transamidase component PIG-S, partial [Mesitornis unicolor]
Length=493

 Score =   176 bits (446),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/332 (30%), Positives = 185/332 (56%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+ LN +P     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  167   ITFSPLNPEPKSHAVNWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  226

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  227   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  284

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  285   STNAFHSPRWGGIMIYNVEAPASTPASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  341

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L      +  LL +   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  342   L-----PSDFLLETPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  396

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  397   DDVASEVYQAVASAQSAMAELAAGHLYSAFQASKKAVTSSERAFFDPSLLHLLYFPDDQK  456

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  457   FAIYIPLFLPMAVPILLSLAKIAREARQRKKE  488



>ref|XP_010310364.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Balearica regulorum gibbericeps]
Length=486

 Score =   176 bits (445),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 180/327 (55%), Gaps = 15/327 (5%)
 Frame = -3

Query  1541  DPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFS  1362
             DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S+I S
Sbjct  168   DPKSHDVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKETSSFILS  227

Query  1361  IKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISP  1182
                LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP
Sbjct  228   AHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSP  285

Query  1181  MWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
              WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + L       
Sbjct  286   RWGGIMVYNVEAPGSPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PP  337

Query  1001  SRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK  828
               LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V 
Sbjct  338   DFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVY  397

Query  827   FSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFF  648
              ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P F
Sbjct  398   RAVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLF  457

Query  647   LPVALHVILA---VLREWKRCKQENKK  576
             LP+A+ ++L+   ++RE ++ K+E  K
Sbjct  458   LPMAVPILLSLAKIVREARQRKKEPTK  484



>ref|XP_005009955.1| PREDICTED: GPI transamidase component PIG-S [Anas platyrhynchos]
Length=519

 Score =   176 bits (447),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/333 (30%), Positives = 182/333 (55%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +      + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  193   ITFSLLNPDPKSHDVDWDIEGAVGRYVQPVLDKLSVVANFSVDSQILYYAVLGVTPRFDK  252

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  253   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPV  310

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFG++ + 
Sbjct  311   PTNAFHSPRWGGIMIYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGISREE  367

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L       S      +G   WELD +   HT  N+    TTL SL++L+  +  ++I D+
Sbjct  368   LPPEFQVES---PGNEGLADWELDRLLWAHTVENIATVATTLTSLAQLLDQISNIVIKDD  424

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ + + +++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  425   VASEVYRAVASVQDAMAELAEGRLRSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFA  484

Query  665   VYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             +Y P FLP+A+ ++L+   +LRE ++ K+E  K
Sbjct  485   IYIPLFLPMAVPILLSLAKILREARQRKKEPSK  517



>ref|XP_010720178.1| PREDICTED: GPI transamidase component PIG-S, partial [Meleagris 
gallopavo]
Length=461

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/333 (32%), Positives = 183/333 (55%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +      + PI+  L  +A+ SV+SQ+LY+        +D+
Sbjct  135   ITFSLLNPDPKSHDVDWDIEGAVKRYVQPILDKLNLVANFSVDSQILYYAVLGVTPRFDK  194

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S+I S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  195   ESSSFILSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGTPV  252

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N    + +    PLR  +   ++ +V EVF+ QLR LFG++ + 
Sbjct  253   ATNAFHSPRWGGIMIYNVEVPASSQTSLPLRVDV---DMLRVMEVFLAQLRLLFGISQEE  309

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L       S      +G   WELD +   HT  N+    TTL SL++L+  +  ++I D+
Sbjct  310   LPPEFLVES---PGNEGLADWELDRLLWAHTLENIATVSTTLTSLAQLLDQISNIVIKDD  366

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ AA+ +++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  367   VASEVYRAVAAAQDAVAELAEGRLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFA  426

Query  665   VYSPFFLPVALHVILAV---LREWKRCKQENKK  576
             +Y P FLP+A+ ++L++   LRE ++ K+E  K
Sbjct  427   IYIPLFLPMAVPILLSLAKMLREARQNKKEPTK  459



>ref|XP_010181345.1| PREDICTED: GPI transamidase component PIG-S, partial [Mesitornis 
unicolor]
Length=496

 Score =   176 bits (445),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/332 (30%), Positives = 185/332 (56%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+ LN +P     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  170   ITFSPLNPEPKSHAVNWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  229

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  230   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  287

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  288   STNAFHSPRWGGIMIYNVEAPASTPASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  344

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L      +  LL +   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  345   L-----PSDFLLETPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  399

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  400   DDVASEVYQAVASAQSAMAELAAGHLYSAFQASKKAVTSSERAFFDPSLLHLLYFPDDQK  459

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  460   FAIYIPLFLPMAVPILLSLAKIAREARQRKKE  491



>ref|XP_005493745.1| PREDICTED: uncharacterized protein LOC102069598 [Zonotrichia 
albicollis]
Length=974

 Score =   181 bits (458),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 187/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  648   ITFSLLNPDPKSHTVDWDIEGAVNRFVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  707

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  708   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPV  765

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      P+   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  766   STNAFHSPRWGGIMVYNVEAPASPQASLPVHVDV---DMARVMEVFLAQLRLLFGLSREE  822

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  823   V-----PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  877

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  878   DDVASEVYQAVASVQSAVTELSLGHLLAAFQASKEAVTCSERAFFDPSLLHLLYFPDDQK  937

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE +  K+E  K
Sbjct  938   FAIYIPLFLPMAVPILLSLAKIVRETRLRKKEPTK  972



>gb|KFV08773.1| GPI transamidase component PIG-S, partial [Tauraco erythrolophus]
Length=475

 Score =   174 bits (442),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/330 (31%), Positives = 181/330 (55%), Gaps = 15/330 (5%)
 Frame = -3

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             L  DP     DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D++  S+
Sbjct  154   LGRDPKSHAVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDKETSSF  213

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             + S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F
Sbjct  214   LLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGTPVSTNAF  271

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L    
Sbjct  272   HSPRWGGIMIYNVEAPASPQASFPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL----  324

Query  1010  TATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  
Sbjct  325   -PPEFLLESPGNEGLADWELDRLLWAHTLENIATVSTTLTSLAQLLDKIGNIVIKDDVAS  383

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             +V  ++ +A+S++   + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y 
Sbjct  384   EVYRAVASAQSAMVELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYI  443

Query  656   PFFLPVALHVILA---VLREWKRCKQENKK  576
             P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  444   PLFLPMAVPILLSLAKIVREARQRKKEPTK  473



>ref|XP_415817.4| PREDICTED: GPI transamidase component PIG-S [Gallus gallus]
Length=514

 Score =   175 bits (444),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/333 (32%), Positives = 183/333 (55%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + PI+  L  +A+ SV+SQ+LY+        +D+
Sbjct  188   ITFSLLNPDPKSHDVDWDIEGAVNHYVQPILDKLNLVANFSVDSQILYYAVLGVTPRFDK  247

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S+I S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  248   ESSSFILSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPV  305

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N    +      PLR  +   ++ +V EVF+ QLR LFG++ + 
Sbjct  306   TTNAFHSPRWGGIMIYNVEVPASPQTSLPLRVDV---DMVRVMEVFLAQLRLLFGISREE  362

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L       S      +G   WELD +   HT  N+    TTL SL++L+  +  ++I D+
Sbjct  363   LPPEFLVES---PGNEGLADWELDHLLWAHTLENIATVSTTLTSLAQLLDQISNIVIKDD  419

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  420   VASEVYRAVAAVQDAVAELAEGRLRSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFA  479

Query  665   VYSPFFLPVALHVILAV---LREWKRCKQENKK  576
             +Y P FLP+A+ ++L++   LRE ++ K+E  K
Sbjct  480   IYIPLFLPMAVPILLSLAKMLREARQSKKEPTK  512



>ref|XP_009883540.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S 
[Charadrius vociferus]
Length=508

 Score =   175 bits (443),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 182/330 (55%), Gaps = 15/330 (5%)
 Frame = -3

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             LN DP     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S+
Sbjct  187   LNPDPKSHAVEWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSF  246

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             + S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G    TN F
Sbjct  247   LLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGASVNTNAF  304

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L    
Sbjct  305   HSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL----  357

Query  1010  TATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  
Sbjct  358   -PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVAS  416

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             +V  ++ +A+ +++  + G+   +  +S+ A + +E AF+ PS++ + Y+  +  FA+Y 
Sbjct  417   EVYRAVASAQKAMAELAAGHLHSAFQASKDAVTSSERAFFDPSLLHLLYFPDDQKFAIYI  476

Query  656   PFFLPVALHVILA---VLREWKRCKQENKK  576
             P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  477   PLFLPMAVPILLSLAKIVREARQRKKEPTK  506



>gb|KFV56129.1| GPI transamidase component PIG-S, partial [Tyto alba]
Length=320

 Score =   170 bits (431),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 183/326 (56%), Gaps = 17/326 (5%)
 Frame = -3

Query  1538  PHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSI  1359
             PHD   D D +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S 
Sbjct  5     PHD--VDGDSEGAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSA  62

Query  1358  KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPM  1179
               LP  +N  E  L +STA+     VL+F++YVP     PL +   +G    TN F SP 
Sbjct  63    HSLPHVINPVEARLGSSTAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPR  120

Query  1178  WGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATS  999
             WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ ++L        
Sbjct  121   WGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSRENL-----PPE  172

Query  998   RLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKF  825
              LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  
Sbjct  173   FLLESPGSEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYQ  232

Query  824   SLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFL  645
             ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FL
Sbjct  233   AVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFL  292

Query  644   PVALHVILA---VLREWKRCKQENKK  576
             P+A+ ++L+   ++RE ++ K+E  K
Sbjct  293   PMAVPILLSLAKIVRETRQRKKEPTK  318



>ref|XP_009976073.1| PREDICTED: GPI transamidase component PIG-S, partial [Tauraco 
erythrolophus]
Length=485

 Score =   174 bits (440),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 180/327 (55%), Gaps = 15/327 (5%)
 Frame = -3

Query  1541  DPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFS  1362
             DP     DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D++  S++ S
Sbjct  167   DPKSHAVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDKETSSFLLS  226

Query  1361  IKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISP  1182
                LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP
Sbjct  227   AHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGTPVSTNAFHSP  284

Query  1181  MWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
              WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L       
Sbjct  285   RWGGIMIYNVEAPASPQASFPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PP  336

Query  1001  SRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK  828
               LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V 
Sbjct  337   EFLLESPGNEGLADWELDRLLWAHTLENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVY  396

Query  827   FSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFF  648
              ++ +A+S++   + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P F
Sbjct  397   RAVASAQSAMVELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLF  456

Query  647   LPVALHVILA---VLREWKRCKQENKK  576
             LP+A+ ++L+   ++RE ++ K+E  K
Sbjct  457   LPMAVPILLSLAKIVREARQRKKEPTK  483



>emb|CEG75171.1| hypothetical protein RMATCC62417_10263 [Rhizopus microsporus]
Length=523

 Score =   174 bits (441),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 181/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  193   ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  252

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  253   RIGKPNYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  309

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  + +S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  310   QPLLTNSFLIPRWGGIVIKNPPRSAVDS------YKLTRADLQPIMKTFLSQLRGLIGVK  363

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  364   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  418

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++  +   S +A  LAE AF+ P+M
Sbjct  419   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMDALRHSIEAIELAEKAFFDPTM  475

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  476   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  506



>gb|KFP21197.1| GPI transamidase component PIG-S, partial [Egretta garzetta]
Length=458

 Score =   173 bits (438),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 181/326 (56%), Gaps = 17/326 (5%)
 Frame = -3

Query  1538  PHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSI  1359
             PH    DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D++  S++ S 
Sbjct  143   PH--AVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSA  200

Query  1358  KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPM  1179
               LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP 
Sbjct  201   HSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPR  258

Query  1178  WGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATS  999
             WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L        
Sbjct  259   WGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PPE  310

Query  998   RLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKF  825
              LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  
Sbjct  311   FLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYQ  370

Query  824   SLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFL  645
             ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FL
Sbjct  371   AVASAQSAMAKLATGHLLSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFL  430

Query  644   PVALHVILA---VLREWKRCKQENKK  576
             P+A+ ++L+   ++RE ++ K+E  K
Sbjct  431   PMAVPILLSLAKIVREARQHKKEPTK  456



>ref|XP_008928818.1| PREDICTED: GPI transamidase component PIG-S-like [Manacus vitellinus]
Length=776

 Score =   177 bits (448),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 182/330 (55%), Gaps = 15/330 (5%)
 Frame = -3

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             LN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S+
Sbjct  455   LNPDPKSHAVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDKESSSF  514

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             + S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G    TN F
Sbjct  515   LLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIHDKDGAPVSTNAF  572

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + L    
Sbjct  573   HSPRWGGIMVYNVEAPGSPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREEL----  625

Query  1010  TATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  
Sbjct  626   -PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVAS  684

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYS  657
             +V  ++ + +++++  ++G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y 
Sbjct  685   EVYRAVASVQTAVAKLAVGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYI  744

Query  656   PFFLPVALHVILA---VLREWKRCKQENKK  576
             P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  745   PLFLPMAVPILLSLAKIVRETRQRKKEPTK  774



>ref|XP_009969001.1| PREDICTED: GPI transamidase component PIG-S, partial [Tyto alba]
Length=352

 Score =   170 bits (430),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 183/326 (56%), Gaps = 17/326 (5%)
 Frame = -3

Query  1538  PHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSI  1359
             PHD   D D +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S 
Sbjct  37    PHD--VDGDSEGAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSA  94

Query  1358  KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPM  1179
               LP  +N  E  L +STA+     VL+F++YVP     PL +   +G    TN F SP 
Sbjct  95    HSLPHVINPVEARLGSSTAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPR  152

Query  1178  WGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATS  999
             WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ ++L        
Sbjct  153   WGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSRENL-----PPE  204

Query  998   RLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKF  825
              LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  
Sbjct  205   FLLESPGSEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYQ  264

Query  824   SLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFL  645
             ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FL
Sbjct  265   AVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFL  324

Query  644   PVALHVILA---VLREWKRCKQENKK  576
             P+A+ ++L+   ++RE ++ K+E  K
Sbjct  325   PMAVPILLSLAKIVRETRQRKKEPTK  350



>ref|XP_002194822.1| PREDICTED: sperm-associated antigen 5 [Taeniopygia guttata]
Length=1148

 Score =   178 bits (452),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 186/335 (56%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  822   ITFSLLNPDPKSHTVDWDIEGAVNRFVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  881

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  882   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  939

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  940   STNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSWEE  996

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  997   V-----PPEFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  1051

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  1052  DDVASEVYRAVASVQSAVTELSLGHLLAAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  1111

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE +  K+E  K
Sbjct  1112  FAIYIPLFLPMAVPILLSLAKIVRETRLRKKEPTK  1146



>emb|CEG75170.1| hypothetical protein RMATCC62417_10263 [Rhizopus microsporus]
Length=545

 Score =   174 bits (440),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 181/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  215   ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  274

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  275   RIGKPNYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  331

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  + +S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  332   QPLLTNSFLIPRWGGIVIKNPPRSAVDS------YKLTRADLQPIMKTFLSQLRGLIGVK  385

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  386   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  440

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++  +   S +A  LAE AF+ P+M
Sbjct  441   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMDALRHSIEAIELAEKAFFDPTM  497

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  498   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  528



>ref|XP_005154498.1| PREDICTED: GPI transamidase component PIG-S [Melopsittacus undulatus]
Length=717

 Score =   176 bits (445),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 184/335 (55%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      W  ++     + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  391   ITFSLLNPDPKSHDVHWAIEDAVTRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  450

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S++ S   LP  +N  E  L +S A+     VL+F++Y+P     PL +   +G   
Sbjct  451   VSSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYIPERSHSPLYIQDKDGAPV  508

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  509   STNAFHSPRWGGIMVYNVEAPASPQTSFPLHVDV---DMARVMEVFLAQLRLLFGLSREE  565

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  566   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  620

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S++   + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  621   DDVASEVYRAVASAQSAMDKLAAGHLHSAFQASKEAATSSERAFFDPSLLHLLYFPDDQK  680

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   ++RE ++ K+E  K
Sbjct  681   FAIYIPLFLPMAVPILLSLAKIIRETRQKKKEPTK  715



>gb|KFV69518.1| GPI transamidase component PIG-S, partial [Picoides pubescens]
Length=482

 Score =   172 bits (437),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/344 (31%), Positives = 186/344 (54%), Gaps = 20/344 (6%)
 Frame = -3

Query  1589  VGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             +G D R  L  +L   D H    DWD ++  +  + P++  L  +A+ SV+SQ+LY+   
Sbjct  151   LGPDARRHLKSSL-GMDSH--TVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVL  207

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQL  1230
                  +D++  S++     LP  +N  E  L +S  A     VL+F++YVP     PL +
Sbjct  208   GVTPRFDKESSSFLLGAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHTPLYI  265

Query  1229  LLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQ  1050
                +G    TN F SP WGG++V+N  + +   +  PL   +   ++ +V EVF+ QLR 
Sbjct  266   QDKDGAPVSTNAFHSPRWGGIMVYNVETPASPQDSLPLHVDV---DMVRVMEVFLAQLRL  322

Query  1049  LFGLNSDSLYVGATATSRLLTSEKG---FTQWELDFISRQHTCFNLLQCGTTLGSLSRLV  879
             LFGL+ + L       + LL    G      WELD +   HT  N+    TTL SL++L+
Sbjct  323   LFGLSREEL------PAELLMESPGNEVLADWELDRLLWAHTIENIATVSTTLTSLAQLL  376

Query  878   QSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMS  699
               +  ++I D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ 
Sbjct  377   DKIGNIVIKDDVASEVYRAVASAQSAMAKLAAGHLHSAFQASKEAVTSSERAFFDPSLLH  436

Query  698   VSYYSFEHCFAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             + Y+  +  FA+Y P FLPVA+ ++L+   ++RE  + K+E  K
Sbjct  437   LLYFPDDQKFAIYIPLFLPVAVPILLSLAKIVRETMQHKKEPSK  480



>gb|EMP37809.1| GPI transamidase component PIG-S [Chelonia mydas]
Length=483

 Score =   172 bits (436),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/335 (32%), Positives = 181/335 (54%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  +A+ SV+SQ+LY+        +D+
Sbjct  157   ITFSLLNPDPKSHNVHWDIEAAVNSYVQPFLDKLGSVANFSVDSQILYYAVLGVSPRFDK  216

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S+I S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  217   ASSSFILSALSLPHVINPVEARLGSS--ATSLYPVLNFLLYVPERVHSPLYIQDTDGAAV  274

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N      +    PL   +   ++ +V EVF+ QLR LFG++  S
Sbjct  275   GTNAFHSPRWGGIMVYNIDHPVADKAPLPLWVDV---DMVRVMEVFLAQLRLLFGISQVS  331

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S    G T WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  332   L-----PEEFLLESPGNDGLTDWELDRLLWTRTVENIATVSTTLTSLAQLLDKIGNIVIK  386

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A++++   + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  387   DDVASEVYHAVASAQTAMLELASGHLGSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  446

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   +LRE K+ K+E  K
Sbjct  447   FAIYIPLFLPMAVPILLSLVKILREAKQSKKEPTK  481



>emb|CEG75169.1| hypothetical protein RMATCC62417_10263 [Rhizopus microsporus]
Length=562

 Score =   174 bits (440),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 181/331 (55%), Gaps = 30/331 (9%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LLN +P +   DW+ +E  +  L P +Q +  +++ S+ SQ+  + P S    + E
Sbjct  232   ITVSLLNNNPENMKMDWEIREALNGYLNPFLQQISELSNFSINSQIQNYAPLSLKPKYKE  291

Query  1385  KQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             + G    Y F  + LP FVNS EW+L ++  +   S  ++F++Y+PS+EE PL++    G
Sbjct  292   RIGKPNYYYFEPQHLPHFVNSAEWNLASTVTS---SPNINFILYIPSQEETPLRIHDTKG  348

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             +   TN F+ P WGG+V+ NPP  + +S      +K++  +L+ + + F+ QLR L G+ 
Sbjct  349   QPLLTNSFLIPRWGGIVIKNPPRSAVDS------YKLTRADLQPIMKTFLSQLRGLIGVK  402

Query  1034  -------SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
                    S S  V   A  R      G T  E D + R  T  N+    +TL SL +LV 
Sbjct  403   DLDVLGKSISFPVEFEAAKR-----TGITALEKDNLIRTRTLENVANTISTLKSLGQLVD  457

