BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25845_g1_i1 len=1805 path=[10075:0-24 @10100@!:25-829 10901:830-849
10921:850-879 10951:880-888 @10960@!:889-1169 11237:1170-1172
11240:1173-1396 11460:1397-1401 11465:1402-1509 515:1510-1565
571:1566-1804]

Length=1805
                                                                      Score     E

ref|XP_009610317.1|  PREDICTED: DNA-directed RNA polymerase III s...    840   0.0      
ref|XP_009610319.1|  PREDICTED: DNA-directed RNA polymerase III s...    839   0.0      
ref|XP_009800353.1|  PREDICTED: DNA-directed RNA polymerase III s...    837   0.0      
ref|XP_006365152.1|  PREDICTED: DNA-directed RNA polymerase III s...    828   0.0      
ref|XP_006365151.1|  PREDICTED: DNA-directed RNA polymerase III s...    830   0.0      
ref|XP_004251448.1|  PREDICTED: DNA-directed RNA polymerase III s...    827   0.0      
ref|XP_011081084.1|  PREDICTED: DNA-directed RNA polymerase III s...    813   0.0      
ref|XP_002284657.1|  PREDICTED: DNA-directed RNA polymerase III s...    758   0.0      Vitis vinifera
emb|CBI16226.3|  unnamed protein product                                759   0.0      
gb|EPS62830.1|  hypothetical protein M569_11956                         723   0.0      
ref|XP_010265589.1|  PREDICTED: DNA-directed RNA polymerase III s...    721   0.0      
gb|KHG07033.1|  DNA-directed RNA polymerase III subunit RPC1            704   0.0      
ref|XP_010535561.1|  PREDICTED: DNA-directed RNA polymerase III s...    706   0.0      
ref|XP_007036220.1|  DNA-directed RNA polymerase                        702   0.0      
ref|XP_006488216.1|  PREDICTED: DNA-directed RNA polymerase III s...    701   0.0      
ref|XP_004148776.1|  PREDICTED: DNA-directed RNA polymerase III s...    700   0.0      
ref|XP_008465290.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    697   0.0      
ref|XP_006424701.1|  hypothetical protein CICLE_v10027681mg             691   0.0      
gb|EYU39043.1|  hypothetical protein MIMGU_mgv1a000232mg                683   0.0      
ref|XP_009358374.1|  PREDICTED: DNA-directed RNA polymerase III s...    664   0.0      
ref|XP_008358068.1|  PREDICTED: DNA-directed RNA polymerase III s...    670   0.0      
ref|XP_008358064.1|  PREDICTED: DNA-directed RNA polymerase III s...    669   0.0      
ref|XP_010666568.1|  PREDICTED: DNA-directed RNA polymerase III s...    664   0.0      
ref|XP_007208145.1|  hypothetical protein PRUPE_ppa024521mg             641   0.0      
ref|XP_003539102.1|  PREDICTED: DNA-directed RNA polymerase III s...    656   0.0      
ref|XP_010033188.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    657   0.0      
ref|XP_002300065.1|  DNA-directed RNA polymerase family protein         655   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011005565.1|  PREDICTED: DNA-directed RNA polymerase III s...    650   0.0      
ref|XP_006400888.1|  hypothetical protein EUTSA_v10012446mg             648   0.0      
ref|XP_008222562.1|  PREDICTED: DNA-directed RNA polymerase III s...    648   0.0      
ref|XP_002864665.1|  hypothetical protein ARALYDRAFT_496142             645   0.0      
ref|XP_007132141.1|  hypothetical protein PHAVU_011G070100g             645   0.0      
ref|XP_004505923.1|  PREDICTED: DNA-directed RNA polymerase III s...    645   0.0      
ref|XP_009126624.1|  PREDICTED: DNA-directed RNA polymerase III s...    644   0.0      
ref|XP_006279465.1|  hypothetical protein CARUB_v10025743mg             644   0.0      
ref|NP_200812.2|  nuclear RNA polymerase C1                             637   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAA96933.1|  DNA-directed RNA polymerase II largest chain           636   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443797.1|  PREDICTED: DNA-directed RNA polymerase III s...    630   0.0      
ref|NP_001190573.1|  nuclear RNA polymerase C1                          628   0.0      
ref|XP_010455868.1|  PREDICTED: DNA-directed RNA polymerase III s...    626   0.0      
ref|XP_010483650.1|  PREDICTED: DNA-directed RNA polymerase III s...    624   0.0      
ref|XP_010907843.1|  PREDICTED: DNA-directed RNA polymerase III s...    618   0.0      
ref|XP_002531828.1|  DNA-directed RNA polymerase III largest subu...    617   0.0      Ricinus communis
ref|XP_010692683.1|  PREDICTED: DNA-directed RNA polymerase III s...    612   0.0      
ref|NP_001053175.1|  Os04g0492300                                       603   0.0      Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37181.1|  TPA: putative DNA-directed RNA polymerase family...    592   0.0      
ref|XP_009402242.1|  PREDICTED: DNA-directed RNA polymerase III s...    600   0.0      
ref|XP_006653556.1|  PREDICTED: DNA-directed RNA polymerase III s...    600   0.0      
gb|EEE61245.1|  hypothetical protein OsJ_15297                          598   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008669237.1|  PREDICTED: DNA-directed RNA polymerase III s...    594   0.0      
ref|XP_004294640.1|  PREDICTED: DNA-directed RNA polymerase III s...    592   0.0      
gb|AES88750.2|  DNA-directed RNA polymerase I protein                   592   0.0      
ref|XP_004976057.1|  PREDICTED: DNA-directed RNA polymerase III s...    590   0.0      
ref|XP_003574945.1|  PREDICTED: DNA-directed RNA polymerase III s...    590   0.0      
ref|XP_002446717.1|  hypothetical protein SORBIDRAFT_06g021120          587   0.0      Sorghum bicolor [broomcorn]
emb|CDM82865.1|  unnamed protein product                                585   0.0      
gb|AES88756.2|  DNA-directed RNA polymerase I protein                   584   0.0      
ref|XP_008380348.1|  PREDICTED: DNA-directed RNA polymerase III s...    582   0.0      
ref|XP_006828249.1|  hypothetical protein AMTR_s00023p00196820          572   0.0      
ref|XP_002974416.1|  hypothetical protein SELMODRAFT_442419             539   5e-173   
ref|XP_002985715.1|  hypothetical protein SELMODRAFT_446351             540   8e-173   
ref|XP_007217796.1|  hypothetical protein PRUPE_ppa023322mg             533   1e-171   
ref|XP_009350016.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    536   2e-171   
ref|XP_010236212.1|  PREDICTED: DNA-directed RNA polymerase III s...    535   5e-171   
ref|XP_001757221.1|  predicted protein                                  531   3e-169   
ref|XP_004505924.1|  PREDICTED: DNA-directed RNA polymerase III s...    511   5e-163   
gb|KDO73040.1|  hypothetical protein CISIN_1g000828mg                   506   3e-161   
ref|XP_004306240.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    508   7e-161   
ref|XP_002502032.1|  predicted protein                                  497   4e-156   Micromonas commoda
ref|XP_003057499.1|  predicted protein                                  497   3e-155   
ref|XP_003075225.1|  RNA polymerase I, large subunit (ISS)              492   1e-154   
emb|CEG01150.1|  DNA-directed RNA polymerase III largest subunit        492   2e-154   
gb|KFM26649.1|  DNA-directed RNA polymerase III subunit rpc1            493   3e-154   
gb|KDP44150.1|  hypothetical protein JCGZ_05617                         480   4e-151   
ref|XP_001416093.1|  predicted protein                                  474   3e-148   Ostreococcus lucimarinus CCE9901
gb|KGN64727.1|  hypothetical protein Csa_1G084260                       455   2e-143   
emb|CDP06311.1|  unnamed protein product                                429   6e-143   
gb|EFA78358.1|  RNA polymerase III                                      459   3e-142   Heterostelium album PN500
ref|XP_004360352.1|  RNA polymerase III                                 456   1e-140   
gb|ETP12595.1|  hypothetical protein F441_12060                         456   3e-140   
ref|XP_005644352.1|  beta and beta-prime subunits of DNA dependen...    452   3e-140   
gb|ETK82878.1|  hypothetical protein L915_11809                         456   4e-140   
emb|CEI95644.1|  Putative DNA-directed RNA polymerase                   429   5e-140   
ref|XP_008908367.1|  hypothetical protein PPTG_13738                    455   5e-140   
gb|ETI42839.1|  hypothetical protein F443_12095                         455   6e-140   
gb|ETO71469.1|  hypothetical protein F444_12201                         455   7e-140   
gb|ETL89477.1|  hypothetical protein L917_11596                         455   8e-140   
gb|ETP40691.1|  hypothetical protein F442_12013                         455   8e-140   
gb|KCW52758.1|  hypothetical protein EUGRSUZ_J02108                     445   2e-139   
gb|KCW52757.1|  hypothetical protein EUGRSUZ_J02108                     446   5e-139   
ref|XP_642724.1|  RNA polymerase III, largest subunit                   451   7e-139   Dictyostelium discoideum AX4
ref|XP_009493070.1|  DNA-directed RNA polymerase III subunit RPC1       451   9e-139   
ref|XP_009525720.1|  hypothetical protein PHYSODRAFT_500633             451   2e-138   
ref|XP_002903770.1|  DNA-directed RNA polymerase III largest subunit    451   2e-138   
dbj|GAM24976.1|  hypothetical protein SAMD00019534_081510               448   2e-138   
ref|XP_009551792.1|  hypothetical protein HETIRDRAFT_389945             448   3e-138   
gb|KDO23974.1|  hypothetical protein SPRG_10671                         442   7e-138   
gb|KDD75278.1|  domain 1 of RNA polymerase Rpb1                         437   9e-138   
emb|CCA19646.1|  DNAdirected RNA polymerase III largest subunit puta    449   1e-137   
ref|XP_002291242.1|  DNA directed RNA polymerase III, largest sub...    447   1e-137   Thalassiosira pseudonana CCMP1335
emb|CCI39585.1|  unnamed protein product                                448   2e-137   
ref|XP_007514262.1|  DNA-directed RNA polymerase III largest subunit    446   1e-136   
ref|XP_001841218.1|  DNA-directed RNA polymerase III largest subunit    443   3e-136   Coprinopsis cinerea okayama7#130
ref|XP_007381679.1|  beta and beta-prime subunits of DNA dependen...    442   4e-136   
ref|XP_007852652.1|  dna-directed rna polymerase iii largest subunit    442   5e-136   
ref|XP_002951663.1|  hypothetical protein VOLCADRAFT_81566              441   6e-136   
ref|XP_007391616.1|  hypothetical protein PHACADRAFT_169499             442   7e-136   
ref|XP_003026267.1|  hypothetical protein SCHCODRAFT_71335              441   1e-135   
ref|XP_003284018.1|  RNA polymerase III, largest subunit                441   1e-135   
gb|KDQ14148.1|  hypothetical protein BOTBODRAFT_188045                  441   1e-135   
gb|EXX55206.1|  Rpo31p                                                  441   2e-135   
gb|EPB83498.1|  DNA-directed RNA polymerase III subunit RPC1            439   7e-135   
ref|XP_008613145.1|  hypothetical protein SDRG_09014                    440   1e-134   
emb|CCM03577.1|  predicted protein                                      438   1e-134   
ref|NP_595506.1|  DNA-directed RNA polymerase III complex large s...    438   2e-134   Schizosaccharomyces pombe
ref|XP_006959589.1|  beta and beta-prime subunits of DNA dependen...    437   3e-134   
ref|XP_007862648.1|  beta and beta-prime subunits of DNA dependen...    437   3e-134   
ref|XP_007305513.1|  beta and beta-prime subunits of DNA dependen...    437   5e-134   
gb|KFH65268.1|  DNA-directed RNA polymerase III subunit C1              437   5e-134   
ref|XP_008874445.1|  hypothetical protein H310_09988                    437   9e-134   
gb|EPS95906.1|  hypothetical protein FOMPIDRAFT_151299                  436   1e-133   
emb|CBJ31607.1|  RNA polymerase III, largest subunit                    437   1e-133   
ref|XP_009268946.1|  DNA-directed RNA polymerase III subunit rpc1       436   1e-133   
ref|XP_009544254.1|  hypothetical protein HETIRDRAFT_473329             435   2e-133   
ref|XP_007364474.1|  beta and beta-prime subunits of DNA dependen...    435   3e-133   
ref|XP_007333657.1|  hypothetical protein AGABI1DRAFT_79519             435   3e-133   
ref|XP_008035936.1|  beta and beta-prime subunits of DNA dependen...    434   3e-133   
ref|XP_009832829.1|  hypothetical protein H257_08583                    436   3e-133   
ref|XP_006459816.1|  hypothetical protein AGABI2DRAFT_202225            434   4e-133   
emb|CDH60837.1|  beta and beta-prime subunits of dna dependentrna...    434   5e-133   
ref|XP_007349199.1|  beta and beta-prime subunits of DNA dependen...    434   6e-133   
ref|XP_002559913.1|  Pc13g15170                                         434   7e-133   Penicillium rubens Wisconsin 54-1255
emb|CCA67009.1|  probable RPO31-DNA-directed RNA polymerase III, ...    433   7e-133   
ref|XP_007268076.1|  beta and beta-prime subunits of DNA dependen...    433   1e-132   
ref|XP_004256178.1|  DNA-directed RNA polymerase III subunit RPC1...    432   1e-132   
ref|XP_007441426.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-132   
emb|CEG69560.1|  Putative DNA-directed RNA polymerase                   432   3e-132   
gb|EMD31809.1|  hypothetical protein CERSUDRAFT_144684                  432   3e-132   
emb|CDM28351.1|  DNA-directed RNA polymerase III subunit RPC1           432   3e-132   
ref|XP_002165029.2|  PREDICTED: DNA-directed RNA polymerase III s...    410   3e-132   
emb|CCD46881.1|  similar to DNA-directed RNA polymerase iii large...    432   4e-132   
gb|KID64990.1|  DNA-directed RNA polymerase III largest subunit         432   4e-132   
ref|XP_001550869.1|  conserved hypothetical protein                     432   6e-132   Botrytis cinerea B05.10
ref|XP_010781572.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   7e-132   
ref|XP_001588093.1|  conserved hypothetical protein                     432   8e-132   Sclerotinia sclerotiorum 1980 UF-70
gb|AAH53071.1|  Polr3a protein                                          412   1e-131   Mus musculus [mouse]
emb|CEI97176.1|  Putative DNA-directed RNA polymerase                   432   2e-131   
gb|KDQ28805.1|  hypothetical protein PLEOSDRAFT_1092688                 430   2e-131   
tpe|CBF87003.1|  TPA: hypothetical protein similar to RNA polymer...    430   3e-131   
gb|KFY23590.1|  hypothetical protein V493_05772                         431   3e-131   
ref|XP_007408913.1|  hypothetical protein MELLADRAFT_47986              429   3e-131   
ref|XP_004327781.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   3e-131   
ref|XP_001884255.1|  predicted protein                                  429   3e-131   Laccaria bicolor S238N-H82
gb|ERE87513.1|  DNA-directed RNA polymerase III subunit RPC1-like...    412   4e-131   
gb|AFR96255.2|  DNA-directed RNA polymerase III subunit RPC1            429   8e-131   
ref|XP_008855890.1|  DNA-directed RNA polymerase III largest subu...    427   8e-131   
gb|EPX74198.1|  DNA-directed RNA polymerase III complex large sub...    428   1e-130   
ref|XP_007315238.1|  hypothetical protein SERLADRAFT_446372             428   1e-130   
gb|EGE03118.1|  DNA-directed RNA polymerase III largest subunit         428   1e-130   
ref|XP_653748.1|  DNA-directed RNA polymerase III largest subunit       427   1e-130   Entamoeba histolytica HM-1:IMSS
ref|XP_002851111.1|  DNA-directed RNA polymerase III largest subunit    428   1e-130   Microsporum canis CBS 113480
gb|EGD93894.1|  DNA-directed RNA polymerase III largest subunit         428   1e-130   
gb|KFZ24317.1|  hypothetical protein V502_01212                         428   2e-130   
gb|KFY50921.1|  hypothetical protein V496_09085                         428   2e-130   
gb|KFY87787.1|  hypothetical protein V500_06760                         428   2e-130   
gb|ELR04038.1|  hypothetical protein GMDG_06549                         428   2e-130   
emb|CBQ71425.1|  probable RPO31-DNA-directed RNA polymerase III, ...    427   3e-130   
gb|KDQ65120.1|  hypothetical protein JAAARDRAFT_28779                   427   3e-130   
gb|KFY71978.1|  hypothetical protein V499_07873                         428   3e-130   
ref|XP_571468.1|  DNA-directed RNA polymerase iii largest subunit       427   3e-130   Cryptococcus neoformans var. neoformans JEC21
gb|KFY13380.1|  hypothetical protein V491_06416                         427   3e-130   
ref|XP_007767849.1|  beta and beta-prime subunits of DNA dependen...    426   3e-130   
gb|KGB75776.1|  DNA-directed RNA polymerase III largest subunit         427   4e-130   
ref|XP_774751.1|  hypothetical protein CNBF4300                         427   4e-130   Cryptococcus neoformans var. neoformans B-3501A
gb|EZF31547.1|  hypothetical protein H101_04849                         427   4e-130   
emb|CCF48724.1|  probable RPO31-DNA-directed RNA polymerase III, ...    426   4e-130   
ref|XP_003194994.1|  DNA-directed RNA polymerase III largest subunit    427   4e-130   
ref|XP_010120226.1|  PREDICTED: DNA-directed RNA polymerase III s...    403   5e-130   
ref|XP_003012110.1|  hypothetical protein ARB_01618                     427   5e-130   
gb|KFM60620.1|  DNA-directed RNA polymerase III subunit RPC1            412   5e-130   
ref|XP_001393726.1|  DNA-directed RNA polymerase III subunit RPO31      427   5e-130   Aspergillus niger CBS 513.88
ref|XP_003177700.1|  DNA-directed RNA polymerase III subunit RPC1       426   6e-130   
ref|XP_009951311.1|  PREDICTED: DNA-directed RNA polymerase III s...    403   6e-130   
ref|XP_003232017.1|  DNA-directed RNA polymerase III largest subunit    426   8e-130   
gb|EPS27070.1|  hypothetical protein PDE_02011                          426   9e-130   
gb|EWM23672.1|  rna polymerase largest subunit                          427   9e-130   
ref|XP_001737245.1|  DNA-directed RNA polymerase III subunit RPC1       425   1e-129   Entamoeba dispar SAW760
gb|EMS18619.1|  DNA-directed RNA polymerase III subunit RPC1            425   1e-129   
gb|EKV16185.1|  DNA-directed RNA polymerase                             430   1e-129   
gb|KDR83341.1|  hypothetical protein GALMADRAFT_235418                  425   1e-129   
gb|KFX97034.1|  hypothetical protein V490_03019                         426   1e-129   
emb|CEG69561.1|  Putative DNA-directed RNA polymerase                   424   1e-129   
ref|XP_003320172.2|  DNA-directed RNA polymerase III subunit C1         425   2e-129   
ref|XP_660116.1|  hypothetical protein AN2512.2                         430   2e-129   Aspergillus nidulans FGSC A4
ref|XP_001271388.1|  DNA-directed RNA polymerase III largest subu...    425   2e-129   Aspergillus clavatus NRRL 1
ref|XP_004464895.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   3e-129   
emb|CDI57148.1|  probable RPO31-DNA-directed RNA polymerase III, ...    424   3e-129   
ref|XP_002176004.1|  DNA-directed RNA polymerase III complex larg...    424   3e-129   Schizosaccharomyces japonicus yFS275
gb|KFY39915.1|  hypothetical protein V494_03749                         425   4e-129   
gb|KGO42540.1|  Translation elongation/initiation factor/Ribosoma...    429   4e-129   
gb|KGQ12286.1|  DNA-directed RNA polymerase III subunit RPC1            424   4e-129   
gb|KFY10944.1|  hypothetical protein V492_04762                         424   4e-129   
ref|XP_011112227.1|  hypothetical protein H072_6431                     424   5e-129   
ref|XP_449275.1|  hypothetical protein                                  424   7e-129   [Candida] glabrata CBS 138
ref|XP_001263030.1|  DNA-directed RNA polymerase III largest subu...    423   8e-129   Aspergillus fischeri NRRL 181
emb|CCU82355.1|  DNA-directed RNA polymerase III subunit RPC1           424   9e-129   
ref|XP_007558435.1|  PREDICTED: DNA-directed RNA polymerase III s...    409   9e-129   
ref|XP_008594312.1|  DNA-directed RNA polymerase III subunit RPC1       423   1e-128   
ref|XP_004624137.1|  PREDICTED: DNA-directed RNA polymerase III s...    422   1e-128   
ref|XP_010092991.1|  DNA-directed RNA polymerase III subunit RPC1       418   1e-128   
gb|EFY94113.2|  DNA-directed RNA polymerase III                         422   1e-128   
gb|KEY77515.1|  DNA directed RNA polymerase III largest subunit         422   2e-128   
gb|KHN86191.1|  DNA-directed RNA polymerase III subunit RPC1            399   2e-128   
gb|EPY49320.1|  DNA-directed RNA polymerase III complex large sub...    422   2e-128   
ref|XP_754189.1|  DNA-directed RNA polymerase III largest subunit       422   2e-128   Aspergillus fumigatus Af293
ref|XP_004202788.1|  Piso0_001648                                       422   3e-128   
ref|XP_011120708.1|  hypothetical protein AOL_s00075g95                 422   3e-128   
ref|XP_006667572.1|  DNA-directed RNA polymerase III                    422   3e-128   
emb|CDS14109.1|  Putative DNA-directed RNA polymerase                   421   3e-128   
gb|EHA28411.1|  hypothetical protein ASPNIDRAFT_128642                  426   3e-128   
dbj|GAD97439.1|  DNA-directed RNA polymerase III subunit RPO31          422   4e-128   
ref|XP_004202165.1|  Piso0_001648                                       421   4e-128   
dbj|GAA88313.1|  DNA-directed RNA polymerase III largest subunit        426   4e-128   
ref|XP_009045244.1|  hypothetical protein LOTGIDRAFT_230094             420   6e-128   
ref|NP_001263425.1|  DNA-directed RNA polymerase III subunit RPC1       420   7e-128   
ref|XP_008057207.1|  PREDICTED: DNA-directed RNA polymerase III s...    420   7e-128   
gb|KID75037.1|  DNA-directed RNA polymerase III largest subunit         421   7e-128   
gb|KDE05534.1|  DNA-directed RNA polymerase III subunit rpc1            421   7e-128   
ref|XP_003388237.1|  PREDICTED: DNA-directed RNA polymerase III s...    420   7e-128   
gb|EGO01485.1|  hypothetical protein SERLA73DRAFT_103293                420   1e-127   
ref|XP_003473860.1|  PREDICTED: DNA-directed RNA polymerase III s...    419   1e-127   
gb|KDN61006.1|  putative RNA polymerase Rpb1                            420   1e-127   
gb|KGO73763.1|  Translation elongation/initiation factor/Ribosoma...    427   1e-127   
ref|XP_005389956.1|  PREDICTED: DNA-directed RNA polymerase III s...    419   2e-127   
ref|XP_001824913.1|  DNA-directed RNA polymerase III subunit RPO31      419   2e-127   Aspergillus oryzae RIB40
ref|XP_006837499.1|  PREDICTED: DNA-directed RNA polymerase III s...    419   2e-127   
ref|XP_007778546.1|  DNA-directed RNA polymerase III subunit C1         420   2e-127   
ref|XP_002383676.1|  DNA-directed RNA polymerase III largest subu...    419   2e-127   Aspergillus flavus NRRL3357
gb|KID97644.1|  DNA-directed RNA polymerase III largest subunit         419   2e-127   
ref|XP_502142.1|  YALI0C22550p                                          420   3e-127   Yarrowia lipolytica CLIB122
ref|XP_003022324.1|  hypothetical protein TRV_03535                     419   3e-127   
ref|XP_010606158.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   3e-127   
ref|XP_007882529.1|  hypothetical protein PFL1_06792                    418   4e-127   
ref|XP_010189951.1|  PREDICTED: DNA-directed RNA polymerase III s...    404   4e-127   
emb|CDO78062.1|  hypothetical protein BN946_scf184826.g7                418   5e-127   
ref|XP_010606151.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   5e-127   
ref|XP_005325893.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   5e-127   
gb|EMG47443.1|  DNA-directed RNA polymerase                             418   5e-127   
ref|XP_006887622.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-127   
ref|XP_010606144.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   6e-127   
ref|XP_004898832.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   6e-127   
ref|XP_007284597.1|  DNA-directed RNA polymerase iii largest            418   6e-127   
gb|EQL01579.1|  DNA-directed RNA polymerase III                         418   6e-127   
emb|CDJ90094.1|  RNA polymerase Rpb1 and RNA polymerase domain co...    399   7e-127   
gb|ESZ97559.1|  DNA-directed RNA polymerase III                         418   7e-127   
ref|XP_008539943.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   8e-127   
gb|EQB48533.1|  RNA polymerase Rpb1                                     418   9e-127   
ref|XP_007936837.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   1e-126   
ref|XP_006154959.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   1e-126   
emb|CCF32618.1|  RNA polymerase Rpb1                                    418   1e-126   
emb|CCU98572.1|  unnamed protein product                                417   1e-126   
ref|XP_007373198.1|  DNA-directed RNA polymerase III subunit C1         417   1e-126   
ref|XP_004680765.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   1e-126   
ref|XP_002484983.1|  DNA-directed RNA polymerase III largest subu...    417   1e-126   Talaromyces stipitatus ATCC 10500
ref|XP_003783569.1|  PREDICTED: DNA-directed RNA polymerase III s...    417   1e-126   
ref|XP_002583147.1|  DNA-directed RNA polymerase III largest subunit    417   1e-126   Uncinocarpus reesii 1704
ref|XP_004464894.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   1e-126   
ref|XP_010961427.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   1e-126   
ref|XP_007166601.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   1e-126   
ref|XP_001929395.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   Sus scrofa [pigs]
ref|XP_010587564.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
ref|XP_001387687.2|  DNA-directed RNA polymerase III subunit C1 (...    417   2e-126   Scheffersomyces stipitis CBS 6054
gb|KID66909.1|  DNA-directed RNA polymerase III                         417   2e-126   
ref|XP_007824411.1|  DNA-directed RNA polymerase III                    417   2e-126   
ref|XP_007464269.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
ref|XP_003051073.1|  hypothetical protein NECHADRAFT_41824              417   2e-126   
ref|XP_009032709.1|  hypothetical protein AURANDRAFT_35850              416   2e-126   
ref|XP_007166599.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
gb|EWZ37845.1|  DNA-directed RNA polymerase III subunit RPC1            417   2e-126   
ref|XP_007539500.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
ref|XP_006791176.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    416   2e-126   
gb|EWY91242.1|  DNA-directed RNA polymerase III subunit RPC1            417   2e-126   
ref|XP_006180106.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
gb|EWZ89493.1|  DNA-directed RNA polymerase III subunit RPC1            417   2e-126   
ref|XP_008566535.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
ref|XP_004080458.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
gb|EXA45448.1|  DNA-directed RNA polymerase III subunit RPC1            417   2e-126   
ref|XP_007806626.1|  DNA-directed RNA polymerase III                    417   2e-126   
gb|KID97202.1|  DNA-directed RNA polymerase III                         417   2e-126   
ref|XP_007873779.1|  hypothetical protein PNEG_01810                    416   2e-126   
gb|KID83391.1|  DNA-directed RNA polymerase III                         417   2e-126   
gb|ENH62774.1|  DNA-directed RNA polymerase III subunit RPC1            417   2e-126   
ref|XP_004464893.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   2e-126   
ref|XP_004622910.1|  PREDICTED: LOW QUALITY PROTEIN: polymerase (...    416   2e-126   
emb|CCG83690.1|  protein of unknown function                            416   2e-126   
ref|XP_003813067.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   2e-126   
ref|XP_010982501.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   3e-126   
ref|XP_004383224.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   3e-126   
ref|XP_006915688.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   3e-126   
ref|XP_005348755.1|  PREDICTED: DNA-directed RNA polymerase III s...    416   3e-126   
ref|XP_002546294.1|  DNA-directed RNA polymerase III largest subunit    411   3e-126   
ref|XP_003139417.1|  RNA polymerase Rpb1                                416   3e-126   
ref|XP_004701478.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   3e-126   
ref|XP_006694917.1|  RNA polymerase-like protein                        417   4e-126   
ref|XP_007292950.1|  DNA-directed RNA polymerase III                    420   4e-126   
ref|XP_002756253.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   4e-126   
ref|XP_008848052.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   4e-126   
ref|XP_005226506.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   4e-126   
ref|XP_004426956.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   4e-126   
ref|XP_007642047.1|  PREDICTED: DNA-directed RNA polymerase III s...    413   4e-126   
gb|ELK09502.1|  DNA-directed RNA polymerase III subunit RPC1            415   4e-126   
gb|EWG39960.1|  DNA-directed RNA polymerase III subunit RPC1            416   5e-126   
ref|XP_006056997.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
ref|XP_008293110.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
ref|XP_003994136.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
dbj|BAH13260.1|  unnamed protein product                                415   5e-126   
ref|XP_006090236.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
emb|CCT68788.1|  probable RPO31-DNA-directed RNA polymerase III, ...    416   5e-126   
gb|EDL01440.1|  mCG7865                                                 414   5e-126   
ref|XP_005864695.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
ref|NP_001077219.1|  DNA-directed RNA polymerase III subunit RPC1       415   5e-126   
gb|EYE90777.1|  beta and beta-prime subunits of DNA dependent RNA...    416   5e-126   
ref|XP_001643927.1|  hypothetical protein Kpol_1016p9                   416   5e-126   
ref|XP_536399.2|  PREDICTED: DNA-directed RNA polymerase III subu...    415   5e-126   
ref|XP_004765375.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   5e-126   
ref|XP_003686816.1|  hypothetical protein TPHA_0H01760                  416   6e-126   
ref|XP_008694313.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_008143525.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_003344876.1|  hypothetical protein SMAC_06162                    416   6e-126   
ref|XP_003903768.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_010361540.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_007961038.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_005285798.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_006937980.1|  PREDICTED: DNA-directed RNA polymerase III s...    415   6e-126   
ref|XP_003939815.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   6e-126   
ref|NP_008986.2|  DNA-directed RNA polymerase III subunit RPC1          414   6e-126   
ref|XP_002554891.1|  KLTH0F16236p                                       416   6e-126   
ref|XP_005699304.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   7e-126   
ref|XP_004021555.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   7e-126   
ref|XP_005985330.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   7e-126   
ref|XP_004561311.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   7e-126   
ref|XP_005736480.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   7e-126   
ref|XP_005919647.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   8e-126   
ref|XP_005565405.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   8e-126   
ref|XP_002918413.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   8e-126   
gb|KFG77815.1|  DNA-directed RNA polymerase III                         415   8e-126   
ref|XP_004561310.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   9e-126   
gb|EMP28778.1|  DNA-directed RNA polymerase III subunit RPC1            413   9e-126   
ref|XP_005736479.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   9e-126   
ref|XP_007067326.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   9e-126   
ref|XP_003957285.1|  hypothetical protein KAFR_0D05030                  415   1e-125   
ref|NP_001074716.1|  DNA-directed RNA polymerase III subunit RPC1       414   1e-125   
ref|XP_007103142.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-125   
ref|XP_005085306.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-125   
ref|XP_007635107.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    412   1e-125   
ref|XP_001352259.2|  GA14391                                            396   1e-125   
ref|XP_001730008.1|  hypothetical protein MGL_2994                      414   1e-125   
ref|XP_001504046.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-125   
ref|XP_004403401.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-125   
ref|XP_006518882.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   1e-125   
gb|ESU16499.1|  DNA-directed RNA polymerase III largest subunit         414   1e-125   
gb|EHB11910.1|  DNA-directed RNA polymerase III subunit RPC1            414   1e-125   
ref|XP_005899894.1|  PREDICTED: DNA-directed RNA polymerase III s...    405   2e-125   
ref|XP_002805710.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   2e-125   
ref|XP_002149197.1|  DNA-directed RNA polymerase III largest subu...    414   2e-125   
ref|XP_003961288.1|  PREDICTED: DNA-directed RNA polymerase III s...    414   2e-125   
gb|EAA27335.3|  DNA-directed RNA polymerase III largest subunit         415   2e-125   
ref|XP_762303.1|  hypothetical protein UM06156.1                        414   2e-125   
emb|CCK68859.1|  hypothetical protein KNAG_0B04240                      414   2e-125   
gb|KGG52576.1|  DNA-directed RNA polymerase                             414   2e-125   
dbj|GAC95021.1|  hypothetical protein PHSY_002596                       414   2e-125   
gb|KHN96186.1|  DNA-directed RNA polymerase III                         414   2e-125   
ref|XP_009243709.1|  PREDICTED: LOW QUALITY PROTEIN: DNA-directed...    404   2e-125   
ref|XP_007833469.1|  DNA-directed RNA polymerase III subunit RPC1       414   2e-125   
ref|XP_001246195.1|  hypothetical protein CIMG_05636                    414   2e-125   
ref|NP_001096178.1|  DNA-directed RNA polymerase III subunit RPC1       413   2e-125   
ref|XP_006964272.1|  predicted protein                                  414   2e-125   
gb|KFZ53690.1|  DNA-directed RNA polymerase III subunit RPC1            405   3e-125   
dbj|GAM40679.1|  RNA polymerase III subunit                             416   3e-125   
gb|EFW17285.1|  DNA-directed RNA polymerase III largest subunit         414   3e-125   
emb|CCA40852.1|  DNA-directed RNA polymerase II subunit A               414   3e-125   
ref|XP_002493720.1|  RNA polymerase III subunit C160, part of cor...    414   3e-125   
ref|XP_002718445.1|  PREDICTED: DNA-directed RNA polymerase III s...    413   3e-125   
gb|EGW07354.1|  DNA-directed RNA polymerase III subunit RPC1            407   3e-125   
ref|XP_003067798.1|  DNA-directed RNA polymerase III largest subu...    414   3e-125   
ref|XP_007600388.1|  RNA polymerase Rpb1                                414   3e-125   
ref|XP_010742631.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   3e-125   
gb|EAS30407.2|  DNA-directed RNA polymerase III largest subunit         413   3e-125   
ref|XP_008435144.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   3e-125   
ref|XP_002408700.1|  DNA-directed RNA polymerase II largest subun...    412   4e-125   
ref|XP_002794867.1|  DNA-directed RNA polymerase III subunit RPC1       413   4e-125   
ref|XP_008435143.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   4e-125   
gb|KFX47101.1|  DNA-directed RNA polymerase III subunit RPC1            412   4e-125   
ref|XP_006991680.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   4e-125   
ref|XP_003441856.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   4e-125   
ref|XP_008268138.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   4e-125   
gb|EST06755.1|  RNA polymerase III, large subunit                       412   5e-125   
ref|XP_007235503.1|  PREDICTED: DNA-directed RNA polymerase III s...    411   5e-125   
ref|XP_009261612.1|  hypothetical protein FPSE_10220                    413   6e-125   
ref|XP_001897051.1|  RNA polymerase Rpb1, domain 1 family protein       412   6e-125   
emb|CDP91898.1|  Protein BM-RPC-1, isoform c                            412   6e-125   
ref|XP_001056048.1|  PREDICTED: DNA-directed RNA polymerase III s...    412   6e-125   
gb|EHK42676.1|  hypothetical protein TRIATDRAFT_86460                   413   6e-125   
ref|XP_004583575.1|  PREDICTED: DNA-directed RNA polymerase III s...    411   9e-125   
ref|XP_010144923.1|  PREDICTED: DNA-directed RNA polymerase III s...    402   1e-124   
ref|XP_007166600.1|  PREDICTED: DNA-directed RNA polymerase III s...    411   1e-124   
ref|XP_003650936.1|  hypothetical protein THITE_2110899                 413   1e-124   
ref|XP_005471423.1|  PREDICTED: DNA-directed RNA polymerase III s...    411   1e-124   
gb|EHK22815.1|  hypothetical protein TRIVIDRAFT_28982                   412   1e-124   
ref|XP_454912.1|  hypothetical protein                                  412   2e-124   
ref|NP_001006500.1|  DNA-directed RNA polymerase III subunit RPC1       411   2e-124   
gb|AAB86536.1|  RNA polymerase III largest subunit                      410   2e-124   
ref|XP_010712645.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   2e-124   
ref|XP_008112536.1|  PREDICTED: DNA-directed RNA polymerase III s...    409   2e-124   
dbj|GAC77017.1|  RNA polymerase III, large subunit                      410   2e-124   
ref|XP_010712644.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   2e-124   
emb|CDR48048.1|  CYFA0S45e00210g1_1                                     411   2e-124   
ref|XP_005471422.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   2e-124   
ref|XP_007558368.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   2e-124   
ref|XP_005794646.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   2e-124   
gb|EGU12835.1|  DNA-directed RNA polymerase                             414   2e-124   
ref|XP_003664539.1|  hypothetical protein MYCTH_2307483                 412   3e-124   
emb|CCE40988.1|  hypothetical protein CPAR2_110260                      411   3e-124   
emb|CBN81514.1|  DNA-directed RNA polymerase III subunit RPC1           410   3e-124   
ref|XP_007166602.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   3e-124   
ref|XP_008312740.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   3e-124   
ref|XP_006018548.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   3e-124   
ref|XP_006114408.1|  PREDICTED: DNA-directed RNA polymerase III s...    409   4e-124   
gb|EDV10712.1|  DNA-directed RNA polymerase III largest subunit         410   4e-124   
ref|XP_009657675.1|  DNA-directed RNA polymerase III subunit RPC1       410   4e-124   
gb|EGE80384.1|  hypothetical protein BDDG_03325                         399   4e-124   
ref|XP_008312739.1|  PREDICTED: DNA-directed RNA polymerase III s...    410   4e-124   
gb|EFB15895.1|  hypothetical protein PANDA_006866                       409   4e-124   
ref|NP_014759.1|  DNA-directed RNA polymerase III core subunit RPO31    410   5e-124   
gb|EEU07959.1|  Rpo31p                                                  410   5e-124   
ref|XP_002617549.1|  DNA-directed RNA polymerase III largest subunit    410   6e-124   
ref|XP_005471424.1|  PREDICTED: DNA-directed RNA polymerase III s...    409   6e-124   
emb|CBK22921.2|  unnamed protein product                                411   6e-124   
gb|ENH89248.1|  DNA-directed RNA polymerase iii largest                 412   6e-124   
ref|XP_010761878.1|  hypothetical protein PADG_06424                    410   8e-124   
ref|XP_005710179.1|  unnamed protein product                            408   8e-124   
gb|EHN04597.1|  Rpo31p                                                  410   9e-124   
emb|CDO95058.1|  unnamed protein product                                410   9e-124   
emb|CCE31769.1|  probable RPO31-DNA-directed RNA polymerase III,1...    409   9e-124   
ref|XP_007008088.1|  hypothetical protein TREMEDRAFT_72470              409   1e-123   
ref|XP_002181195.1|  rna polymerase C 157 kDa                           407   1e-123   
ref|XP_003868270.1|  Rpo31 protein                                      409   1e-123   
gb|ESX01874.1|  DNA-directed RNA polymerase III subunit RPC1            409   1e-123   
ref|XP_010211830.1|  PREDICTED: DNA-directed RNA polymerase III s...    408   1e-123   
gb|KGL76477.1|  DNA-directed RNA polymerase III subunit RPC1            408   1e-123   
ref|XP_003002464.1|  DNA-directed RNA polymerase III subunit RPC1       409   1e-123   
ref|XP_006717660.1|  PREDICTED: DNA-directed RNA polymerase III s...    408   1e-123   
ref|XP_009686308.1|  PREDICTED: DNA-directed RNA polymerase III s...    408   2e-123   
ref|XP_007896394.1|  PREDICTED: DNA-directed RNA polymerase III s...    408   2e-123   
gb|EOB04172.1|  DNA-directed RNA polymerase III subunit RPC1            408   2e-123   
ref|XP_006688035.1|  beta and beta-prime subunits of DNA dependen...    409   2e-123   
gb|KFP18569.1|  DNA-directed RNA polymerase III subunit RPC1            408   2e-123   
gb|ETS59708.1|  hypothetical protein PaG_06226                          411   2e-123   
ref|XP_011105521.1|  rpo31p                                             409   2e-123   
gb|KFO79360.1|  DNA-directed RNA polymerase III subunit RPC1            407   2e-123   
gb|EEH41126.2|  DNA-directed RNA polymerase III subunit RPC1            408   3e-123   
ref|XP_002195476.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   3e-123   
gb|KFQ65829.1|  DNA-directed RNA polymerase III subunit RPC1            406   3e-123   
gb|KFO11772.1|  DNA-directed RNA polymerase III subunit RPC1            407   3e-123   
ref|XP_010280439.1|  PREDICTED: DNA-directed RNA polymerase III s...    406   3e-123   
emb|CDH14183.1|  DNA-directed RNA polymerase III subunit RPC1           408   3e-123   
dbj|GAK67633.1|  beta and beta-prime subunits of DNA dependent RN...    410   3e-123   
ref|XP_005015841.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   3e-123   
emb|CDF90706.1|  ZYBA0S08-01046g1_1                                     408   3e-123   
ref|XP_009276249.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   3e-123   
ref|XP_005048232.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   3e-123   
gb|KFQ32071.1|  DNA-directed RNA polymerase III subunit RPC1            406   3e-123   
ref|XP_008941033.1|  PREDICTED: DNA-directed RNA polymerase III s...    406   3e-123   
emb|CAA47897.1|  DNA-directed RNA polymerase                            385   4e-123   
gb|KFM06387.1|  DNA-directed RNA polymerase III subunit RPC1            407   4e-123   
ref|XP_006269703.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   4e-123   
ref|XP_003844722.1|  similar to DNA-directed RNA polymerase iii l...    409   4e-123   
ref|XP_003669066.1|  hypothetical protein NDAI_0C01620                  408   4e-123   
gb|KFP08607.1|  DNA-directed RNA polymerase III subunit RPC1            407   4e-123   
gb|KFQ91411.1|  DNA-directed RNA polymerase III subunit RPC1            407   4e-123   
gb|ERT01864.1|  hypothetical protein HMPREF1624_00158                   408   4e-123   
ref|XP_007913527.1|  putative dna-directed rna polymerase iii sub...    407   4e-123   
ref|XP_004925761.1|  PREDICTED: DNA-directed RNA polymerase III s...    406   5e-123   
gb|KIH88149.1|  DNA-directed RNA polymerase III subunit RPC1            408   5e-123   
ref|XP_005769182.1|  hypothetical protein EMIHUDRAFT_451446             406   5e-123   
gb|KFW70391.1|  DNA-directed RNA polymerase III subunit RPC1            406   5e-123   
ref|XP_002497625.1|  ZYRO0F09856p                                       407   5e-123   
gb|KGU07160.1|  DNA-directed RNA polymerase III subunit RPC1            407   6e-123   
dbj|BAO42714.1|  DNA-directed RNA polymerase III subunit RPC1           407   6e-123   
gb|KGQ92684.1|  DNA-directed RNA polymerase III subunit RPC1            407   6e-123   
ref|XP_462102.2|  DEHA2G12980p                                          407   6e-123   
emb|CDH08890.1|  DNA-directed RNA polymerase III subunit RPC1           407   6e-123   
gb|KGU29233.1|  DNA-directed RNA polymerase III subunit RPC1            407   6e-123   
gb|KHC61027.1|  DNA-directed RNA polymerase III subunit RPC1            407   6e-123   
ref|XP_005500192.1|  PREDICTED: DNA-directed RNA polymerase III s...    407   6e-123   
ref|XP_005773771.1|  hypothetical protein EMIHUDRAFT_458392             406   6e-123   
gb|EMC79953.1|  DNA-directed RNA polymerase III subunit RPC1            406   6e-123   
ref|XP_009640259.1|  PREDICTED: DNA-directed RNA polymerase III s...    406   6e-123   
gb|EEQ44828.1|  DNA-directed RNA polymerase III largest subunit         407   6e-123   
dbj|BAP74084.1|  DNA-directed RNA polymerase III subunit RPC1           407   6e-123   