Query  875   SLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSM  705
              +P M++ D I  +V+ SL   DA + SL +    ++  +   S +A  LAE AF+ P+M
Sbjct  458   EIPNMVVQDHISSKVQQSLNCLDAVRQSLEHE---DFMDALRHSIEAIELAEKAFFDPTM  514

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVL  612
             +S+ Y+  EH +A+Y P F+P ++ +I A++
Sbjct  515   VSMLYFPDEHKYAIYMPLFVPTSVPLISALI  545



>ref|XP_009643348.1| PREDICTED: GPI transamidase component PIG-S [Egretta garzetta]
Length=489

 Score =   172 bits (436),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 182/326 (56%), Gaps = 17/326 (5%)
 Frame = -3

Query  1538  PHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSI  1359
             PH    DWD ++  +  + PI+  L  +A+ SV+SQ+LY+        +D++  S++ S 
Sbjct  174   PH--AVDWDIEDAVNRYVQPILDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSA  231

Query  1358  KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPM  1179
               LP  +N  E  L +S A+     VL+F++YVP     PL +   +G    TN F SP 
Sbjct  232   HSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPR  289

Query  1178  WGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATS  999
             WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L        
Sbjct  290   WGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PPE  341

Query  998   RLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKF  825
              LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  
Sbjct  342   FLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYQ  401

Query  824   SLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFL  645
             ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FL
Sbjct  402   AVASAQSAMAKLATGHLLSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFL  461

Query  644   PVALHVILA---VLREWKRCKQENKK  576
             P+A+ ++L+   ++RE ++ K+E  K
Sbjct  462   PMAVPILLSLAKIVREARQHKKEPTK  487



>ref|XP_010291837.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Phaethon lepturus]
Length=493

 Score =   172 bits (436),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/355 (29%), Positives = 185/355 (52%), Gaps = 24/355 (7%)
 Frame = -3

Query  1592  PVGADGR--------VVLSFNLLNA--------DPHDWIYDWDFQELDDMLLAPIVQALR  1461
             P+G D R          ++F L+N         DP     +WD ++  +  + P++  L 
Sbjct  142   PLGPDTRRHLKSSLGYAITFTLMNPXXXXXXXPDPKSHAVNWDIEDAVNHYVQPVLDKLS  201

Query  1460  PIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKV  1281
              +A+ SV+SQ+LY+        +D++  S+  S   LP  +N  E  L +S  A     V
Sbjct  202   LVANFSVDSQILYYAVLGVTPRFDKESSSFFLSAHSLPHVINPVEARLGSS--AASLYPV  259

Query  1280  LHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKIS  1101
             L+F++YVP     PL +   +G    TN F SP WGG++V+N  + +      PL   + 
Sbjct  260   LNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV-  318

Query  1100  SEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNL  921
               ++ +V EVF+ QLR LFGL+ + L       S      +G   WELD +   HT  N+
Sbjct  319   --DMVRVMEVFLAQLRLLFGLSREELPPEFVLES---PGNEGLADWELDRLLWAHTVENI  373

Query  920   LQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQAR  741
                 TTL SL++L+  +  ++I D++  +V  ++ +A+ +++  + G+   +  +S++A 
Sbjct  374   ATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASAQRAMAKLATGHLHLAFQASKEAV  433

Query  740   SLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  434   TSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIAREARQRKKE  488



>ref|XP_006274286.1| PREDICTED: GPI transamidase component PIG-S [Alligator mississippiensis]
Length=551

 Score =   172 bits (437),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 178/335 (53%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P +  L  +A+ +V+SQ+LY+        +D 
Sbjct  225   ITFSLLNPDPKSHDVRWDIEAAVRGYVQPFLDKLSFVANFTVDSQILYYAMLGVTPRFDR  284

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G L 
Sbjct  285   NSSSFLLSAHSLPHVINPVEARLGSSAAS--LFPVLNFLLYVPERAHSPLYIQDRDGALV  342

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
             +TN F SP WGG++V+N    + +    PLR  +   ++ +V EVF+ QLR LFG++   
Sbjct  343   RTNAFHSPRWGGIMVYNVKHPAADEAPLPLRVDV---DMVRVMEVFLAQLRLLFGISRAP  399

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL +    G   WELD +    T  N+    TTL SL+ L+  +  ++I 
Sbjct  400   L-----PGEFLLENPGNAGLAAWELDRLLWARTVENVATVSTTLTSLAELLDKIGNIVIK  454

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + + +L   + G    +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  455   DDVASEVYRAVASVQQALEELAAGRLGAAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  514

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   +LRE +R K+E  K
Sbjct  515   FAIYIPLFLPMAVPLLLSLAKILREARRGKKEPTK  549



>ref|XP_009701857.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Cariama cristata]
Length=492

 Score =   171 bits (434),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 100/327 (31%), Positives = 182/327 (56%), Gaps = 14/327 (4%)
 Frame = -3

Query  1538  PHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSI  1359
             P +   DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S 
Sbjct  172   PGESPLDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLST  231

Query  1358  KDLPFFVNSNEWHL-DTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISP  1182
               LP  +N  E  L +  ++A     VL+F++YVP     PL +   +G    TN F SP
Sbjct  232   HSLPHVINPVEARLGEHCSSAASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSP  291

Query  1181  MWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
              WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L       
Sbjct  292   RWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PA  343

Query  1001  SRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK  828
               LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V 
Sbjct  344   EFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVY  403

Query  827   FSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFF  648
              ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P F
Sbjct  404   RAVASAQSAMAKLTTGHLHLAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLF  463

Query  647   LPVALHVILA---VLREWKRCKQENKK  576
             LP+A+ ++L+   ++RE ++ K+E  K
Sbjct  464   LPMAVPILLSLAKIVRETRQHKKEPTK  490



>ref|XP_009075478.1| PREDICTED: GPI transamidase component PIG-S, partial [Acanthisitta 
chloris]
Length=470

 Score =   171 bits (432),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/318 (31%), Positives = 177/318 (56%), Gaps = 15/318 (5%)
 Frame = -3

Query  1514  DFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVN  1335
             D +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S   LP  +N
Sbjct  161   DIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDKESSSFLLSAHSLPHVIN  220

Query  1334  SNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWN  1155
               E  L +S  A     VL+F++YVP     PL +   +G    TN F SP WGG++V+N
Sbjct  221   PVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGTPVSTNAFHSPRWGGIMVYN  278

Query  1154  PPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTS--E  981
               + +      PL   +   ++ +V EVF+ QLR LFGL+ + +         LL S   
Sbjct  279   VETPASTQTSLPLHVDV---DMARVMEVFLAQLRLLFGLSREEV-----PPEFLLESPGN  330

Query  980   KGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSS  801
             +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ + +S+
Sbjct  331   EGMADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVSSVQSA  390

Query  800   LSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVIL  621
             ++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ ++L
Sbjct  391   IAKLSMGHLHAAFQASKEAVTCSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILL  450

Query  620   A---VLREWKRCKQENKK  576
             +   ++RE ++CK+E  K
Sbjct  451   SLVKIVRETRQCKKEPIK  468



>ref|XP_005439956.1| PREDICTED: GPI transamidase component PIG-S [Falco cherrug]
Length=542

 Score =   172 bits (435),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 183/332 (55%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             L + +   DP     DWD ++  D  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  216   LGYEITFTDPKSHAVDWDIEDAVDRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  275

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+   + VL+F++YVP     PL +   +G   
Sbjct  276   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LNPVLNFLLYVPERSHSPLYIQDKDGAPV  333

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG+VV+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  334   STNAFHSPRWGGIVVYNIEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  390

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  391   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  445

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ AA+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  446   DDVASEVYRAVAAAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  505

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  506   FAIYIPLFLPMAVPILLSLAKIVREARQRQKE  537



>ref|XP_003287188.1| hypothetical protein DICPUDRAFT_54711 [Dictyostelium purpureum]
 gb|EGC36310.1| hypothetical protein DICPUDRAFT_54711 [Dictyostelium purpureum]
Length=397

 Score =   168 bits (426),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/339 (30%), Positives = 180/339 (53%), Gaps = 19/339 (6%)
 Frame = -3

Query  1589  VGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             V +     LSF LLN+DP D I  WDF  L +  + P ++ +  IA+ +V+S++ ++   
Sbjct  75    VKSSTEYSLSFTLLNSDPIDIIPKWDFPYLSNKYIQPFIEQISDIANFTVQSKISHYATL  134

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQL  1230
                   + K  SY      L  ++N NEW LDT +        L+F++Y+PS+ + PL +
Sbjct  135   LKSPLHEPKDNSYYIPSSFLSEYINPNEWQLDTPST---NQPTLNFIIYIPSKSQSPLYI  191

Query  1229  LLPNGELSKTNGFISPMWGGVVVWNPPSCS-KNSEMQPLRHKISSEELKKVFEVFMGQLR  1053
                      +N F+ P WGG+++ N  +   K  E+  L ++I ++ +      F  QL+
Sbjct  192   ----RSDQDSNSFLIPQWGGIIIHNTNTNKIKQGEIVDLTNEIENQMI-----TFKYQLK  242

Query  1052  QLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQS  873
             +L G+ S+          + L+S+   +  E+DF  +++T  N+    +TL SLS+L+ S
Sbjct  243   ELLGIKSNH------EQQKSLSSDIILSDQEIDFAIKRYTAENINVTLSTLFSLSKLIDS  296

Query  872   LPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVS  693
             LP M+++D I  +VK ++DA + +       +Y G+  +S+ A   +E AF+  +M+S  
Sbjct  297   LPNMLVLDNIRDEVKVAIDALQQAHKCLQEKDYKGALKASKIALYSSESAFFDKNMLSQL  356

Query  692   YYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             Y+  EH +AVY+P F+PV   +I  V +E+   +++  K
Sbjct  357   YFPDEHKYAVYTPLFVPVCFPIIAGVFQEFSNYRKKKLK  395



>ref|XP_007057840.1| PREDICTED: GPI transamidase component PIG-S [Chelonia mydas]
Length=569

 Score =   171 bits (434),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/335 (32%), Positives = 181/335 (54%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  +A+ SV+SQ+LY+        +D+
Sbjct  243   ITFSLLNPDPKSHNVHWDIEAAVNSYVQPFLDKLGSVANFSVDSQILYYAVLGVSPRFDK  302

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S+I S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  303   ASSSFILSALSLPHVINPVEARLGSS--ATSLYPVLNFLLYVPERVHSPLYIQDTDGAAV  360

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N      +    PL   +   ++ +V EVF+ QLR LFG++  S
Sbjct  361   GTNAFHSPRWGGIMVYNIDHPVADKAPLPLWVDV---DMVRVMEVFLAQLRLLFGISQVS  417

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S    G T WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  418   L-----PEEFLLESPGNDGLTDWELDRLLWTRTVENIATVSTTLTSLAQLLDKIGNIVIK  472

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A++++   + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  473   DDVASEVYHAVASAQTAMLELASGHLGSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  532

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   +LRE K+ K+E  K
Sbjct  533   FAIYIPLFLPMAVPILLSLVKILREAKQSKKEPTK  567



>ref|XP_008042282.1| hypothetical protein TRAVEDRAFT_172621 [Trametes versicolor FP-101664 
SS1]
 gb|EIW54995.1| hypothetical protein TRAVEDRAFT_172621 [Trametes versicolor FP-101664 
SS1]
Length=509

 Score =   171 bits (432),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 177/340 (52%), Gaps = 23/340 (7%)
 Frame = -3

Query  1574  RVVLSFNLLN--ADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKS--  1407
             R  L+F LLN  A        WD Q+     + P+++ L  + + ++ESQV YH P +  
Sbjct  169   RYRLAFTLLNEEATSGSAALAWDVQDAIQTHVGPLLKKLSDLHNFTIESQVQYHAPLAFQ  228

Query  1406  SFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL  1227
                   E Q  +  + +DL  FVNS EW L +S ++     V+HFV++VPS +  PL +L
Sbjct  229   PRPLQHEGQDVHGLTQEDLTVFVNSAEWTLSSSVSS---DPVIHFVLFVPSTKNSPLHIL  285

Query  1226  LPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQL  1047
                G +  +N F+ P WGG+V+ NPP      E  P+  +++  +L+ +F  F  QL  L
Sbjct  286   DQQGSVHPSNAFLLPQWGGIVLLNPPK-----EASPIA-RLTPADLRPIFATFAYQLLTL  339

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLP  867
              G+    L+V            + FT WELD + RQ    N+     TL ++ RLV  + 
Sbjct  340   LGVPGLPLHVRTA-------QREPFTDWELDALLRQRAFENVQGSADTLEAIVRLVDQIE  392

Query  866   RMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
              M +  ++   V+ +LDA   +  ++   +   +   S +A +LA  AF++P M+++ Y+
Sbjct  393   NMPVGQDVVGDVQDALDALNEAHDSSRASSPVATLKHSARALTLASRAFFNPGMLALLYF  452

Query  686   SFEHCFAVYSPFFLPVALHVILAVLRE---WKRCKQENKK  576
               EH +AVY+P F  V+  ++ AV+RE   WK+ ++E K+
Sbjct  453   PAEHTYAVYAPLFASVSAPLLGAVIRELMAWKKARKEAKE  492



>gb|ELU07676.1| hypothetical protein CAPTEDRAFT_220035 [Capitella teleta]
Length=454

 Score =   169 bits (429),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F LLN  P      W+ QE     L+P++ AL    ++ V+SQ L+ T        D+
Sbjct  134   ITFTLLNPQPSHVRASWNIQEATKRYLSPLLSALHDYTNIKVKSQYLHSTNIGVRPKVDQ  193

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
               G Y  +I  LP  +N  E  L +  +       L+F++Y+P  ++ PL +   NGE  
Sbjct  194   V-GGYALNIDQLPHIINPIEAFLGSHVSNNPN---LNFILYIPLRDQSPLFIYNQNGEKV  249

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F+SP WGG +V N     +N+ + P+  +I     + V +VF  QLR L G++   
Sbjct  250   ASNAFLSPRWGGFLVHNV-RVEENASL-PVDVQIDE---RPVMQVFAAQLRLLLGVSP--  302

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L+ G  A           T WELD   R H   NL     TL SL++L++ +  ++I D+
Sbjct  303   LHHG-LAVEEAPAGNAVITDWELDLWLRSHCLENLASSVATLNSLAQLLEKIGNIVINDD  361

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             IG++V+ +++  + S +  S G    + +SSRQA+  +E AF+ PS++ + Y+  +  FA
Sbjct  362   IGREVERAVEQIQISHTALSQGQLRDAYLSSRQAKQFSEKAFFDPSLLELLYFPEDQKFA  421

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYL  570
             +Y P FLP+ + V+++VL+  K  +++NK+ +
Sbjct  422   IYIPLFLPIGIPVVMSVLQSLKYLRKKNKQKM  453



>ref|XP_006463300.1| hypothetical protein AGABI2DRAFT_208009 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV45155.1| hypothetical protein AGABI2DRAFT_208009 [Agaricus bisporus var. 
bisporus H97]
Length=493

 Score =   170 bits (430),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 184/337 (55%), Gaps = 26/337 (8%)
 Frame = -3

Query  1565  LSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGW  1392
             L+F LLN D      + +WD +      + PI+  L P+ + ++ESQV ++  + +F   
Sbjct  166   LAFTLLNEDASAGSSVSNWDVRAGLVSRIQPILNKLEPLHNFTIESQVQFNG-RLAFQPQ  224

Query  1391  DEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
             +   GSY  + +DL  F+NS EW L +S +      VLHFV+++PS    PL +L P+G+
Sbjct  225   ENSDGSYGVTPEDLTVFINSAEWSLSSSVS---NDPVLHFVLFIPSALRRPLHILSPDGQ  281

Query  1211  LSKTNGFISPMWGGVVVWNPPS--CSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGL  1038
             +S++  F+ P WGG+V++NPP+    KN+ +        SE  +++F+ F  +L  L G+
Sbjct  282   ISRSRSFLLPQWGGIVIYNPPTDDTGKNTNL-------PSETNEQIFKEFSKELLSLLGV  334

Query  1037  NSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMI  858
              +           R ++     + W++D + R+ T  N+     TL S+ +LV  +  M 
Sbjct  335   PT-----LPNGVKRHISEAANLSNWQIDALMRRRTAENVKNTQETLTSIVKLVNQIDNMP  389

Query  857   IMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFE  678
             + +++   V+ +L+A + S S  S+G    +   S QA +L+  AF++P M+++ Y+  E
Sbjct  390   VKEDVRDDVQGALEALEQSHSARSLGE---AFRYSAQATTLSSRAFFNPGMLALLYFPAE  446

Query  677   HCFAVYSPFFLPVALHVILAVLRE---WKRCKQENKK  576
             H +AVY+P F    + +++A L+E   WK+ ++ + K
Sbjct  447   HKYAVYTPLFASAVIPLLIAALKEIVAWKKERRASVK  483



>ref|XP_006825320.1| PREDICTED: GPI transamidase component PIG-S-like [Saccoglossus 
kowalevskii]
Length=555

 Score =   171 bits (432),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/400 (31%), Positives = 200/400 (50%), Gaps = 30/400 (8%)
 Frame = -3

Query  1724  GKYRHAWIVGK-------LSEQesvekvveifvevfVNGGKEEGSIHGE-----FMPVGA  1581
             G+YRHA++ G+       L+ Q   E  V   +   ++G    G  H E        V +
Sbjct  164   GRYRHAFVSGQDLKSAAALAAQVVKELHVNEALAAKIHG-TAAGVKHTEADVESMRSVRS  222

Query  1580  DGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
                  L+F+LLN  P   I  WD  E     L P ++ L   AD +V SQVLY+   +  
Sbjct  223   TPGYELTFSLLNPSPDVIIAKWDIAEGIRSYLDPFLKTLTEYADFTVNSQVLYYMGLAVT  282

Query  1400  SGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLP  1221
                D+    Y+ +   LP  +N  E  L +  +    +  L+F+VYVP   + PL +L  
Sbjct  283   PTKDDTNKRYVLNAASLPHLINPVEAKLGSHVST---NPTLNFLVYVPPPSQSPLHILNE  339

Query  1220  NGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG  1041
             +G+    N F+SP WGG++++N P  +  +   P        ++K V EVF+ QLR L G
Sbjct  340   HGDTVTNNAFLSPRWGGIMLYNSPRDTSGNVTLP---DTVDVDMKTVMEVFLSQLRLLIG  396

Query  1040  L---NSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSL  870
             +    SD L   A+          G T WELDF+ R  T  N+     TL SLS+L+  +
Sbjct  397   VPKQKSDPLLTIASP------DNTGITHWELDFLLRTRTLENVATATLTLSSLSQLLGQI  450

Query  869   PRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSY  690
               M+I D+I +QV  ++++ +S+ S    GN   +  SS++A   +E AF+ PS++ + Y
Sbjct  451   RNMVIRDDIAEQVYIAVESIQSTHSYLKDGNMYRAFHSSKRAIQASETAFFDPSLLELLY  510

Query  689   YSFEHCFAVYSPFFLPVALHVILAVLR--EWKRCKQENKK  576
             +  +  FA+Y P FLP+++ V+++ ++  +W + K+   K
Sbjct  511   FPEDQKFAIYIPLFLPMSIPVLMSTVKALKWIKSKRRQNK  550



>ref|XP_006131127.1| PREDICTED: GPI transamidase component PIG-S [Pelodiscus sinensis]
Length=594

 Score =   171 bits (434),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 179/335 (53%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P +  L  +A+ SV+SQ+LY+        +D+
Sbjct  268   ITFSLLNPDPKSHDVHWDIEAAVSSYVQPFLNKLGSVANFSVDSQILYYAALGVSPRFDK  327

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                S+I S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  328   ASSSFILSAHSLPHVINPVEARLGSS--ATSLYPVLNFLLYVPERVHSPLYIQDKDGAPV  385

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    +      PLR  +   ++ +V EVF+ QLR LFG++ + 
Sbjct  386   GTNAFHSPRWGGIMVYNIDQPAPEKAPLPLRVDV---DMVQVMEVFLAQLRLLFGISQEP  442

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  443   L-----PEDFLLVSPGSEGLADWELDRLLWTRTIENIATVSTTLTSLAQLLDKIGNIVIK  497

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+ +L   + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  498   DDVASEVYRAVASAQIALLELASGHLGTAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  557

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+   +LRE  + K+E  K
Sbjct  558   FAIYIPLFLPMAVPILLSLVKILREATQSKKEPMK  592



>ref|XP_007332678.1| hypothetical protein AGABI1DRAFT_108623 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM76786.1| hypothetical protein AGABI1DRAFT_108623 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=493

 Score =   170 bits (430),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 184/337 (55%), Gaps = 26/337 (8%)
 Frame = -3