>ref|XP_009610317.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009610318.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X1 [Nicotiana tomentosiformis]
Length=1390

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/501 (79%), Positives = 447/501 (89%), Gaps = 2/501 (0%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +E +QFTKQPYIEDVGPRKIKSIQFS FS +E++K  EVEVYRGVYY+++K PI N
Sbjct  1     MRRTQEIIQFTKQPYIEDVGPRKIKSIQFSLFSEAEILKLGEVEVYRGVYYESTKKPIPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK   C TC+G+F+ECPGHYGYL L LPV+NVGYL  +VD+LKCICK CS
Sbjct  61    GLLDPRMGPPNKNGGCETCHGNFRECPGHYGYLVLTLPVYNVGYLGTVVDLLKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KE   FL+KMRN + E L K+EL K+VVK+CT+MTSG+K V CS+CG +NGMVK
Sbjct  121   SILLDDKECRVFLKKMRNPRTEPLMKSELQKKVVKKCTSMTSGQKTVTCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNKT--KGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             KG LKIIHE G++FLDE + A+S+K   K S++VPPE+D K V+SLFK M DEDCELLYL
Sbjct  181   KGQLKIIHERGNRFLDEFNAAISHKIELKTSVSVPPEIDPKAVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+ L ++ISDT+  
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANARLLEDISDTSFQ  300

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL++WVDLQMEVAQYINSDVRG+P  +QAS+P+SGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  301   NKSLSAWVDLQMEVAQYINSDVRGVPLHLQASKPMSGFTQRLKGKQGRFRGNLSGKRVEY  360

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMARILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+IKH
Sbjct  361   TGRTVISPDPNLKITEVAIPILMARILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIKH  420

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDGTEISLM+SSRKRHADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  421   PDGTEISLMFSSRKRHADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  480

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  481   TLRFNESVCNPYNADFDGDEM  501



>ref|XP_009610319.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009610320.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X2 [Nicotiana tomentosiformis]
Length=1375

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/501 (79%), Positives = 447/501 (89%), Gaps = 2/501 (0%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +E +QFTKQPYIEDVGPRKIKSIQFS FS +E++K  EVEVYRGVYY+++K PI N
Sbjct  1     MRRTQEIIQFTKQPYIEDVGPRKIKSIQFSLFSEAEILKLGEVEVYRGVYYESTKKPIPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK   C TC+G+F+ECPGHYGYL L LPV+NVGYL  +VD+LKCICK CS
Sbjct  61    GLLDPRMGPPNKNGGCETCHGNFRECPGHYGYLVLTLPVYNVGYLGTVVDLLKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KE   FL+KMRN + E L K+EL K+VVK+CT+MTSG+K V CS+CG +NGMVK
Sbjct  121   SILLDDKECRVFLKKMRNPRTEPLMKSELQKKVVKKCTSMTSGQKTVTCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNKT--KGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             KG LKIIHE G++FLDE + A+S+K   K S++VPPE+D K V+SLFK M DEDCELLYL
Sbjct  181   KGQLKIIHERGNRFLDEFNAAISHKIELKTSVSVPPEIDPKAVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+ L ++ISDT+  
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANARLLEDISDTSFQ  300

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL++WVDLQMEVAQYINSDVRG+P  +QAS+P+SGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  301   NKSLSAWVDLQMEVAQYINSDVRGVPLHLQASKPMSGFTQRLKGKQGRFRGNLSGKRVEY  360

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMARILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+IKH
Sbjct  361   TGRTVISPDPNLKITEVAIPILMARILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIKH  420

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDGTEISLM+SSRKRHADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  421   PDGTEISLMFSSRKRHADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  480

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  481   TLRFNESVCNPYNADFDGDEM  501



>ref|XP_009800353.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Nicotiana 
sylvestris]
 ref|XP_009800354.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Nicotiana 
sylvestris]
Length=1390