Query  1565  LSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGW  1392
             L+F LLN D      + +WD +      + PI+  L P+ + ++ESQV ++  + +F   
Sbjct  166   LAFTLLNEDASAGSSVSNWDVRAGLVSRIQPILHKLEPLHNFTIESQVQFNG-RLAFQPQ  224

Query  1391  DEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
             +   GSY  + +DL  F+NS EW L +S +      VLHFV+++PS    PL +L P+G+
Sbjct  225   ENSDGSYGVTPEDLTVFINSAEWSLSSSVS---NDPVLHFVLFIPSALRRPLHILSPDGQ  281

Query  1211  LSKTNGFISPMWGGVVVWNPPS--CSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGL  1038
             +S++  F+ P WGG+V++NPP+    KN+ +        SE  +++F+ F  +L  L G+
Sbjct  282   ISRSRSFLLPQWGGIVIYNPPTDDTGKNTNL-------PSETNEQIFKEFSKELLSLLGV  334

Query  1037  NSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMI  858
                   +      R ++     + W++D + R+ T  N+     TL S+ +LV  +  M 
Sbjct  335   P-----MLPNGVKRHISEAANLSDWQIDALMRRRTAENVKNTQETLTSIVKLVNQIDNMP  389

Query  857   IMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFE  678
             + +++   V+ +L+A + S S  S+G    +   S QA +L+  AF++P M+++ Y+  E
Sbjct  390   VKEDVRDDVQGALEALEQSHSARSLGE---AFRYSAQATTLSSRAFFNPGMLALLYFPAE  446

Query  677   HCFAVYSPFFLPVALHVILAVLRE---WKRCKQENKK  576
             H +AVY+P F    + +++A L+E   WK+ ++ + K
Sbjct  447   HKYAVYTPLFASAVIPLLIAALKEIVAWKKERRASVK  483



>gb|KFP01852.1| GPI transamidase component PIG-S, partial [Calypte anna]
Length=487

 Score =   169 bits (428),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 177/317 (56%), Gaps = 8/317 (3%)
 Frame = -3

Query  1526  IYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLP  1347
             + +W+ ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S+I S   LP
Sbjct  174   VVNWEIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFILSAHSLP  233

Query  1346  FFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGV  1167
               +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP WGG+
Sbjct  234   HVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGI  291

Query  1166  VVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLT  987
             +++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L          +T
Sbjct  292   MIYNIEAPASPQASFPLHVDV---DMVRVMEVFLAQLRLLFGLSREELPPEFLVE---IT  345

Query  986   SEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAK  807
               +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ +A+
Sbjct  346   GNEGLADWELDRLLWTHTMENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASAQ  405

Query  806   SSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV  627
             ++++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ +
Sbjct  406   NAMAELARGRLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPI  465

Query  626   ILAVLREWKRCKQENKK  576
             +L++++  +  +Q+ K+
Sbjct  466   LLSLVKIVRETRQQKKE  482



>gb|KFU87707.1| GPI transamidase component PIG-S, partial [Chaetura pelagica]
Length=419

 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/346 (29%), Positives = 185/346 (53%), Gaps = 16/346 (5%)
 Frame = -3

Query  1589  VGADGRVVLSFNL---LNADPHDW-----IYDWDFQELDDMLLAPIVQALRPIADVSVES  1434
             VG D R  L  +L   +   P  W     + +WD ++  +  + P++  L  +A+ SV+S
Sbjct  77    VGPDARRHLKSSLGRDVCPSPLPWPGGTPLVEWDIEDAVNRYVQPVLDKLSLVANFSVDS  136

Query  1433  QVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPS  1254
             Q+LY+        +D++  S++ S   LP  +N  E  L +S A+     VL+F++YVP 
Sbjct  137   QILYYAVLGVTPRFDKESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPE  194

Query  1253  EEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFE  1074
                 PL +   +G    TN F SP WGG++V+N  + +      PL   +   ++ +V E
Sbjct  195   RSHSPLYIQDKDGAPVSTNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVME  251

Query  1073  VFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGS  894
             VF+ QLR LFGL+ + L       S      +G   WELD +   HT  N+    TTL S
Sbjct  252   VFLAQLRLLFGLSREELPPEFLVES---PGNEGLADWELDRLLWAHTVENIATVSTTLTS  308

Query  893   LSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYH  714
             L++L+  +  ++I D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ 
Sbjct  309   LAQLLDKIGNIVIKDDVASEVYRAVASAQSAMAQLATGHLHSAFQASKEAVTSSERAFFD  368

Query  713   PSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             PS++ + Y+  +  FA+Y P  LP+A+ ++L++ +  +  +Q  K+
Sbjct  369   PSLLHLLYFPDDQKFAIYIPLCLPMAVPILLSLAKIAREARQRKKE  414



>ref|XP_001507200.1| PREDICTED: GPI transamidase component PIG-S [Ornithorhynchus 
anatinus]
Length=555

 Score =   170 bits (430),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/333 (31%), Positives = 179/333 (54%), Gaps = 11/333 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      W  +      + P +  LRP A+ SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPRSHDVRWAIEGAVRHYVQPFLDKLRPAANFSVDSQILYYAMLGVTPRYDT  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY+  +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASASYVLPVHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPDRSHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N    + N+   P+R ++   ++ +V EVF+ QLR LFG++   
Sbjct  347   ATNAFHSPRWGGIMIYNVDLSASNATELPVRVEV---DMVRVMEVFLAQLRLLFGISQAQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             +       +      +G   WELD +    T  N+    TTL SL++L+  +  ++I D+
Sbjct  404   VPADFQLEN---PGNEGLAAWELDRLLWARTVENIATVATTLTSLAQLLDKIGNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  +++AA+S+ +    G    +  +SR A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYQAVEAAQSAAAELEAGRLGPAFQASRTAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILA---VLREWKRCKQENKK  576
             +Y P FLP+A+ ++L+   +LRE ++ ++E+ K
Sbjct  521   IYIPLFLPMAVPILLSLVKILREARQARKESLK  553



>ref|XP_008493364.1| PREDICTED: GPI transamidase component PIG-S [Calypte anna]
Length=499

 Score =   169 bits (428),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 177/317 (56%), Gaps = 8/317 (3%)
 Frame = -3

Query  1526  IYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLP  1347
             + +W+ ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S+I S   LP
Sbjct  186   VVNWEIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFILSAHSLP  245

Query  1346  FFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGV  1167
               +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP WGG+
Sbjct  246   HVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGI  303

Query  1166  VVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLT  987
             +++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L          +T
Sbjct  304   MIYNIEAPASPQASFPLHVDV---DMVRVMEVFLAQLRLLFGLSREELPPEFLVE---IT  357

Query  986   SEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAK  807
               +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ +A+
Sbjct  358   GNEGLADWELDRLLWTHTMENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASAQ  417

Query  806   SSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV  627
             ++++  + G    +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ +
Sbjct  418   NAMAELARGRLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPI  477

Query  626   ILAVLREWKRCKQENKK  576
             +L++++  +  +Q+ K+
Sbjct  478   LLSLVKIVRETRQQKKE  494



>ref|XP_009993417.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Chaetura pelagica]
Length=416

 Score =   167 bits (423),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 174/317 (55%), Gaps = 8/317 (3%)
 Frame = -3

Query  1526  IYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLP  1347
             + +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S   LP
Sbjct  103   LVEWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSAHSLP  162

Query  1346  FFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGV  1167
               +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP WGG+
Sbjct  163   HVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGI  220

Query  1166  VVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLT  987
             +V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L       S    
Sbjct  221   MVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREELPPEFLVES---P  274

Query  986   SEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAK  807
               +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ +A+
Sbjct  275   GNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASAQ  334

Query  806   SSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV  627
             S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P  LP+A+ +
Sbjct  335   SAMAQLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLCLPMAVPI  394

Query  626   ILAVLREWKRCKQENKK  576
             +L++ +  +  +Q  K+
Sbjct  395   LLSLAKIAREARQRKKE  411



>gb|KFQ81338.1| GPI transamidase component PIG-S, partial [Phaethon lepturus]
Length=480

 Score =   168 bits (425),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 183/342 (54%), Gaps = 12/342 (4%)
 Frame = -3

Query  1592  PVGADGRVVLSFNL---LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLY  1422
             P+G D R  L  +L   +   P   + +WD ++  +  + P++  L  +A+ SV+SQ+LY
Sbjct  143   PLGPDTRRHLKSSLGMDMRPSPSHAV-NWDIEDAVNHYVQPVLDKLSLVANFSVDSQILY  201

Query  1421  HTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEEC  1242
             +        +D++  S+  S   LP  +N  E  L +S  A     VL+F++YVP     
Sbjct  202   YAVLGVTPRFDKESSSFFLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHS  259

Query  1241  PLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMG  1062
             PL +   +G    TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ 
Sbjct  260   PLYIQDKDGAPVSTNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLA  316

Query  1061  QLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRL  882
             QLR LFGL+ + L       S      +G   WELD +   HT  N+    TTL SL++L
Sbjct  317   QLRLLFGLSREELPPEFVLES---PGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQL  373

Query  881   VQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             +  +  ++I D++  +V  ++ +A+ +++  + G+   +  +S++A + +E AF+ PS++
Sbjct  374   LDKIGNIVIKDDVASEVYRAVASAQRAMAKLATGHLHLAFQASKEAVTSSERAFFDPSLL  433

Query  701   SVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
              + Y+  +  FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  434   HLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIAREARQRKKE  475



>emb|CDS10776.1| hypothetical protein LRAMOSA11262 [Absidia idahoensis var. thermophila]
Length=525

 Score =   168 bits (426),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 97/339 (29%), Positives = 183/339 (54%), Gaps = 20/339 (6%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSG  1395
             R  ++F+L+N DP   + DWD ++     + P++Q +  +++ +V+SQ+  +   S    
Sbjct  198   RYQITFSLMNNDPEHLLVDWDIRDAVKSYMHPLLQEISMVSNFTVDSQIQNYASLSIPPS  257

Query  1394  WDEKQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
               E+ G    Y +    L  F+NS +W+L ++ ++      ++F++Y+PS    P Q L 
Sbjct  258   ERERPGKPSYYYYEQGQLSHFINSADWNLASTISS---YPTVNFILYIPS----PKQRLW  310

Query  1223  PNGELSKT---NGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLR  1053
              +   ++    N F+ P WGGV++ N P            +++  ++L     +F+ QLR
Sbjct  311   IHDAHNRPLPDNAFLIPRWGGVLIKNLPKAEDG------HYRLDKKKLHSTMRIFVSQLR  364

Query  1052  QLFGLNS-DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
              L G++  DS+    T+ + L +   G T  E D + R+ T  N+     TL SL++LV 
Sbjct  365   NLIGIHEHDSIETSDTSITYLPSPHTGITLLEKDHLIRRCTVENIANAAKTLNSLAQLVT  424

Query  875   SLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSV  696
              +P M++++EI  QV+ SL   +         +Y+ +   S +A  LAE+AF++P+M+S+
Sbjct  425   EIPNMVVLEEINTQVRHSLRDLELGCEALKNADYESALQHSIRATKLAEEAFFNPTMVSM  484

Query  695   SYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENK  579
              Y+  EH +A+Y P F+P+++ +++AVL+ +KR   + K
Sbjct  485   LYFPDEHKYAIYMPLFVPISVPLVMAVLKGFKRKAPKEK  523



>emb|CDH48220.1| gpi transamidase component pig-s-like [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=526

 Score =   168 bits (425),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 105/344 (31%), Positives = 188/344 (55%), Gaps = 29/344 (8%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSG  1395
             R  ++F+L+N DP   + DWD +E     + P+++ +  +++ +V+SQ+  +   S    
Sbjct  199   RYQITFSLMNNDPEHLLVDWDIREAVKSYMHPLLKEISMVSNFTVDSQIQNYASLSIPPF  258

Query  1394  WDEKQGS---YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL-  1227
               E+ G    Y +    L  F+NS +W+L ++ ++      ++F++Y+PS    P Q L 
Sbjct  259   ERERPGKPSYYYYEQGQLSHFINSADWNLASTISS---YPTVNFILYIPS----PTQRLW  311

Query  1226  ---LPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQL  1056
                + N  L   N F+ P WGGV++ N P            +++  ++L     +F+ QL
Sbjct  312   IHDVHNRPLPD-NAFLIPRWGGVLIKNLPKAPDG------HYRLDKQKLHSTMRIFVSQL  364

Query  1055  RQLFGLNS-DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLV  879
             R L G++  DSL    T+ + L +   G T  E D + R+ T  N+     TL SL++LV
Sbjct  365   RSLIGIHEHDSLETSDTSITYLTSPHTGITLLEKDNLIRRCTVENIANAAKTLNSLAQLV  424

Query  878   QSLPRMIIMDEIGKQVKFSL---DAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPS  708
               +P M++++EI  QV+ SL   +    +L NA   +Y+ +   S +A  LAE+AF++P+
Sbjct  425   TEIPNMVVLEEINTQVRHSLRDLELGSEALRNA---DYESALKHSIRATKLAEEAFFNPT  481

Query  707   MMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             M+S+ Y+  EH +A+Y P F+P+++ +++AVL+  KR K+  KK
Sbjct  482   MVSMLYFPDEHKYAIYMPLFVPISVPLVMAVLKGLKR-KEPKKK  524



>ref|XP_006674957.1| hypothetical protein BATDEDRAFT_7967, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF84282.1| hypothetical protein BATDEDRAFT_7967, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=410

 Score =   165 bits (417),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/343 (32%), Positives = 179/343 (52%), Gaps = 27/343 (8%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHT--PKSSF  1401
             +VVLS  LL  DP   +  WD Q      + P +  L  I++ ++ SQ+L +   P    
Sbjct  78    QVVLS--LLVGDPESVMVSWDAQAAASAYIQPFLFELNAISEFTISSQILNYASLPIQPE  135

Query  1400  SGWD-EKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
              G D     +Y  ++K L  F+NS EW+L +  ++      ++ ++Y+P  E+ PL +L 
Sbjct  136   KGQDGNGNTAYYMNVKALSNFLNSAEWNLASVVSSASP---INLILYIPPMEQTPLHVLH  192

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLF  1044
              NG     N F+ P WGGVV+ N P+     E + + + +  E+L  + E+F+ QLR L 
Sbjct  193   YNG----INSFLIPQWGGVVIRNVPN-----EFRQIHYNL--EKLHPIMEIFVEQLRGLL  241

Query  1043  GLNS-----DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLV  879
             G++S     + + +          SE G T+WELD + R  T  N+     TL SL+ L+
Sbjct  242   GIDSVCIVNEKMLLPNVRVEYGDASEIGMTRWELDRLIRSRTVQNMANAAQTLISLANLL  301

Query  878   QSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMS  699
             + L  M+++D I   V  SL+    +    S   +  +A  +R+A + AE AF+ P+M+ 
Sbjct  302   ERLSGMVVLDLIKYYVTDSLNYLNMTKHELSTCQFTNAAQYARRAVTSAEAAFFDPTMVP  361

Query  698   VSYYSFEHCFAVYSPFFLPVALHVILAVLRE---WKRCKQENK  579
             + Y+  EH FA+Y P+F+PV + +ILA+ RE   W   K+E K
Sbjct  362   LLYFPDEHKFAIYMPYFVPVTVPLILALFREVRLWISKKREAK  404



>ref|NP_001087430.1| phosphatidylinositol glycan anchor biosynthesis, class S [Xenopus 
laevis]
 gb|AAH79776.1| MGC86278 protein [Xenopus laevis]
Length=591

 Score =   167 bits (423),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 99/331 (30%), Positives = 176/331 (53%), Gaps = 10/331 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      W+     D  + P +  L+ +A+ SV+SQ LY+        +++
Sbjct  265   ITFSLLNPDPKSHDLSWNISSASDQFIQPFLDKLQNVANFSVDSQTLYYAMLGVTPRFEK  324

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SYI ++ +LP  +N  E  L +S  A     VL+F++Y+P     PL +   +G   
Sbjct  325   TTSSYILNLHNLPHVINPVEARLGSS--AASLYPVLNFLLYIPEYSHSPLYIQDKDGSRI  382

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQ-PLRHKISSEELKKVFEVFMGQLRQLFGLNSD  1029
              TN F SP WGG++++N  +     E+Q P+   I   ++ +V EVF+ QLR L G+   
Sbjct  383   PTNAFHSPRWGGIMIYNV-NYGNAGELQFPVHIDI---DMVRVMEVFLTQLRLLLGITKA  438

Query  1028  SLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMD  849
             ++       S      +G T WELD +       N+    TTL SL++L+  +  ++I D
Sbjct  439   TVPENYQLES---PGNEGLTDWELDRLLWSRVVENIATVATTLTSLAQLLDQIGNIVIND  495

Query  848   EIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCF  669
              +  +V  ++ + + +LS    G+ + +  +S++A S +E AF+ PS++ + Y+  +  F
Sbjct  496   IVASEVYHAVSSVQIALSELEAGHLESAFQASKEAISSSEKAFFDPSLLHLLYFPDDQKF  555

Query  668   AVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             A+Y P FLP+A+ + L++++  K  KQ  K+
Sbjct  556   AIYIPLFLPMAVPIFLSLIKIAKEYKQSKKE  586



>ref|NP_001106424.1| phosphatidylinositol glycan anchor biosynthesis, class S [Xenopus 
(Silurana) tropicalis]
 gb|AAI53366.1| LOC100127592 protein [Xenopus (Silurana) tropicalis]
Length=564

 Score =   167 bits (422),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 98/332 (30%), Positives = 175/332 (53%), Gaps = 8/332 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     +W+     D  + P +  L+ +A+ S++SQ LY+        +++
Sbjct  238   ITFSLLNPDPKSHDLNWNISSASDQYIQPFLDKLQNVANFSMDSQTLYYAMLGVTPRFEK  297

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SYI ++ +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  298   STSSYILNLHNLPHVINPVEARLGSS--AASLYPVLNFLLYVPEYSHSPLYIQDKDGSRI  355

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N    +      P+   I   ++ +V EVF+ QLR L G+   +
Sbjct  356   PTNAFHSPRWGGIMIYNVDYGNLGELQFPVHIDI---DMVRVMEVFLTQLRLLLGITKAT  412

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             +       S      +G T WELD +       N+    TTL SL++L+  +  ++I D 
Sbjct  413   VPEDYQLES---PGNEGLTDWELDRLLWSRVVENIATVTTTLTSLAQLLDQIGNIVINDI  469

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ + +++LS    G  + +  +S++A S +E AF+ PS++ + Y+  +  FA
Sbjct  470   VASEVYHAVSSVQTALSELEAGRLESAFQASKEAISSSEKAFFDPSLLHLLYFPDDQKFA  529

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYL  570
             +Y P FLP+A+ + L++++  K  KQ  K+ L
Sbjct  530   IYIPLFLPMAVPIFLSLIKIAKEYKQSKKEPL  561



>ref|XP_009058874.1| hypothetical protein LOTGIDRAFT_123335 [Lottia gigantea]
 gb|ESO90553.1| hypothetical protein LOTGIDRAFT_123335 [Lottia gigantea]
Length=544

 Score =   166 bits (419),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 150/549 (27%), Positives = 252/549 (46%), Gaps = 64/549 (12%)
 Frame = -3

Query  2165  SIEIHRAPLPFKDIDSLALSIERSPLLFPCKFQVVFVNLDHSTTSTASELSFLITSQMQK  1986
             + E++R  LP+ DI  L+    + PL++    +V+  +LD    S   ++S     Q+Q+
Sbjct  36    TTEVYRVQLPYNDISDLS----QIPLVYLTDIEVI--SLDKKLDSNLVQIS----QQLQE  85

Query  1985  LTSAKSPVCGTCLSNFTVAITLESSSSNCIYSENQDIVWKCGALSGLDFEKSLDNTDDFL  1806
               S K     T +   TV  ++    S     +N+D                L N D  L
Sbjct  86    DLSRKRGEEVTPIYRVTVRESVGDEQSIFNKYDNKD----------------LSNIDKLL  129

Query  1805  ESLLDsrssrvytvvvvnrdeevravVGKYRHAWIV--GKLSEQesvekvveifvevfVN  1632
               L   + ++    ++ + + ++   +GKY ++++   GKL +   +         V   
Sbjct  130   SELSPLQRNKYLIFLIPSNNGKLNVFIGKYYNSFVSSNGKLDKIIPLISKTVQMTIV---  186

Query  1631  GGKEEGSIHGEFMPVGADG--------RVV-------LSFNLLNADPHDWIYDWDFQELD  1497
               KE+  +   F   GA          R V       L+F L    P  +   W+ +E  
Sbjct  187   --KEQSVVKSIFNAKGARSLKPDKESMRSVRYNTGYDLTFTLTVPQPDIFDVSWNIREAV  244

Query  1496  DMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHL  1317
             D  L P+V  L+    + + SQ+ Y T        DEK   Y F  +DLP  +N  E  L
Sbjct  245   DTYLKPLVDHLKEFTQLKINSQIHYFTTLQRKPQKDEKLNEYYFLEQDLPHLINPIESTL  304

Query  1316  DTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSK  1137
              TS +       L+F+VY+P+ ++ PL +   NG    TN F+SP WGGV+++N P  ++
Sbjct  305   GTSASNNPE---LNFIVYIPTRDQSPLYIKDKNGVKVPTNSFLSPRWGGVMIFNVPEFNE  361

Query  1136  NSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLL---TSEKGFTQ  966
             ++ + P   K+   E K + EVF+ Q+R L  LNS       T++  +        G + 
Sbjct  362   STPL-PFPVKV---EGKNIMEVFLTQIRLLLNLNS------PTSSHEVWFDPVEVNGISN  411

Query  965   WELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNAS  786
              E+D   R     NL     TL SL++L+  +  ++I D+IG QV+ ++   KSSL   S
Sbjct  412   MEIDVWLRNRCFENLATSINTLQSLAQLLGQISNIVIKDDIGSQVEAAVREIKSSLKYLS  471

Query  785   IGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLRE  606
              GN   +  SS++A   +E AF+ PS++ + Y+  +  FA+Y P FLP+++ +I A++  
Sbjct  472   TGNLVDAFHSSKRAIIASEKAFFDPSLLELLYFPEDQKFAIYIPLFLPISIPLITAMMHA  531

Query  605   WKRCKQENK  579
              K  K   K
Sbjct  532   IKWFKGTKK  540



>ref|XP_009487271.1| PREDICTED: GPI transamidase component PIG-S, partial [Pelecanus 
crispus]
Length=414

 Score =   163 bits (412),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/304 (31%), Positives = 167/304 (55%), Gaps = 12/304 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  120   ITFSLLNPDPKSHTVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  179

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  180   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGTPV  237

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  238   STNAFHSPRWGGIMIYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  294

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  295   L-----PAEFLLESLGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  349

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  350   DDVASEVYRAVASVQSAMAELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  409

Query  671   FAVY  660
             FA+Y
Sbjct  410   FAIY  413



>gb|KFQ64436.1| GPI transamidase component PIG-S, partial [Pelecanus crispus]
Length=422

 Score =   163 bits (412),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/304 (31%), Positives = 167/304 (55%), Gaps = 12/304 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  128   ITFSLLNPDPKSHTVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  187

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  188   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGTPV  245

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  246   STNAFHSPRWGGIMIYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  302

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  303   L-----PAEFLLESLGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  357

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  358   DDVASEVYRAVASVQSAMAELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  417

Query  671   FAVY  660
             FA+Y
Sbjct  418   FAIY  421



>ref|XP_001415830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94122.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=438

 Score =   163 bits (413),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/340 (32%), Positives = 176/340 (52%), Gaps = 10/340 (3%)
 Frame = -3

Query  1583  ADGRVVLSFNLLNADPH-DWIYDWDFQ-ELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             +DG ++ SF+L+NA+P   + + WDFQ +++   L  + +AL  + +V +E+QVL H   
Sbjct  93    SDGILLASFSLVNAEPTPGYAFSWDFQRDVEQPFLGALPEALSRVLEVRIEAQVLRHARS  152

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTS-TAAGGRSKVLHFVVYVPSEEECPLQ  1233
                  W +K   Y+   K  PFF++S+ W +DTS T      K LHFVVYVP + ECPL 
Sbjct  153   RVRPMWSDKHRGYVVDSKQTPFFIDSD-WPIDTSVTYTPIDGKPLHFVVYVPPQTECPLY  211

Query  1232  LLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLR  1053
             +L  N EL+ TN FI   WGG+VV NPP C+       +R  + ++E+  V   F+ QLR
Sbjct  212   VLDDNHELTATNAFIVEGWGGLVVVNPPGCAVARGENEIR--LRNDEVVNVVNAFVRQLR  269

Query  1052  QLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQS  873
                G        GA     L     GF  WE+D +       +     +TL SL  ++ S
Sbjct  270   IHLGAGEFLQKFGAKV---LPPKHTGFATWEVDALVHSRLVADSQSTISTLKSLDEVISS  326

Query  872   LPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHP-SMMSV  696
             +  + + D I +++  S++A + ++  A    YD +  S+R A + AE AF+ P S+  +
Sbjct  327   IADIAVPDAIAERILESVEALERAIDLAQNARYDEAGASARSAHAAAERAFFDPFSLGGL  386

Query  695   SYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
               + FE+  A   P  LP    ++L  +RE +  +   ++
Sbjct  387   ESFPFEYKVASVMPIILPTIFPLMLGFMREMRHFQLRRRE  426



>gb|KFH63482.1| hypothetical protein MVEG_10891 [Mortierella verticillata NRRL 
6337]
Length=583

 Score =   166 bits (419),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/332 (31%), Positives = 175/332 (53%), Gaps = 16/332 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             L+F+L + D  + I  W  QE     ++P ++++  I+  ++ESQV ++   +     D 
Sbjct  242   LTFSLFSGDTSNGIRSWKIQEAISAYMSPFLRSMSTISKFNIESQVQHYASLTFEPKVDP  301

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
              +  +  +   L  F+N+ EW L  ST +   S  L+F+VYVP   + PL +     + S
Sbjct  302   IKNEHYLTPDSLSNFINAAEWSL-ASTVSSFPS--LNFLVYVPKSSDSPLVIKQGPEQTS  358

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              T+ F+ P WGG+ + N     +N+        IS++EL+ V  VF+ QLR L G+    
Sbjct  359   TTDSFLIPRWGGITILN-----RNNSSSADADTISAKELETVMSVFLTQLRDLLGV--PD  411

Query  1025  LYVGATATSRLLTSEKGF------TQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
             L + + AT+++ T  +        T WE D++ R     NL+    TL SL++LV   P 
Sbjct  412   LSISSKATAKIPTQFQRHSNAAVPTAWEQDYLLRLRWAENLVDSRRTLTSLAQLVTDTPN  471

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYS  684
             M+++D I K V  +L   + S    +   Y  +   SR     AE AF+ P+M+S+ Y+ 
Sbjct  472   MVVLDHIQKDVVEALKDIEESCGLMAKQEYTAALAHSRDGLVKAEAAFFDPTMVSMLYFP  531

Query  683   FEHCFAVYSPFFLPVALHVILAVLREWKRCKQ  588
              EH +A+Y P F+P+++ +++A+LRE K+ K+
Sbjct  532   DEHKYAIYMPLFVPISVPLVMALLRELKKIKE  563



>ref|XP_010007983.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Nestor notabilis]
Length=452

 Score =   163 bits (413),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 177/335 (53%), Gaps = 19/335 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     +WD +E     + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  130   ITFSLLNPDPKSHDVNWDIEEAVTRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  189

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  190   ESSSFLLSTHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  247

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG+VV+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  248   STNAFHSPRWGGIVVYNVEAPAAPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  304

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  305   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  359

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S++   + G+   +  +S++A + +E AF+ PS++ +        
Sbjct  360   DDVASEVYRAVASAQSAMDKLATGHLHPAFQASKEAATSSERAFFDPSLLHLX----XXX  415

Query  671   FAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
                  P  LP A+ ++L+   ++RE ++ K+E  K
Sbjct  416   XXXXXPLSLPRAVPILLSLAKIIRETRQKKKEPTK  450



>gb|KFP61112.1| GPI transamidase component PIG-S, partial [Cariama cristata]
Length=475

 Score =   162 bits (411),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 173/308 (56%), Gaps = 14/308 (5%)
 Frame = -3

Query  1481  PIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHL-DTST  1305
             P++  L  +A+ SV+SQ+LY+        +D++  S++ S   LP  +N  E  L +  +
Sbjct  174   PVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLSTHSLPHVINPVEARLGEHCS  233

Query  1304  AAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEM  1125
             +A     VL+F++YVP     PL +   +G    TN F SP WGG++V+N  + +     
Sbjct  234   SAASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGIMVYNVEAPASPQAS  293

Query  1124  QPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTS--EKGFTQWELDF  951
              PL   +   ++ +V EVF+ QLR LFGL+ + L         LL S   +G   WELD 
Sbjct  294   LPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PAEFLLESPGNEGLADWELDR  345

Query  950   ISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYD  771
             +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ +A+S+++  + G+  
Sbjct  346   LLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASAQSAMAKLTTGHLH  405

Query  770   GSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILA---VLREWK  600
              +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ ++L+   ++RE +
Sbjct  406   LAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIVRETR  465

Query  599   RCKQENKK  576
             + K+E  K
Sbjct  466   QHKKEPTK  473



>ref|XP_010118137.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Chlamydotis macqueenii]
Length=294

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/290 (31%), Positives = 159/290 (55%), Gaps = 9/290 (3%)
 Frame = -3

Query  1433  QVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPS  1254
             Q+LY+        +D++  S++ S   LP  +N  E  L +S  A     VL+F++YVP 
Sbjct  8     QILYYAVLGVTPRFDKESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPE  65

Query  1253  EEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFE  1074
                 PL +   +G    TN F SP WGG++V+N  + +      PL   +   ++ +V E
Sbjct  66    RSPSPLYIQDKDGAPVSTNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVME  122

Query  1073  VFMGQLRQLFGLNSDSLY-VGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLG  897
             VF+ QLR LFGL+ + L               +G   WELD +   HT  N+    TTL 
Sbjct  123   VFLAQLRLLFGLSREELPPXXXXXXXXXXXXXEGLADWELDRLLWAHTVENIATVSTTLT  182

Query  896   SLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFY  717
             SL++L+  +  ++I D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+
Sbjct  183   SLAQLLDKIGNIVIKDDVASEVYRAVASAQSTMAKLATGHLHSAFQASKEAVTSSERAFF  242

Query  716   HPSMMSVSYYSFEHCFAVYSPFFLPVALHVILA---VLREWKRCKQENKK  576
              PS++ + Y+  +  FA+Y P FLP+A+ ++L+   ++RE ++CK+E  K
Sbjct  243   DPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIVRETRQCKKEPTK  292



>gb|KFO64172.1| GPI transamidase component PIG-S, partial [Corvus brachyrhynchos]
Length=492

 Score =   162 bits (411),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/332 (29%), Positives = 176/332 (53%), Gaps = 13/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LL  DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  167   ITLSLLKPDPKSHTVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  226

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  227   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  284

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  285   STNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  341

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  342   V-----PPKFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  396

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+     
Sbjct  397   DDVASEVYRAVASVQSAVTELSLGHLHAAFQASKEAVTSSERAFFDPSLLHLLYFPXXXX  456

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
                    FLP+A+ ++L++ +  +  +Q  K+
Sbjct  457   XXXXX-LFLPMAVPILLSLAKIVRETRQRTKE  487



>ref|XP_006005797.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Latimeria 
chalumnae]
Length=559

 Score =   163 bits (413),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 108/332 (33%), Positives = 174/332 (52%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  +A+ S++SQ+LY+         D+
Sbjct  233   ITFSLLNPDPKSHDLHWDIENAVNYYIQPFLGKLSSMANFSMDSQILYYAILGVTPRHDK  292

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SYI S + LP  +N  E    +S  A     VL+F++YVP     PL +   +G   
Sbjct  293   ASSSYILSAESLPHVINPVEARFGSS--AASLYPVLNFLLYVPDYAHSPLHIRDHHGAQV  350

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N  + P+R  I   ++ +V EVF+ QLR L G+    
Sbjct  351   TTNAFHSPRWGGIMVYNVKHKNSNETLFPIRVDI---DMVRVMEVFLTQLRLLLGIQKVE  407

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
                  T    LL S   +G T WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  408   -----TPADVLLQSPGNEGITDWELDRLLWVRTVENIATATTTLTSLAQLLDQIGNIVIN  462

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D I  +V  S+ +  ++LS    G    +  +S+QA + +E AF+ PS++ + Y+  +  
Sbjct  463   DHIASEVYSSVASVHATLSELEAGRLSSAFHASKQAITSSERAFFDPSLLHLLYFPDDQK  522

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ +IL++LR     +Q  K+
Sbjct  523   FAIYIPLFLPMAVPIILSLLRIASDFRQAQKQ  554



>ref|XP_009463456.1| PREDICTED: GPI transamidase component PIG-S [Nipponia nippon]
Length=481

 Score =   162 bits (410),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 188/369 (51%), Gaps = 49/369 (13%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV-------------L  1425
             ++F+ LN DP      WD ++  +  + P++  L  +A+ SV+SQV              
Sbjct  121   ITFSPLNPDPKSHAVHWDIEDAVNRYVQPVLDKLSLVANFSVDSQVRAGRGDEESPALAF  180

Query  1424  YHTPKSSFSG---------------------WDEKQGSYIFSIKDLPFFVNSNEWHLDTS  1308
                P + FS                      +D++  S++ S   LP  +N  E  L +S
Sbjct  181   LGAPGTRFSASNVFVVCLQILYYAVLGVTPRFDKESSSFLLSAHSLPHVINPVEARLGSS  240

Query  1307  TAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSE  1128
              A+     VL+F++YVP     PL +   +G    TN F SP WGG++++N  + +    
Sbjct  241   AAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGIMLYNVEAPASPQA  298

Query  1127  MQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTS--EKGFTQWELD  954
               PL   +   ++ +V EVF+ QLR LFGL+ + L         LL S   +G   WELD
Sbjct  299   SLPLHVYV---DMVRVMEVFLAQLRLLFGLSREEL-----PPEILLESPGNEGLADWELD  350

Query  953   FISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNY  774
              +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ +A+S+++  + G+ 
Sbjct  351   RLLWAHTVENIATVSTTLNSLAQLLDKIGNIVIKDDVASEVYRAVASAQSAMAKLATGHL  410

Query  773   DGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILA---VLREW  603
               +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P FLP+A+ ++L+   ++RE 
Sbjct  411   HSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLAKIVREA  470

Query  602   KRCKQENKK  576
             ++ K+E  K
Sbjct  471   RQRKKEPTK  479



>ref|XP_006005796.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Latimeria 
chalumnae]
Length=564

 Score =   163 bits (413),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 108/332 (33%), Positives = 174/332 (52%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  +A+ S++SQ+LY+         D+
Sbjct  238   ITFSLLNPDPKSHDLHWDIENAVNYYIQPFLGKLSSMANFSMDSQILYYAILGVTPRHDK  297

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SYI S + LP  +N  E    +S  A     VL+F++YVP     PL +   +G   
Sbjct  298   ASSSYILSAESLPHVINPVEARFGSS--AASLYPVLNFLLYVPDYAHSPLHIRDHHGAQV  355

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N  + P+R  I   ++ +V EVF+ QLR L G+    
Sbjct  356   TTNAFHSPRWGGIMVYNVKHKNSNETLFPIRVDI---DMVRVMEVFLTQLRLLLGIQKVE  412

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
                  T    LL S   +G T WELD +    T  N+    TTL SL++L+  +  ++I 
Sbjct  413   -----TPADVLLQSPGNEGITDWELDRLLWVRTVENIATATTTLTSLAQLLDQIGNIVIN  467

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D I  +V  S+ +  ++LS    G    +  +S+QA + +E AF+ PS++ + Y+  +  
Sbjct  468   DHIASEVYSSVASVHATLSELEAGRLSSAFHASKQAITSSERAFFDPSLLHLLYFPDDQK  527

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ +IL++LR     +Q  K+
Sbjct  528   FAIYIPLFLPMAVPIILSLLRIASDFRQAQKQ  559



>ref|XP_001375860.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Monodelphis 
domestica]
Length=580

 Score =   163 bits (413),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 97/336 (29%), Positives = 179/336 (53%), Gaps = 17/336 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +     + + S++SQ+LY+        +D 
Sbjct  254   ITFSLLNPDPKSHEVHWDIEGAMESFVQPFLSLFGALGNFSMDSQILYYAMLGVTPRFDA  313

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S A+   + V++F++YVP     PL +   +G   
Sbjct  314   ASSSYTLAAHSLPHVINPVEARLGSSAAS--LNPVINFLLYVPERAHSPLYIQDKDGARV  371

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P++  +   ++ +V EVF+ Q+R LFG+    
Sbjct  372   ATNAFHSPRWGGIMVYNVDPKAYNTTKFPVKVNV---DMVQVMEVFLAQMRLLFGIPYPQ  428

Query  1025  L---YVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMII  855
             +   +V A   S      +G   WELD +    T  NL    TTL SL+ L+  +  ++I
Sbjct  429   MPANFVLAGPPS------EGLRSWELDRLLWARTVENLATVTTTLTSLAELLDKIGNIVI  482

Query  854   MDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH  675
              D++  +V  ++DA   ++   + GN + +  +SR+A + +E AF+ PS++ + Y+  + 
Sbjct  483   KDDVASEVYRAVDAVHDAIVELAAGNLNSAFHASREAVTSSEKAFFDPSLLHLLYFPDDQ  542

Query  674   CFAVYSPFFLPVALHVILAVLR---EWKRCKQENKK  576
              FA+Y P FLP+A+ + L++++   E ++ +++ +K
Sbjct  543   KFAIYIPLFLPMAVPIFLSMIKIILENQKIRKDIEK  578



>ref|XP_010160735.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Caprimulgus carolinensis]
Length=399

 Score =   160 bits (404),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 98/331 (30%), Positives = 179/331 (54%), Gaps = 12/331 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN   H    DW  ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  73    ITFSLLNPXSH--TVDWAIEDAVNCYVRPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  130

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  131   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  188

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQ--LFGLNS  1032
              TN F SP WGG++++N  + +      PL   +   ++ +V EVF+ QLR   LFGL+ 
Sbjct  189   STNAFHSPRWGGIMIYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRXCCLFGLSR  245

Query  1031  DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             + L       S      +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  246   EELPPEFLVES---PGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  302

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A +S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  303   DDVASEVYRAVAAVQSAVAELATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  362

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENK  579
             FA+Y P FLP+A+ ++L++ +  +  +Q  K
Sbjct  363   FAIYIPLFLPMAVPILLSLAKIVREARQRKK  393



>emb|CCM04395.1| predicted protein [Fibroporia radiculosa]
Length=519

 Score =   162 bits (409),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 110/349 (32%), Positives = 177/349 (51%), Gaps = 27/349 (8%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDWI--YDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  L+F LLN D         WD        +AP ++ L  + + +VESQV ++ P + F
Sbjct  187   RYRLAFTLLNEDAASGTAALSWDVHASLSSHIAPTLERLSVLHNFTVESQVQFYAPLA-F  245

Query  1400  SGWDEKQGS-YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLL  1224
                    GS +  + +DL  F+NS EW L +S +      VLHFV+++PS    PL +L 
Sbjct  246   EPRSVGDGSSHGLTQEDLTVFINSAEWTLSSSVS---NDPVLHFVLFIPSSSHSPLCILD  302

Query  1223  PNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLF  1044
              NG  + +  FI P WGG+V++NPP+   N  +Q     ++S+ L  VF  F  QL  L 
Sbjct  303   SNGTPTSSTAFILPQWGGIVIYNPPTA--NITLQ-----LTSDALSPVFTTFQQQLIALL  355

Query  1043  GLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPR  864
             G+ +   ++    T     S+  FT W+LD + R+    N +    TL S+ RLV  +  
Sbjct  356   GVPALPAHIH---TQHKTASDATFTDWQLDALIRRRAVENTMGAQDTLQSIVRLVTQIEN  412

Query  863   MIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS---SRQARSLAEDAFYHPSMMSVS  693
             M     + + VK  +  A   L  A       SA++   + +A +LA  AF++P M+++ 
Sbjct  413   M----PVKRDVKNDVQEALMELEEAYAATSFSSALALQHASEALTLASRAFFNPGMLALL  468

Query  692   YYSFEHCFAVYSPFFLPVALHVILAVLRE---WKRCKQENKKYLAWKAK  555
             Y+  EH +AVY+P F  ++  ++ A++RE   WKR ++  ++  A K K
Sbjct  469   YFPAEHNYAVYAPLFASISAPLVAALIREIVAWKRARKAKQEDTAVKLK  517



>ref|XP_007485656.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Monodelphis 
domestica]
Length=612

 Score =   163 bits (412),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/331 (29%), Positives = 174/331 (53%), Gaps = 14/331 (4%)
 Frame = -3