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/501 (79%), Positives = 445/501 (89%), Gaps = 2/501 (0%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +E +QFTK+PYIEDVGPRKIKSIQFS FS  E++K  EVEVYRGVYYD++K PI N
Sbjct  1     MKRTQEIIQFTKEPYIEDVGPRKIKSIQFSLFSEVEILKLGEVEVYRGVYYDSTKKPIPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK   C TC+G+F+ECPGHYGYL L LPV+NVGYL  +VD+LKCICK CS
Sbjct  61    GLLDPRMGPPNKNGGCETCHGNFRECPGHYGYLVLTLPVYNVGYLGTVVDLLKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KER  FL+KMRN + E L K+EL K+VVK+CT+MTSG+K+V CS+CG +NGMVK
Sbjct  121   SILLDDKERRVFLKKMRNPRTEPLMKSELQKKVVKKCTSMTSGQKSVTCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNKT--KGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             KG LKIIHE G++FLDE + A+S+K   K S++VPPE+D K V+SLFK M DEDCELLYL
Sbjct  181   KGQLKIIHERGNRFLDEFNAAISHKIDLKTSVSVPPEIDPKAVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQ N+ L ++ISDT+  
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQENARLLEDISDTSFQ  300

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL +WV LQMEVAQYINSDVRG+P  +QAS+P+SGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  301   NKSLNAWVGLQMEVAQYINSDVRGVPLHLQASKPMSGFTQRLKGKQGRFRGNLSGKRVEY  360

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMARILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+IKH
Sbjct  361   TGRTVISPDPNLKITEVAIPILMARILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIKH  420

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDGTEISLM+SSRKRHADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  421   PDGTEISLMFSSRKRHADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  480

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  481   TLRFNESVCNPYNADFDGDEM  501



>ref|XP_006365152.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X2 [Solanum tuberosum]
Length=1243

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/501 (78%), Positives = 441/501 (88%), Gaps = 3/501 (1%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +  +Q TKQPYIEDVGPRKIKSI+FS FS SE++KSAEVEVY G+YY+++K PI N
Sbjct  1     MKRIQNSLQVTKQPYIEDVGPRKIKSIKFSLFSESEILKSAEVEVYLGLYYESTKKPIQN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK   C TC+G+F+ECPGHYGYL LALPV+NVGYL  +VDILKCICK CS
Sbjct  61    GLLDPRMGPPNKNGCCETCHGNFRECPGHYGYLVLALPVYNVGYLGTVVDILKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KER D L+KMRN + E LKK+EL K+VVKRC AM  G+K   CS+CG +NGMVK
Sbjct  121   SILLDDKERRDILKKMRNPRTEFLKKSELHKKVVKRCNAMAGGQKTATCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             K  LKI HE G++ LDE + A+S+K   + S++VPPELD K V+SLFK M DEDCELLYL
Sbjct  181   KLQLKITHEQGNRILDEINVAISDKRELRASVSVPPELDPKVVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+SL QE+SD++ P
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANASLHQEMSDSS-P  299

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL  W+DLQMEVAQYINSDVRG+P  MQA RPLSGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  300   VKSLNLWIDLQMEVAQYINSDVRGVPLHMQAQRPLSGFTQRLKGKQGRFRGNLSGKRVEY  359

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMA+ILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+I+H
Sbjct  360   TGRTVISPDPNLKITEVAIPILMAQILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIRH  419

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDG+EISLM++SRKRHADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  420   PDGSEISLMFTSRKRHADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  479

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  480   TLRFNESVCNPYNADFDGDEM  500



>ref|XP_006365151.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X1 [Solanum tuberosum]
Length=1394

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/501 (78%), Positives = 441/501 (88%), Gaps = 3/501 (1%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +  +Q TKQPYIEDVGPRKIKSI+FS FS SE++KSAEVEVY G+YY+++K PI N
Sbjct  1     MKRIQNSLQVTKQPYIEDVGPRKIKSIKFSLFSESEILKSAEVEVYLGLYYESTKKPIQN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK   C TC+G+F+ECPGHYGYL LALPV+NVGYL  +VDILKCICK CS
Sbjct  61    GLLDPRMGPPNKNGCCETCHGNFRECPGHYGYLVLALPVYNVGYLGTVVDILKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KER D L+KMRN + E LKK+EL K+VVKRC AM  G+K   CS+CG +NGMVK
Sbjct  121   SILLDDKERRDILKKMRNPRTEFLKKSELHKKVVKRCNAMAGGQKTATCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             K  LKI HE G++ LDE + A+S+K   + S++VPPELD K V+SLFK M DEDCELLYL
Sbjct  181   KLQLKITHEQGNRILDEINVAISDKRELRASVSVPPELDPKVVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+SL QE+SD++ P
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANASLHQEMSDSS-P  299

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL  W+DLQMEVAQYINSDVRG+P  MQA RPLSGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  300   VKSLNLWIDLQMEVAQYINSDVRGVPLHMQAQRPLSGFTQRLKGKQGRFRGNLSGKRVEY  359

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMA+ILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+I+H
Sbjct  360   TGRTVISPDPNLKITEVAIPILMAQILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIRH  419

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDG+EISLM++SRKRHADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  420   PDGSEISLMFTSRKRHADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  479

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  480   TLRFNESVCNPYNADFDGDEM  500



>ref|XP_004251448.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Solanum 
lycopersicum]
Length=1390

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/501 (78%), Positives = 441/501 (88%), Gaps = 3/501 (1%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R +E +Q TKQPYIEDVGPRKIKSI+FS FS SE++K AEVEVY G+YY+++K PI N
Sbjct  1     MNRAQESLQVTKQPYIEDVGPRKIKSIKFSLFSESEILKLAEVEVYLGLYYESTKKPIQN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK+  C TC+G+F+ECPGHYGYL LALPV+NVGYL  +VDILKCICK CS
Sbjct  61    GLLDPRMGPPNKSGCCETCHGNFRECPGHYGYLVLALPVYNVGYLGTVVDILKCICKCCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
              ILL +KER D L+KMRN + E LKK+EL KRVVKRC AM  G+K   CS+CG +NGMVK
Sbjct  121   SILLDDKERRDILKKMRNPRTEFLKKSELHKRVVKRCNAMAGGQKTATCSKCGYMNGMVK  180

Query  957   KGPLKIIHEYGSQFLDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             K  LKI HE G++ LDE + A+S+K   + S++VPPE+D K V+SLFK M DEDCELLYL
Sbjct  181   KLQLKITHEQGNRILDEINVAISDKRELRASVSVPPEIDPKVVYSLFKNMSDEDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKLLVTSIPVPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+SL QE+SD++ P
Sbjct  241   SDRPEKLLVTSIPVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANASLHQEMSDSS-P  299

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              +SL  W+DLQMEVAQYINSDVRG+P QMQ  RPLSGF QRLKGKQGRFRGNLSGKRVEY
Sbjct  300   VKSLNQWIDLQMEVAQYINSDVRGVPLQMQPPRPLSGFTQRLKGKQGRFRGNLSGKRVEY  359

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMA+ILT+PERVS+HNIEKLRQCVRNGPNKYPGAK+I+H
Sbjct  360   TGRTVISPDPNLKITEVAIPILMAQILTYPERVSQHNIEKLRQCVRNGPNKYPGAKFIRH  419

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDG E+SLM+SSRKR+ADELK+GYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIMPWR
Sbjct  420   PDGNEMSLMFSSRKRYADELKFGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWR  479

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  480   TLRFNESVCNPYNADFDGDEM  500



>ref|XP_011081084.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Sesamum 
indicum]
Length=1405

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/504 (77%), Positives = 437/504 (87%), Gaps = 6/504 (1%)
 Frame = -3

Query  1494  MRK-REEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             MRK +  +QF+KQPYIEDVGPR+I+SIQFSTFSG+EV+K+AEVEV RGVYYD++K PI N
Sbjct  1     MRKVQATLQFSKQPYIEDVGPRRIESIQFSTFSGTEVLKTAEVEVSRGVYYDSTKKPIDN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDP MGPPNK   C TC G+F+ECPGH GYL LALPV+NVGYL  I+DILKCICK C+
Sbjct  61    GLLDPHMGPPNKNGFCKTCYGNFRECPGHCGYLALALPVYNVGYLSTIIDILKCICKKCA  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EKER +FL+KMRN KLE LKKNE+ K+VVKRC AM   ++AV CSRCG +NGMVK
Sbjct  121   RVLLEEKERQEFLKKMRNPKLEPLKKNEILKKVVKRCNAMAGSKRAVKCSRCGYINGMVK  180

Query  957   KGPLKIIHEYG---SQFLDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
             KGPLKI H+        L+EC +AVS+   +KG++     +D K V+ L + M+DEDCEL
Sbjct  181   KGPLKIQHDRAKIVDSDLEECQSAVSHTKDSKGNVNFSSIIDPKLVYQLLRNMLDEDCEL  240

Query  792   LYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDT  613
             LYL+D+PEKL+VT+I VPPIAIRPSVFVDGG QSNENDITERLKRIIQAN+SLRQE+ +T
Sbjct  241   LYLNDRPEKLMVTNILVPPIAIRPSVFVDGGTQSNENDITERLKRIIQANASLRQELLET  300

Query  612   TLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKR  433
              L  ++L SW DLQMEVAQYINSDVRGLP  M  ++PLSGFVQRLKGKQGRFRGNLSGKR
Sbjct  301   NLYNKNLTSWDDLQMEVAQYINSDVRGLPFHMTTAKPLSGFVQRLKGKQGRFRGNLSGKR  360

Query  432   VEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY  253
             VEYTGRTVISPDPNLKI+EVAIPILMARILT+PERVS HNIEKLRQCVRNGPNKYPGAK+
Sbjct  361   VEYTGRTVISPDPNLKISEVAIPILMARILTYPERVSHHNIEKLRQCVRNGPNKYPGAKF  420

Query  252   IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIM  73
             I+ PDGTEISLM+SSRKRHADELKYGYIVDRHLEDGD VLFNRQPSLHRMSIM HRARIM
Sbjct  421   IRQPDGTEISLMFSSRKRHADELKYGYIVDRHLEDGDIVLFNRQPSLHRMSIMSHRARIM  480

Query  72    PWRTLRFNESVCNPYNADFDGDEM  1
             PWRTLRFNESVCNPYNADFDGDEM
Sbjct  481   PWRTLRFNESVCNPYNADFDGDEM  504



>ref|XP_002284657.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Vitis 
vinifera]
Length=1383

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/502 (72%), Positives = 427/502 (85%), Gaps = 7/502 (1%)
 Frame = -3

Query  1485  REEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLD  1306
             ++ +QFTK+PYIEDVGPRKI+SI+F+ FS SE+ K+AEV+V+RGVYYDA++ PI NGLLD
Sbjct  2     KDGIQFTKEPYIEDVGPRKIESIRFALFSESEISKAAEVQVWRGVYYDANRKPIENGLLD  61

Query  1305  PRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILL  1126
             PRMGP NK  +CATC G+F++CPGH GYL LALPV+NVGYL  IVDILKCICK CSR+LL
Sbjct  62    PRMGPANKNGTCATCLGNFRDCPGHCGYLTLALPVYNVGYLSTIVDILKCICKSCSRVLL  121

Query  1125  GEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP-  949
              EK   D+L+KMR+ K+E LKK EL K++V++CTAM S +KAV CSRCG +NG+VKK   
Sbjct  122   DEKASKDYLKKMRSQKMEALKKAELMKKIVQKCTAMASSKKAVKCSRCGYMNGIVKKAVS  181

Query  948   -LKIIHE---YGSQFLDECHNAVSN--KTKGSITVPPELDSKTVHSLFKKMIDEDCELLY  787
              L IIH+        L+EC +A+S+  ++K S +V   L+   V SLFK+M+DEDC+LL 
Sbjct  182   VLGIIHDRSKIADGSLEECSSAISHTKESKASFSVVDILNPVKVLSLFKRMMDEDCDLLN  241

Query  786   LSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
             L+++PEKL++T+I VPPIAIRPSVF+DGG QSNEND+TERLKRIIQAN+SL QE+ DT  
Sbjct  242   LAERPEKLVLTNIGVPPIAIRPSVFMDGGTQSNENDVTERLKRIIQANASLHQELQDTGS  301

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              ++ LA W  LQ+EVAQYINSDVRG+P  MQA+RPLSGFVQRLKGKQGRFRGNLSGKRVE
Sbjct  302   TSKCLAGWDYLQIEVAQYINSDVRGVPLAMQAARPLSGFVQRLKGKQGRFRGNLSGKRVE  361

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             YTGRTVISPDPNLKITEVAIPILMA+IL++PERVS HNIEKLRQC+ NGP KYPGAK I+
Sbjct  362   YTGRTVISPDPNLKITEVAIPILMAKILSYPERVSHHNIEKLRQCILNGPFKYPGAKLIR  421

Query  246   HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
             +PDG+  SLM+S RKR ADELKYGYIV+RHLEDGD VLFNRQPSLHRMSIMCHRARIMPW
Sbjct  422   YPDGSMRSLMFSGRKRFADELKYGYIVERHLEDGDVVLFNRQPSLHRMSIMCHRARIMPW  481

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RTLRFNESVCNPYNADFDGDEM
Sbjct  482   RTLRFNESVCNPYNADFDGDEM  503



>emb|CBI16226.3| unnamed protein product [Vitis vinifera]
Length=1819

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/502 (72%), Positives = 427/502 (85%), Gaps = 7/502 (1%)
 Frame = -3

Query  1485  REEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLD  1306
             ++ +QFTK+PYIEDVGPRKI+SI+F+ FS SE+ K+AEV+V+RGVYYDA++ PI NGLLD
Sbjct  2     KDGIQFTKEPYIEDVGPRKIESIRFALFSESEISKAAEVQVWRGVYYDANRKPIENGLLD  61

Query  1305  PRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILL  1126
             PRMGP NK  +CATC G+F++CPGH GYL LALPV+NVGYL  IVDILKCICK CSR+LL
Sbjct  62    PRMGPANKNGTCATCLGNFRDCPGHCGYLTLALPVYNVGYLSTIVDILKCICKSCSRVLL  121

Query  1125  GEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP-  949
              EK   D+L+KMR+ K+E LKK EL K++V++CTAM S +KAV CSRCG +NG+VKK   
Sbjct  122   DEKASKDYLKKMRSQKMEALKKAELMKKIVQKCTAMASSKKAVKCSRCGYMNGIVKKAVS  181

Query  948   -LKIIHE---YGSQFLDECHNAVSN--KTKGSITVPPELDSKTVHSLFKKMIDEDCELLY  787
              L IIH+        L+EC +A+S+  ++K S +V   L+   V SLFK+M+DEDC+LL 
Sbjct  182   VLGIIHDRSKIADGSLEECSSAISHTKESKASFSVVDILNPVKVLSLFKRMMDEDCDLLN  241

Query  786   LSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
             L+++PEKL++T+I VPPIAIRPSVF+DGG QSNEND+TERLKRIIQAN+SL QE+ DT  
Sbjct  242   LAERPEKLVLTNIGVPPIAIRPSVFMDGGTQSNENDVTERLKRIIQANASLHQELQDTGS  301

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              ++ LA W  LQ+EVAQYINSDVRG+P  MQA+RPLSGFVQRLKGKQGRFRGNLSGKRVE
Sbjct  302   TSKCLAGWDYLQIEVAQYINSDVRGVPLAMQAARPLSGFVQRLKGKQGRFRGNLSGKRVE  361

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             YTGRTVISPDPNLKITEVAIPILMA+IL++PERVS HNIEKLRQC+ NGP KYPGAK I+
Sbjct  362   YTGRTVISPDPNLKITEVAIPILMAKILSYPERVSHHNIEKLRQCILNGPFKYPGAKLIR  421

Query  246   HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
             +PDG+  SLM+S RKR ADELKYGYIV+RHLEDGD VLFNRQPSLHRMSIMCHRARIMPW
Sbjct  422   YPDGSMRSLMFSGRKRFADELKYGYIVERHLEDGDVVLFNRQPSLHRMSIMCHRARIMPW  481

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RTLRFNESVCNPYNADFDGDEM
Sbjct  482   RTLRFNESVCNPYNADFDGDEM  503



>gb|EPS62830.1| hypothetical protein M569_11956, partial [Genlisea aurea]
Length=1368

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/496 (70%), Positives = 402/496 (81%), Gaps = 4/496 (1%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRM  1297
             +Q TKQPYIEDVG R+I+SI FST SGSEV+K+A VEVY+G YYDA+K P+ NGLLD RM
Sbjct  1     LQSTKQPYIEDVGSRRIESINFSTLSGSEVLKTAVVEVYKGSYYDANKKPVSNGLLDMRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             GPPNK   C TC+G+F+ECPGHYGYL LALPV+NVGYL  IVDILKCICK CSR+LL EK
Sbjct  61    GPPNKRSVCGTCHGNFQECPGHYGYLALALPVYNVGYLSNIVDILKCICKNCSRVLLEEK  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGPLKII  937
             E   FLRKMRN +LE LKK +LFK++VKRC +     K   C RCG +NGMVK+ P K++
Sbjct  121   EHHGFLRKMRNPRLEPLKKTDLFKKIVKRCNSKAGSNKLAKCPRCGHINGMVKRAPYKVM  180

Query  936   HEYGSQF---LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYLSDKPEK  766
             ++ G      ++EC +A  +           LD+  V  L + M+DEDCELLY+ D+PEK
Sbjct  181   YDRGRVIDSQMEECQSAGPSMKASRGNTTSTLDALFVFRLLRNMLDEDCELLYIHDRPEK  240

Query  765   LLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLAS  586
             L+VT+I VPP AIRPSVFVDGG QSNENDITERLK II+AN++L Q++ +T +  + + S
Sbjct  241   LMVTNILVPPTAIRPSVFVDGGTQSNENDITERLKYIIEANANLSQQLLETNIYKKGVTS  300

Query  585   WVDLQMEVAQYINSDVRGLPPQMQ-ASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTV  409
             W  LQ+EVAQYINSD RGLP     +S+PLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTV
Sbjct  301   WETLQIEVAQYINSDTRGLPLYGGGSSKPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTV  360

Query  408   ISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTE  229
             ISPDPNLKITEVA+PILMA+ILT+PERVS  NI +LR+CVR GPN+YPGAK+I+ PDGTE
Sbjct  361   ISPDPNLKITEVAVPILMAKILTYPERVSHQNIAELRECVRRGPNEYPGAKFIRQPDGTE  420

Query  228   ISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFN  49
             ISL +SSRK HAD LKYG IVDRHL+DGD VLFNRQPSLHRMSIMCHRARIMPWRTLRFN
Sbjct  421   ISLRFSSRKIHADALKYGDIVDRHLKDGDIVLFNRQPSLHRMSIMCHRARIMPWRTLRFN  480

Query  48    ESVCNPYNADFDGDEM  1
             ESVCNPYNADFDGDEM
Sbjct  481   ESVCNPYNADFDGDEM  496



>ref|XP_010265589.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Nelumbo 
nucifera]
Length=1392

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/512 (67%), Positives = 413/512 (81%), Gaps = 13/512 (3%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M   ++ M FTK+PYIEDVGPRKIKSI+FS FSG E+ K+AEV+V+R VYYD ++ PI +
Sbjct  1     MANTQDRMLFTKEPYIEDVGPRKIKSIRFSMFSGDEIRKAAEVQVWRSVYYDVNRKPIDD  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMGP +K+  C TC+G F +CPGH+GYLNLALPVFNVGY   I+DILKCICK C+
Sbjct  61    GLLDSRMGPASKSGICTTCDGSFTDCPGHFGYLNLALPVFNVGYFSTILDILKCICKSCA  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             RILL E++R D+L+KMR++K + L+KN L K++VK+CT M S +KA+ C+RCG +NG VK
Sbjct  121   RILLEEEKRKDYLKKMRSSKADALQKNNLMKQIVKKCTTMLSSKKALKCTRCGYINGFVK  180

Query  957   KGP--------LKIIHE---YGSQFLDECHNAVSNK--TKGSITVPPELDSKTVHSLFKK  817
             KG         L I+H+      + L+EC +A+S+K  +K S  V   L+   + +LFK+
Sbjct  181   KGASISGTGSTLGIVHDRSKVNDESLEECSSAISHKKESKASFRVVHVLNPVRILALFKR  240

Query  816   MIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSS  637
             M+DEDCELLYL D+PEKL++T I VPPIAIRPSVF+D G  SNE+DIT +L  II+AN+ 
Sbjct  241   MVDEDCELLYLYDRPEKLIITDIAVPPIAIRPSVFMDAGTMSNEDDITSKLSAIIRANAP  300

Query  636   LRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRF  457
             LRQ++      ++ L  W  LQ+EVAQYINSDVRG+P  MQ S+PL GFVQRLKGKQGRF
Sbjct  301   LRQDLQGANPKSKCLLDWDQLQIEVAQYINSDVRGIPTSMQPSKPLRGFVQRLKGKQGRF  360

Query  456   RGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGP  277
             RGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMA+ILT+PERVS HNIEKLRQCVRNG 
Sbjct  361   RGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMAQILTYPERVSHHNIEKLRQCVRNGS  420

Query  276   NKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              KYPGA +I++PDG+ ++L +S+RKR ADELKYGYIV+RHLEDGD VLFNRQPSLHRMSI
Sbjct  421   QKYPGANFIRYPDGSIMNLRFSARKRAADELKYGYIVERHLEDGDIVLFNRQPSLHRMSI  480

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  481   MSHRARIMPWRTLRFNESVCNPYNADFDGDEM  512



>gb|KHG07033.1| DNA-directed RNA polymerase III subunit RPC1 [Gossypium arboreum]
Length=1050

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/506 (69%), Positives = 404/506 (80%), Gaps = 12/506 (2%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M ++ +++ FTK+PYIEDVGPR+IKSI+FS FS SE+ K+AEV+VY+GVYYD    PI  
Sbjct  1     MQQRSQDIVFTKRPYIEDVGPRRIKSIKFSMFSDSEIAKAAEVQVYKGVYYDPQSRPIEG  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMGPPNK+  CATC+G F +CPGHYGYL L LPV+NVGYL  I+DILKCICK CS
Sbjct  61    GLLDPRMGPPNKSGKCATCDGSFGDCPGHYGYLPLVLPVYNVGYLSTILDILKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             RILL +K   D+L+KMR  K E LKK E+ K VVK+CTAM  G KAV CSRCG +NG VK
Sbjct  121   RILLDDKLAKDYLKKMRAPKTEPLKKAEIMKSVVKKCTAMAGG-KAVKCSRCGYLNGTVK  179

Query  957   KGP--LKIIHE---YGSQFLDECHNAVSN--KTKGSITVPPELDSKTVHSLFKKMIDEDC  799
             K P  + + H+         +E  +A+S+  ++K SI     L+   V SLFK+M D DC
Sbjct  180   KAPKMIGVFHDRSKVNDNSSEELKSAISHTKESKSSINTSSVLNPVKVLSLFKRMTDVDC  239

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELLYLSD+PEK ++T+I VPP AIRPSV VD    SNENDITERLKRIIQANSSLRQ++ 
Sbjct  240   ELLYLSDRPEKFIITNIAVPPTAIRPSVPVD----SNENDITERLKRIIQANSSLRQQLV  295

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
             D+      L  W  LQ++VAQYINSDVRG+P +MQ SRPLSGF+QRLKGKQGRFRGNLSG
Sbjct  296   DSNAAFHCLNGWDLLQVDVAQYINSDVRGVPTEMQPSRPLSGFLQRLKGKQGRFRGNLSG  355

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRVE+TGRTVISPDPNLKITEVAIPI MARIL++PERVS HNIEKLRQCVRNGP+KYPGA
Sbjct  356   KRVEFTGRTVISPDPNLKITEVAIPIHMARILSYPERVSSHNIEKLRQCVRNGPSKYPGA  415

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
               +++PDG+   L+   RKR ADELK+G IVDRHLEDGD VLFNRQPSLHRMSIMCHRAR
Sbjct  416   VKVRYPDGSARLLIGDYRKRLADELKFGCIVDRHLEDGDIVLFNRQPSLHRMSIMCHRAR  475

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  476   IMPWRTLRFNESVCNPYNADFDGDEM  501



>ref|XP_010535561.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Tarenaya 
hassleriana]
Length=1376