Query  1592  PVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTP  1413
             P+ A     ++F+LLN DP      WD +   +  + P +     + + S++SQ+LY+  
Sbjct  277   PLKASLGYEITFSLLNPDPKSHEVHWDIEGAMESFVQPFLSLFGALGNFSMDSQILYYAM  336

Query  1412  KSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQ  1233
                   +D    SY  +   LP  +N  E  L +S A+   + V++F++YVP     PL 
Sbjct  337   LGVTPRFDAASSSYTLAAHSLPHVINPVEARLGSSAAS--LNPVINFLLYVPERAHSPLY  394

Query  1232  LLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLR  1053
             +   +G    TN F SP WGG++V+N    + N+   P++  +   ++ +V EVF+ Q+R
Sbjct  395   IQDKDGARVATNAFHSPRWGGIMVYNVDPKAYNTTKFPVKVNV---DMVQVMEVFLAQMR  451

Query  1052  QLFGLNSDSL---YVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRL  882
              LFG+    +   +V A   S      +G   WELD +    T  NL    TTL SL+ L
Sbjct  452   LLFGIPYPQMPANFVLAGPPS------EGLRSWELDRLLWARTVENLATVTTTLTSLAEL  505

Query  881   VQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             +  +  ++I D++  +V  ++DA   ++   + GN + +  +SR+A + +E AF+ PS++
Sbjct  506   LDKIGNIVIKDDVASEVYRAVDAVHDAIVELAAGNLNSAFHASREAVTSSEKAFFDPSLL  565

Query  701   SVSYYSFEHCFAVYSPFFLPVALHVILAVLR  609
              + Y+  +  FA+Y P FLP+A+ + L++++
Sbjct  566   HLLYFPDDQKFAIYIPLFLPMAVPIFLSMIK  596



>emb|CEF96649.1| Phosphatidylinositol-glycan biosynthesis class S protein [Ostreococcus 
tauri]
Length=508

 Score =   161 bits (407),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 182/360 (51%), Gaps = 29/360 (8%)
 Frame = -3

Query  1583  ADGRVVLSFNLLNADPH-DWIYDWDFQ-ELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             +DG ++ SF+L+NA+P   + + WDF+ +++   L  +  ALR + D+ +ESQVL H   
Sbjct  163   SDGVLLASFSLVNAEPRAGYAFTWDFERDVEQPRLGALPNALRRVIDLRIESQVLRHATS  222

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTS---TAAGGRSKVLHFVVYVPSEEECP  1239
                  W      ++   + LPFF++ + W +DTS   T   GR   L FVVYVPS  ECP
Sbjct  223   RIRPTWSATHDGFVVKSEQLPFFIDPD-WPIDTSITYTPVDGRP--LQFVVYVPSAAECP  279

Query  1238  LQLLLPNGELSKTNGFISPMWGGVVVWNPPSCS---KNSEMQPLRHKISSEELKKVFEVF  1068
             L  L  NGE ++ N ++   WGGVVV+NP  C+     SE      ++S +E+  V   F
Sbjct  280   LYFLDENGEATEQNAYLVEGWGGVVVFNPRGCAVVPGESE-----RRLSEDEISNVVNAF  334

Query  1067  MGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLS  888
             + QLR   GL      + AT     LT   GF  WE+D +       +     +TL SL 
Sbjct  335   VRQLRIHLGLRERPQNIDATVLPPKLT---GFATWEVDSLVHTRLVSDSSSAISTLKSLD  391

Query  887   RLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHP-  711
              ++ S+  + + + I  ++  S  A + +   + I  YD + V+++ A + AE AF+ P 
Sbjct  392   EVISSIDDIAVPEFIVNEMSRSFGALERATRLSEISRYDEALVNAQVAHAAAEAAFFDPF  451

Query  710   SMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLRE------WKRCKQENKKYLAWKAKVN  549
             S+  +  +SFE   A   P  LP    ++L ++RE       +RC  E +   A KAK +
Sbjct  452   SLGGLESFSFESKMASVIPLLLPCVFPLLLQIIREARHFQVRRRCASEAR---ARKAKAS  508



>ref|XP_010199273.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S, 
partial [Colius striatus]
Length=349

 Score =   157 bits (398),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/331 (29%), Positives = 175/331 (53%), Gaps = 16/331 (5%)
 Frame = -3

Query  1550  LNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSY  1371
             +N DP      WD ++     + P++  L  +A+ SV+SQ+LY+        +D++  S+
Sbjct  24    VNPDPKSHAVAWDIEDAVKRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSF  83

Query  1370  IFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGF  1191
             + S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F
Sbjct  84    LLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAF  141

Query  1190  ISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGA  1011
              SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + +    
Sbjct  142   HSPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSQEEV----  194

Query  1010  TATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGK  837
                  LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  
Sbjct  195   -PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVAS  253

Query  836   QVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH----CF  669
             +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +       
Sbjct  254   EVYRAVASAQSAMAELATGHLQSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQXXXXXX  313

Query  668   AVYSPFFLPVALHVILAVLREWKRCKQENKK  576
                 P FLP+A+ ++L++++  +  +Q  K+
Sbjct  314   XXXXPPFLPMAVPILLSLVKIVREARQHKKE  344



>ref|XP_008330935.1| PREDICTED: GPI transamidase component PIG-S [Cynoglossus semilaevis]
Length=587

 Score =   161 bits (408),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/335 (29%), Positives = 174/335 (52%), Gaps = 8/335 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P++  L PIA+ S++SQ LY+        +D 
Sbjct  260   ITFSLLNPDPKSHRLHWDIESAVETYVQPLLTKLAPIANFSIDSQTLYYAMLGVNPRFDI  319

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
              + SY  + + L   +N  E  L ++ A+   + VL+F++YVP     PL +L    +  
Sbjct  320   SRSSYTLNAESLAHVINPVEARLGSNAASS--NPVLNFLLYVPDALHSPLHILDRKKQAV  377

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F SP WGG++V+N         + P+   I+   + KV  VF+ QLR L G+ S S
Sbjct  378   HSNAFHSPRWGGIMVYNVNDVYGPEAVLPVDININ---MAKVMGVFLAQLRLLLGVQSSS  434

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G    S    S  G   WELD +    +  N+    TT+ SL++L+  +  ++I D 
Sbjct  435   PPPGFVVAS---CSSTGLADWELDRLMWSRSVENVATATTTITSLAQLLDQIGNIVINDN  491

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             I +QV  ++ + + +++    GN   +   S++A   +E AF+ PS++ + Y+  +  FA
Sbjct  492   IAEQVSSAVTSLQLAVAELEAGNLGFALQYSKEAILASERAFFDPSLLHLLYFPDDQKFA  551

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             +Y P FLP+ + ++L++++     +Q+ ++  A K
Sbjct  552   IYIPLFLPMCVPILLSLIKIASDARQKRREKQAKK  586



>ref|XP_009549961.1| hypothetical protein HETIRDRAFT_157379 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77948.1| hypothetical protein HETIRDRAFT_157379 [Heterobasidion irregulare 
TC 32-1]
Length=478

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/330 (32%), Positives = 169/330 (51%), Gaps = 22/330 (7%)
 Frame = -3

Query  1565  LSFNLLNADPHD--WIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTP---KSSF  1401
             L+F +LN D  D   +  WD +      L+ ++  +  + + ++ESQV YH P   +   
Sbjct  145   LAFTVLNEDAADGTAVIGWDIRNSISRHLSSLLHRISALHNFTIESQVRYHAPLAFEPHH  204

Query  1400  SGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLP  1221
              G D  +G Y  +  DL  FVNS EW L +S        VLHF++++PS    PL++L  
Sbjct  205   VGLD-NEGIYGLTQDDLKVFVNSAEWTLSSS---ASNDPVLHFILFIPSASHTPLRILDA  260

Query  1220  NGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG  1041
                 + +N F+ P WGGVV++N       S++ P +  +++ +L +VF +F  QL  L G
Sbjct  261   KNNPTSSNAFLLPQWGGVVLFN-----LQSDLAP-QTFLTTSDLDQVFSIFRLQLLSLLG  314

Query  1040  LNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
             +      +     S  LT       W+LD + RQ    N      TL S+++LV  +P M
Sbjct  315   VPRLPPNIVPANPSDPLT------DWQLDSLYRQRAIENAFSSKETLESIAKLVNEIPNM  368

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
              +  ++   V+ +L A +     A+         SSR A +LA  AF++P M+++ Y+  
Sbjct  369   PLGQDVRGDVQDALTALEKVYPAATNSPILALQYSSR-ALTLASRAFFNPGMLALLYFPA  427

Query  680   EHCFAVYSPFFLPVALHVILAVLREWKRCK  591
             EH +AVY+P F PVA+ ++   LREWK+ +
Sbjct  428   EHKYAVYTPLFAPVAVPLLATALREWKKAR  457



>gb|KDQ07435.1| hypothetical protein BOTBODRAFT_180713 [Botryobasidium botryosum 
FD-172 SS1]
Length=496

 Score =   160 bits (404),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 98/338 (29%), Positives = 172/338 (51%), Gaps = 23/338 (7%)
 Frame = -3

Query  1574  RVVLSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  L+F LLN D      I  W+     +  L+  ++ L  + + ++ESQV +H P +  
Sbjct  175   RYRLAFTLLNEDASVGGAIMGWEIASAINRYLSSSLERLHVLHNFTIESQVQFHAPLAFD  234

Query  1400  SGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLP  1221
                 +    Y+   + L  FVNS EW L +S +      VLHFV+++PS    PL+++  
Sbjct  235   PDTADNGKEYVLDQERLKTFVNSAEWTLASSVS---NDPVLHFVLFIPSAARRPLRIVQE  291

Query  1220  NGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG  1041
             NG  SK+N FI P WGG+++ NPP          L   +++ +L  +F  F  QL  L G
Sbjct  292   NGAPSKSNAFIVPQWGGIIIHNPPDHDH------LNQYLTAPDLSAIFTTFRTQLLALLG  345

Query  1040  LNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
             +            + ++ + +G + W LD + R+    N       LGS+ +LV  +  M
Sbjct  346   V--------PQFPANVVDTGEGISSWNLDAMLRRRAAENTKGSLEALGSIVKLVDRIKGM  397

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
              I +++      +L+      S+A + + + + + S +A +L+  AF++P M+++ Y+  
Sbjct  398   PIKNDVKGDFIEALEELDQVYSSA-VESPEAALLHSSRAHTLSSRAFFNPGMLAMLYFPA  456

Query  680   EHCFAVYSPFFLPVALHVILAVLRE---WKRCKQENKK  576
             EH +AVY+P F P A+ + +A++RE   WK+ +Q+  K
Sbjct  457   EHTYAVYTPLFAPAAVPLFVAIVREFKDWKKRRQDKTK  494



>ref|XP_003074319.1| putative phosphatidylinositol glycan class S (ISS) [Ostreococcus 
tauri]
Length=608

 Score =   161 bits (408),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 116/360 (32%), Positives = 182/360 (51%), Gaps = 29/360 (8%)
 Frame = -3

Query  1583  ADGRVVLSFNLLNADPH-DWIYDWDFQ-ELDDMLLAPIVQALRPIADVSVESQVLYHTPK  1410
             +DG ++ SF+L+NA+P   + + WDF+ +++   L  +  ALR + D+ +ESQVL H   
Sbjct  263   SDGVLLASFSLVNAEPRAGYAFTWDFERDVEQPRLGALPNALRRVIDLRIESQVLRHATS  322

Query  1409  SSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTS---TAAGGRSKVLHFVVYVPSEEECP  1239
                  W      ++   + LPFF++ + W +DTS   T   GR   L FVVYVPS  ECP
Sbjct  323   RIRPTWSATHDGFVVKSEQLPFFIDPD-WPIDTSITYTPVDGRP--LQFVVYVPSAAECP  379

Query  1238  LQLLLPNGELSKTNGFISPMWGGVVVWNPPSCS---KNSEMQPLRHKISSEELKKVFEVF  1068
             L  L  NGE ++ N ++   WGGVVV+NP  C+     SE      ++S +E+  V   F
Sbjct  380   LYFLDENGEATEQNAYLVEGWGGVVVFNPRGCAVVPGESE-----RRLSEDEISNVVNAF  434

Query  1067  MGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLS  888
             + QLR   GL      + AT     LT   GF  WE+D +       +     +TL SL 
Sbjct  435   VRQLRIHLGLRERPQNIDATVLPPKLT---GFATWEVDSLVHTRLVSDSSSAISTLKSLD  491

Query  887   RLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHP-  711
              ++ S+  + + + I  ++  S  A + +   + I  YD + V+++ A + AE AF+ P 
Sbjct  492   EVISSIDDIAVPEFIVNEMSRSFGALERATRLSEISRYDEALVNAQVAHAAAEAAFFDPF  551

Query  710   SMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLRE------WKRCKQENKKYLAWKAKVN  549
             S+  +  +SFE   A   P  LP    ++L ++RE       +RC  E +   A KAK +
Sbjct  552   SLGGLESFSFESKMASVIPLLLPCVFPLLLQIIREARHFQVRRRCASEAR---ARKAKAS  608



>ref|XP_003416997.1| PREDICTED: GPI transamidase component PIG-S [Loxodonta africana]
Length=555

 Score =   160 bits (405),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 172/330 (52%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVQRYVQPFLNALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGTPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P++ ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPTAYNASGLPVKVEV---DMVQVMEVFLAQLRLLFGIAQPH  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +       +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPPKCLFSG---PKSEGLMSWELDRLLWARSVENLATAMTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELATGHLASAFLASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLFKIFLETRKSWKK  550



>ref|XP_009807266.1| PREDICTED: GPI transamidase component PIG-S, partial [Gavia stellata]
Length=440

 Score =   158 bits (400),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 175/332 (53%), Gaps = 25/332 (8%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LL+ DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  130   ITFSLLSPDPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  189

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  190   ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  247

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  +        PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  248   STNAFHSPRWGGIMVYNVETPVSPEASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREE  304

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  305   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  359

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  360   DDVASEVYRAVASAQSAMAKLATGHLHSAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  419

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             F+             +  ++RE ++ K+E  K
Sbjct  420   FS-------------LAKIVREARQRKKEPTK  438



>ref|XP_010149468.1| PREDICTED: GPI transamidase component PIG-S, partial [Eurypyga 
helias]
Length=363

 Score =   156 bits (395),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 176/332 (53%), Gaps = 36/332 (11%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQ--VLYHTPKSSFSGW  1392
             ++F+LLN DP     DWD +   +  + P++  L  +A+ SV+SQ  +LY+        +
Sbjct  5     ITFSLLNPDPKSHAVDWDIEGAVNRYVQPVLDKLSVVANFSVDSQGRILYYAVLGVTPRF  64

Query  1391  DEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
             D++  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G 
Sbjct  65    DKESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGA  122

Query  1211  LSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNS  1032
              + TN F SP WGG++++N  + +      PL  ++   ++ +V EVF+ QLR LFGL+ 
Sbjct  123   PASTNAFHSPRWGGIMIYNVEAPASPQIPLPLHVEV---DMVRVMEVFLAQLRLLFGLSR  179

Query  1031  DSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             + L                             T  N+    TTL SL++L+  +  ++I 
Sbjct  180   EEL-----------------------------TVENIATVSTTLTSLAQLLDKIGNIVIK  210

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  211   DDVASEVYRAVASAQSAMAKLATGHLHVAFQASKEAVTSSERAFFDPSLLHLLYFPDDQK  270

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++ +  +  +Q  K+
Sbjct  271   FAIYIPLFLPMAVPILLSLAKIAREAQQRKKE  302



>ref|XP_007852141.1| gpi transamidase component pig-s [Moniliophthora roreri MCA 2997]
 gb|ESK88548.1| gpi transamidase component pig-s [Moniliophthora roreri MCA 2997]
Length=487

 Score =   159 bits (402),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 112/343 (33%), Positives = 176/343 (51%), Gaps = 38/343 (11%)
 Frame = -3

Query  1574  RVVLSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  LSF LLN D      I  WD        + PI+ AL  + + ++ESQV Y+ P +  
Sbjct  170   RYRLSFTLLNEDASGGQVITGWDVSRAISGHIKPILSALSVLHNFTIESQVQYYAPLAFE  229

Query  1400  SGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLP  1221
                  ++  Y  + +DL  F+NS EW L +S++      VLHFV++VPS    PL +L  
Sbjct  230   PKQLPEENRYGLTPEDLTVFINSAEWTLSSSSS---NDPVLHFVLFVPSANRRPLTILNA  286

Query  1220  NGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG  1041
              G+ S +N F+ P WGG+V+ + P     SEM     K+ + +L   F  F  QL  L G
Sbjct  287   GGKPSGSNAFLIPQWGGIVIADLPDLP--SEM-----KLPASQLASAFSAFSQQLLTLLG  339

Query  1040  LNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
             +    L  G ++TS L       T W++D + RQ T  N+ +   TL S   LV+ +  M
Sbjct  340   V--PRLPAGISSTSAL-------TPWQIDALLRQRTSENIARTRDTLRSTVSLVEQIENM  390

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSS------RQAR--SLAEDAFYHPSM  705
                  +G++V+  +  A  +L   S+ N+D  + SS      R  R  +L++ AF+HP M
Sbjct  391   ----PVGEKVRDDVQDALKTL--GSLWNFDEMSSSSLRSTLQRSGRALTLSQRAFFHPGM  444

Query  704   MSVSYYSFEHCFAVYSPFFLPVALHVILAVLRE---WKRCKQE  585
             +++ Y+  EH +AVY+P F+   + ++   LRE   WKR +++
Sbjct  445   LALLYFPAEHKYAVYTPLFVSATIPMLAGALREIIAWKRQRRQ  487



>ref|XP_008638620.1| PREDICTED: GPI transamidase component PIG-S-like, partial [Corvus 
brachyrhynchos]
Length=810

 Score =   162 bits (411),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 96/332 (29%), Positives = 177/332 (53%), Gaps = 13/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++ +LL  DP     DWD +   +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  485   ITLSLLKPDPKSHTVDWDIEGAVNRYVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  544

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  545   ESSSFLLSAHSLPHVINPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPV  602

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  603   STNAFHSPRWGGIMVYNVEAPASPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  659

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  660   V-----PPKFLLESPGNEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  714

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ + +S+++  S+G+   +  +S++A + +E AF+ PS++ + Y+     
Sbjct  715   DDVASEVYRAVASVQSAVTELSLGHLHAAFQASKEAVTSSERAFFDPSLLHLLYFPXXXX  774

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
                    FLP+A+ ++L++ +  +  +Q  K+
Sbjct  775   XXXXX-LFLPMAVPILLSLAKIVRETRQRTKE  805



>gb|KFP78042.1| GPI transamidase component PIG-S, partial [Apaloderma vittatum]
Length=288

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 159/290 (55%), Gaps = 12/290 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  6     ITFSLLNPDPKSHAVEWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  65

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  66    ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGATV  123

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PLR  +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  124   STNAFHSPRWGGIMVYNVEAPASPQVSLPLRVDV---DMVRVMEVFLAQLRLLFGLSREE  180

Query  1025  LYVGATATSRLLT--SEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL     +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  181   L-----PPEFLLERPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  235

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++
Sbjct  236   DDVASEVYQAVSSAQSAMAELAAGHLYSAFQASKEAVTSSERAFFDPSLL  285



>ref|XP_005093987.1| PREDICTED: GPI transamidase component PIG-S-like [Aplysia californica]
Length=543

 Score =   159 bits (401),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/334 (31%), Positives = 175/334 (52%), Gaps = 21/334 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F L+  +P     DWD +      L P+  +L    D+S+ SQVLY        G  +
Sbjct  222   VTFTLMVPEPERVRVDWDIETGIKDYLQPLKASLDEYIDISISSQVLYFI---GIGGRPK  278

Query  1385  K-QGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
             K  G Y F  +DLP  +N  E  L +       +  ++F+VY+P+  + PL +    G  
Sbjct  279   KGDGFYFFQEQDLPHIINPLESKLGSH---ASNNPGMNFIVYIPTVNKRPLFIHDNKGVP  335

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN--  1035
               +N F+SP WGGV+++N  S   NS  QP  +   + ++ KV EVF+ Q+R L  +N  
Sbjct  336   VPSNSFLSPRWGGVMIYNSESSGVNSS-QPDSN--VNVDMHKVMEVFISQMRLLLNINAQ  392

Query  1034  --SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
               ++ L +  T ++RL        QWEL    R     NL     TL SL++L++ +  +
Sbjct  393   LMTEELLIVQTGSARL-------QQWELSAWLRSRCVENLAAATLTLQSLAQLLEEIGNI  445

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
             +I DEIGK+V+ ++ + K S     +G+   + ++SR A   +E AF+HPS++ + Y+  
Sbjct  446   VINDEIGKEVESAVASIKDSQRQLLLGDLHAAFLASRAAVEASELAFFHPSLLELLYFPE  505

Query  680   EHCFAVYSPFFLPVALHVILAVLREWKRCKQENK  579
             +  FA+Y P FLP+++ ++ +VL   K  ++  K
Sbjct  506   DQKFAIYIPLFLPISIPILTSVLHAIKFFRRPPK  539



>ref|XP_009871948.1| PREDICTED: GPI transamidase component PIG-S, partial [Apaloderma 
vittatum]
Length=299

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 159/290 (55%), Gaps = 12/290 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     +WD ++  +  + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  18    ITFSLLNPDPKSHAVEWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDK  77

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  78    ESSSFLLSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGATV  135

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  + +      PLR  +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  136   STNAFHSPRWGGIMVYNVEAPASPQVSLPLRVDV---DMVRVMEVFLAQLRLLFGLSREE  192

Query  1025  LYVGATATSRLLT--SEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL     +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  193   L-----PPEFLLERPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  247

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             D++  +V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++
Sbjct  248   DDVASEVYQAVSSAQSAMAELAAGHLYSAFQASKEAVTSSERAFFDPSLL  297



>gb|KFQ46054.1| GPI transamidase component PIG-S, partial [Nestor notabilis]
Length=386

 Score =   155 bits (392),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/290 (32%), Positives = 157/290 (54%), Gaps = 12/290 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP     +WD +E     + P++  L  +A+ SV+SQ+LY+        +D+
Sbjct  105   ITFSLLNPDPKSHDVNWDIEEAVTRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRYDK  164

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  S++ S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  165   ESSSFLLSTHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPV  222

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG+VV+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + 
Sbjct  223   STNAFHSPRWGGIVVYNVEAPAAPQASLPLHVDV---DMARVMEVFLAQLRLLFGLSREE  279

Query  1025  LYVGATATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I 
Sbjct  280   L-----PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIK  334

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMM  702
             D++  +V  ++ +A+S++   + G+   +  +S++A + +E AF+ PS++
Sbjct  335   DDVASEVYRAVASAQSAMDKLATGHLHPAFQASKEAATSSERAFFDPSLL  384



>emb|CDO70983.1| hypothetical protein BN946_scf184830.g15 [Trametes cinnabarina]
Length=408

 Score =   155 bits (391),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 101/330 (31%), Positives = 165/330 (50%), Gaps = 14/330 (4%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDW--IYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  L+F LLN D      +  WD Q      + P+++ L  + + ++ESQV +H P +  
Sbjct  60    RYRLAFTLLNEDAASGTGVMAWDVQGAIRSHIGPLLEKLSDLHNFTIESQVQFHAPLAFE  119

Query  1400  SGWDEKQGSYIFSI--KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL  1227
                     + +  +  +DL  F+NS EW L +S +      VLHFV+++PS +  PL +L
Sbjct  120   PRLLRHNDTEVHGLAHEDLTVFINSAEWTLSSSVS---NDPVLHFVLFIPSAKNTPLHIL  176

Query  1226  ---LPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQL  1056
                 P G +  +N F+ P WGG+V+ NP   S  S       +++  +L  VF  F  QL
Sbjct  177   DQQAPTGSIHPSNAFLLPQWGGIVIMNP---SHKSFTSTTISRLTVADLSPVFSTFAHQL  233

Query  1055  RQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQ  876
               L G+     +V            + FT WELD + R+    N+     TL ++ RLV 
Sbjct  234   LTLLGVPGLPPHVRPARRPENDAHREPFTDWELDALLRRRALENVQSSMETLEAIVRLVD  293

Query  875   SLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSV  696
              +  M + +++   V+ +LDA   +  ++     +    S+R A +LA  AF++P M+++
Sbjct  294   QIENMPVGEDVVGDVQDALDALNDAHESSRFSPVETLKHSAR-ALTLASRAFFNPGMLAL  352

Query  695   SYYSFEHCFAVYSPFFLPVALHVILAVLRE  606
              Y+  EH +AVY+P F  VA  +I AV+RE
Sbjct  353   LYFPAEHTYAVYTPLFASVAAPLIGAVIRE  382



>ref|XP_005583289.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Macaca 
fascicularis]
Length=458

 Score =   155 bits (392),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  132   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  191

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  192   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  249

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  250   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  306

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  307   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  361

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  362   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  421

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +    +  KK
Sbjct  422   FAIYIPLFLPMAVPILLSLVKIFLETHKSWKK  453



>ref|XP_004605349.1| PREDICTED: GPI transamidase component PIG-S [Sorex araneus]
Length=555

 Score =   157 bits (396),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 97/335 (29%), Positives = 172/335 (51%), Gaps = 18/335 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P V AL    ++SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHEIHWDIEGAVRHYVQPFVDALSIAGNISVDSQILYYAMLGVNPRFDA  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P++ ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVKVEV---DMVQVMEVFLAQLRLLFGIPEPQ  403

Query  1025  -----LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
                  L++G  +         G   WE+D +    T  NL     TL SL++L+  +  +
Sbjct  404   MPPYCLFLGPPS--------GGLMTWEVDRLLWARTLENLATATATLTSLAQLLGKISNI  455

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
             +I D++  +V  ++ A + +    + G    +  +S++A + +E AF+ PS++ + Y+  
Sbjct  456   VIKDDVASEVYRAVAAVQKAAEELASGRLVSAFTASQEAVTSSERAFFDPSLLHLLYFPD  515

Query  680   EHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +  FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  516   DQKFAIYIPLFLPMAVPILLSLVKIFLEMRKSWKK  550



>ref|XP_003770093.1| PREDICTED: GPI transamidase component PIG-S [Sarcophilus harrisii]
Length=579

 Score =   156 bits (394),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/335 (28%), Positives = 174/335 (52%), Gaps = 15/335 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P +  L  + + S++SQ+LY+        +D 
Sbjct  253   ITFSLLNPDPKSHEVHWDIEGAVENYVQPFLSLLSVVGNFSMDSQILYYAMLGVTPRFDA  312

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L   + A     V++F++YVP     PL +   +G   
Sbjct  313   ASSSYTLAAYSLPHVINPVEARL--GSRATSLYPVINFLLYVPERAHSPLYIQDKDGARV  370

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P++  +   ++  V EVF+ Q+R LFG+    
Sbjct  371   ATNAFHSPRWGGIMVYNVDPSAYNTTKYPVKVDV---DMVPVMEVFLSQMRLLFGIPPPQ  427

Query  1025  LYVGATATSRLL--TSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +       + LL     +G   WE+D +    T  N+    TTL SL+ L+  +  ++I 
Sbjct  428   M-----PENFLLGDPPREGLRSWEVDRLVWARTVENVATVVTTLTSLAELLDKIGNIVIK  482

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D +  +V  ++DA + ++   S GN + +   SR+A + +E AF+ PS++ + Y+  +  
Sbjct  483   DNVASEVYRAVDAIQEAVVELSAGNLELAFRYSREAVTSSEKAFFDPSLLHLLYFPDDQK  542

Query  671   FAVYSPFFLPVALHVILAVLR---EWKRCKQENKK  576
             FA+Y P FLP+A+ + L++++   E ++ +++ +K
Sbjct  543   FAIYIPLFLPMAVPIFLSMIKIIVENQKARKDIEK  577



>ref|XP_002611905.1| hypothetical protein BRAFLDRAFT_249423 [Branchiostoma floridae]
 gb|EEN67914.1| hypothetical protein BRAFLDRAFT_249423 [Branchiostoma floridae]
Length=332

 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/325 (31%), Positives = 162/325 (50%), Gaps = 16/325 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      L P +  L  +A+  V SQVLY+   +     DE
Sbjct  21    VTFSLLNPDPSVLDVQWDVEAGTASYLNPFLDRLADVAEFKVFSQVLYYVDLTVRPARDE  80

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             +  SY  +   LP  +N  E  L +  +       +HF+VYVP     PL +   +G  S
Sbjct  81    RTASYCLTPDQLPHTINPVEAKLGSHVSTYPS---VHFLVYVPERGHSPLYIHNEDGMES  137

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG---LN  1035
             +TN F SP WGG+ + N  S  KN+    L H ++ + L  V E F+  LR L G   L 
Sbjct  138   ETNAFFSPRWGGMKIVNVASPPKNAS---LPHTVTLD-LLPVMETFLSHLRLLLGMAQLP  193

Query  1034  SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMII  855
              D   V   A +         T WE D + R  T  NL     TL SLS+L+  +  ++I
Sbjct  194   PDPWIVVEPADN------TAITDWEYDHLLRVRTVENLATATATLASLSQLLGEIGNIVI  247

Query  854   MDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH  675
              D+I  QV  ++DA + +    + G    +  +S++A   +E AF+ PS++ + Y+  + 
Sbjct  248   NDDIAWQVYLAVDAIRKAQLLLATGELTAAFQASKEAILSSEKAFFDPSLLELLYFPEDQ  307

Query  674   CFAVYSPFFLPVALHVILAVLREWK  600
              FA+Y P FLP+++ V++++ + ++
Sbjct  308   KFAIYIPLFLPMSVPVLMSLFQAFR  332



>ref|NP_001127081.1| GPI transamidase component PIG-S [Pongo abelii]
 emb|CAI29629.1| hypothetical protein [Pongo abelii]
Length=494

 Score =   154 bits (390),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +        P + AL    + SV+SQ+LY+        +D 
Sbjct  168   ITFSLLNPDPKSHDVHWDIEGAVRRYAQPFLNALSAAGNFSVDSQILYYAVLGVNPRFDS  227

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  228   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  285

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  286   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  342

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  343   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  397

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  398   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK  457

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  458   FAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  489



>ref|XP_001107461.1| PREDICTED: GPI transamidase component PIG-S-like isoform 2 [Macaca 
mulatta]
 ref|XP_005583288.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Macaca 
fascicularis]
 gb|EHH57822.1| hypothetical protein EGM_07549 [Macaca fascicularis]
Length=555

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +    +  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETHKSWKK  550



>ref|XP_007183950.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=555

 Score =   155 bits (392),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR + + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVQRYVQPFLNALRAVGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSSAAS--LYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             +      +    +  +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   MPPKCLFSG---SKSEGIMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLFKIFLETRKSWKK  550



>ref|XP_636197.1| phosphatidylinositol glycan, class S [Dictyostelium discoideum 
AX4]
 gb|EAL62689.1| phosphatidylinositol glycan, class S [Dictyostelium discoideum 
AX4]
Length=407

 Score =   153 bits (386),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/334 (29%), Positives = 174/334 (52%), Gaps = 16/334 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             LSF LLN+DP D I  WDF  L +  + P ++ +  IA+ +V+S++ ++        +D 
Sbjct  83    LSFTLLNSDPSDIIPKWDFPYLSNKYIQPFIEQISDIANFTVQSKISHYATLLKSPLYDS  142

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             K+ SY      L  ++N NEW LDT +        L+F++Y+P   + PL +        
Sbjct  143   KENSYYIPSAFLSEYINPNEWQLDTPST---NQPTLNFIIYIPKTTQSPLYI----RSNQ  195

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F+ P WGG+++ N  +    +   P+     + EL+     F  QL++L G+N+++
Sbjct  196   NSNSFLIPQWGGIIIHNVNNNKNKNNNGPIDL---TNELEDQMVSFKYQLKELLGINNEN  252

Query  1025  LYVGATATSRLLTSEKG----FTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMI  858
                      +            +  E+D   +++T  N+    +TL SLS L++SLP M+
Sbjct  253   NKNNNKNNEKKEKKYLEKDIILSNDEIDSTIKRYTAENINVSISTLYSLSSLIESLPNML  312

Query  857   IMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFE  678
             ++D I  QVK ++++   +       +Y+ +  +S+Q+ + +E AF+  +M+S  Y+  E
Sbjct  313   VLDNIRDQVKVAIESLGRAHQCLEQSDYNCALQASKQSLASSESAFFDKNMLSQLYFPDE  372

Query  677   HCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             H +AVY+P F+PV   +I  + +E+K  +  NKK
Sbjct  373   HKYAVYTPLFVPVCFPIIAGIFQEFKHYR--NKK  404



>gb|EHH24634.1| hypothetical protein EGK_08327 [Macaca mulatta]
Length=555

 Score =   155 bits (392),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/337 (31%), Positives = 179/337 (53%), Gaps = 19/337 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVL-------REWKRCKQEN  582
             FA+Y P FLP+A+ ++L+++       + WK+ ++ +
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETHKSWKKPEKTD  555



>ref|XP_010791814.1| PREDICTED: GPI transamidase component PIG-S [Notothenia coriiceps]
Length=562

 Score =   155 bits (392),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 170/335 (51%), Gaps = 8/335 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P++  L P+A+ S++SQ LY+        +D 
Sbjct  235   ITFSLLNPDPKSHRLHWDIEGAVQTYIQPLLTKLAPVANFSIDSQTLYYAMLGVNPRFDS  294

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
              + +Y  +   L   +N  E  L ++ A+   + VL+F++Y P  +  PL +     +  
Sbjct  295   SRNAYTLNSDSLAHVINPVEARLGSNAASS--NPVLNFLLYAPDAQHSPLYIQDRQKQKV  352

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F SP WGG++V+N  S      + P+   I   ++ KV  VF+ QLR L G+ S +
Sbjct  353   PSNAFHSPRWGGIMVYNVNSFYGPEAVFPVDINI---DMAKVMGVFLAQLRLLLGVQSST  409

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G         S  G   WELD +    +  N+    TT+ SL++L+  +  ++I D 
Sbjct  410   APPGFLVAP---CSSTGLADWELDRLMWSRSVENVATAATTITSLAQLLDQIGNIVINDN  466

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             I +QV  ++ + + +++    GN   +   S++A   +E AF+ PS++ + Y+  +  FA
Sbjct  467   IAEQVSSAVTSLQLAVAELEAGNLGFALQYSKEAILASERAFFDPSLLHLLYFPDDQKFA  526

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             +Y P FLP+ + ++L++L+     +Q  K+  A K
Sbjct  527   IYIPLFLPMCVPILLSLLKIISDARQRRKERQAKK  561



>ref|XP_003912553.1| PREDICTED: GPI transamidase component PIG-S [Papio anubis]
Length=555

 Score =   155 bits (391),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSRPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +    +  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETHKSWKK  550



>ref|XP_004267181.1| PREDICTED: GPI transamidase component PIG-S [Orcinus orca]
Length=555

 Score =   155 bits (391),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 173/330 (52%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR + + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALRAVGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +       +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPPKCLFSG---PKSEGIMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLFKIFLETRKSWKK  550



>ref|XP_781371.3| PREDICTED: GPI transamidase component PIG-S-like [Strongylocentrotus 
purpuratus]
Length=550

 Score =   154 bits (390),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 176/332 (53%), Gaps = 16/332 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             LSF LL  +PH+    W+      + L P+ + L   A+ +V SQVLY+T  S      +
Sbjct  229   LSFTLLIPEPHNIQAHWNLDHAQKVYLDPLTRKLEEFAEFTVASQVLYYTSLSV--KPKK  286

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
             K  S+ FS   LP  +   E  L +          L+FVVY+P  ++ PL +   NG+  
Sbjct  287   KDSSFYFSHSSLPHIITPVEAKLGSHATNFPN---LNFVVYIPPLDQSPLYIHSSNGKPV  343

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F+SP WGGV++ N P   +N+  +P+  ++ +     V  VF+ QLR L G+ S  
Sbjct  344   STNAFLSPRWGGVLIHNTPIPDENA-TRPVWVEVKNS---AVMPVFLAQLRLLLGIPSPD  399

Query  1025  LYVGATATSRLL--TSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
                     S LL    E     WE D + R+H   NL     +L SLS+L++ +  ++I 
Sbjct  400   -----DIESVLLEKPKEHSVLDWEYDSLLRRHCVENLASASASLFSLSQLLEKISNIVIN  454

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D+I KQV  ++++ +SS    + G    +  +S++A   +E AF+ PS++ + Y+  +  
Sbjct  455   DDIAKQVYTAVESIQSSHRFLAEGKLHPAFHASKRALIASEKAFFDPSLLQLLYFPDDQK  514

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLPV++ V+L++++ +K  KQ+ +K
Sbjct  515   FAIYIPLFLPVSIPVVLSLIKAFKWIKQQRRK  546



>ref|XP_003277168.1| PREDICTED: LOW QUALITY PROTEIN: GPI transamidase component PIG-S 
[Nomascus leucogenys]
Length=557

 Score =   154 bits (389),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 178/332 (54%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  231   ITFSLLNPDPKSHDVHWDIEGAVLRYVQPFLNALSATGNFSVDSQILYYAMLGVNPRFDS  290

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  291   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  348

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  349   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAHPQ  405

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  406   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  460

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  461   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK  520

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L+++R +   ++  KK
Sbjct  521   FAIYIPLFLPMAVPILLSLVRIFLETRKSWKK  552



>gb|KFQ35328.1| GPI transamidase component PIG-S, partial [Merops nubicus]
Length=281

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 88/287 (31%), Positives = 155/287 (54%), Gaps = 12/287 (4%)
 Frame = -3

Query  1541  DPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFS  1362
             DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S
Sbjct  1     DPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLS  60

Query  1361  IKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISP  1182
                LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP
Sbjct  61    AHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSP  118

Query  1181  MWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
              WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L       
Sbjct  119   RWGGIMIYNVEAPASPEASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PP  170

Query  1001  SRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK  828
               LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V 
Sbjct  171   EFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVY  230

Query  827   FSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
              ++ +A+S+L+  + G+   +  +S++A + +E AF+ PS++ + Y+
Sbjct  231   RAVASAQSALAELAAGHLHLAFKASKEAVTSSEKAFFDPSLLHLLYF  277



>ref|XP_010746523.1| PREDICTED: GPI transamidase component PIG-S [Larimichthys crocea]
Length=562

 Score =   154 bits (389),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 93/330 (28%), Positives = 167/330 (51%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P++  L P+A+ S++SQ LY+T       +D 
Sbjct  235   ITFSLLNPDPKSHRLHWDIESAVQTYIQPLLTKLAPLANFSIDSQTLYYTMLGVNPRFDS  294

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
              +  Y+ +   L   +N  E  L ++ A+   + VL+F++YVP     PL +     +  
Sbjct  295   SRSIYMLNADSLAHVINPVEARLGSNAASS--NPVLNFLLYVPDAHHSPLHIHDHKKQEV  352

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F SP WGG++V+N           P+   I+   + KV  VF+ QLR L G+ S S
Sbjct  353   PSNAFHSPRWGGIMVYNVDGFYGPEAAFPVDININ---MAKVMGVFLAQLRLLLGVQSSS  409

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G         S  G   WELD +    +  N+    TT+ SL++L+  +  ++I D 
Sbjct  410   PPPGFRVAP---CSSAGLADWELDRLMWSRSVENVATATTTITSLAQLLDQIGNIVINDN  466

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             I +QV  ++ + + +++    GN   +   S++A   +E AF+ PS++ + Y+  +  FA
Sbjct  467   IAQQVSSAVTSLQLAVAELEAGNLGFALQYSKEAILASERAFFDPSLLHLLYFPDDQKFA  526

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+ + ++L++L+     +Q  ++
Sbjct  527   IYIPLFLPMCVPILLSLLKIMSEARQRRRE  556



>ref|XP_002748296.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Callithrix 
jacchus]
Length=555

 Score =   154 bits (389),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKAYNASALPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G T WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLTTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DNVASEVYRAVAAIQKSAEELASGHLASAFVASQEAVTSSECAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_004399710.1| PREDICTED: GPI transamidase component PIG-S isoform 2 [Odobenus 
rosmarus divergens]
Length=458

 Score =   152 bits (385),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 176/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  132   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  191

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  192   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  249

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  250   PTNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVQVMEVFLAQLRLLFGIAQPQ  306

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +    +  +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  307   MPLKCLFSG---SKSEGLTTWELDRLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  363

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  364   VASEVYRAVAAVQKAAEELASGHLASAFIASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  423

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  424   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  453



>ref|XP_008008982.1| PREDICTED: GPI transamidase component PIG-S [Chlorocebus sabaeus]
Length=555

 Score =   154 bits (388),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/332 (31%), Positives = 176/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+ + P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKTYNASVLPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSVGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +    +  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETHKSWKK  550



>ref|XP_002912373.1| PREDICTED: GPI transamidase component PIG-S-like [Ailuropoda 
melanoleuca]
 gb|EFB26135.1| hypothetical protein PANDA_000118 [Ailuropoda melanoleuca]
Length=555