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/508 (68%), Positives = 410/508 (81%), Gaps = 12/508 (2%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M+  +E++FTK+PYIEDVGPR+IKSI+FS FS +EVMK+AEV+V++GVYYD +  PI  G
Sbjct  1     MQATKEIEFTKKPYIEDVGPRRIKSIEFSIFSETEVMKAAEVQVWQGVYYDTNGKPIEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   C TC+G+F+ CPGHYGYL LALPV+N+GY   I+DILKCICK CSR
Sbjct  61    LLDPRMGPPNKKGKCTTCDGNFQNCPGHYGYLKLALPVYNIGYFNNILDILKCICKRCSR  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D+L+KMRN K+E LKK EL K VVK+C+AM S  K + C +CG +NGMVKK
Sbjct  121   MLLDEKLSEDYLKKMRNPKMESLKKTELAKAVVKKCSAMASS-KIITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHEYGSQF---LDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDE  805
                   + I H+        ++E  +A+S+  + S  + P    L+  +V +LFK M ++
Sbjct  180   AATSSGIGISHDRSRIHEGDVEEFKSAISHTKESSGAINPITYVLNPVSVLALFKGMSNK  239

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DCELLYL+D+PEKL++TSI VPPI+IRPSV + GG QSNENDITERLKR+IQ N+SLRQ 
Sbjct  240   DCELLYLADRPEKLIITSIAVPPISIRPSVII-GGTQSNENDITERLKRVIQNNASLRQF  298

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             + + T   ++L +W  LQ+EVAQYINSDVRG+P  MQ S+PLSGF+QRLKGKQGRFRGNL
Sbjct  299   LVEPTTSPKNLHAWESLQVEVAQYINSDVRGVPLAMQPSKPLSGFIQRLKGKQGRFRGNL  358

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPE VSRHNIEKLRQCVRNGP KYP
Sbjct  359   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPECVSRHNIEKLRQCVRNGPYKYP  418

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA+ +++PDG+  +L+   RKR ADEL  G IVDRHLEDGD VLFNRQPSLHRMSIMCHR
Sbjct  419   GARLVRYPDGSSRALVGDYRKRLADELTIGCIVDRHLEDGDVVLFNRQPSLHRMSIMCHR  478

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  479   ARIMPWRTLRFNESVCNPYNADFDGDEM  506



>ref|XP_007036220.1| DNA-directed RNA polymerase [Theobroma cacao]
 gb|EOY20721.1| DNA-directed RNA polymerase [Theobroma cacao]
Length=1395

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/501 (69%), Positives = 405/501 (81%), Gaps = 10/501 (2%)
 Frame = -3

Query  1479  EMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPR  1300
             + +FTK+PYIEDVGPRKIKSIQFS  S SE+ K+AEV+VY+ +YYD    PI  GLLDPR
Sbjct  2     QQKFTKRPYIEDVGPRKIKSIQFSMLSDSEIAKAAEVQVYQALYYDPKSRPIEGGLLDPR  61

Query  1299  MGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGE  1120
             MGP NK+  CATC+G+F +CPGHYGYL+LALPV+NVGYL  I+DILKCICK CSRI+L E
Sbjct  62    MGPANKSGKCATCHGNFADCPGHYGYLSLALPVYNVGYLSTILDILKCICKSCSRIILDE  121

Query  1119  KERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--L  946
             K   D+L++MR+ K++ LKK ++ K +VK+C+AM S  KAV C RCG VNG VKK    L
Sbjct  122   KLCKDYLKRMRSPKIDALKKGDIMKSIVKKCSAMASS-KAVKCWRCGYVNGTVKKAVAML  180

Query  945   KIIHE---YGSQFLDECHNAVSN--KTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYL  784
              IIH+        L+E  +A+S+  ++K S  V    L+   V SLFK+M D DCELLYL
Sbjct  181   GIIHDRSKINDNSLEEFRSAISHTKESKASFNVATYVLNPVKVLSLFKRMTDLDCELLYL  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             SD+PEKL++T+I VPPI IRPSV +DG  QSNENDITERLKRIIQAN+SLRQE+ +T   
Sbjct  241   SDRPEKLIITNIAVPPIPIRPSVIMDGS-QSNENDITERLKRIIQANASLRQELVETNAA  299

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              + L  W  LQ+EVAQYINSDVRG+P  MQ S+PLSGFVQR+KGK GRFRGNLSGKRVEY
Sbjct  300   FKCLGGWEMLQVEVAQYINSDVRGVPFSMQVSKPLSGFVQRIKGKHGRFRGNLSGKRVEY  359

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPI MARILT+PERVS HNIEKLRQCVRNGP+KYPGA+ +++
Sbjct  360   TGRTVISPDPNLKITEVAIPIHMARILTYPERVSNHNIEKLRQCVRNGPSKYPGARMVRY  419

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDG+   L+   RKR ADELK+G +VDRHLEDGD VLFNRQPSLHRMSIMCHRARIMPWR
Sbjct  420   PDGSARLLIGDYRKRLADELKFGCVVDRHLEDGDIVLFNRQPSLHRMSIMCHRARIMPWR  479

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  480   TLRFNESVCNPYNADFDGDEM  500



>ref|XP_006488216.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X1 [Citrus sinensis]
 ref|XP_006488217.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X2 [Citrus sinensis]
Length=1404

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/510 (68%), Positives = 410/510 (80%), Gaps = 10/510 (2%)
 Frame = -3

Query  1509  VVKMMMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN  1330
             + + + +K + + FTKQPYIEDVGPRKI+SIQFS  S SE+MK+AEV+VY+G YY +++ 
Sbjct  1     MTQQLQQKSQSIAFTKQPYIEDVGPRKIESIQFSMMSDSEIMKAAEVQVYKGQYYSSNRV  60

Query  1329  PILNGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCIC  1150
             PI  GLLDPRMGP NK+ +CATC+G F  CPGHYGYL LALPV+NVGYL  I+DILKCIC
Sbjct  61    PIEGGLLDPRMGPANKSCTCATCHGGFSNCPGHYGYLTLALPVYNVGYLSTILDILKCIC  120

Query  1149  KGCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVN  970
             K CSR+LL EK   D+L+KMRN K+E L+K +L K +VK+C+ M S  KAV C RCG +N
Sbjct  121   KYCSRLLLEEKLCKDYLKKMRNPKMEALRKTDLMKSIVKKCSTMAS--KAVKCPRCGYIN  178

Query  969   GMVKKGP--LKIIHEYG--SQFLDECHNAVSN--KTKGSITVPPE-LDSKTVHSLFKKMI  811
             GMVKK    L IIH+    ++ L E  +A+++  ++K ++ V    L+   V  LFK+M 
Sbjct  179   GMVKKAVAVLGIIHDRSKVTESLQEFASAITHTKESKAAVNVATYILNPVNVLFLFKRMT  238

Query  810   DEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             D DCE+LYLS++PEKL++T+I VPPIAIRPSV +DG  QSNENDITERLKRIIQ N+SL+
Sbjct  239   DTDCEVLYLSERPEKLIITNIAVPPIAIRPSVIMDGS-QSNENDITERLKRIIQTNASLQ  297

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             QE+ +     +SLA W  LQ+EVAQYINSDVRG+P  MQ +RPLSGFVQRLKGKQGRFRG
Sbjct  298   QELVEANSAFKSLAGWETLQVEVAQYINSDVRGVPFSMQVARPLSGFVQRLKGKQGRFRG  357

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERVS HNIEKLRQC++NGP+K
Sbjct  358   NLSGKRVEYTGRTVISPDPNLKITEVAIPIRMARILTYPERVSDHNIEKLRQCIQNGPDK  417

Query  270   YPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             YPGA+ I++PDGT   L    R + A ELK G IVDRHLEDGD VLFNRQPSLHRMSIMC
Sbjct  418   YPGARMIRYPDGTARVLYGKFRNQLAVELKSGCIVDRHLEDGDVVLFNRQPSLHRMSIMC  477

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  478   HRARIMPWRTLRFNESVCNPYNADFDGDEM  507



>ref|XP_004148776.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Cucumis sativus]
Length=1400

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/497 (69%), Positives = 403/497 (81%), Gaps = 7/497 (1%)
 Frame = -3

Query  1482  EEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDP  1303
             E + FTKQPYIEDVGPRKIKS+QF+TFSG+E+ K AEV+VY+G+YYD ++ PI  GLLDP
Sbjct  7     EGLVFTKQPYIEDVGPRKIKSMQFTTFSGAEISKLAEVQVYKGLYYDTTRKPIDGGLLDP  66

Query  1302  RMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLG  1123
             RMGP NK   CATC+ +F +CPGHYGY+NLALPVFNVGY   I++ILKCICK CSRILL 
Sbjct  67    RMGPANKGCKCATCHANFGDCPGHYGYVNLALPVFNVGYFTTILEILKCICKSCSRILLE  126

Query  1122  EKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--  949
             EK   DFLRKMRN KLE L+K +L K+++K+C+ +T+G K+  CSRCG +NG VKK    
Sbjct  127   EKLFKDFLRKMRNPKLEALRKVDLVKKIIKKCSTLTTGNKSTRCSRCGYLNGSVKKAVSM  186

Query  948   LKIIHEYGSQFLDECHNAVSNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDKP  772
             L I+H Y ++  D     VS   +    V  + L+   V  LF++M DEDCELL+LS++P
Sbjct  187   LGILH-YRARSKDA--GVVSEDLRAPYNVSNDILNPFRVLCLFQRMSDEDCELLFLSNRP  243

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             EKL++T++ VPPIAIRPSV +DG  QSNENDITERLKRIIQ N+S+ QE+S +   A+ L
Sbjct  244   EKLIITNVLVPPIAIRPSVIMDGS-QSNENDITERLKRIIQQNASVSQELSTSNSQAKCL  302

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
              SW  LQ EVAQ INSDVRG+P  MQ S+PL+GFVQRLKGKQGRFRGNL GKRVE+TGRT
Sbjct  303   ESWDMLQSEVAQLINSDVRGIPFSMQVSKPLAGFVQRLKGKQGRFRGNLCGKRVEFTGRT  362

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             VISPDPNLKITEVA+PI MARILT+PERV+RHNIEKLRQCV NGP+KYPGA+ ++H DG+
Sbjct  363   VISPDPNLKITEVAVPIHMARILTYPERVTRHNIEKLRQCVSNGPDKYPGARMLRHLDGS  422

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
               SLM S RKR ADELKYG IV+RHLEDGD VLFNRQPSLHRMSIMCHR R+MPWRTLRF
Sbjct  423   MRSLMISGRKRLADELKYGEIVERHLEDGDVVLFNRQPSLHRMSIMCHRVRVMPWRTLRF  482

Query  51    NESVCNPYNADFDGDEM  1
             NESVCNPYNADFDGDEM
Sbjct  483   NESVCNPYNADFDGDEM  499



>ref|XP_008465290.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III 
subunit rpc1 [Cucumis melo]
Length=1400

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/497 (68%), Positives = 402/497 (81%), Gaps = 7/497 (1%)
 Frame = -3

Query  1482  EEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDP  1303
             E + FTKQPYIEDVGPRKIKS+QF+TFSG+E+ K AEV+VY+G+YYD ++ PI  GLLDP
Sbjct  7     EGLVFTKQPYIEDVGPRKIKSMQFTTFSGAEISKLAEVQVYKGLYYDTTRKPIDGGLLDP  66

Query  1302  RMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLG  1123
             RMGP NK   C+TC+ +F +CPGHYGY+NL+LPVFNVGY   I++ILKCICK CSRILL 
Sbjct  67    RMGPANKGCKCSTCHANFGDCPGHYGYVNLSLPVFNVGYFTTILEILKCICKSCSRILLE  126

Query  1122  EKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--  949
             EK   DFLRKMRN KLE L+K +L K+++K+C+ +T+G K+  CSRCG +NG VKK    
Sbjct  127   EKLYKDFLRKMRNPKLEALRKCDLVKKIIKKCSTLTTGNKSTKCSRCGYLNGSVKKAVSM  186

Query  948   LKIIHEYGSQFLDECHNAVSNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDKP  772
             L I+H Y ++  D     VS   +    V  + L+   V  LF++M DEDCELL+LSD+P
Sbjct  187   LGILH-YRARSKDA--GVVSEDLRAPYNVSNDILNPFRVLCLFQRMSDEDCELLFLSDRP  243

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             EKL++T++ VPPIAIRPSV +DG  QSNENDITERLKRIIQ N+S+ QE+S +   A+ L
Sbjct  244   EKLIITNVLVPPIAIRPSVIMDGS-QSNENDITERLKRIIQQNASVSQELSTSNSQAKCL  302

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
              SW  LQ EVAQ INSDVRG+P  MQ S+PL+GFVQRLKGKQGRFRGNL GKRVE+TGRT
Sbjct  303   ESWDMLQSEVAQLINSDVRGIPFTMQVSKPLAGFVQRLKGKQGRFRGNLCGKRVEFTGRT  362

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             VISPDPNLKITEVA+PI MARILT+PERV+ HNIEKLRQCV NGP+KYPGA+ ++H DG+
Sbjct  363   VISPDPNLKITEVAVPIHMARILTYPERVTSHNIEKLRQCVSNGPDKYPGARMLRHLDGS  422

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
               SLM S RKR ADELKYG IV+RHLEDGD VLFNRQPSLHRMSIMCHR R+MPWRTLRF
Sbjct  423   MRSLMISGRKRLADELKYGEIVERHLEDGDVVLFNRQPSLHRMSIMCHRVRVMPWRTLRF  482

Query  51    NESVCNPYNADFDGDEM  1
             NESVCNPYNADFDGDEM
Sbjct  483   NESVCNPYNADFDGDEM  499



>ref|XP_006424701.1| hypothetical protein CICLE_v10027681mg [Citrus clementina]
 gb|ESR37941.1| hypothetical protein CICLE_v10027681mg [Citrus clementina]
Length=1397

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/525 (66%), Positives = 410/525 (78%), Gaps = 25/525 (5%)
 Frame = -3

Query  1509  VVKMMMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN  1330
             + + + +K + + FTKQPYIEDVGPRKI+SIQFS  S SE+MK+AEV+VY+G YY +++ 
Sbjct  1     MTQQLQQKSQSIAFTKQPYIEDVGPRKIESIQFSMMSDSEIMKAAEVQVYKGQYYSSNRV  60

Query  1329  PILNGLLDPRM---------------GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFN  1195
             PI  GLLDPRM               GP NK+ +CATC+G F  CPGHYGYL LALPV+N
Sbjct  61    PIEGGLLDPRMEKIIFLQRLFFHGFQGPANKSCTCATCHGGFSNCPGHYGYLTLALPVYN  120

Query  1194  VGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMT  1015
             VGYL  I+DILKCICK CSR+LL EK   D+L+KMRN K+E L+K +L K +VK+C+ M 
Sbjct  121   VGYLSTILDILKCICKYCSRLLLEEKLCKDYLKKMRNPKMEALRKTDLMKSIVKKCSTMA  180

Query  1014  SGRKAVICSRCGCVNGMVKKGP--LKIIHEYG--SQFLDECHNAVSN--KTKGSITVPPE  853
             S  KAV C RCG +NGMVKK    L IIH+    ++ L E  +A+++  ++K ++ V   
Sbjct  181   S--KAVKCPRCGYINGMVKKAVAVLGIIHDRSKVTESLQEFASAITHTKESKAAVNVATY  238

Query  852   -LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDI  676
              L+   V  LFK+M D DCE+LYLS++PEKL++T+I VPPIAIRPSV +DG  QSNENDI
Sbjct  239   ILNPVNVLFLFKRMTDTDCEVLYLSERPEKLIITNIAVPPIAIRPSVIMDGS-QSNENDI  297

Query  675   TERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLS  496
             TERLKRIIQ N+SL+QE+ +     +SLA W  LQ+EVAQYINSDVRG+P  MQ +RPLS
Sbjct  298   TERLKRIIQTNASLQQELVEANSAFKSLAGWETLQVEVAQYINSDVRGVPFSMQVARPLS  357

Query  495   GFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRH  316
             GFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERVS H
Sbjct  358   GFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPIRMARILTYPERVSDH  417

Query  315   NIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAV  136
             NIEKLRQC++NGP+KYPGA+ I++PDGT   L    R + A ELK G IVDRHLEDGD V
Sbjct  418   NIEKLRQCIQNGPDKYPGARMIRYPDGTARVLYGKFRNQLAVELKSGCIVDRHLEDGDVV  477

Query  135   LFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  478   LFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  522



>gb|EYU39043.1| hypothetical protein MIMGU_mgv1a000232mg [Erythranthe guttata]
Length=1394

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/508 (67%), Positives = 406/508 (80%), Gaps = 13/508 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M+K   +QFTK+PY+EDVGPR+I+SIQFSTFS +EV+K+ EVEV +  YYD ++ PI NG
Sbjct  1     MKKSGTIQFTKRPYVEDVGPRRIESIQFSTFSAAEVLKAGEVEVNKIAYYDENRKPIDNG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLD RMGP NK+  C TC G F +CPGHYGYL LALPV+NVG+   I+DILKCICK CSR
Sbjct  61    LLDQRMGPANKSILCKTCGGKFVDCPGHYGYLPLALPVYNVGFFLTIIDILKCICKNCSR  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL +K+   FL++MRN K E LKK E+ KRVVK+C ++   ++AV CSRCG +NGMVKK
Sbjct  121   VLLADKDHQVFLKQMRNPKCETLKKIEIQKRVVKKCNSLAGSKRAVKCSRCGYINGMVKK  180

Query  954   G--PLKIIHEYGSQFLDECHN------AVSNKTKGSITVPPELDSKTVHSLFKKMIDEDC  799
                PLKI H+  ++ +D C +      A +   KG+  V   +D KT + L + M+DEDC
Sbjct  181   AKEPLKIQHDR-AKVVDNCLDERRSALAHTKDIKGNPVVISTIDPKTAYHLLENMLDEDC  239

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELLYL D+PEKL+VT+I VPPIAIRPSVF    M SNENDIT RLK+IIQ N+++ QE+S
Sbjct  240   ELLYLHDRPEKLIVTNILVPPIAIRPSVFSTRAM-SNENDITSRLKQIIQINAAVLQEMS  298

Query  618   DTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQM-QASRPLSGFVQRLKGKQGRFRGNL  445
             D +  ++SL + W  LQ+EVAQYINSDVR +P Q  + ++PLSGFVQRLKGKQGRFRGNL
Sbjct  299   DQSSQSQSLTNNWDSLQVEVAQYINSDVR-VPLQYSENTKPLSGFVQRLKGKQGRFRGNL  357

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRVE+TGRTVISPDPNLKI EVA+PILMA+IL++PERVS HNIE+LRQCVRNGP KYP
Sbjct  358   SGKRVEFTGRTVISPDPNLKINEVAVPILMAQILSYPERVSHHNIERLRQCVRNGPTKYP  417

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GAK+IKHPDGTEISL    R R AD+LKYGYIV RHL+DGD +LFNRQPSLHRMSIM HR
Sbjct  418   GAKFIKHPDGTEISLTGKIRHRAADDLKYGYIVCRHLQDGDIILFNRQPSLHRMSIMSHR  477

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  478   ARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_009358374.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Pyrus x bretschneideri]
Length=864

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/499 (66%), Positives = 398/499 (80%), Gaps = 12/499 (2%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTKQP+IED G  +I+  +FS  S  E+ K AEV++++G YYD+++ PI  GLLDPR+GP
Sbjct  11    FTKQPFIEDEGHLRIEKWKFSAMSDKEIGKMAEVQIFKGQYYDSNRKPIEGGLLDPRLGP  70

Query  1290  PNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
              N++  +CATC G  K+CPGH+GYL LALPVFNVGYL  IVDILKCICK CS ILL E  
Sbjct  71    ANRSSGACATCGGTTKDCPGHFGYLVLALPVFNVGYLSTIVDILKCICKLCSGILLEEGM  130

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKI  940
             R++FL+KMR  K+E +KK+EL K +VK+C ++T+  + V CS+CG +NG VKK  G L I
Sbjct  131   RIEFLKKMRRPKMEPMKKSELMKVIVKKCNSLTTNNRPVKCSKCGFINGSVKKAVGVLGI  190

Query  939   IHEYGSQF---LDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDCELLYLSD  778
             IH+  S+F   +D+  +A+S+  +   +  P    L+   V SLFK+M+DEDCELLYLSD
Sbjct  191   IHDR-SKFVGVMDDFRSAISHTKESKASFNPATHNLNPARVFSLFKRMVDEDCELLYLSD  249

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE L++T+I VPPI IRPSV VDG  QSNENDITERLKRIIQ+NSSLRQ++ + +  A+
Sbjct  250   RPENLIMTNIAVPPIPIRPSVIVDGS-QSNENDITERLKRIIQSNSSLRQDLMEASSAAK  308

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              LASW  LQ+EVAQYINSDVRG+P  MQ S+PL+GFVQRLKGK GRFRGNLSGKRVEYTG
Sbjct  309   CLASWEILQVEVAQYINSDVRGVPFSMQTSKPLAGFVQRLKGKGGRFRGNLSGKRVEYTG  368

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNLKITEV IPI MA ILT+PERVS HNIEKLRQCV NGP+KYPGA+ +++ D
Sbjct  369   RTVISPDPNLKITEVGIPIKMATILTYPERVSHHNIEKLRQCVSNGPDKYPGARVLRNSD  428

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             GTE  L   +RK  AD LKYG IV+RHLEDGD VLFNRQPSLHRMS+MCHRA+IMPWRTL
Sbjct  429   GTEWVLKV-NRKSIADSLKYGDIVERHLEDGDVVLFNRQPSLHRMSLMCHRAKIMPWRTL  487

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNESVCNPYNADFDGDEM
Sbjct  488   RFNESVCNPYNADFDGDEM  506



>ref|XP_008358068.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X2 [Malus domestica]
Length=1390

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/499 (66%), Positives = 398/499 (80%), Gaps = 12/499 (2%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTKQP+IED G  +I+  +FS  S  E+ K AEV++++G YYD+++ PI  GLLDPR+GP
Sbjct  11    FTKQPFIEDEGHLRIEKWKFSAMSDKEIRKMAEVQIFKGQYYDSNRKPIEGGLLDPRLGP  70

Query  1290  PNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
              N++  +CATC G  K+CPGH+GYL LALPVFNVGYL  IVDILKCICK CS ILL E  
Sbjct  71    ANRSSGACATCGGTTKDCPGHFGYLVLALPVFNVGYLSTIVDILKCICKLCSGILLEEGM  130

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKI  940
             R++FL+KMR  K+E +KK+EL K +VK+C ++T+  + V CS+CG +NG VKK  G L I
Sbjct  131   RIEFLKKMRRPKMEPMKKSELMKVIVKKCNSLTTNNRPVKCSKCGFINGSVKKAVGVLGI  190

Query  939   IHEYGSQF---LDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDCELLYLSD  778
             IH+  S+F   +D+  +A+S+  +   +  P    L+   V SLFK+M+DEDCELLYLSD
Sbjct  191   IHDR-SKFIGVMDDFRSAISHTKESKASFNPATHNLNPARVFSLFKRMVDEDCELLYLSD  249

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE L++T+I VPPI IRPSV VDG  QSNENDITERLKRIIQ+NSSLRQ++ + +  A+
Sbjct  250   RPENLIMTNIAVPPIPIRPSVIVDGS-QSNENDITERLKRIIQSNSSLRQDLIEASSAAK  308

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              LASW  LQ+EVAQYINSDVRG+P  MQ S+PL+GFVQRLKGK GRFRGNLSGKRVEYTG
Sbjct  309   CLASWEILQVEVAQYINSDVRGVPFSMQTSKPLAGFVQRLKGKGGRFRGNLSGKRVEYTG  368

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNLKITEV IPI MA ILT+PERVS HNIEKLRQCV NGP+KYPGA+ +++ D
Sbjct  369   RTVISPDPNLKITEVGIPIKMATILTYPERVSHHNIEKLRQCVSNGPDKYPGARVLRNSD  428

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             GTE  L   +RK  AD LKYG IV+RHLEDGD VLFNRQPSLHRMS+MCHRA+IMPWRTL
Sbjct  429   GTEWVLKV-NRKSIADSLKYGDIVERHLEDGDVVLFNRQPSLHRMSLMCHRAKIMPWRTL  487