 Score =   154 bits (388),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 97/330 (29%), Positives = 174/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +       +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  404   MPLKCLFSG---PKSEGLTTWELDRLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G    + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGRLASAFIASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L+++R +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLVRIFLETRKSWKK  550



>ref|XP_006731646.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Leptonychotes 
weddellii]
Length=458

 Score =   152 bits (384),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 176/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  132   ITFSLLNPDPKSHGVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  191

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  192   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  249

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  250   ATNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVQVMEVFLAQLRLLFGIAQPQ  306

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +    +  +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  307   MPLKCLFSG---SKSEGLTTWELDQLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  363

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  364   VASEVYRAVAAVQKAAEELASGHLASAFIASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  423

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  424   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  453



>ref|XP_003931469.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Saimiri 
boliviensis boliviensis]
Length=555

 Score =   153 bits (387),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/332 (31%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKAYNASALPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAIQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_008995450.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Callithrix 
jacchus]
Length=578

 Score =   153 bits (387),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/332 (31%), Positives = 178/332 (54%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  252   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  311

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  312   ASSSYYLDMHNLPHVINPVESRLGSSAAS--LYPVLNFLLYVPELAHSPLYIQDKDGAPV  369

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  370   ATNAFHSPRWGGIMVYNVDSKAYNASALPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  426

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G T WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  427   V-----PPKCLLSGPKSEGLTTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  481

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  482   DNVASEVYRAVAAIQKSAEELASGHLASAFVASQEAVTSSECAFFDPSLLHLLYFPDDQK  541

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  542   FAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  573



>ref|XP_003996538.1| PREDICTED: GPI transamidase component PIG-S [Felis catus]
Length=555

 Score =   153 bits (387),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 99/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++++V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNASKLPVRVEV---DMEQVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L V    +       +G T WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPVKCLFSG---PKSEGLTTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFTASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_008944491.1| PREDICTED: GPI transamidase component PIG-S, partial [Merops 
nubicus]
Length=307

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 88/287 (31%), Positives = 155/287 (54%), Gaps = 12/287 (4%)
 Frame = -3

Query  1541  DPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFS  1362
             DP     DWD ++  +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S
Sbjct  4     DPKSHAVDWDIEDAVNRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFLLS  63

Query  1361  IKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISP  1182
                LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F SP
Sbjct  64    AHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSP  121

Query  1181  MWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATAT  1002
              WGG++++N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + L       
Sbjct  122   RWGGIMIYNVEAPASPEASLPLHVDV---DMVRVMEVFLAQLRLLFGLSREEL-----PP  173

Query  1001  SRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVK  828
               LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V 
Sbjct  174   EFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVY  233

Query  827   FSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
              ++ +A+S+L+  + G+   +  +S++A + +E AF+ PS++ + Y+
Sbjct  234   RAVASAQSALAELAAGHLHLAFKASKEAVTSSEKAFFDPSLLHLLYF  280



>gb|AAH07301.2| PIGS protein, partial [Homo sapiens]
Length=474

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 177/330 (54%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  148   ITFSLLNPDPKSHDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDS  207

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  208   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  265

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  266   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  322

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    TSE G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  323   LPPKCLLSGP--TSE-GLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  379

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  380   VASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFA  439

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  440   IYIPLFLPMAVPILLSLVKIFLETRKSWRK  469



>tpe|CBF80962.1| TPA: GPI transamidase component PIG-S, putative (AFU_orthologue; 
AFUA_6G07180) [Aspergillus nidulans FGSC A4]
Length=565

 Score =   153 bits (386),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/340 (30%), Positives = 162/340 (48%), Gaps = 35/340 (10%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV-LYHT--PKSSFSG  1395
             L+F+L    P      WD +      ++PIVQAL PI++ +V++QV LY T  P +    
Sbjct  252   LAFSLFTPGPAP--SSWDIESAVQGYISPIVQALSPISNFTVDTQVQLYATFSPTTPVPE  309

Query  1394  WDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNG  1215
             +DE QG +    ++L  F+N+ EW L+ S  +G     ++F++YVP+  + PL +     
Sbjct  310   YDETQGVWTLKEENLSAFINAAEWPLNPSIGSG---PTINFILYVPAPSQSPLLV-----  361

Query  1214  ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLN  1035
             + SK   +I P WGGV + NPP  + +   Q     +  + L+  F  F  QL  L G  
Sbjct  362   QESKATSWIIPQWGGVFILNPPLSTTDGSAQSNPPHLPRDALRAPFLTFSHQLLSLLGTP  421

Query  1034  SDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMII  855
             S    +                 + L  + R      LL   +T+GSL+RL +SLP + I
Sbjct  422   STPPSL----------------PFRLQTLIRIRAATVLLSASSTMGSLARLTESLPSIPI  465

Query  854   MDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH  675
                +   V  +L    SS  +   G +  +  S+R A + AE +F+  SM+   Y+  EH
Sbjct  466   PATVASSVATTLSHLSSSCESLQNGQFQAALASARVAEAEAERSFFEKSMVGQMYFPDEH  525

Query  674   CFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWKAK  555
               AVY P   P+ + ++L +L+E KR          WKA+
Sbjct  526   KVAVYLPLLGPIGVPLVLGLLKEVKRV------VTGWKAR  559



>emb|CCJ31432.1| unnamed protein product [Pneumocystis jirovecii]
Length=516

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 176/338 (52%), Gaps = 26/338 (8%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             + F+L+N D  + +  WD ++  ++   P+++ L  +++ +VESQ+ +   + +F+ +  
Sbjct  192   IVFSLVNGDEKNVVSFWDIKK-AEVYFRPLLRQLSALSEFNVESQI-HFCSELTFNPYKS  249

Query  1385  KQGS-YIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGEL  1209
             KQG+ +  SI   P FVN  EW+L+T+ ++    K+++F+VYVP     PL L   +  L
Sbjct  250   KQGNMFQISIDQFPEFVNFAEWNLETTFSSH---KIINFLVYVPPRNIQPLFLKDLHDNL  306

Query  1208  SKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSD  1029
               TN F+ P WG +++ N     +N     + H ++  +L+ +F +F+     L G  S 
Sbjct  307   ITTNSFLVPQWGSIIIHN-----QNHTDIDISH-LNITQLQPIFHIFISNFLSLLGTPSL  360

Query  1028  SLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMD  849
               Y+       L         W LD + RQ    N++    TLGSL+RL Q +  M+I D
Sbjct  361   PSYISIEPLPVL-------NAWRLDGLYRQRITENIISASETLGSLARLAQRIHNMVIPD  413

Query  848   EIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCF  669
             ++ + V  ++D  K +  + +   +  +   SR A + AE AF+ PSM+S+ Y+  EH +
Sbjct  414   QVQQDVSKTIDYLKKTCQSLNDSKFSNALNYSRIAVNSAEKAFFDPSMVSMLYFPDEHKY  473

Query  668   AVYSPFFLPVALHVILAVLRE-------WKRCKQENKK  576
              VY P F P+   +++ +LRE       WK  + E K+
Sbjct  474   GVYLPLFGPLFFPLVIPLLREFSNFLKSWKTKRNEKKE  511



>ref|XP_004399709.1| PREDICTED: GPI transamidase component PIG-S isoform 1 [Odobenus 
rosmarus divergens]
Length=555

 Score =   152 bits (385),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 176/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   PTNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVQVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +    +  +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  404   MPLKCLFSG---SKSEGLTTWELDRLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFIASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_007384351.1| hypothetical protein PUNSTDRAFT_103264 [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN08399.1| hypothetical protein PUNSTDRAFT_103264 [Punctularia strigosozonata 
HHB-11173 SS5]
Length=496

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 107/343 (31%), Positives = 181/343 (53%), Gaps = 25/343 (7%)
 Frame = -3

Query  1622  EEGSIHGEFMPVGADGRVVLSFNLLNADPHD--WIYDWDFQELDDMLLAPIVQALRPIAD  1449
             EE + HG  +   A  R  L+F+LLN D  +      WD +      L PI++ LRP+ +
Sbjct  150   EEVASHGHRVAQYAP-RYRLAFSLLNEDAAEGKAALTWDVRTSITQHLEPILERLRPLHN  208

Query  1448  VSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFV  1269
              ++ESQ+ +H P +  +     +G Y  + +DL  FVNS EW L +S +      VLHF+
Sbjct  209   FTIESQIRFHAPLA-ITPQPLVEG-YGINPEDLAVFVNSAEWTLSSSVS---NDPVLHFI  263

Query  1268  VYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEEL  1089
             +++PS    PL +L  NG  SK++ FI P WGG+V++NPP+   + ++ P         L
Sbjct  264   LFIPSATRRPLHILDSNGSPSKSSAFILPQWGGIVIFNPPTTEGHFDLPP-------PTL  316

Query  1088  KKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCG  909
                F  F  QL  L G+     ++  T  +         T W+LD + R+    N+    
Sbjct  317   DAPFSTFRYQLLSLLGVPPLPPWLETTDAA------TTITDWQLDTLLRRRALENVKNSE  370

Query  908   TTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS-SRQARSLA  732
              TL S+++LV  +  M I  ++   V+ +L+A +      ++ +   SA++ S +A +L+
Sbjct  371   ETLQSIAKLVHQIDNMPIGPDVRGDVQGALNALEKVY---ALRDSPSSALAHSAEALTLS  427

Query  731   EDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREW  603
               AF++P M+++ Y+  EH +AVY P F+P+++ +I A  RE+
Sbjct  428   SRAFFNPGMLALLYFPAEHKYAVYMPLFVPISVPLIAAAGREF  470



>ref|XP_004042046.1| PREDICTED: GPI transamidase component PIG-S isoform 2 [Gorilla 
gorilla gorilla]
Length=494

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  168   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  227

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  228   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  285

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  286   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  342

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  343   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  397

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  398   DDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK  457

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  458   FAIYIPLFLPMAVPILLSLVKIFLETRKSWRK  489



>dbj|BAG59572.1| unnamed protein product [Homo sapiens]
Length=494

 Score =   152 bits (383),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 177/330 (54%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  168   ITFSLLNPDPKSHDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDS  227

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  228   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  285

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  286   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  342

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    TSE G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  343   LPPKCLLSGP--TSE-GLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  399

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  400   VASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPNDQKFA  459

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  460   IYIPLFLPMAVPILLSLVKIFLETRKSWRK  489



>ref|XP_004684919.1| PREDICTED: GPI transamidase component PIG-S [Condylura cristata]
Length=555

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 101/338 (30%), Positives = 178/338 (53%), Gaps = 21/338 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    ++SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVQHYVQPFLNALSVAGNISVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHTPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVRVMEVFLAQLRLLFGIAQPH  403

Query  1025  LYVGATATSRLLTSE---KGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMII  855
             +        + L S+   +G   WELD +    +  NL    TTL SL++L+  +  ++I
Sbjct  404   V------PPKCLLSQPQSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVI  457

Query  854   MDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEH  675
              D++  +V  ++ A + +    + G+   + VSS++A + +E AF+ PS++ + Y+  + 
Sbjct  458   KDDVASEVYRAVAAVQKAAEELATGHLASAFVSSQEAVTSSERAFFDPSLLHLLYFPDDQ  517

Query  674   CFAVYSPFFLPVALHVILAV-------LREWKRCKQEN  582
              FA+Y P FLP+A+ ++L++       L+ WK+ ++ +
Sbjct  518   KFAIYIPLFLPMAVPILLSLVKISLETLKSWKKPEKTD  555



>ref|XP_010863992.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Esox 
lucius]
Length=451

 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 90/339 (27%), Positives = 171/339 (50%), Gaps = 19/339 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP   +  WD +      + P++  + P+A+ S++SQ+LY+        +D 
Sbjct  127   ITFSLLNPDPTSHLLHWDVEAAISSYIQPLLSKMAPVANFSIDSQILYYAVLGVNPRYDP  186

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                +Y  +   L   +N  E  L +S A+   + VL+F++YVP     PL +        
Sbjct  187   TLNAYTLNADSLSHVINPVEARLGSSAASS--NPVLNFLLYVPDSRHSPLHITDHRRHTV  244

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F SP WGG++V+N    + +    P+   I   ++++V  VF+ QLR + G+ S +
Sbjct  245   PSNAFSSPRWGGIMVYN---VNASGTELPVDVHI---DMRRVMGVFLPQLRLMLGVQSAA  298

Query  1025  ----LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMI  858
                   +G    +       G   WELD +    +  N+    TT+ SL++L+  +  ++
Sbjct  299   PPPGFLIGPCGNA-------GLADWELDRLMWTRSVENVATATTTITSLAQLLDQIGNIV  351

Query  857   IMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFE  678
             I D I +QV  ++ + + ++    +GN   +   S++A   +E AF+ PS++ + Y+  +
Sbjct  352   INDNIAEQVSSAVASLQLAVGQLEVGNLGLAMQYSKEAILQSERAFFDPSLLHLLYFPDD  411

Query  677   HCFAVYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
               FA+Y P FLP+ + ++L++L+     +Q   +  A K
Sbjct  412   QKFAIYIPLFLPMCVPILLSLLKMASEVRQRPGQGQAQK  450



>ref|XP_006731645.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Leptonychotes 
weddellii]
Length=555

 Score =   152 bits (384),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 176/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHGVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNASELPVRVEV---DMVQVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +    +  +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  404   MPLKCLFSG---SKSEGLTTWELDQLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFIASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_010370628.1| PREDICTED: GPI transamidase component PIG-S [Rhinopithecus roxellana]
Length=555

 Score =   152 bits (384),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 178/337 (53%), Gaps = 19/337 (6%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRHVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   + +LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASALPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYRAVAAVQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVL-------REWKRCKQEN  582
             FA+Y P FLP+A+ ++L+++       + WK+ ++ +
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETYKSWKKPEKTD  555



>ref|XP_008580868.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Galeopterus 
variegatus]
Length=555

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVQRYVQPFLNALSAAGNFSVDSQILYYAALGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  ++  LP  +N  E  L +STA+     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAMHSLPHVINPVESRLGSSTAS--LYPVLNFLLYVPELAHTPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNVSELPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +     + +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPPKCLLSG---PNGEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + VSS++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELASGHLASAFVSSQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +    +  KK
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETHKSWKK  550



>ref|XP_008580866.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Galeopterus 
variegatus]
 ref|XP_008580867.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Galeopterus 
variegatus]
Length=584

 Score =   152 bits (384),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  258   ITFSLLNPDPKSHDVHWDIEGAVQRYVQPFLNALSAAGNFSVDSQILYYAALGVNPRFDP  317

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  ++  LP  +N  E  L +STA+     VL+F++YVP     PL +   +G   
Sbjct  318   ASSSYYLAMHSLPHVINPVESRLGSSTAS--LYPVLNFLLYVPELAHTPLYIQDKDGAPV  375

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  376   ATNAFHSPRWGGIMVYNVDPKAYNVSELPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  432

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +     + +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  433   LPPKCLLSG---PNGEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  489

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + VSS++A + +E AF+ PS++ + Y+  +  FA
Sbjct  490   VASEVYRAVAAVQKAAEELASGHLASAFVSSQEAVTSSERAFFDPSLLHLLYFPDDQKFA  549

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +    +  KK
Sbjct  550   IYIPLFLPMAVPILLSLVKIFLETHKSWKK  579



>ref|XP_007121814.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Physeter 
catodon]
Length=555

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 100/335 (30%), Positives = 175/335 (52%), Gaps = 18/335 (5%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR + + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRSYVQPFLNALRAVGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  -----LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRM  861
                  L+ G  +        +G   WELD +    +  NL    TTL SL++L+  +  +
Sbjct  404   VPPKCLFSGPKS--------EGIMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNI  455

Query  860   IIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSF  681
             +I D++  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  
Sbjct  456   VIKDDVASEVYRAVAAVQKAAEELASGHLASAFIASQEAVTSSECAFFDPSLLHLLYFPD  515

Query  680   EHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +  FA+Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  516   DQKFAIYIPLFLPMAVPILLSLFKIFLETRKSWKK  550



>ref|XP_007869409.1| hypothetical protein GLOTRDRAFT_80455 [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ52232.1| hypothetical protein GLOTRDRAFT_80455 [Gloeophyllum trabeum ATCC 
11539]
Length=511

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 171/335 (51%), Gaps = 34/335 (10%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHDW--IYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  ++F LLN D         W+ ++   + + P+++ L  + + ++ESQV YH P +  
Sbjct  179   RYRIAFTLLNEDAASGKSALSWEIRKALSLHIRPLLKRLESLHNFTIESQVQYHAPLAFS  238

Query  1400  SGWDEKQGSYIFSI--KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL  1227
                    GS ++ +  +DL  FVNS EW L +         VLH +++VPS    PL +L
Sbjct  239   PSVVSANGSEVYGLTPEDLTVFVNSAEWTLSSGVT---NDPVLHLLLFVPSPSRRPLHIL  295

Query  1226  LPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQL  1047
                G L+ ++ FI P WGGV ++NPP     ++MQ     +++ +L K+  +F  QL  L
Sbjct  296   DSAGVLTTSHSFILPQWGGVTIYNPP-----ADMQD-HFDLTARQLNKIVPIFRNQLSSL  349

Query  1046  FGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLP  867
              G+    L  G  A S         + W++D + R+ T  N+ +   TL S+ +LV+ + 
Sbjct  350   LGV--PRLPKGIKAPS----PGCSVSSWQIDALLRRRTVENVREAQQTLESIVKLVEQIE  403

Query  866   RMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS-------SRQARSLAEDAFYHPS  708
              M     +GK VK  ++ A  +L  A    +D + +S       S  A +LA  AF++P 
Sbjct  404   NM----PVGKDVKQDVEGALRALDQA----FDAATLSPKLAFDHSNDALTLASRAFFNPG  455

Query  707   MMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREW  603
             M+++ Y+  EH  AVY+P F    + +++AVLRE+
Sbjct  456   MLALLYFPPEHRLAVYTPLFASATVPLVVAVLREF  490



>ref|XP_004042045.1| PREDICTED: GPI transamidase component PIG-S isoform 1 [Gorilla 
gorilla gorilla]
Length=555

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/332 (30%), Positives = 177/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETRKSWRK  550



>ref|NP_149975.1| GPI transamidase component PIG-S [Homo sapiens]
 sp|Q96S52.3|PIGS_HUMAN RecName: Full=GPI transamidase component PIG-S; AltName: Full=Phosphatidylinositol-glycan 
biosynthesis class S protein [Homo 
sapiens]
 dbj|BAB60853.1| phosphatidyl inositol glycan class S [Homo sapiens]
 gb|AAH69228.1| Phosphatidylinositol glycan anchor biosynthesis, class S [Homo 
sapiens]
 gb|EAW51102.1| phosphatidylinositol glycan, class S, isoform CRA_c [Homo sapiens]
 dbj|BAI45805.1| phosphatidylinositol glycan anchor biosynthesis, class S [synthetic 
construct]
Length=555

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 177/330 (54%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    TSE G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPPKCLLSGP--TSE-GLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETRKSWRK  550



>ref|XP_007301576.1| hypothetical protein STEHIDRAFT_53681 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM89154.1| hypothetical protein STEHIDRAFT_53681 [Stereum hirsutum FP-91666 
SS1]
Length=539

 Score =   151 bits (382),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 105/352 (30%), Positives = 178/352 (51%), Gaps = 34/352 (10%)
 Frame = -3

Query  1574  RVVLSFNLLNADPHD--WIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKS--  1407
             R  L+F  LN D  D   +  W+ ++     L+ I+  L  + + ++ESQ+ +H P +  
Sbjct  187   RYRLAFTFLNEDAADGNAVVGWEVEKSISHHLSSILDQLSELYNFTIESQIRFHAPLAFE  246

Query  1406  ----SFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECP  1239
                 + S  +E  G    + +DL  FVNS EW L +S +      VLHFV+++PS    P
Sbjct  247   PQAVANSDGNEVHG---LTPEDLTVFVNSAEWTLSSSVS---NDPVLHFVLFMPSARHSP  300

Query  1238  LQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQ  1059
             L++L      + +N FI P WGG++++N P  S  +      H +++  L   F+ F  Q
Sbjct  301   LRILDAKNNPTSSNAFILPQWGGIMIFNLPIQSTTNTTSAQLH-LTTHTLTPAFQTFKTQ  359

Query  1058  LRQLFGLNS--DSLYVGATATSRL--LTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSL  891
             L  L G+ +   S+ + + A  ++  +      T W+LD + R     N +    TL S+
Sbjct  360   LLALLGVPALPPSIQIQSHAQQQVKGVGINNELTDWQLDALYRMRAQENAVSSKETLMSI  419