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNESVCNPYNADFDGDEM
Sbjct  488   RFNESVCNPYNADFDGDEM  506



>ref|XP_008358064.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 isoform 
X1 [Malus domestica]
Length=1419

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/499 (66%), Positives = 398/499 (80%), Gaps = 12/499 (2%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTKQP+IED G  +I+  +FS  S  E+ K AEV++++G YYD+++ PI  GLLDPR+GP
Sbjct  11    FTKQPFIEDEGHLRIEKWKFSAMSDKEIRKMAEVQIFKGQYYDSNRKPIEGGLLDPRLGP  70

Query  1290  PNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
              N++  +CATC G  K+CPGH+GYL LALPVFNVGYL  IVDILKCICK CS ILL E  
Sbjct  71    ANRSSGACATCGGTTKDCPGHFGYLVLALPVFNVGYLSTIVDILKCICKLCSGILLEEGM  130

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKI  940
             R++FL+KMR  K+E +KK+EL K +VK+C ++T+  + V CS+CG +NG VKK  G L I
Sbjct  131   RIEFLKKMRRPKMEPMKKSELMKVIVKKCNSLTTNNRPVKCSKCGFINGSVKKAVGVLGI  190

Query  939   IHEYGSQF---LDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDCELLYLSD  778
             IH+  S+F   +D+  +A+S+  +   +  P    L+   V SLFK+M+DEDCELLYLSD
Sbjct  191   IHDR-SKFIGVMDDFRSAISHTKESKASFNPATHNLNPARVFSLFKRMVDEDCELLYLSD  249

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE L++T+I VPPI IRPSV VDG  QSNENDITERLKRIIQ+NSSLRQ++ + +  A+
Sbjct  250   RPENLIMTNIAVPPIPIRPSVIVDGS-QSNENDITERLKRIIQSNSSLRQDLIEASSAAK  308

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              LASW  LQ+EVAQYINSDVRG+P  MQ S+PL+GFVQRLKGK GRFRGNLSGKRVEYTG
Sbjct  309   CLASWEILQVEVAQYINSDVRGVPFSMQTSKPLAGFVQRLKGKGGRFRGNLSGKRVEYTG  368

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNLKITEV IPI MA ILT+PERVS HNIEKLRQCV NGP+KYPGA+ +++ D
Sbjct  369   RTVISPDPNLKITEVGIPIKMATILTYPERVSHHNIEKLRQCVSNGPDKYPGARVLRNSD  428

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             GTE  L   +RK  AD LKYG IV+RHLEDGD VLFNRQPSLHRMS+MCHRA+IMPWRTL
Sbjct  429   GTEWVLKV-NRKSIADSLKYGDIVERHLEDGDVVLFNRQPSLHRMSLMCHRAKIMPWRTL  487

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNESVCNPYNADFDGDEM
Sbjct  488   RFNESVCNPYNADFDGDEM  506



>ref|XP_010666568.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Beta 
vulgaris subsp. vulgaris]
Length=1352

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/502 (64%), Positives = 389/502 (77%), Gaps = 15/502 (3%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M+R  + + FTKQPYIED  PR+I SI FS FS  E+ K +EVEV++GVYYDA K PI+N
Sbjct  1     MLRPHDNIVFTKQPYIEDNEPRRIHSITFSMFSAPEISKISEVEVFKGVYYDAQKKPIVN  60

Query  1317  GLLDPRMGPPNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
             GLLDP+MGPPNK+   C TC   +++CPGHYG L L+LPVFN+GY+  I+D+LKCICK C
Sbjct  61    GLLDPKMGPPNKSSGLCTTCYSKYEDCPGHYGCLTLSLPVFNIGYISAILDVLKCICKSC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMV  961
             S ILL EKE  +FL+KMRN KL+ L+K EL K++VK+CT+    +  V C RCG +NG V
Sbjct  121   SHILLPEKECKEFLKKMRNNKLDSLQKTELRKKIVKKCTS----KLEVQCLRCGYLNGKV  176

Query  960   KKG--PLKIIHEYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLY  787
             KKG   L+I+H    Q          N  +   + P  ++      LFK+M+D+DCELLY
Sbjct  177   KKGKTALQIVHNRPKQ--------DKNNEESGASSPSLINPHDALLLFKQMLDQDCELLY  228

Query  786   LSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
             L+++PE L++T++ VPP+A+RPSVFVDGG+QSNENDITERLKRIIQAN+ L Q + + + 
Sbjct  229   LNNRPENLIITNVSVPPMALRPSVFVDGGIQSNENDITERLKRIIQANACLHQGLQEPSS  288

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
               + L  W  LQ+EVAQYINSDVR      Q ++PLSGFVQRLKGKQGRFRGNLSGKRVE
Sbjct  289   SYKILDDWDYLQVEVAQYINSDVRVALQGQQPTKPLSGFVQRLKGKQGRFRGNLSGKRVE  348

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             +TGRTVISPDPNLKITEVA+P+LMA ILT+PE V+ HNIEKLRQCVRNGP KYPGAK++ 
Sbjct  349   FTGRTVISPDPNLKITEVAVPLLMASILTYPECVNHHNIEKLRQCVRNGPKKYPGAKFVI  408

Query  246   HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
              P+G +  L +S RKR ADELK+GYIV RHLEDGD VLFNRQPSLHRMSIM HRARIMPW
Sbjct  409   EPNGDKKDLSFSGRKRIADELKFGYIVHRHLEDGDVVLFNRQPSLHRMSIMSHRARIMPW  468

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RTLRFNESVCNPYNADFDGDEM
Sbjct  469   RTLRFNESVCNPYNADFDGDEM  490



>ref|XP_007208145.1| hypothetical protein PRUPE_ppa024521mg, partial [Prunus persica]
 gb|EMJ09344.1| hypothetical protein PRUPE_ppa024521mg, partial [Prunus persica]
Length=867

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/498 (64%), Positives = 390/498 (78%), Gaps = 10/498 (2%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTKQP+IED G RKI+  QFS  S +E++  AE ++Y+  YYD ++ PI  GLLDPR+GP
Sbjct  14    FTKQPFIEDEGHRKIEKWQFSAMSDTEIVNMAETQIYKCNYYDPNQKPIEGGLLDPRLGP  73

Query  1290  PNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
              NK+   CATC    K+CPGH+G+L LALPV NVGYL  +VDILKCICK CS ILL E  
Sbjct  74    ANKSSGECATCGAVMKDCPGHFGFLVLALPVLNVGYLSTVVDILKCICKLCSGILLEEGM  133

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKI  940
             R DFL+KMR+ K+E L+K EL K++VK+C  +T+  + V CS+CG +NG VKK  G L I
Sbjct  134   RNDFLKKMRSPKMEPLRKTELMKKIVKKCNNLTTNYRPVKCSKCGFINGSVKKAVGVLGI  193

Query  939   IHEYG--SQFLDECHNAVSN--KTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDK  775
             IH+    +  +D+    +S+  ++K S  V    L+   ++SLFK+M+DEDCELL LS++
Sbjct  194   IHDRSKLNGVMDDFRTTLSHTKESKASFNVATHMLNPARIYSLFKRMVDEDCELLNLSNR  253

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             P+ L++ +I VPPIAIRPSV VD  + SNENDITERLKRIIQ+N+ LR+++ +     + 
Sbjct  254   PQNLIIKNIAVPPIAIRPSVIVDRSL-SNENDITERLKRIIQSNAILRRDLLEAKSAPKC  312

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             LASW  LQ+EVAQYINSD+RG+P  MQ ++PLSGFVQRLKGK GRFRGNLSGKRVEYTGR
Sbjct  313   LASWDILQVEVAQYINSDIRGVPFSMQTAKPLSGFVQRLKGKGGRFRGNLSGKRVEYTGR  372

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNLKITEV +PI MA+ILT+PERVS HNIEKLRQCV NGP+KYPGA+ +++PDG
Sbjct  373   TVISPDPNLKITEVGVPIKMAQILTYPERVSHHNIEKLRQCVSNGPDKYPGARMLRNPDG  432

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
             TE SL   +RK  AD LKYG IV+RHLEDGD VLFNRQPSLHRMSIMCHRA++MPWRTLR
Sbjct  433   TEWSLKV-NRKNAADGLKYGDIVERHLEDGDIVLFNRQPSLHRMSIMCHRAKVMPWRTLR  491

Query  54    FNESVCNPYNADFDGDEM  1
             FNESVCNPYNADFDGDEM
Sbjct  492   FNESVCNPYNADFDGDEM  509



>ref|XP_003539102.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Glycine max]
Length=1391

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/509 (65%), Positives = 393/509 (77%), Gaps = 17/509 (3%)
 Frame = -3

Query  1497  MMRKREE-MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL  1321
             M R R E + FTK+P++ED GPRKIK+++FST S SE+ K AEV+V++G YYD+ K PI 
Sbjct  1     MNRARTEGITFTKEPFMEDTGPRKIKNMKFSTLSESEISKIAEVQVWKGSYYDSFKKPIH  60

Query  1320  NGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
              GLLDPRMGP NK+  CATC+G+F +CPGHYGYLNLALPVFNVGYL  IV+ILKCICKGC
Sbjct  61    GGLLDPRMGPANKSLVCATCDGNFHDCPGHYGYLNLALPVFNVGYLSTIVEILKCICKGC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFK-RVVKRCTAMTSGRKAVICSRCGCVNGM  964
             +RILL E  R   L+KMR++K   L K +  K RV+K C+      K V C RCG +NG 
Sbjct  121   ARILLDEDTRKKHLKKMRSSKKSELDKIDFVKVRVIKDCS------KVVNCPRCGYINGS  174

Query  963   VKKGP--LKIIHEYG---SQFLDECHNAVSNKTKGSITVPPE---LDSKTVHSLFKKMID  808
             VKK P  L IIH+     +  ++E  +A+S       T       L+   V SLFK+M+D
Sbjct  175   VKKLPASLTIIHDCSKCRNYIVEELDSALSRMKDSRATTNVSNRILNPFQVLSLFKRMLD  234

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             EDCELLY++++PEKL++T++ VPPIAIRPSV +D  + SNENDITERLK IIQAN+ LRQ
Sbjct  235   EDCELLYVAERPEKLIMTNVVVPPIAIRPSVVMDESL-SNENDITERLKNIIQANAVLRQ  293

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
             E+ ++T  ++ L  W  LQ EVAQ+INSDVRG+P  MQ ++ L+GFVQRLKGK GRFRGN
Sbjct  294   ELQESTFSSKFLDGWDILQNEVAQFINSDVRGIPFYMQPTKQLAGFVQRLKGKHGRFRGN  353

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVEYTGRTVISPDPNLKI+EVAIPI MARILT+PERV+ HNIEKLRQCVRNGP+KY
Sbjct  354   LSGKRVEYTGRTVISPDPNLKISEVAIPIHMARILTYPERVTHHNIEKLRQCVRNGPDKY  413

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ ++   G   SL    RKR ADEL+ G IVDRHLEDGD VLFNRQPSLHRMSIMCH
Sbjct  414   PGARMLRRDGGHSWSLKVLCRKRAADELRIGDIVDRHLEDGDIVLFNRQPSLHRMSIMCH  473

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  474   RARIMPWRTLRFNESVCNPYNADFDGDEM  502



>ref|XP_010033188.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III 
subunit rpc1 [Eucalyptus grandis]
Length=1402

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/507 (64%), Positives = 396/507 (78%), Gaps = 29/507 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTK+PY+E+VGPR+IKSI FS FS SE+   AEV+VY+GVYYD ++ P+  GLLDPRMGP
Sbjct  8     FTKEPYVENVGPRRIKSIHFSMFSASEIGNVAEVQVYKGVYYDGTRKPLEGGLLDPRMGP  67

Query  1290  PNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKER  1111
              NK+  C+TC+GDFK+CPGHYGYL LALPV+NVG+L  I+++LK +CK CSRILL E+ R
Sbjct  68    ANKSCRCSTCHGDFKDCPGHYGYLTLALPVYNVGFLDKILEVLKSLCKSCSRILLDEESR  127

Query  1110  LDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKII  937
                L K+R+ K + L K EL K+ V +C     GR    C+ CG +NG VKK  G +  I
Sbjct  128   RKELEKIRHPKRDALNKAELAKKTVSKCKP---GR----CAHCGYINGTVKKAIGAISYI  180

Query  936   HE---YGSQFLDECHNAVSN--KTKGSITVPPEL----------DSKTVHSLFKKMIDED  802
             H+      + L+EC +A+S+  ++KGS++V   +          + + V SLF++M DED
Sbjct  181   HDRSKTSDRSLEECKSAISHTKESKGSLSVASNIINPGMFCNIINPRDVLSLFERMSDED  240

Query  801   CELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             CELL ++D+PEK ++T+I VPPIAIRPSV ++G  QSNENDITERLKRIIQ N+SL+QE+
Sbjct  241   CELLNIADRPEKFMITTIAVPPIAIRPSVMMEGS-QSNENDITERLKRIIQVNASLQQEL  299

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
              D     +++A+W  LQ EV  YINSDVRG+P   Q ++PL+GF+QRLKGKQGRFRGNLS
Sbjct  300   QDM----KNMAAWDHLQAEVGLYINSDVRGVPYPFQVAKPLAGFIQRLKGKQGRFRGNLS  355

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+++NIEKLRQCVRNGP KYPG
Sbjct  356   GKRVEYTGRTVISPDPNLKITEVAIPIQMARILTYPERVNQYNIEKLRQCVRNGPYKYPG  415

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A+ I++PDG    LM S RKR ADEL +G IVDRHLEDGD VLFNRQPSLHRMSIMCHRA
Sbjct  416   ARMIRYPDGEMRLLMGSFRKRLADELGFGVIVDRHLEDGDVVLFNRQPSLHRMSIMCHRA  475

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             R+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  476   RVMPWRTLRFNESVCNPYNADFDGDEM  502



>ref|XP_002300065.1| DNA-directed RNA polymerase family protein [Populus trichocarpa]
 gb|EEE84870.1| DNA-directed RNA polymerase family protein [Populus trichocarpa]
Length=1394

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/508 (64%), Positives = 392/508 (77%), Gaps = 12/508 (2%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M ++ +++ +TKQPYIEDVGPR+IKSIQFST SGS+++K++E +V+ G YYDA+K  I+ 
Sbjct  1     MQQRAQDIIYTKQPYIEDVGPRRIKSIQFSTMSGSDILKASECQVHLGQYYDANKKAIVG  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG PNK  +C TC G F +CPGH+GYLNL LPV+NVGYL  I+DILKCICK CS
Sbjct  61    GLLDTRMGAPNKHGTCQTCGGSFTDCPGHFGYLNLVLPVYNVGYLSTILDILKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+L+ EK R  +L++MRN + E LKKNEL K +VK+C++M S  KAV C RCG +NGMVK
Sbjct  121   RVLVDEKLRKSYLKRMRNPRTEPLKKNELMKEIVKKCSSMASS-KAVKCLRCGYMNGMVK  179

Query  957   KGP--LKIIHEYG---SQFLDECHNAVSNKTKGSITVPPE---LDSKTVHSLFKKMIDED  802
             K    + IIH+       +L+EC +A+ +  +    +      L+   V SLF++M++ED
Sbjct  180   KAGSVVGIIHDRSKLIDGYLEECKSAIGHTREARAPIGLATYILNPVRVLSLFQRMVEED  239

Query  801   CELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             CELLYL  +PEKL++T+I VPPI+IRPSVF +G  QSNENDITERLK+IIQ N+ LR E+
Sbjct  240   CELLYLQGRPEKLIITTIAVPPISIRPSVFTEGS-QSNENDITERLKQIIQFNAKLRLEL  298

Query  621   SDTTLPA-RSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
              +      + L  W +LQ  V  YINSDVR +P  MQ  RPLSGFVQRL GKQGRFR NL
Sbjct  299   LEGRRTGIKYLIGWDELQAVVTLYINSDVR-IPLDMQVGRPLSGFVQRLTGKQGRFRQNL  357

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             +GKRVE+TGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKLRQCV NG  KYP
Sbjct  358   AGKRVEFTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKLRQCVNNGSYKYP  417

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA+ + +PDG+   L  + RKR A+ELK G IV RHLEDGD VLFNRQPSLHRMSIMCHR
Sbjct  418   GARMVTYPDGSSKMLTGNYRKRIAEELKSGCIVHRHLEDGDVVLFNRQPSLHRMSIMCHR  477

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  478   ARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_011005565.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Populus 
euphratica]
Length=1410

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/508 (63%), Positives = 391/508 (77%), Gaps = 12/508 (2%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M ++ +++ +TKQPY+EDVGPR+IKSIQFST SGS+++K++E +V+ G YYDA+K  I+ 
Sbjct  1     MQQRAQDIIYTKQPYVEDVGPRRIKSIQFSTMSGSDILKASECQVHLGQYYDANKKAIVG  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG PNK  +C TC G F +CPGH+GYLNL LPV+NVGYL  I+DILKCICK CS
Sbjct  61    GLLDTRMGAPNKHGTCQTCGGSFTDCPGHFGYLNLVLPVYNVGYLSTILDILKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+L+ EK R  +L++MRN + E LKKNEL K +VK+C++M S  KAV C RCG +NGMVK
Sbjct  121   RVLIDEKLRKSYLKRMRNPRTEPLKKNELMKEIVKKCSSMASS-KAVKCLRCGYMNGMVK  179

Query  957   KGP--LKIIHE---YGSQFLDECHNAVSNKTKGSITVPPE---LDSKTVHSLFKKMIDED  802
             K    + IIH+       +L+EC +A+ +  +    +      L+   V SLF+++++ED
Sbjct  180   KAGSVVGIIHDRSKLSDGYLEECKSAIGHTREARAPIGLATYILNPVRVLSLFQRIVEED  239

Query  801   CELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             CELLYL  +PEKL++T+I VPPI+IRPSVF +G  QSNENDITERLK+IIQ N+ LR E+
Sbjct  240   CELLYLQGRPEKLIITTIAVPPISIRPSVFTEGS-QSNENDITERLKQIIQFNAKLRLEL  298

Query  621   SDTTLPA-RSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
              +      + L  W +LQ  V  YINSDVR +P  MQ  RPLSGFVQRL GKQGRFR NL
Sbjct  299   LEGRRTGIKYLIGWDELQAVVTLYINSDVR-IPLDMQVGRPLSGFVQRLTGKQGRFRQNL  357

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             +GKRVE+TGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKLR CV NG  KYP
Sbjct  358   AGKRVEFTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKLRHCVNNGSYKYP  417

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA+ + +PDG+   L  + RKR A+ELK G IV RHLEDGD VLFNRQPSLHRMSIMCHR
Sbjct  418   GARMVTYPDGSSKMLTGNYRKRIAEELKSGCIVHRHLEDGDVVLFNRQPSLHRMSIMCHR  477

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  478   ARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_006400888.1| hypothetical protein EUTSA_v10012446mg [Eutrema salsugineum]
 gb|ESQ42341.1| hypothetical protein EUTSA_v10012446mg [Eutrema salsugineum]
Length=1375

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/510 (63%), Positives = 391/510 (77%), Gaps = 16/510 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTKQPYIEDVGP KIKSI FS FS  E+MK+AEV+V+R  YY+++  P+  G
Sbjct  1     METKMEIEFTKQPYIEDVGPLKIKSINFSIFSDLEIMKAAEVQVWRNNYYESNFKPVEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   CATC+ DF+ CPGH+GYL L LPV+NVG+L  I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKKSICATCHADFQNCPGHFGYLKLDLPVYNVGFLNYILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             IL+ EK   D L+KMRN K+E LKK EL K VVK+C+ M S R  + C  CG +NGMVKK
Sbjct  121   ILIDEKLYEDHLKKMRNPKMEPLKKTELAKAVVKKCSMMASQR-IITCKNCGYLNGMVKK  179

Query  954   -----GPLKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMI  811
                  G + I H+    +G + +DE  +A+S+  + +  + P    LD   V  LFK M 
Sbjct  180   VAAQMGIIGISHDRSKIHGGE-VDEFKSAISHTRESTGAINPLTYVLDPNLVLGLFKGMS  238

Query  810   DEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             D+DCELLY++ +PE L +  + VPP+  RPSV + GG QSNEND+TER+K+I+Q N+S +
Sbjct  239   DKDCELLYIAHRPENLFIICMFVPPLPTRPSVRI-GGTQSNENDLTERVKKILQDNASCK  297

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             + ++  T   +++  W  +Q EVAQYINS+VRG+P Q   S+PLSG +QRLKGKQGRFR 
Sbjct  298   KILNQATTSPKNMQVWDTVQSEVAQYINSEVRGIPNQPD-SKPLSGILQRLKGKQGRFRA  356

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRVEYTGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNGPNK
Sbjct  357   NLSGKRVEYTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNGPNK  416

Query  270   YPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             YPGA+ +++PDG+  +L+   RKR ADEL  G IVDRHLE+GDAVLFNRQPSLHRMSIMC
Sbjct  417   YPGARSVRYPDGSSRTLVGDYRKRIADELTIGCIVDRHLEEGDAVLFNRQPSLHRMSIMC  476

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   HRARIMPWRTLRFNESVCNPYNADFDGDEM  506



>ref|XP_008222562.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Prunus 
mume]
Length=1425

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/498 (65%), Positives = 391/498 (79%), Gaps = 10/498 (2%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGP  1291
             FTKQP+IED G RKI+  QFST S +E++  AE ++Y+  YYD ++ PI  GLLDPR+GP
Sbjct  14    FTKQPFIEDEGHRKIEKWQFSTMSDTEIVNMAETQIYKCNYYDPNQKPIEGGLLDPRLGP  73

Query  1290  PNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
              NK+   CATC    K+CPGH+G+L LALPV NVGYL  IVDILKCICK CS ILL E  
Sbjct  74    ANKSSGECATCGAVMKDCPGHFGFLVLALPVLNVGYLSTIVDILKCICKLCSGILLEEGM  133

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKI  940
             R DFL+KMR+ K+E L+K EL K++VK+C  +T+  + V CS+CG +NG VKK  G L I
Sbjct  134   RNDFLKKMRSPKMEPLRKTELMKKIVKKCNNLTTNYRPVKCSKCGFINGSVKKAVGVLGI  193

Query  939   IHEYG--SQFLDECHNAVSN--KTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDK  775
             IH+    +  +D+    +S+  ++K S  V    L+   ++SLFK+M+DEDCELL LS++
Sbjct  194   IHDRSKLNGVMDDFRTTLSHTKESKASFNVATHMLNPARIYSLFKRMVDEDCELLNLSNR  253

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE L++ +I VPPIAIRPSV VD  + SNENDITERLKRIIQ+N+ LR+++ +     + 
Sbjct  254   PENLIMKNIAVPPIAIRPSVIVDRSL-SNENDITERLKRIIQSNAILRRDLLEAKSAPKC  312

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             LASW  LQ+EVAQYINSD+RG+P  MQ ++PLSGFVQRLKGK GRFRGNLSGKRVEYTGR
Sbjct  313   LASWDILQVEVAQYINSDIRGVPFSMQTAKPLSGFVQRLKGKGGRFRGNLSGKRVEYTGR  372

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNLKITEV IPI MA+ILT+PERVS HNIEKLRQCV NGP+KYPGA+ +++PDG
Sbjct  373   TVISPDPNLKITEVGIPIKMAQILTYPERVSHHNIEKLRQCVSNGPDKYPGARMLRNPDG  432

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
             TE SL   +RK  AD LKYG IV+RHLEDGD VLFNRQPSLHRMSIMCHRA++MPWRTLR
Sbjct  433   TEWSLKV-NRKNAADGLKYGDIVERHLEDGDIVLFNRQPSLHRMSIMCHRAKVMPWRTLR  491

Query  54    FNESVCNPYNADFDGDEM  1
             FNESVCNPYNADFDGDEM
Sbjct  492   FNESVCNPYNADFDGDEM  509



>ref|XP_002864665.1| hypothetical protein ARALYDRAFT_496142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40924.1| hypothetical protein ARALYDRAFT_496142 [Arabidopsis lyrata subsp. 
lyrata]
Length=1376