Query  890   SRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVS-------SRQARSLA  732
             ++LV  +P M     +G+ VK  +  A + L       Y  S  S       S +A +LA
Sbjct  420   AKLVDEIPNM----PVGQDVKGDVQGALAELDLV----YTTSPTSPTLILRHSAEALTLA  471

Query  731   EDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
               AF++P M+++ Y+  EH +AVY+P F PVA+ +I+ V+RE+K  ++  +K
Sbjct  472   SRAFFNPGMLALLYFPAEHKYAVYTPLFAPVAVPLIVTVIREFKAWREGRRK  523



>gb|AAQ89470.1| PIGS [Homo sapiens]
 gb|EAW51099.1| phosphatidylinositol glycan, class S, isoform CRA_a [Homo sapiens]
Length=547

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/330 (31%), Positives = 177/330 (54%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  221   ITFSLLNPDPKSHDVYWDIEGAVRRYVQPFLNALGAAGNFSVDSQILYYAMLGVNPRFDS  280

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  281   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  338

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  339   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  395

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    TSE G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  396   LPPKCLLSGP--TSE-GLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  452

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  453   VASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFA  512

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  +K
Sbjct  513   IYIPLFLPMAVPILLSLVKIFLETRKSWRK  542



>ref|XP_004341418.1| Phosphatidylinositol glycan anchor biosynthesis, class S, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR19333.1| Phosphatidylinositol glycan anchor biosynthesis, class S, putative 
[Acanthamoeba castellanii str. Neff]
Length=553

 Score =   152 bits (383),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 111/359 (31%), Positives = 183/359 (51%), Gaps = 34/359 (9%)
 Frame = -3

Query  1607  HGEFMPVGADGRVVLSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQV  1428
             H   +P   + R  LSF+LLNA+     Y W F +  +  L P +  +  + + S++SQV
Sbjct  174   HQVSLPPAPEYR--LSFSLLNANSAQAFYSWAFDKAAEAYLLPFLNDVSLLGNFSIDSQV  231

Query  1427  LYHTPKSSFSGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEE  1248
             L++        +DE+  +Y F+   L +FV+ N+ + D +  +      L+F+VY+PS +
Sbjct  232   LHYVALPKQPLYDEQAKAYYFTPAMLSYFVHPNDLNSDFTVTS---EVTLNFMVYIPSPD  288

Query  1247  ECPLQLLLPNGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVF  1068
             + PL +   +G  S TN F+    GG+V++NP   +  S   PLR  +   EL     VF
Sbjct  289   QSPLYIRYDDGTYSDTNAFLILRTGGIVIFNPEEKNTTS---PLR-TLEPSELYGPMSVF  344

Query  1067  MGQLRQLFGLNSDSLY--------VGATATS--------RLLTSEKGFTQWELDFISRQH  936
             + QLR+L G+ + +L+         GA            + L S  G ++WELD + RQ 
Sbjct  345   VEQLRELLGVPA-ALFPTIDTKKGTGAPEVKEGCEDLDVQFLPSPSGVSKWELDVLLRQR  403

Query  935   TCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGS---  765
             T  NL++  T++ +L +LV+    M++ D I  ++  +L   + +L +   G+ DGS   
Sbjct  404   TYENLVKAKTSILTLCQLVKKQTHMVVHDHIKDKLLSALHKLQLALDHLE-GDRDGSGFD  462

Query  764   -AVSSRQA---RSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWK  600
              A + R A      AE AF+   M+S+ YY  EH  A+Y P FLPV   +++ +L E K
Sbjct  463   YATAHRHALEGLKEAESAFFDKEMVSLLYYPPEHEAAIYIPHFLPVFYPIVVGLLFELK  521



>ref|XP_005402806.1| PREDICTED: GPI transamidase component PIG-S [Chinchilla lanigera]
Length=555

 Score =   152 bits (383),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 176/332 (53%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR   + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVQRYVQPFLNALRAAGNFSVDSQILYYAMLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  ++  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDRDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N   +P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDLKAYNVSERPVRVEV---DMVRVMEVFLAQLRLLFGIAHPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   V-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D++  +V  ++ A + +    + G+   +  +S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DDVATEVYRAVAAVQKAAEELASGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  519   FAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



>ref|XP_007452479.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Lipotes 
vexillifer]
Length=494

 Score =   151 bits (381),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR + + SV+SQ+LY+        +D 
Sbjct  168   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALRAVGNFSVDSQILYYAVLGVNPRFDP  227

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  228   ASSSYYLAAHSLPHVINPVESRLGSSAAS--LYPVLNFLLYVPELAHSPLYIQDKDGAPV  285

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  286   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  342

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    +  +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  343   LPPKCLFSG---SKSEGIMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  399

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  400   VASEVYRAVAAVQRAAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  459

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  460   IYIPLFLPMAVPILLSLFKIFLETRKSWKK  489



>ref|XP_010340344.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Saimiri 
boliviensis boliviensis]
Length=559

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 177/334 (53%), Gaps = 12/334 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDT--STAAGGRSKVLHFVVYVPSEEECPLQLLLPNGE  1212
                SY   + +LP  +N  E  L     ++A     VL+F++YVP     PL +   +G 
Sbjct  289   ASSSYYLDMHNLPHVINPVESRLGEHLRSSAASLYPVLNFLLYVPELAHSPLYIQDKDGA  348

Query  1211  LSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNS  1032
                TN F SP WGG++V+N  S + N+   P+R ++   ++ +V EVF+ QLR LFG+  
Sbjct  349   PVATNAFHSPRWGGIMVYNVDSKAYNASALPVRVEV---DMVRVMEVFLAQLRLLFGIAQ  405

Query  1031  DSLYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMI  858
               +         LL+  K  G   WELD +    +  NL    TTL SL++L+  +  ++
Sbjct  406   PQV-----PPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIV  460

Query  857   IMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFE  678
             I D++  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +
Sbjct  461   IKDDVASEVYRAVAAIQKSAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDD  520

Query  677   HCFAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
               FA+Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  521   QKFAIYIPLFLPMAVPILLSLVKIFLETRKSWKK  554



>ref|XP_007259680.1| PREDICTED: GPI transamidase component PIG-S-like, partial [Astyanax 
mexicanus]
Length=556

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/335 (28%), Positives = 170/335 (51%), Gaps = 8/335 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P++  L P+A+ SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHRLHWDIEGGVHSYIQPLLDKLSPLANFSVDSQILYYAVLGVNPRFDS  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                +Y  +   L   +N  E  L ++ A+   + VL+F++YVP  +  PL +   + +  
Sbjct  289   SVSAYTLNADSLAHVINPVEARLGSNAASS--NPVLNFLLYVPDAQHSPLFIRDHSKKEV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              +N F SP WGG++V+N     K     P+   I+   + KV  VF+ QLR + G+    
Sbjct  347   TSNAFHSPRWGGIMVYNVNDMYKPEAEFPVDININ---MAKVMGVFLAQLRLMLGVQKTQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
                G    S       G   WELD +    +  N+    TT+ SL++L+  +  ++I D 
Sbjct  404   PPPGFVLQS---PGSAGLADWELDRLMWSRSVENVATASTTITSLAQLLDQIGNIVINDN  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             I +QV  ++ + +++++    GN   +   S++A   +E AF+ PS++ + Y+  +  FA
Sbjct  461   IAQQVSSAVTSLQAAVAELEAGNLAFALQYSKEAILASERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKKYLAWK  561
             +Y P FLP+ + ++L++L+     +Q   + LA K
Sbjct  521   IYIPLFLPMCVPIMLSLLKIASEIRQRRAEKLAKK  555



>ref|XP_007367509.1| hypothetical protein DICSQDRAFT_108434 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF59797.1| hypothetical protein DICSQDRAFT_108434 [Dichomitus squalens LYAD-421 
SS1]
Length=532

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/328 (31%), Positives = 175/328 (53%), Gaps = 12/328 (4%)
 Frame = -3

Query  1574  RVVLSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  L+F LLN D    +    WD Q+     ++P++  L  + + ++ESQV +H P +  
Sbjct  182   RYRLAFTLLNEDAASGNGALAWDVQKAIQRHVSPLLNKLSVLHNFTIESQVQFHAPLAFE  241

Query  1400  SGWDEKQGSYIFSI--KDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLL  1227
               + ++ G  +  +  +DL  FVNS EW L +S +      V+HFV+++PS +  PL +L
Sbjct  242   PRYIQQDGGDVHGLTHEDLTVFVNSAEWTLSSSAS---NDPVIHFVLFIPSSKHSPLHIL  298

Query  1226  LPNG-ELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQ  1050
               +G  ++ +N F+ P WGG+V+ NP S   +S + PL  +++  +L  +F  F  QL  
Sbjct  299   EEDGVSVNPSNAFLLPQWGGIVLHNP-SHPPSSTLNPLP-RLALSDLDLIFNTFAYQLLT  356

Query  1049  LFGLNSDSLYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSL  870
             L G+      V + + +     E  FT WELD + R+    N+     TL S+ RLV  +
Sbjct  357   LLGVPGLPPRVQSVSAAEGAPPEP-FTDWELDALLRRRAVENVWGSTETLESIVRLVDQI  415

Query  869   PRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSY  690
               M +  ++   V+ +L +A   +   S  +   +  +S +A +L+  AF++P M+++ Y
Sbjct  416   EGMPVGPDVKGDVQDAL-SALDDVHETSRSSPIAALKASARALTLSSRAFFNPGMLALLY  474

Query  689   YSFEHCFAVYSPFFLPVALHVILAVLRE  606
             +  EH +AVY+P F  VA  ++ AVLRE
Sbjct  475   FPTEHKYAVYTPLFASVAAPLVGAVLRE  502



>gb|KFP31331.1| GPI transamidase component PIG-S, partial [Colius striatus]
Length=283

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/289 (30%), Positives = 154/289 (53%), Gaps = 12/289 (4%)
 Frame = -3

Query  1547  NADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYI  1368
             N DP      WD ++     + P++  L  +A+ SV+SQ+LY+        +D++  S++
Sbjct  1     NPDPKSHAVAWDIEDAVKRYVQPVLDKLSLVANFSVDSQILYYAVLGVTPRFDKESSSFL  60

Query  1367  FSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFI  1188
              S   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G    TN F 
Sbjct  61    LSAHSLPHVINPVEARLGSS--AASLYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFH  118

Query  1187  SPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGAT  1008
             SP WGG++V+N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + +     
Sbjct  119   SPRWGGIMVYNVEAPASPQASLPLHVDV---DMVRVMEVFLAQLRLLFGLSQEEV-----  170

Query  1007  ATSRLLTS--EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQ  834
                 LL S   +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +
Sbjct  171   PPEFLLESPGNEGLADWELDRLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASE  230

Query  833   VKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYY  687
             V  ++ +A+S+++  + G+   +  +S++A + +E AF+ PS++ + Y+
Sbjct  231   VYRAVASAQSAMAELATGHLQSAFQASKEAVTSSERAFFDPSLLHLLYF  279



>ref|XP_006874268.1| PREDICTED: GPI transamidase component PIG-S [Chrysochloris asiatica]
Length=555

 Score =   151 bits (382),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 173/332 (52%), Gaps = 12/332 (4%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +   +  + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVERYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L   + A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLATHSLPHVINPVESRL--GSGAASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N+   P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNASGLPVRVEV---DMVRVMEVFLAQLRVLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEK--GFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIM  852
             L         LL   K  G   WELD +    +  NL    TTL SL++L+  +  ++I 
Sbjct  404   L-----PPKCLLAGPKSEGLMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK  458

Query  851   DEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHC  672
             D +  +V  ++ A + +    + G+   + ++S++A + +E AF+ PS++ + Y+  +  
Sbjct  459   DNVASEVYRAVAAVQKAAEELATGHLASAFLASQEAVTSSERAFFDPSLLHLLYFPDDQK  518

Query  671   FAVYSPFFLPVALHVILAVLREWKRCKQENKK  576
             FA+Y P FLPVA+ ++L++++ ++   +  KK
Sbjct  519   FAIYIPLFLPVAVPILLSLVKIFRETHKSWKK  550



>gb|KDR80088.1| hypothetical protein GALMADRAFT_136636 [Galerina marginata CBS 
339.88]
Length=541

 Score =   151 bits (381),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 174/344 (51%), Gaps = 34/344 (10%)
 Frame = -3

Query  1574  RVVLSFNLLNADPH--DWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSF  1401
             R  L+F+LLN D      + DW  QE     ++PI++ L  + + ++ESQV +H P + F
Sbjct  208   RYRLAFSLLNEDAAAGGGVKDWRIQEELKSHISPILRRLAVLHNFTIESQVQFHAPLA-F  266

Query  1400  SGWDEKQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLP  1221
             S    +   Y  +  DL  F+NS EW L +S++      VLHFV+++PS    PL++L  
Sbjct  267   SPLQLEDRQYGIAPADLTVFINSAEWTLSSSSS---NDPVLHFVLFIPSASRRPLRILAN  323

Query  1220  NGELSKTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFG  1041
             +G LS ++ F+ P WGG+V+ NP S S      P   ++ S++L  +F +F  QL  L G
Sbjct  324   DGTLSPSSAFLLPQWGGIVIHNPISDS------PQNPELPSQDLHAIFSLFANQLLSLLG  377

Query  1040  LNSDSLYVGATATSRLLTSEKGFT---QWELDFISRQHTCFNLLQCGTTLGSLSRLVQSL  870
             + +    + A  TS   T     T     +LD + R+ T  N      TL S+ +LV  +
Sbjct  378   VPT----LPADVTSLTQTPHVDATVLSDCQLDALVRRRTLENSQGSQDTLLSIIKLVDQI  433

Query  869   PRMIIMDEIGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARS-------LAEDAFYHP  711
               M +  ++   ++ +LDA         +  Y+ S  S +Q  S       LA  AF+ P
Sbjct  434   ENMPVGQDVRGDIENALDAL--------VKMYESSTTSLQQTFSHSAESLHLASRAFFSP  485

Query  710   SMMSVSYYSFEHCFAVYSPFFLPVALHVILAVLREWKRCKQENK  579
              M+++ Y+  EH +AVY+P F    + + +A LRE    ++E K
Sbjct  486   GMLALLYFPAEHKYAVYTPLFASAVIPLFVAALRELLAYRRERK  529



>ref|XP_005425543.1| PREDICTED: GPI transamidase component PIG-S, partial [Geospiza 
fortis]
Length=498

 Score =   150 bits (380),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 93/319 (29%), Positives = 168/319 (53%), Gaps = 15/319 (5%)
 Frame = -3

Query  1517  WDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDEKQGSYIFSIKDLPFFV  1338
             WD +   +  + P++  L  +A+ SV+SQ+LY+        +D++  S++ S   LP  +
Sbjct  188   WDIEGAVNRFVKPVLDKLSLVANFSVDSQILYYAVLGVTPRYDKESSSFLLSAHSLPHVI  247

Query  1337  NSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELSKTNGFISPMWGGVVVW  1158
             N  E  L +S A+     VL+F++YVP     PL +   +G    TN F SP WGG++V+
Sbjct  248   NPVEARLGSSAAS--LYPVLNFLLYVPERSHSPLYIQDKDGAPVSTNAFHSPRWGGIMVY  305

Query  1157  NPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDSLYVGATATSRLLTS--  984
             N  + +      PL   +   ++ +V EVF+ QLR LFGL+ + +         LL S  
Sbjct  306   NVEAPASPQVSLPLHVDV---DMARVMEVFLAQLRLLFGLSREEV-----PPEFLLESPG  357

Query  983   EKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDEIGKQVKFSLDAAKS  804
              +G   WELD +   HT  N+    TTL SL++L+  +  ++I D++  +V  ++ + +S
Sbjct  358   NEGLADWELDHLLWAHTVENIATVSTTLTSLAQLLDKIGNIVIKDDVASEVYRAVASVQS  417

Query  803   SLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFAVYSPFFLPVALHV-  627
             +++  S+G+   +  +S++A + +E AF+ PS++ + Y+  +  FA+Y P          
Sbjct  418   AVTELSLGHLLAAFQASKEAVTCSERAFFDPSLLHLLYFPDDQKFAIYIPXXXXXXXXXX  477

Query  626   --ILAVLREWKRCKQENKK  576
               +  ++RE +  K+E  K
Sbjct  478   XSLAKIVRETRLRKKEPTK  496



>ref|XP_007452478.1| PREDICTED: GPI transamidase component PIG-S isoform X1 [Lipotes 
vexillifer]
Length=555

 Score =   151 bits (381),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/330 (30%), Positives = 175/330 (53%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + ALR + + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALRAVGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S A+     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSSAAS--LYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R K+   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVKV---DMVRVMEVFLAQLRLLFGIAQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             L      +    +  +G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  404   LPPKCLFSG---SKSEGIMSWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQRAAEELASGHLASAFVASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++ + +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLFKIFLETRKSWKK  550



>ref|XP_009430805.1| PREDICTED: GPI transamidase component PIG-S isoform X2 [Pan troglodytes]
Length=494

 Score =   150 bits (379),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 100/319 (31%), Positives = 172/319 (54%), Gaps = 8/319 (3%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  168   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLNALSAAGNFSVDSQILYYAMLGVNPRFDS  227

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY   +  LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  228   ASSSYYLDMHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  285

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N  S + N+ + P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  286   ATNAFHSPRWGGIMVYNVDSKTYNASVLPVRVEV---DMVRVMEVFLAQLRLLFGIAQPQ  342

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             +      +    TSE G   WELD +    +  NL    TTL SL++L+  +  ++I D+
Sbjct  343   VPPKCLLSGP--TSE-GLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDD  399

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + S    + G+   + V+S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  400   VASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQKFA  459

Query  665   VYSPFFLPVALHVILAVLR  609
             +Y P FLP+A+ ++L++++
Sbjct  460   IYIPLFLPMAVPILLSLVK  478



>ref|XP_004747056.1| PREDICTED: GPI transamidase component PIG-S [Mustela putorius 
furo]
 ref|XP_004807567.1| PREDICTED: GPI transamidase component PIG-S [Mustela putorius 
furo]
Length=555

 Score =   151 bits (381),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 96/330 (29%), Positives = 173/330 (52%), Gaps = 8/330 (2%)
 Frame = -3

Query  1565  LSFNLLNADPHDWIYDWDFQELDDMLLAPIVQALRPIADVSVESQVLYHTPKSSFSGWDE  1386
             ++F+LLN DP      WD +      + P + AL    + SV+SQ+LY+        +D 
Sbjct  229   ITFSLLNPDPKSHDVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDP  288

Query  1385  KQGSYIFSIKDLPFFVNSNEWHLDTSTAAGGRSKVLHFVVYVPSEEECPLQLLLPNGELS  1206
                SY  +   LP  +N  E  L +S  A     VL+F++YVP     PL +   +G   
Sbjct  289   ASSSYYLAAHSLPHVINPVESRLGSS--AASLYPVLNFLLYVPELAHSPLYIQDKDGAPV  346

Query  1205  KTNGFISPMWGGVVVWNPPSCSKNSEMQPLRHKISSEELKKVFEVFMGQLRQLFGLNSDS  1026
              TN F SP WGG++V+N    + N    P+R ++   ++ +V EVF+ QLR LFG+    
Sbjct  347   ATNAFHSPRWGGIMVYNVDPKAYNGSELPVRVEV---DMVRVMEVFLAQLRLLFGIGQPQ  403

Query  1025  LYVGATATSRLLTSEKGFTQWELDFISRQHTCFNLLQCGTTLGSLSRLVQSLPRMIIMDE  846
             + +    +       +G T WELD +    +  N+    TTL SL++L+  +  ++I D+
Sbjct  404   IPLKCLFSG---PKSEGLTIWELDRLLWARSVENVATATTTLTSLAQLLGKISNIVIKDD  460

Query  845   IGKQVKFSLDAAKSSLSNASIGNYDGSAVSSRQARSLAEDAFYHPSMMSVSYYSFEHCFA  666
             +  +V  ++ A + +    + G+   +  +S++A + +E AF+ PS++ + Y+  +  FA
Sbjct  461   VASEVYRAVAAVQKAAEELAAGHLASAFTASQEAVTSSERAFFDPSLLHLLYFPDDQKFA  520

Query  665   VYSPFFLPVALHVILAVLREWKRCKQENKK  576
             +Y P FLP+A+ ++L++++ +   ++  KK
Sbjct  521   IYIPLFLPMAVPILLSLVKIFLETRKSWKK  550



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8725518043704