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/509 (64%), Positives = 388/509 (76%), Gaps = 15/509 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTKQPYIEDVGP KIKSI FS  S  EVMK+AEV+V++  YY+ +  P  NG
Sbjct  1     METKMEIEFTKQPYIEDVGPLKIKSINFSVLSDLEVMKAAEVQVWKNNYYETNLKPYENG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLD RMGPPNK   C TC+G+F+ CPGHYGYL L LPV+NVG+   I+DILKCICK CS 
Sbjct  61    LLDARMGPPNKKSICTTCDGNFQNCPGHYGYLKLDLPVYNVGFFNFILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMRN K+E LKK EL K VVK+C+ M S R  + C +CG +NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRNPKMEPLKKTELAKAVVKKCSTMASQR-IITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMID  808
                   + I H+    +G + +DEC +A+S+  + +  + P    LD   V  LFK M D
Sbjct  180   IAAQMGIGISHDRSKIHGGE-VDECKSAISHTKESTRAINPLTYVLDPNLVLGLFKGMSD  238

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             +DCELLY++ +PE L+ T + VPP++IRPSV + GG +SNENDITERLK IIQ N+ L +
Sbjct  239   KDCELLYIAHRPENLITTCMLVPPLSIRPSVMI-GGTRSNENDITERLKLIIQNNACLHR  297

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +S  T   +++  W  +Q EVA+YINS+VRG+  Q + + PLSG +QRLKGKQGRFR N
Sbjct  298   ILSQPTTSPKNMQVWDTVQSEVAKYINSEVRGVQNQPEKT-PLSGLLQRLKGKQGRFRAN  356

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVEYTGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNGPNKY
Sbjct  357   LSGKRVEYTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNGPNKY  416

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ +++PDG+  +L+   RKR ADEL  G IVDRHLE+GDAVLFNRQPSLHRMSIMCH
Sbjct  417   PGARNVRYPDGSSRTLVGDYRKRIADELTIGCIVDRHLEEGDAVLFNRQPSLHRMSIMCH  476

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   RARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_007132141.1| hypothetical protein PHAVU_011G070100g [Phaseolus vulgaris]
 gb|ESW04135.1| hypothetical protein PHAVU_011G070100g [Phaseolus vulgaris]
Length=1392

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/509 (64%), Positives = 394/509 (77%), Gaps = 17/509 (3%)
 Frame = -3

Query  1497  MMRKREE-MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL  1321
             M R R E + FTK+P++ED GPRKIK+++FS  S SE+ K  EV+V++G YYD+ K PI 
Sbjct  1     MNRGRTEGITFTKEPFMEDAGPRKIKNMKFSMLSDSEISKLGEVQVWKGSYYDSFKKPIH  60

Query  1320  NGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
              GLLDPRMGP NK+  CATC+G+F +CPGHYGYLNLALPVFNVGYL  IV+ILKCICKGC
Sbjct  61    GGLLDPRMGPANKSLGCATCHGNFHDCPGHYGYLNLALPVFNVGYLGSIVEILKCICKGC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFK-RVVKRCTAMTSGRKAVICSRCGCVNGM  964
             +RILL E  R   L+KMR++K   L K +  K R++K C+      K V C RCG +NG 
Sbjct  121   ARILLDEDTRKKHLKKMRSSKKSELDKMDFVKVRIIKDCS------KVVNCPRCGYINGS  174

Query  963   VKKGP--LKIIHEYG---SQFLDECHNAVS--NKTKGSITVPPE-LDSKTVHSLFKKMID  808
             VKK P  L I+H+     +  ++E  + +S    +K +  V    L+   V SLF+KM+D
Sbjct  175   VKKLPASLIIMHDCSKCKNNIVEELESTLSRIKDSKATANVSNRILNPFQVLSLFRKMLD  234

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             EDCELLY++++PEKL++T+I VPPIAIRPSV +D  + SNENDITERLK IIQAN+ LRQ
Sbjct  235   EDCELLYVAERPEKLIITNIVVPPIAIRPSVVMDESL-SNENDITERLKNIIQANAVLRQ  293

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
             E+ ++++ ++ L  W  LQ EVAQ+INS+VRG+P  MQ+++ L+GFVQRLKGK GRFRGN
Sbjct  294   ELQESSVSSKFLDGWEILQNEVAQFINSEVRGIPFYMQSTKQLAGFVQRLKGKHGRFRGN  353

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVEYTGRTVISPDPNLKI+EVAIPILMA ILT+PERV+ HNIEKLRQCVRNGP+KY
Sbjct  354   LSGKRVEYTGRTVISPDPNLKISEVAIPILMASILTYPERVTHHNIEKLRQCVRNGPDKY  413

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ ++   G   SL    RKR ADEL+ G IVDRHLEDGD VLFNRQPSLHRMSIM H
Sbjct  414   PGARMLRRDGGHSWSLKVLCRKRAADELRIGDIVDRHLEDGDIVLFNRQPSLHRMSIMSH  473

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  474   RARIMPWRTLRFNESVCNPYNADFDGDEM  502



>ref|XP_004505923.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X1 [Cicer arietinum]
Length=1399

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/508 (63%), Positives = 394/508 (78%), Gaps = 17/508 (3%)
 Frame = -3

Query  1497  MMRKREE-MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL  1321
             M R R E + FTK+P+IED+GPRKI  I +ST S +E+ K  EV+V++G YYDA + P  
Sbjct  1     MNRSRTEGLVFTKEPFIEDLGPRKIAGITYSTLSEAEISKIGEVQVWKGTYYDAFRKPEA  60

Query  1320  NGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
             +GLLD RMGP NK+  CATC+G+F +C GHYGYL L  PVFNVGYL  +V ILKCICKGC
Sbjct  61    DGLLDSRMGPANKSLVCATCHGNFADCQGHYGYLPLVQPVFNVGYLNTMVKILKCICKGC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMV  961
             + ILL E  R  +L+KMRN+KL+ L+K +L + ++KR  +     K + C RCG +NG+V
Sbjct  121   AGILLDEDTRKKYLKKMRNSKLDELQKIQLLESIMKRFRSA----KFIKCQRCGYINGIV  176

Query  960   K--KGPLKIIHE--YG-SQFLDECHNAVSNKTKGSIT---VPPELDSKTVHSLFKKMIDE  805
             K  +  L+I+H+  +G +  + E  +A+S+  +   T       LD K+VHSLF KM DE
Sbjct  177   KLTRSTLRIVHDCSHGKNDVVSELQSALSHMKEYRATNDLASRNLDPKSVHSLFTKMSDE  236

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DC LLYL+++PEKL++T+I VPPI IRPSV +DG  QSNENDITE+L++IIQAN++L +E
Sbjct  237   DCALLYLAERPEKLIITNIAVPPIVIRPSVIMDGS-QSNENDITEKLRKIIQANAALHKE  295

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             + ++T   +    +  LQ  VAQYINSDV+G P  MQAS+PL+GFVQR+KGKQGRFR NL
Sbjct  296   LEEST---KFQGGFEMLQFLVAQYINSDVKGGPYSMQASKPLTGFVQRIKGKQGRFRSNL  352

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKLRQC+RNGP+KYP
Sbjct  353   SGKRVEYTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKLRQCLRNGPDKYP  412

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GAK ++H  GT  +L  S RKR ADEL++G IVDRHLEDGD VLFNRQPSLHRMS+MCHR
Sbjct  413   GAKLLRHAGGTTWNLKVSCRKRLADELRFGDIVDRHLEDGDVVLFNRQPSLHRMSMMCHR  472

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  473   ARIMPWRTLRFNESVCNPYNADFDGDEM  500



>ref|XP_009126624.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Brassica 
rapa]
 emb|CDY09230.1| BnaA02g06560D [Brassica napus]
Length=1370

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/509 (62%), Positives = 395/509 (78%), Gaps = 15/509 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVGP KI+SI FS  S  EVMK+AEV+V++ +YY+++  PI  G
Sbjct  1     METKTEIEFTKEPYIEDVGPLKIQSINFSMLSDIEVMKAAEVQVWKNMYYESNFKPIEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK  +CATC+G+F+ CPGHYGYL L LPV+NVG+   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKRSTCATCHGNFQNCPGHYGYLKLDLPVYNVGFFNFILDILKCICKSCSS  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +L+ EK   D L+KMRN + E L+K EL K VVK+C+ M +G++ + C +CG +NGMVKK
Sbjct  121   MLIEEKMYEDHLKKMRNPRTEPLRKTELAKAVVKKCSLM-AGQRVITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMID  808
                   + I H+    +G + +DE  +A+S+  + +  + P    LD   V  LFK M D
Sbjct  180   VAAQLGIGISHDRSKIHGGE-IDEFKSAISHTKESAGGINPLTYVLDPNVVLRLFKGMSD  238

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             +DCELLY++ +PE L++T + VPP++IRPSV + GG QSNENDITERLK+IIQ N+SL +
Sbjct  239   KDCELLYIAHRPENLIITCMLVPPLSIRPSVMI-GGTQSNENDITERLKKIIQDNASLHK  297

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +S  T   +++  W  +Q EVAQYINS+VRG+   M  ++PL+G +QRLKGK GRFR N
Sbjct  298   ILSQPTTSPKNMQVWDTVQSEVAQYINSEVRGVQI-MPNTKPLAGLLQRLKGKGGRFRAN  356

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVE+TGRTVISPDPNLKITEV IPILMARILTFPE VSRHNI+KLRQ VRNGPNKY
Sbjct  357   LSGKRVEFTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIDKLRQRVRNGPNKY  416

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ +++PDG+  +L+   RKR ADEL YG IVDRHLEDGDA+LFNRQPSLHRMSIMCH
Sbjct  417   PGARNVRYPDGSSRTLVGDYRKRIADELTYGCIVDRHLEDGDAILFNRQPSLHRMSIMCH  476

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   RARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_006279465.1| hypothetical protein CARUB_v10025743mg [Capsella rubella]
 gb|EOA12363.1| hypothetical protein CARUB_v10025743mg [Capsella rubella]
Length=1376

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/509 (63%), Positives = 388/509 (76%), Gaps = 15/509 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E+++TK+PYIEDVG  KIKSI FS  S  EVMK+AEV+V++  YYD +  P   G
Sbjct  1     METKMEIEYTKKPYIEDVGSLKIKSINFSMLSDLEVMKAAEVQVWKNSYYDPNCKPFEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   C TC G+F+ CPGHYGYL L LPV+N+GY   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKKSICTTCEGNFQNCPGHYGYLKLDLPVYNIGYFNFILDILKCICKCCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMRN K+E LKK EL K VVK+C+ M S R  + C +CG +NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRNPKMEPLKKTELAKAVVKKCSTMASQR-IITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMID  808
              P    + I H+    +G + +DE   A+S+  + +  + P    LD   V  LFK M D
Sbjct  180   IPAQMGIGISHDRSKIHGGE-VDEFKAAISHIKESTQAINPLTYVLDPNVVLGLFKGMSD  238

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             +DCELLY++ +PE L++T + VPP++IRPSV V GG QSNEND++ RLK+IIQ N+SL +
Sbjct  239   KDCELLYIAHRPENLIITCMLVPPLSIRPSVMV-GGSQSNENDLSARLKQIIQDNASLHR  297

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +S  T  A+++  W  +Q EVA+YINS+VRG+  Q   S+P+SG +QRLKGKQGRFR N
Sbjct  298   ILSQPTTSAKNMQVWDTVQSEVAKYINSEVRGVQNQPD-SKPMSGILQRLKGKQGRFRAN  356

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVEYTGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNGPNKY
Sbjct  357   LSGKRVEYTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNGPNKY  416

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ +++PDG+  +L+   RKR ADEL  G IVDRHLE+GDAVLFNRQPSLHRMSIMCH
Sbjct  417   PGARNVRYPDGSSRALVGDYRKRIADELAIGCIVDRHLEEGDAVLFNRQPSLHRMSIMCH  476

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   RARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|NP_200812.2| nuclear RNA polymerase C1 [Arabidopsis thaliana]
 gb|AED97269.1| nuclear RNA polymerase C1 [Arabidopsis thaliana]
Length=1376

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/509 (63%), Positives = 386/509 (76%), Gaps = 15/509 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVGP KIKSI FS  S  EVMK+AEV+V+    YD S  P  NG
Sbjct  1     METKMEIEFTKKPYIEDVGPLKIKSINFSVLSDLEVMKAAEVQVWNIGLYDHSFKPYENG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   C TC G+F+ CPGHYGYL L LPV+NVGY   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKKSICTTCEGNFQNCPGHYGYLKLDLPVYNVGYFNFILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMRN ++E LKK EL K VVK+C+ M S R  + C +CG +NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRNPRMEPLKKTELAKAVVKKCSTMASQR-IITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMID  808
                   + I H+    +G + +DEC +A+S+  + +  + P    LD   V  LFK+M D
Sbjct  180   IAAQFGIGISHDRSKIHGGE-IDECKSAISHTKQSTAAINPLTYVLDPNLVLGLFKRMSD  238

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             +DCELLY++ +PE L++T + VPP++IRPSV + GG+QSNEND+T RLK+II  N+SL +
Sbjct  239   KDCELLYIAYRPENLIITCMLVPPLSIRPSVMI-GGIQSNENDLTARLKQIILGNASLHK  297

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +S  T   +++  W  +Q+EVA+YINS+VRG   Q +   PLSG +QRLKGK GRFR N
Sbjct  298   ILSQPTSSPKNMQVWDTVQIEVARYINSEVRGCQNQPE-EHPLSGILQRLKGKGGRFRAN  356

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVE+TGRTVISPDPNLKITEV IPILMA+ILTFPE VSRHNIEKLRQCVRNGPNKY
Sbjct  357   LSGKRVEFTGRTVISPDPNLKITEVGIPILMAQILTFPECVSRHNIEKLRQCVRNGPNKY  416

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ +++PDG+  +L+   RKR ADEL  G IVDRHL++GD VLFNRQPSLHRMSIMCH
Sbjct  417   PGARNVRYPDGSSRTLVGDYRKRIADELAIGCIVDRHLQEGDVVLFNRQPSLHRMSIMCH  476

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   RARIMPWRTLRFNESVCNPYNADFDGDEM  505



>dbj|BAA96933.1| DNA-directed RNA polymerase II largest chain [Arabidopsis thaliana]
Length=1383

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/509 (63%), Positives = 386/509 (76%), Gaps = 15/509 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVGP KIKSI FS  S  EVMK+AEV+V+    YD S  P  NG
Sbjct  1     METKMEIEFTKKPYIEDVGPLKIKSINFSVLSDLEVMKAAEVQVWNIGLYDHSFKPYENG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   C TC G+F+ CPGHYGYL L LPV+NVGY   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKKSICTTCEGNFQNCPGHYGYLKLDLPVYNVGYFNFILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMRN ++E LKK EL K VVK+C+ M S R  + C +CG +NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRNPRMEPLKKTELAKAVVKKCSTMASQR-IITCKKCGYLNGMVKK  179

Query  954   GP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMID  808
                   + I H+    +G + +DEC +A+S+  + +  + P    LD   V  LFK+M D
Sbjct  180   IAAQFGIGISHDRSKIHGGE-IDECKSAISHTKQSTAAINPLTYVLDPNLVLGLFKRMSD  238

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             +DCELLY++ +PE L++T + VPP++IRPSV + GG+QSNEND+T RLK+II  N+SL +
Sbjct  239   KDCELLYIAYRPENLIITCMLVPPLSIRPSVMI-GGIQSNENDLTARLKQIILGNASLHK  297

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +S  T   +++  W  +Q+EVA+YINS+VRG   Q +   PLSG +QRLKGK GRFR N
Sbjct  298   ILSQPTSSPKNMQVWDTVQIEVARYINSEVRGCQNQPE-EHPLSGILQRLKGKGGRFRAN  356

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRVE+TGRTVISPDPNLKITEV IPILMA+ILTFPE VSRHNIEKLRQCVRNGPNKY
Sbjct  357   LSGKRVEFTGRTVISPDPNLKITEVGIPILMAQILTFPECVSRHNIEKLRQCVRNGPNKY  416

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA+ +++PDG+  +L+   RKR ADEL  G IVDRHL++GD VLFNRQPSLHRMSIMCH
Sbjct  417   PGARNVRYPDGSSRTLVGDYRKRIADELAIGCIVDRHLQEGDVVLFNRQPSLHRMSIMCH  476

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   RARIMPWRTLRFNESVCNPYNADFDGDEM  505



>ref|XP_010443797.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Camelina sativa]
Length=1377

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 383/510 (75%), Gaps = 16/510 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVG  KIKSI FS  S  EVMK+AEV+V+   YYD +  P   G
Sbjct  1     METKMEIEFTKKPYIEDVGALKIKSINFSMLSDLEVMKAAEVQVWNNGYYDPNNKPHEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPPNK   CATC G+F+ CPGHYGYL L LPV+N+GY   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPNKRSICATCEGNFQNCPGHYGYLKLDLPVYNIGYFNFILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMR+ K+E LKK EL K VVK+C+ M S R  + C +CG  NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRSPKMEPLKKTELAKAVVKKCSTMASQR-VITCKKCGYQNGMVKK  179

Query  954   GP-----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMI  811
              P     + I H+    +G + +DE   A+S+  + S  + P    LD   V  LFK M 
Sbjct  180   IPAQMGFIGISHDRSKIHGGE-VDEFKAAISHTKESSQGINPLTYVLDPNVVLGLFKGMS  238

Query  810   DEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             D+DCELLY++ +PE L++T + VPP++IRPSV +DG  +SNEND++ +LK+IIQ N+SL 
Sbjct  239   DKDCELLYIAHRPENLIITCMLVPPLSIRPSVMIDG-TKSNENDLSSQLKQIIQDNASLH  297

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             + +S  T   +++  W  +Q EVA++INS+VRG+  Q    + LSG +QRLKGKQGRFR 
Sbjct  298   RILSQPTTSTKNMQVWDTVQSEVAKFINSEVRGVQSQPD-RKQLSGILQRLKGKQGRFRA  356

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRVE+TGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNGPNK
Sbjct  357   NLSGKRVEFTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNGPNK  416

Query  270   YPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             YPGA+ +++PDG+  +L+   RKR ADEL  G IVDRHL+DGD VLFNRQPSLHRMSIMC
Sbjct  417   YPGARNVRYPDGSSRTLVGDYRKRIADELTIGCIVDRHLQDGDVVLFNRQPSLHRMSIMC  476

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   HRARIMPWRTLRFNESVCNPYNADFDGDEM  506



>ref|NP_001190573.1| nuclear RNA polymerase C1 [Arabidopsis thaliana]
 gb|AED97270.1| nuclear RNA polymerase C1 [Arabidopsis thaliana]
Length=1391

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/519 (61%), Positives = 386/519 (74%), Gaps = 25/519 (5%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVGP KIKSI FS  S  EVMK+AEV+V+    YD S  P  NG
Sbjct  1     METKMEIEFTKKPYIEDVGPLKIKSINFSVLSDLEVMKAAEVQVWNIGLYDHSFKPYENG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICK----  1147
             LLDPRMGPPNK   C TC G+F+ CPGHYGYL L LPV+NVGY   I+DILKCICK    
Sbjct  61    LLDPRMGPPNKKSICTTCEGNFQNCPGHYGYLKLDLPVYNVGYFNFILDILKCICKVTEL  120

Query  1146  ------GCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSR  985
                    CS +LL EK   D LRKMRN ++E LKK EL K VVK+C+ M S R  + C +
Sbjct  121   ADYVSLRCSNMLLDEKLYEDHLRKMRNPRMEPLKKTELAKAVVKKCSTMASQR-IITCKK  179

Query  984   CGCVNGMVKKGP----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKT  838
             CG +NGMVKK      + I H+    +G + +DEC +A+S+  + +  + P    LD   
Sbjct  180   CGYLNGMVKKIAAQFGIGISHDRSKIHGGE-IDECKSAISHTKQSTAAINPLTYVLDPNL  238

Query  837   VHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKR  658
             V  LFK+M D+DCELLY++ +PE L++T + VPP++IRPSV + GG+QSNEND+T RLK+
Sbjct  239   VLGLFKRMSDKDCELLYIAYRPENLIITCMLVPPLSIRPSVMI-GGIQSNENDLTARLKQ  297

Query  657   IIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRL  478
             II  N+SL + +S  T   +++  W  +Q+EVA+YINS+VRG   Q +   PLSG +QRL
Sbjct  298   IILGNASLHKILSQPTSSPKNMQVWDTVQIEVARYINSEVRGCQNQPE-EHPLSGILQRL  356

Query  477   KGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLR  298
             KGK GRFR NLSGKRVE+TGRTVISPDPNLKITEV IPILMA+ILTFPE VSRHNIEKLR
Sbjct  357   KGKGGRFRANLSGKRVEFTGRTVISPDPNLKITEVGIPILMAQILTFPECVSRHNIEKLR  416

Query  297   QCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQP  118
             QCVRNGPNKYPGA+ +++PDG+  +L+   RKR ADEL  G IVDRHL++GD VLFNRQP
Sbjct  417   QCVRNGPNKYPGARNVRYPDGSSRTLVGDYRKRIADELAIGCIVDRHLQEGDVVLFNRQP  476

Query  117   SLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   SLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  515



>ref|XP_010455868.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Camelina sativa]
Length=1379

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/513 (62%), Positives = 387/513 (75%), Gaps = 20/513 (4%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PIL  1321
             M  + E++FTK+P+IEDVG  KIKSI FS FS  EVMK+AEV+V++  YYD +    P  
Sbjct  1     METKMEIEFTKKPFIEDVGALKIKSINFSMFSDLEVMKAAEVQVWKNGYYDPNNGGKPHE  60

Query  1320  NGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
              GLLDPRMGPPNK   CATC G+F+ CPGHYGYL L LPV+N+GY   I+DILKCICK C
Sbjct  61    GGLLDPRMGPPNKRSICATCEGNFQNCPGHYGYLKLDLPVYNIGYFNFILDILKCICKRC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMV  961
             S +LL EK   D LRKMR+ K+E LKK EL K VVK+C+ M S R  + C +CG  NGMV
Sbjct  121   SNMLLDEKLYEDHLRKMRSPKMEPLKKTELAKAVVKKCSTMASQR-VITCKKCGYQNGMV  179

Query  960   KKGP-----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKK  817
             KK P     + I H+    +G + +DE   A+S+  + S  + P    LD   V  LFK 
Sbjct  180   KKIPAQMGFIGISHDRSKIHGGE-VDEFKAAISHTKESSQGINPLTYVLDPNVVLGLFKG  238

Query  816   MIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSS  637
             M D+DCELLY++ +PE L++T + VPP++IRPSV + GG +SNEND++ +LK+IIQ N+S
Sbjct  239   MSDKDCELLYIAHRPENLIITCMLVPPLSIRPSVMI-GGTESNENDLSSQLKQIIQDNAS  297

Query  636   LRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRP-LSGFVQRLKGKQGR  460
             L + ++  T   +++  W  +Q EVA++INS+VRG+  Q+Q  R  LSG +QRLKGKQGR
Sbjct  298   LHRILNQPTTSTKNMQVWDTVQSEVAKFINSEVRGV--QIQPDRKQLSGVLQRLKGKQGR  355

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FR NLSGKRVE+TGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNG
Sbjct  356   FRANLSGKRVEFTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNG  415

Query  279   PNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
             PNKYPGA+ +++PDG+  +L+   RKR ADEL  G IVDRHLE+GD VLFNRQPSLHRMS
Sbjct  416   PNKYPGARNVRYPDGSSRTLVGDYRKRIADELTIGCIVDRHLENGDVVLFNRQPSLHRMS  475

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  476   IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  508



>ref|XP_010483650.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Camelina sativa]
Length=1377

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/510 (62%), Positives = 382/510 (75%), Gaps = 16/510 (3%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M  + E++FTK+PYIEDVG  KIKSI FS  S  EVMK+AEV+V+   +Y  +  P   G
Sbjct  1     METKMEIEFTKKPYIEDVGALKIKSINFSMLSDLEVMKAAEVQVWNNGHYAPNGKPHEGG  60

Query  1314  LLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LLDPRMGPP K   CATC G+F+ CPGHYGYL L LPV+N+GY   I+DILKCICK CS 
Sbjct  61    LLDPRMGPPTKRSICATCEGNFQNCPGHYGYLKLDLPVYNIGYFNFILDILKCICKRCSN  120

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             +LL EK   D LRKMR+ K+E LKK EL K VVK+C+ M S R  + C +CG  NGMVKK
Sbjct  121   MLLDEKLYEDHLRKMRSPKMEPLKKTELAKAVVKKCSTMASQR-VITCKKCGYQNGMVKK  179

Query  954   GP-----LKIIHE----YGSQFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMI  811
              P     + I H+    +G + +DE   A+S+  + S  + P    LD   V  LFK M 
Sbjct  180   IPAQMGFIGISHDRSKIHGGE-VDEFKAAISHTKESSQGINPLTYVLDPNVVLGLFKGMS  238

Query  810   DEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             D+DCELLY++ +PE L++T + VPP++IRPSV +DG  +SNEND++ +LK+IIQ N+SL 
Sbjct  239   DKDCELLYIAHRPENLIITCMLVPPLSIRPSVMIDG-TKSNENDLSSQLKQIIQDNASLH  297

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             + +S  T   +++  W  +Q EVA++INS+VRG+  Q +  + LSG +QRLKGKQGRFR 
Sbjct  298   RILSQPTTSTKNMQVWDTVQSEVAKFINSEVRGVQSQPE-RKQLSGILQRLKGKQGRFRA  356

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRVE+TGRTVISPDPNLKITEV IPILMARILTFPE VSRHNIEKLRQCVRNGPNK
Sbjct  357   NLSGKRVEFTGRTVISPDPNLKITEVGIPILMARILTFPECVSRHNIEKLRQCVRNGPNK  416

Query  270   YPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             YPGA+ +++PDG+  +L+   RKR ADEL  G IVDRHL+DGD VLFNRQPSLHRMSIMC
Sbjct  417   YPGARNVRYPDGSSRTLVGDYRKRIADELTIGCIVDRHLQDGDVVLFNRQPSLHRMSIMC  476

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  477   HRARIMPWRTLRFNESVCNPYNADFDGDEM  506



>ref|XP_010907843.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Elaeis 
guineensis]
Length=1369

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/501 (61%), Positives = 371/501 (74%), Gaps = 18/501 (4%)
 Frame = -3

Query  1485  REEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLD  1306
             +E+++ TK+PYIEDVGPRKIKSI+FSTFSG E+ K AEV+V+    YD +  PI NGLLD
Sbjct  2     QEKLRCTKEPYIEDVGPRKIKSIRFSTFSGEEIRKLAEVQVWNNRIYDLNLKPIENGLLD  61

Query  1305  PRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILL  1126
             PRMG PN+   CATC+G+F +CPGH+GYL L LPVFNVGY   I++ILKCICKGC RILL
Sbjct  62    PRMGAPNRQTECATCHGNFTDCPGHFGYLKLTLPVFNVGYFNSILNILKCICKGCGRILL  121

Query  1125  GEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG--  952
              E  R  +L+KMRN K +  +KN L K V  +C       K   C RCG  NG+VKK   
Sbjct  122   DETLRKSYLKKMRNPKADIFQKNALMKMVRDKC-------KPSRCLRCGYANGVVKKARS  174

Query  951   PLKIIHEYGSQF---LDECHNAVSN-KTKGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
              L  I ++       ++E  +A+S+ K K S  V   L +  V SLF+KM+DEDCELL L
Sbjct  175   GLYFIQDFSKTADPSVEEFRSALSHTKDKTSFQVSHVLSAVAVLSLFRKMLDEDCELLNL  234

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
              D+PEKL+VT I VPP++IRPSV VD G  SNE++IT  LK II  NS LR+++     P
Sbjct  235   YDRPEKLIVTHIAVPPVSIRPSVIVDSGRSSNEDNITSILKNIINTNSILREDLEGAAPP  294

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              + L  W  LQ++V +YINS+   +P          G VQRLKGKQGRFRGNLSGKRVE+
Sbjct  295   FKCLDCWTHLQIQVVEYINSEAPCIPDSKH-----RGLVQRLKGKQGRFRGNLSGKRVEF  349

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVAIPILMAR+LT+PERVS +NIEKLRQ VRNGP+KYPGA ++  
Sbjct  350   TGRTVISPDPNLKITEVAIPILMARVLTYPERVSNYNIEKLRQLVRNGPSKYPGANFVLR  409

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
             PDG+++ L Y  ++  A+ELKYGY+V+RHLEDGD VLFNRQPSLHRMSIMCHRARIMPWR
Sbjct  410   PDGSKVHLRYVDKRDIANELKYGYVVERHLEDGDIVLFNRQPSLHRMSIMCHRARIMPWR  469

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  470   TLRFNESVCNPYNADFDGDEM  490



>ref|XP_002531828.1| DNA-directed RNA polymerase III largest subunit, putative [Ricinus 
communis]
 gb|EEF30548.1| DNA-directed RNA polymerase III largest subunit, putative [Ricinus 
communis]
Length=1383

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/478 (65%), Positives = 377/478 (79%), Gaps = 13/478 (3%)
 Frame = -3

Query  1404  FSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGPPNKTKS-CATCNGDFKECPGHY  1228
              SG+E++K+AE +V+ G YYD+++ PI  GLLDPR+GP  K  S C TC  DF ECPGH+
Sbjct  2     MSGAEILKAAECQVHLGSYYDSTRKPIQAGLLDPRLGPATKQSSACETCGADFHECPGHF  61

Query  1227  GYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELF  1048
             GYLNL LPVFNVGY+  I+DILKCICK CSRIL  EK     L+KMRN ++EHL+K+EL 
Sbjct  62    GYLNLVLPVFNVGYMSNILDILKCICKSCSRILYDEKLCKADLKKMRNPRIEHLRKSELV  121

Query  1047  KRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LKIIHEYG---SQFLDECHNAVSN-  886
             K++VK+C++MTS  KAV C+RCG +NGMVKK    L IIH+       +L+EC +A+++ 
Sbjct  122   KKIVKKCSSMTS-NKAVKCTRCGDMNGMVKKAGSVLSIIHDRAKLVDGYLEECRSAIAHT  180

Query  885   -KTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVF  712
              +++  I++    L    V SLFK++ +EDCE+L L D+PEKL++T+I VPPI+IRPSVF
Sbjct  181   KESRAPISLATYILTPVKVLSLFKRIPEEDCEVLGLYDRPEKLIITNIAVPPISIRPSVF  240

Query  711   VDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPA-RSLASWVDLQMEVAQYINSDVR  535
              DG +QSNENDITERLK+IIQAN+SLR E+ +  +   + L SW  LQ  VA Y+NSDVR
Sbjct  241   TDG-LQSNENDITERLKQIIQANASLRMELLEGRMSVNKYLDSWDGLQAAVALYMNSDVR  299

Query  534   GLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILM  355
              +P  ++  +PLSGFVQRLKGKQGRFRGNLSGKRVE+TGRTVISPDPNLKITEVAIPI M
Sbjct  300   -VPNNVEVGKPLSGFVQRLKGKQGRFRGNLSGKRVEFTGRTVISPDPNLKITEVAIPIHM  358

Query  354   ARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYG  175
             ARIL++PERVS HNIEKLRQ V NGP KYPGA  +++PDG+   L+ S RK  A+EL +G
Sbjct  359   ARILSYPERVSHHNIEKLRQLVSNGPQKYPGASTVRYPDGSSKRLIGSYRKTIAEELTFG  418

Query  174   YIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              IVDRHLEDGD VLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  419   CIVDRHLEDGDVVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  476



>ref|XP_010692683.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Beta vulgaris subsp. vulgaris]
Length=1344

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/501 (61%), Positives = 381/501 (76%), Gaps = 20/501 (4%)
 Frame = -3

Query  1494  MRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNG  1315
             M    +++FTKQPYIE+   R+I+SI FS FS SE+ K AEVEV+RGVYYD +K P  NG
Sbjct  1     MNPLSKIKFTKQPYIEEDDTRQIESIDFSMFSASEMSKIAEVEVFRGVYYDRNKKPENNG  60

Query  1314  LLDPRMGPPNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             LLDP+MGPPNK+   CATC+  F++CPGHYGYL LALPVFN+GY+  I DILKCICK CS
Sbjct  61    LLDPKMGPPNKSAGLCATCHAKFEDCPGHYGYLPLALPVFNIGYINAIRDILKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             RILL E+   ++L+ MR  KL+ L K +L K+++K    M + +K ++C RCG VNG VK
Sbjct  121   RILLSEEVCREYLKTMR--KLDRLHKIDLTKKIMK----MFANKKEILCFRCGYVNGKVK  174

Query  957   KG--PLKIIHEYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYL  784
             KG   L I+H   +Q        VS++TK ++  P +        LFK+M+++DCELLYL
Sbjct  175   KGGSQLAIVHTLPNQ------GRVSDETKSTLIQPHD-----ALLLFKQMLNQDCELLYL  223

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
             +D+PEKL+ T++ VPP+A+RPSVF+DGG QSNENDITERLKRIIQANS LR ++ ++   
Sbjct  224   ADRPEKLIFTNMLVPPMALRPSVFMDGGTQSNENDITERLKRIIQANSCLRHKMEESCNS  283

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
              R L  W  LQ+EV QYINS+VR      Q ++PL+GFVQRLKGK GRFRG+LSGKRVE+
Sbjct  284   LRFLDDWNYLQVEVTQYINSEVRVASQGPQPTKPLAGFVQRLKGKHGRFRGHLSGKRVEF  343

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGRTVISPDPNLKITEVA+P+LMA +LT+PE V+  NIEKL+Q V+NG  KYPGAK++  
Sbjct  344   TGRTVISPDPNLKITEVAVPLLMATVLTYPEHVNHQNIEKLKQYVQNGSKKYPGAKFVVE  403

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
              +G    L + +RK  AD LK+G IV R+LEDGD +LFNRQPSLHRMS+MCH+ARIMPWR
Sbjct  404   SNGDRRDLSFGNRKTIADGLKFGSIVHRYLEDGDVLLFNRQPSLHRMSMMCHKARIMPWR  463

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLRFNESVCNPYNADFDGDEM
Sbjct  464   TLRFNESVCNPYNADFDGDEM  484



>ref|NP_001053175.1| Os04g0492300 [Oryza sativa Japonica Group]
 emb|CAE02045.2| OJ990528_30.3 [Oryza sativa Japonica Group]
 emb|CAD41360.2| OSJNBa0076N16.24 [Oryza sativa Japonica Group]
 dbj|BAF15089.1| Os04g0492300 [Oryza sativa Japonica Group]
 emb|CAH67354.1| OSIGBa0130B08.14 [Oryza sativa Indica Group]
 emb|CAH67535.1| H0425E08.3 [Oryza sativa Indica Group]
 dbj|BAH00234.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77539.1| hypothetical protein OsI_16437 [Oryza sativa Indica Group]
Length=1383

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/506 (60%), Positives = 369/506 (73%), Gaps = 20/506 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R  E+++ TK+P+IEDVG R+IKSI+FS FSG+EV +SAEV+V+    Y+    P+ N
Sbjct  1     MARPEEKLRCTKEPFIEDVGTRRIKSIRFSMFSGNEVRQSAEVQVWNSRIYNHEMKPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG  NK   C+TC+G F ECPGH+GYL LALPVFNVG+   I+D+LKCICK CS
Sbjct  61    GLLDTRMGAANKLGECSTCHGSFAECPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+RL+FL+KMRN K + L+K+ + K+V  +C       K   C  CG +NG+ K
Sbjct  121   RVLLMEKDRLEFLKKMRNPKADPLQKSAIMKKVRDKC-------KLSRCPWCGFINGVAK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L I+H+  S+ LD    E  +A+S+K  K SI+    LD   V SLFK+M DEDC
Sbjct  174   KGRAGLIILHDC-SKTLDGSTEELRDALSHKKEKLSISAVRMLDPAIVLSLFKRMTDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL+VT I VPP+ IRPSVFV GG  SNE+ IT  LK I   NS L++ + 
Sbjct  233   ELLNLGDRPEKLIVTEIAVPPVPIRPSVFVAGGRMSNEDSITVILKSIANTNSILKENLQ  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                   +    W  LQ++V +YINSD   LP          G VQRLKGK GRFRGNLSG
Sbjct  293   TGGQFMKCFDCWQHLQLQVVEYINSDAPSLPESQH-----RGLVQRLKGKTGRFRGNLSG  347

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KR EYTGRTVISPDPNL+ITEVAIPILMAR+LT+PERVS +NIEKLRQC+RNGP+K+PGA
Sbjct  348   KRTEYTGRTVISPDPNLRITEVAIPILMARVLTYPERVSYYNIEKLRQCIRNGPHKHPGA  407

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              +I  PDGT++ L Y  R+  A +LKYG +V+RHLEDGD VLFNRQPSLHRMSIM HRAR
Sbjct  408   NFIIQPDGTKLHLKYCDRRIAARDLKYGCVVERHLEDGDIVLFNRQPSLHRMSIMSHRAR  467

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   IMPWRTLRFNESVCNPYNADFDGDEM  493



>tpg|DAA37181.1| TPA: putative DNA-directed RNA polymerase family protein [Zea 
mays]
Length=1030

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/506 (59%), Positives = 363/506 (72%), Gaps = 20/506 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M +  E+++ TK+P+IEDVG R+IKSI+FS  SGSE+ KSAEV+V+    YD    P+ N
Sbjct  1     MAKPEEKLRCTKEPFIEDVGTRRIKSIRFSVLSGSEIRKSAEVQVWNNRIYDRDMTPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMG P K   C TC+G+F +CPGH+GYL LALPVFNVG+   I+D+LKCICK CS
Sbjct  61    GLLDPRMGIPTKRGKCNTCHGEFSDCPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+R +FL+KMRN + + L+K+   K+V  +C       K   C RC   NG+VK
Sbjct  121   RVLLIEKDRREFLKKMRNPRADALQKSATMKKVRDKC-------KLSCCPRCDYRNGVVK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L ++H+  S+ LD    E  NA+ NK  K S +    LD  TV SLF++MIDEDC
Sbjct  174   KGRAGLIVVHDC-SKVLDGHTEELKNALQNKKEKVSASSVLVLDPATVLSLFRRMIDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL+VT I VPP+ IRPSV V     SNE+ IT  LK I+  NS L++ + 
Sbjct  233   ELLNLGDRPEKLIVTEIAVPPVPIRPSVVVGNSRTSNEDSITVILKSIVNTNSILKETLH  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                   +    W  LQ++V +Y+NSD   LP          G VQRLKGK GRFRGNLSG
Sbjct  293   TGGPFTKCFDCWQYLQLQVVEYVNSDAPSLPESQH-----RGLVQRLKGKTGRFRGNLSG  347

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KR EYTGRTVISPDPNLKITEVAIP+LMAR+LT+PERVS +NIEKLRQC+RNGP KYPGA
Sbjct  348   KRTEYTGRTVISPDPNLKITEVAIPVLMARVLTYPERVSNYNIEKLRQCIRNGPFKYPGA  407

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              ++  PDG + SL Y  R+  A +LK G IV+RHLEDGD VLFNRQPSLHRMSIMCHRAR
Sbjct  408   NFVTQPDGMKQSLKYGDRRITARDLKCGCIVERHLEDGDVVLFNRQPSLHRMSIMCHRAR  467

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   IMPWRTLRFNESVCNPYNADFDGDEM  493



>ref|XP_009402242.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Musa 
acuminata subsp. malaccensis]
Length=1372

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/503 (60%), Positives = 363/503 (72%), Gaps = 20/503 (4%)
 Frame = -3

Query  1488  KREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLL  1309
             + E+++ TK+PYIEDVGP++IKSI+FSTFSG E+ K AEV+V+    Y     P+ NGLL
Sbjct  4     REEKLRCTKEPYIEDVGPQRIKSIRFSTFSGEEIKKLAEVQVWNNRIYGIDLRPVENGLL  63

Query  1308  DPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRIL  1129
             DP+MG  NK   CATC+G+F ECPGH+GYL L LPVFNVG+   I+++LKCICK C+RIL
Sbjct  64    DPKMGAANKAGVCATCHGNFTECPGHFGYLKLTLPVFNVGFFNSILNVLKCICKACARIL  123

Query  1128  LGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG-  952
             L E +R  FL+KMRN K +   KN L K++  +C       K  IC  CG  NG+VKK  
Sbjct  124   LLENDRRIFLKKMRNPKADIFMKNALMKKIRDKC-------KISICPWCGSRNGVVKKAR  176

Query  951   -PLKIIHEYGSQFLDECHNAVSN-----KTKGSITVPPELDSKTVHSLFKKMIDEDCELL  790
                 I H++ S+ +DE    V       K K S  +   L   TV SLFK+M+DEDCELL
Sbjct  177   SSFAIAHDF-SRSVDESIEVVRAALSHIKAKSSFQIVHVLSPVTVLSLFKRMVDEDCELL  235

Query  789   YLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTT  610
              L D+P+KL+VT+I VPP+A+RPSVFVD G  SNE+ IT  LK II  NS LR+++    
Sbjct  236   NLYDRPDKLIVTTIAVPPVAVRPSVFVDFGKSSNEDSITTILKNIINTNSILREDLEGAA  295

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRV  430
              P + L  W  LQ++V +YINS+   +P          G +QRLKGKQGRFRGNLSGKRV
Sbjct  296   PPFKCLDCWAHLQIQVVEYINSEAPSVPDSKH-----RGLIQRLKGKQGRFRGNLSGKRV  350

Query  429   EYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI  250
             E+TGRTVISPDPNLKITEVAIP+LMA+ LT+PERVS +NIEKLRQ + NGP+KYPGA +I
Sbjct  351   EFTGRTVISPDPNLKITEVAIPVLMAKKLTYPERVSAYNIEKLRQRICNGPDKYPGANFI  410

Query  249   KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                DGT+  L Y  +K  A ELKYGYIV+RHLEDGD VLFNRQPSLHRMSIMCHRARIMP
Sbjct  411   LLGDGTKQHLRYVDKKTAASELKYGYIVERHLEDGDVVLFNRQPSLHRMSIMCHRARIMP  470

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRTLRFNESVCNPYNADFDGDEM
Sbjct  471   WRTLRFNESVCNPYNADFDGDEM  493



>ref|XP_006653556.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Oryza brachyantha]
Length=1389

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/506 (60%), Positives = 367/506 (73%), Gaps = 20/506 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R  E+++ TK+P+IED G R+IKSI+FS FSG+EV +SAEV+V+    Y+    P+ N
Sbjct  1     MARPEEKLRCTKEPFIEDAGTRRIKSIRFSMFSGNEVRQSAEVQVWNSRIYNQEMRPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG  NK   C+TC+G F ECPGH+GYL LALPVFNVG+   I+D+LKCICKGCS
Sbjct  61    GLLDTRMGAANKLGECSTCHGSFAECPGHFGYLKLALPVFNVGFFNCILDVLKCICKGCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+RL+FL+KMRN K + L+K+ + K+V  +C       K   C  CG +NG+ K
Sbjct  121   RVLLVEKDRLEFLKKMRNPKADPLQKSAIMKKVRDKC-------KLSRCPWCGFINGVAK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L I+H+  S+ LD    E   A+S+K  K S +    LD  TV SLFK+M DEDC
Sbjct  174   KGRAGLIILHDC-SKTLDGSTEELKEALSHKKEKLSFSAVHMLDPATVLSLFKRMTDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL+VT I VPP+ IRPSVFV GG  SNE+ IT  LK I   NS L++ + 
Sbjct  233   ELLNLGDRPEKLIVTEIAVPPVPIRPSVFVAGGRMSNEDSITVILKSIANTNSILKENLQ  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                   +    W  LQ++V +YINSD   LP          G VQRLKGK GRFRGNLSG
Sbjct  293   TGGQFMKCFDCWQHLQLQVVEYINSDAPSLPESQH-----RGLVQRLKGKTGRFRGNLSG  347

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KR EYTGRTVISPDPNL+ITEVAIPILMAR+LT+PERVS +NIEKLRQC+RNGP+K+PGA
Sbjct  348   KRTEYTGRTVISPDPNLRITEVAIPILMARVLTYPERVSYYNIEKLRQCIRNGPHKHPGA  407

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              +I   DGT++ L Y  R+  A +LKYG +V+RHLEDGD VLFNRQPSLHRMSIM HRAR
Sbjct  408   NFIIQTDGTKLHLKYCDRRIAARDLKYGCVVERHLEDGDIVLFNRQPSLHRMSIMSHRAR  467

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   IMPWRTLRFNESVCNPYNADFDGDEM  493



>gb|EEE61245.1| hypothetical protein OsJ_15297 [Oryza sativa Japonica Group]
Length=1321

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/507 (60%), Positives = 367/507 (72%), Gaps = 21/507 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R  E+++ TK+P+IEDVG R+IKSI+FS FSG+EV +SAEV+V+    Y+    P+ N
Sbjct  1     MARPEEKLRCTKEPFIEDVGTRRIKSIRFSMFSGNEVRQSAEVQVWNSRIYNHEMKPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG  NK   C+TC+G F ECPGH+GYL LALPVFNVG+   I+D+LKCICK CS
Sbjct  61    GLLDTRMGAANKLGECSTCHGSFAECPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+RL+FL+KMRN K + L+K+ + K+V  +C       K   C  CG +NG V 
Sbjct  121   RVLLMEKDRLEFLKKMRNPKADPLQKSAIMKKVRDKC-------KLSRCPWCGFINGSVA  173

Query  957   K---GPLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDED  802
             K     L I+H+  S+ LD    E  +A+S+K  K SI+    LD   V SLFK+M DED
Sbjct  174   KKGRAGLIILHDC-SKTLDGSTEELRDALSHKKEKLSISAVRMLDPAIVLSLFKRMTDED  232

Query  801   CELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             CELL L D+PEKL+VT I VPP+ IRPSVFV GG  SNE+ IT  LK I   NS L++ +
Sbjct  233   CELLNLGDRPEKLIVTEIAVPPVPIRPSVFVAGGRMSNEDSITVILKSIANTNSILKENL  292

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                    +    W  LQ++V +YINSD   LP          G VQRLKGK GRFRGNLS
Sbjct  293   QTGGQFMKCFDCWQHLQLQVVEYINSDAPSLPESQH-----RGLVQRLKGKTGRFRGNLS  347

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKR EYTGRTVISPDPNL+ITEVAIPILMAR+LT+PERVS +NIEKLRQC+RNGP+K+PG
Sbjct  348   GKRTEYTGRTVISPDPNLRITEVAIPILMARVLTYPERVSYYNIEKLRQCIRNGPHKHPG  407

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A +I  PDGT++ L Y  R+  A +LKYG +V+RHLEDGD VLFNRQPSLHRMSIM HRA
Sbjct  408   ANFIIQPDGTKLHLKYCDRRIAARDLKYGCVVERHLEDGDIVLFNRQPSLHRMSIMSHRA  467

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             RIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   RIMPWRTLRFNESVCNPYNADFDGDEM  494



>ref|XP_008669237.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1 [Zea 
mays]
Length=1394

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/506 (59%), Positives = 363/506 (72%), Gaps = 20/506 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M +  E+++ TK+P+IEDVG R+IKSI+FS  SGSE+ KSAEV+V+    YD    P+ N
Sbjct  1     MAKPEEKLRCTKEPFIEDVGTRRIKSIRFSVLSGSEIRKSAEVQVWNNRIYDRDMTPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMG P K   C TC+G+F +CPGH+GYL LALPVFNVG+   I+D+LKCICK CS
Sbjct  61    GLLDPRMGIPTKRGKCNTCHGEFSDCPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+R +FL+KMRN + + L+K+   K+V  +C       K   C RC   NG+VK
Sbjct  121   RVLLIEKDRREFLKKMRNPRADALQKSATMKKVRDKC-------KLSCCPRCDYRNGVVK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L ++H+  S+ LD    E  NA+ NK  K S +    LD  TV SLF++MIDEDC
Sbjct  174   KGRAGLIVVHDC-SKVLDGHTEELKNALQNKKEKVSASSVLVLDPATVLSLFRRMIDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL+VT I VPP+ IRPSV V     SNE+ IT  LK I+  NS L++ + 
Sbjct  233   ELLNLGDRPEKLIVTEIAVPPVPIRPSVVVGNSRTSNEDSITVILKSIVNTNSILKETLH  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                   +    W  LQ++V +Y+NSD   LP          G VQRLKGK GRFRGNLSG
Sbjct  293   TGGPFTKCFDCWQYLQLQVVEYVNSDAPSLPESQH-----RGLVQRLKGKTGRFRGNLSG  347

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KR EYTGRTVISPDPNLKITEVAIP+LMAR+LT+PERVS +NIEKLRQC+RNGP KYPGA
Sbjct  348   KRTEYTGRTVISPDPNLKITEVAIPVLMARVLTYPERVSNYNIEKLRQCIRNGPFKYPGA  407

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              ++  PDG + SL Y  R+  A +LK G IV+RHLEDGD VLFNRQPSLHRMSIMCHRAR
Sbjct  408   NFVTQPDGMKQSLKYGDRRITARDLKCGCIVERHLEDGDVVLFNRQPSLHRMSIMCHRAR  467

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   IMPWRTLRFNESVCNPYNADFDGDEM  493



>ref|XP_004294640.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Fragaria vesca subsp. vesca]
Length=1390

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/507 (60%), Positives = 372/507 (73%), Gaps = 15/507 (3%)
 Frame = -3

Query  1497  MMRK--REEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPI  1324
             MM+K   + + FTK+P+IE+ G  +I   QF+  S SE+ K A  +++ G YYD+++ PI
Sbjct  1     MMKKVHAKTIAFTKEPFIEEEGHCRIAQWQFNAMSQSEISKMAATQIFLGRYYDSNQKPI  60

Query  1323  LNGLLDPRMGPPNKT-KSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICK  1147
               GLLD R+GP NK    C TC     +CPGH+GYL LA+PVFNVGYL  +VD+LKCICK
Sbjct  61    RGGLLDARLGPANKQCGDCETCGAKLSDCPGHFGYLVLAVPVFNVGYLSTVVDVLKCICK  120

Query  1146  GCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNG  967
              CSRI+L +K R  FL  +R+ K +   K+   K +VK+CT+M+S  ++V C +CG +NG
Sbjct  121   SCSRIILDDKSRSRFLNVVRDPKKD---KSVTMKLIVKKCTSMSSNNRSVKCPKCGYMNG  177

Query  966   MVKK--GPLKIIHEYGSQFLDECHNAVSNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCE  796
              VK+  G L I+H     F  +  N V    K SI + P  L+   V SLFK+M+DEDCE
Sbjct  178   SVKRAQGMLAIVHGAVDDF--KSVNPVMKDPKASINLQPHMLNPVKVFSLFKRMLDEDCE  235

Query  795   LLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             LL L  +PE L++T+I VPPIAIRPSV VDG  QSNENDITERLK+IIQ N+ ++Q++S+
Sbjct  236   LLNLKSRPENLIMTTIAVPPIAIRPSVLVDGS-QSNENDITERLKKIIQTNACVQQDLSE  294

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGNLSG  439
              +   R L++W  LQ EVA YINSDVRG+P  M A ++PL+G VQRLKGK GRFRGNL G
Sbjct  295   GS-TTRFLSNWEILQAEVALYINSDVRGVPYHMTANAKPLNGLVQRLKGKTGRFRGNLCG  353

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRVEYTGRTVISPDPNLKITEV IPI MA+IL++PERVS HNIEKLR+CV NGP KYPGA
Sbjct  354   KRVEYTGRTVISPDPNLKITEVGIPIQMAQILSYPERVSDHNIEKLRRCVANGPFKYPGA  413

Query  258   KYIKHPDGTEISLMYSS-RKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
               +K  +G E SL     R  HAD LK G IVDRHLEDGD VLFNRQPSLHRMSIMCHRA
Sbjct  414   LVLKCQNGEEWSLKAGQKRMSHADNLKPGDIVDRHLEDGDIVLFNRQPSLHRMSIMCHRA  473

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             RIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  474   RIMPWRTLRFNESVCNPYNADFDGDEM  500



>gb|AES88750.2| DNA-directed RNA polymerase I protein [Medicago truncatula]
Length=1379

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/506 (59%), Positives = 375/506 (74%), Gaps = 20/506 (4%)
 Frame = -3

Query  1488  KREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLL  1309
             K + + FTK+PYIED GPRKI  I FST S ++++   E +V++  YYDA +  +  G+L
Sbjct  5     KSDGVIFTKEPYIEDTGPRKIAGITFSTLSDTDIINIGETQVWKDSYYDAFRKAVDGGVL  64

Query  1308  DPRMGPPNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRI  1132
             DPR+GP NK+  SCATC+G+F +C GHYGYL LA PVFNVG+L  IV ILKCICK C+RI
Sbjct  65    DPRLGPANKSSPSCATCHGNFTDCQGHYGYLPLAQPVFNVGFLSTIVKILKCICKKCARI  124

Query  1131  LLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK--  958
             LL EK+   +L KMRN KL+ L+K  + + ++K+  +     K + C RCG +NG VK  
Sbjct  125   LLPEKDCKKWLVKMRNPKLDGLQKMNMLESIMKKFKSA----KQIECPRCGYINGAVKHN  180

Query  957   KGPLKIIHEYGSQFLD---ECHNAVSN----KTKGSITVPPELDSKTVHSLFKKMIDEDC  799
             K  L I+H+      D   E  +A+ +    +    +T  P L+   V  LFKKM  EDC
Sbjct  181   KPTLSIVHDCSKANNDDVAELQSALPHINNYRACNDLTSRP-LNPVVVLELFKKMHGEDC  239

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             +LLY+++KPE L++T+I VPPI IRPSV +DG  QSNENDITE+LK+IIQAN+ ++QE  
Sbjct  240   KLLYIAEKPENLIITNIAVPPIVIRPSVMMDG--QSNENDITEKLKKIIQANAIMQQESV  297

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
             +T    +    ++ LQ EVAQYINSDV+G P   Q S+ L+GF+QR+KGKQGRFR NLSG
Sbjct  298   ET---QKYQDGYLMLQFEVAQYINSDVKGGPYNPQMSKSLTGFIQRIKGKQGRFRSNLSG  354

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKLRQCVRNGP+KYPGA
Sbjct  355   KRVEYTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKLRQCVRNGPDKYPGA  414

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
             + +K   G   +L  SSR R ADELK+G IV+RH+EDGD V+FNRQPSLHRMS+M HRAR
Sbjct  415   RMLKEAGGNSWNLRVSSRTRRADELKFGDIVERHIEDGDIVIFNRQPSLHRMSMMSHRAR  474

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             +MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  475   VMPWRTLRFNESVCNPYNADFDGDEM  500



>ref|XP_004976057.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Setaria italica]
Length=1397

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/509 (58%), Positives = 368/509 (72%), Gaps = 23/509 (5%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M +  E+++ TK+P+IEDVG R+IKSI+FS  SGSE+ KSAEV+V+    Y+    P+ N
Sbjct  1     MAKPEEKLRCTKEPFIEDVGARRIKSIRFSVLSGSEIRKSAEVQVWNSRIYEHDMKPVPN  60

Query  1317  GLLDPRMGPPNKTKS---CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICK  1147
             GLLD RMG  +K  +   C+TC+G F ECPGH+GYL LALPVFNVG+   I+D+LKCICK
Sbjct  61    GLLDMRMGLASKKDTELKCSTCHGPFAECPGHFGYLKLALPVFNVGFFNCILDVLKCICK  120

Query  1146  GCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNG  967
             GCSR+LL EK+R +FL+KMRN + + L+K+ + K+V  +C       K   C RC   NG
Sbjct  121   GCSRVLLAEKDRREFLKKMRNPRADALQKSAIMKKVRDKC-------KLTCCPRCEYKNG  173

Query  966   MVKKG--PLKIIHEYGSQFLD----ECHNAVSNK-TKGSITVPPELDSKTVHSLFKKMID  808
             +VKKG   L +IH+  S+ LD    E  NA+ +K  K S +    LD  T  SLF++M+D
Sbjct  174   VVKKGRVGLIVIHDC-SKILDGHTEELKNALQHKKEKVSTSSVRMLDPATALSLFRRMVD  232

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             EDCELL L D+PEKL+VT I VPP+ IRPSV V     SNE+ IT  LK I+  NS L++
Sbjct  233   EDCELLNLGDRPEKLIVTEIAVPPVPIRPSVVVGNTRTSNEDSITAILKSIVNTNSILKE  292

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +    L ++    W  LQ++V +++NSD   LP          G VQRLKGK GRFRGN
Sbjct  293   TLQTGGLFSKCFDCWQQLQLQVVEFVNSDAPCLPESQH-----RGLVQRLKGKTGRFRGN  347

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKR EYTGRTVISPDPNL+ITEVAIP+LMAR+LT+PERVS +N+EKLRQC+RNGP K+
Sbjct  348   LSGKRTEYTGRTVISPDPNLRITEVAIPVLMARVLTYPERVSNYNLEKLRQCIRNGPYKH  407

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA +I  PDGT++SL Y  R+ HA +LK GY V+RHLEDGD VLFNRQPSLHRMSIM H
Sbjct  408   PGANFIITPDGTKLSLKYGDRRIHARDLKCGYTVERHLEDGDVVLFNRQPSLHRMSIMSH  467

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   RARIMPWRTLRFNESVCNPYNADFDGDEM  496



>ref|XP_003574945.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Brachypodium distachyon]
Length=1392

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/507 (59%), Positives = 368/507 (73%), Gaps = 22/507 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M R  E+++ TK+P++EDVG R+IKS++FS FSG E+ +SAE +V+    Y     P+ N
Sbjct  1     MARPEEKLRCTKEPFVEDVGTRRIKSMRFSMFSGKEIRQSAETQVWNNRIYGNDMKPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMG  NK   CATC+G + ECPGH+GYL L LPVFNVG+   I+D+LK ICKGCS
Sbjct  61    GLLDPRMGAANKFGECATCHGSYHECPGHFGYLKLVLPVFNVGFFNNILDVLKSICKGCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             RILL EK++ +FL+KMRN +LE L K  L K+V  +C       K   C  CG +NG+ K
Sbjct  121   RILLHEKDQREFLKKMRNPRLEPLHKAALMKKVRDKC-------KLSRCPSCGYINGVAK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L I+H+  S+ LD    E  +A+S+K  K SI+    LD  TV SLFK+M DEDC
Sbjct  174   KGRPGLLIVHDC-SKTLDGSTEELRSALSHKKEKLSISSVHTLDPATVLSLFKRMTDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL++T I VPP+ IRPSVFV GG  SNE+ IT  L+ I+  NS L+  + 
Sbjct  233   ELLNLGDRPEKLIITEIAVPPVPIRPSVFVGGGRMSNEDGITCILRNIVNTNSILKGILQ  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLP-PQMQASRPLSGFVQRLKGKQGRFRGNLS  442
             +     +    W  LQ++V +YINSD   L  PQ +      G VQRLKGK GRFRGNLS
Sbjct  293   NGDPLMKCFDCWQLLQLQVVEYINSDAPSLTDPQNR------GLVQRLKGKTGRFRGNLS  346

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKR EYTGRTVISPDPNL+ITEVAIP+LMAR+LT+PERVS +NIEKLRQC+RNGP+K+PG
Sbjct  347   GKRTEYTGRTVISPDPNLRITEVAIPVLMARVLTYPERVSYYNIEKLRQCIRNGPHKHPG  406

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A ++  PDGT++ L Y  R+  A +LKYG IV+RHLEDGD VLFNRQPSLHRMSIM HRA
Sbjct  407   ANFVTQPDGTKLHLKYCDRRIAARDLKYGCIVERHLEDGDIVLFNRQPSLHRMSIMSHRA  466

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             RIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  467   RIMPWRTLRFNESVCNPYNADFDGDEM  493



>ref|XP_002446717.1| hypothetical protein SORBIDRAFT_06g021120 [Sorghum bicolor]
 gb|EES11045.1| hypothetical protein SORBIDRAFT_06g021120 [Sorghum bicolor]
Length=1391

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/506 (59%), Positives = 362/506 (72%), Gaps = 20/506 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M +  E+++ TK+P+IEDVG R+IKSI+FS  SGSE+ KSAEV+V+    Y     P+ N
Sbjct  1     MAKPEEKLRCTKEPFIEDVGTRRIKSIRFSVLSGSEIRKSAEVQVWNNRIYGHDMKPVPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLDPRMG PNK + C+TC+G+F +CPGH+GYL LALPVFNVG+   I+D+LKCICK CS
Sbjct  61    GLLDPRMGVPNKREKCSTCHGEFSDCPGHFGYLKLALPVFNVGFFNCILDVLKCICKSCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+R +FL+KMRN + + L+K+   K+V  +C       K   C RC   NG+VK
Sbjct  121   RVLLFEKDRREFLKKMRNPRADALQKSATMKKVRDKC-------KLSCCPRCDYRNGVVK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L ++H+  S+ LD    E  NA+ NK  K S      LD  TV SLF++M DEDC
Sbjct  174   KGRAGLIVVHDC-SKVLDGHTEELKNALQNKKEKVSANSVRVLDPATVLSLFRRMTDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL L D+PEKL+V+ I VPP+ IRPSV V     SNE+ IT  LK I+  NS L++ + 
Sbjct  233   ELLNLGDRPEKLIVSEIAVPPVPIRPSVVVGSSRTSNEDSITVILKSIVNTNSILKETLH  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                   +    W  LQ++V +Y+NSD   LP          G VQRLKGK GRFRGNLSG
Sbjct  293   TGGPFTKCFDCWQYLQLQVVEYVNSDAPCLPDSQH-----RGLVQRLKGKTGRFRGNLSG  347

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KR EYTGRTVISPDPNLKITEVAIP+LMAR+LT+PERVS +NIEKLRQC+RNGP KYPGA
Sbjct  348   KRTEYTGRTVISPDPNLKITEVAIPVLMARVLTYPERVSNYNIEKLRQCIRNGPFKYPGA  407

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              ++  PDG + SL Y  R+  A +LK G IV+RHLEDGD VLFNRQPSLHRMSIM HRAR
Sbjct  408   NFVTQPDGMKQSLKYGDRRITARDLKCGCIVERHLEDGDVVLFNRQPSLHRMSIMSHRAR  467

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             IMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   IMPWRTLRFNESVCNPYNADFDGDEM  493



>emb|CDM82865.1| unnamed protein product [Triticum aestivum]
Length=1395

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/508 (59%), Positives = 366/508 (72%), Gaps = 22/508 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILN  1318
             M+R+ E+++ TK+P+IEDVG R+IKS++FS FSG E+ +SAE +V+    Y+ +  P  N
Sbjct  1     MLRQEEKLRCTKEPFIEDVGTRRIKSMRFSMFSGKEIRQSAEAQVWNNRIYEPNMKPAPN  60

Query  1317  GLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS  1138
             GLLD RMG  NK   C TC+G + ECPGH+GYL LALPVFNVG+   I+D++KCICKGCS
Sbjct  61    GLLDTRMGAANKQGECGTCHGSYTECPGHFGYLKLALPVFNVGFFNNILDVVKCICKGCS  120

Query  1137  RILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK  958
             R+LL EK+R +FL+KMR  + E L K  L K+V  +C       K   C  CG +NG+ K
Sbjct  121   RVLLVEKDRREFLKKMRQPRAEPLVKFALMKKVRDKC-------KLSRCPWCGFINGVAK  173

Query  957   KG--PLKIIHEYGSQFLD----ECHNAVSNKT-KGSITVPPELDSKTVHSLFKKMIDEDC  799
             KG   L I+H+  S+ LD    E  +A+S+K  K +IT    LD  TV SLF++MIDEDC
Sbjct  174   KGRMGLVIVHDC-SKTLDGSTEELRSALSHKKEKLAITSIHTLDPATVLSLFRRMIDEDC  232

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGG--MQSNENDITERLKRIIQANSSLRQE  625
             ELL L D+PEKL++T I VPP+ IRPSVFV GG    SNE+ IT  LK I+  NS L+  
Sbjct  233   ELLNLGDRPEKLIITEIAVPPVPIRPSVFVGGGGGRMSNEDSITCILKNIVNTNSILKGT  292

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             +       +    W  LQ++V +YINSD   L           G +QRLKGK GRFRGNL
Sbjct  293   LQSGEPLVKCFDCWQHLQLQVVEYINSDAPCLIDSQH-----RGLIQRLKGKTGRFRGNL  347

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKR EYTGRTVISPDPNL+ITEVAIPILMAR+LT+PERVS +NIEKLRQC+RNGP+K+P
Sbjct  348   SGKRTEYTGRTVISPDPNLRITEVAIPILMARVLTYPERVSYYNIEKLRQCIRNGPHKHP  407

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA +I  PDGT++ L Y  R+  A +LKYG IV+RHLEDGD VLFNRQPSLHRMSIM HR
Sbjct  408   GANFILQPDGTKLHLKYCDRRIAARDLKYGCIVERHLEDGDIVLFNRQPSLHRMSIMSHR  467

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  468   ARIMPWRTLRFNESVCNPYNADFDGDEM  495



>gb|AES88756.2| DNA-directed RNA polymerase I protein [Medicago truncatula]
Length=1388

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/511 (59%), Positives = 368/511 (72%), Gaps = 21/511 (4%)
 Frame = -3

Query  1500  MMMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL  1321
             M M K   + FTK PYIE   PRKI  I +ST S  ++ K  E +V++  YYDA K  + 
Sbjct  1     MNMSKTNGIIFTKDPYIEKAEPRKIAGISYSTLSDKDITKIGEAQVWQDRYYDAFKKAVE  60

Query  1320  NGLLDPRMGPPNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKG  1144
              G+LDPR+GP NK+  SCATC+G+F +C GHYGYL LA PVFNVG+L  IV ILKCICK 
Sbjct  61    GGVLDPRLGPANKSSPSCATCHGNFTDCQGHYGYLPLAQPVFNVGFLSTIVKILKCICKN  120

Query  1143  CSRILLGEK--ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVN  970
             C+RILL +   +R  +  KM N KL+ L+K  +F  ++K      S +K   C RCG +N
Sbjct  121   CARILLDKDHIKREKYFEKMNNPKLDGLQKMAVFDDIMKN---FKSAKKE--CPRCGYIN  175

Query  969   GMVK--KGPLKIIHEYGSQFLD---ECHNA---VSNKTKGSITVPPELDSKTVHSLFKKM  814
             G VK  +  L I+H+      D   E  +A   ++N    +      L    V  LFKKM
Sbjct  176   GSVKQQRATLSILHDCSKANNDDVAELQSALPHINNYRACNDLTSRTLYPAVVLELFKKM  235

Query  813   IDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
               +DC LLY+++KPE L++T+I VPPI IRPSV +DG  QSNENDITE+LK+IIQAN+ +
Sbjct  236   HGKDCTLLYIAEKPENLIITNIAVPPIVIRPSVMMDG--QSNENDITEKLKKIIQANAIM  293

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             +QE  +T    +   +++ LQ EVAQYINSDV+G P  +Q S+PL+GF+QR+KGKQGRFR
Sbjct  294   QQESVET---QKYQDAYLMLQFEVAQYINSDVKGGPYNLQMSKPLTGFIQRIKGKQGRFR  350

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
              NLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKLRQCVRNGP+
Sbjct  351   SNLSGKRVEYTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKLRQCVRNGPD  410

Query  273   KYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             KYPGA+ +K   G   +L   +R R ADELK+G IV+RH+EDGD VLFNRQPSLHRMS+M
Sbjct  411   KYPGARMVKEAGGNSWNLKILTRTRRADELKFGDIVERHIEDGDVVLFNRQPSLHRMSMM  470

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             CHRAR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  471   CHRARVMPWRTLRFNESVCNPYNADFDGDEM  501



>ref|XP_008380348.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Malus domestica]
Length=1397

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/502 (59%), Positives = 372/502 (74%), Gaps = 15/502 (3%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRM  1297
             + FT+QP+IE    R +K ++F+  S +E+MK AEV++Y G YY++   PI  GLLDPR+
Sbjct  9     LDFTRQPFIEPDTHRTVKELKFTVMSPAEIMKLAEVQIYIGAYYNSGWKPIEGGLLDPRL  68

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             GP +K   CATC G+  ECPGH+GYL LALPV+NVGYL  +V++LKCICK CS  LL ++
Sbjct  69    GPASKRLICATCGGNHVECPGHFGYLALALPVYNVGYLGTVVNVLKCICKNCSGFLLKDE  128

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLK  943
              R+++LRKMRN K + +KK EL K VVK+CTA+ +G +   C +CG VNG VKK  G + 
Sbjct  129   MRVEYLRKMRNLK-DPMKKIELMKIVVKKCTALCAGNRRAECWKCGYVNGTVKKAVGMIG  187

Query  942   IIHEYGSQF---LDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCELLYLSD  778
             I+H+  S+F   +DE    ++    +   ++V   LD   V +L K+M DEDCE+LYLS 
Sbjct  188   ILHDR-SKFEDVMDELRKTMAETKVSAAGLSVEAMLDPAKVFTLLKEMSDEDCEVLYLST  246

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE LL+T+I VPP  IRPSV V GG  SNENDIT RLK+IIQ+N+ L +++ D  L   
Sbjct  247   RPENLLITNILVPPTVIRPSVLV-GGEVSNENDITVRLKQIIQSNARLTRDLFDLRLGYA  305

Query  597   SLA--SWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
                  SW +LQ+EVAQYINS+VR +P  MQ   PL+GFVQRLKGKQGRFRGNLS KRVEY
Sbjct  306   PGVKRSWDELQVEVAQYINSEVR-VPFTMQGGNPLNGFVQRLKGKQGRFRGNLSAKRVEY  364

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGR+VISPDPNLKI EV +PI MA+ILT+PERV+ HNIEKLR+CV NGP+KYPGA+ + H
Sbjct  365   TGRSVISPDPNLKINEVGVPIEMAQILTYPERVTCHNIEKLRKCVSNGPHKYPGARSL-H  423

Query  243   PDGTEISLMYSS-RKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
              DG E SL  +   K  AD L+YG IV RHL+DGD +LFNRQPSLHRMS M HRA++MPW
Sbjct  424   RDGEEFSLAITRISKNLADGLQYGDIVGRHLQDGDILLFNRQPSLHRMSFMSHRAKVMPW  483

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RTLRFNESVCNPYNADFDGDEM
Sbjct  484   RTLRFNESVCNPYNADFDGDEM  505



>ref|XP_006828249.1| hypothetical protein AMTR_s00023p00196820 [Amborella trichopoda]
 gb|ERM95665.1| hypothetical protein AMTR_s00023p00196820 [Amborella trichopoda]
Length=1383

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/508 (56%), Positives = 363/508 (71%), Gaps = 18/508 (4%)
 Frame = -3

Query  1497  MMRKREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASK-NPIL  1321
             M  ++E   FTK+P++ED+GPRKIKS+QF   SG E++K+AE +VY+  YY+ +   P  
Sbjct  1     MDSEKEAFNFTKKPFVEDIGPRKIKSVQFCMLSGPEIVKAAETQVYKRDYYNRTDLKPAE  60

Query  1320  NGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGC  1141
             +G+LD RMG   K+ SCATC GDF+ CPGH+GYL LALPVF+VGY    + +L+CICK C
Sbjct  61    HGVLDTRMGFSTKSGSCATCFGDFQTCPGHFGYLKLALPVFHVGYFRTTIIVLQCICKSC  120

Query  1140  SRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMV  961
             +RILL E+ER  FL+K+RN + E  +KN+  K+V+ +C      ++  IC RCG  NG+V
Sbjct  121   ARILLFEEERKQFLKKIRNPRAELHQKNDFVKKVIDKC------KRVRICPRCGDYNGVV  174

Query  960   KK-GP-LKIIHEYGSQFLD----ECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDE  805
             KK GP  +I H+      D    EC  A+S    +     +   L  +   +LF++M+DE
Sbjct  175   KKAGPTFRISHDRSKANYDKLTKECKTAISQTKYSNSDFNMVENLTPQRALALFERMVDE  234

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DC+LLYL D+PEKL++T I VPP  IRP+     G + NEN++T +L  I+Q N +L   
Sbjct  235   DCDLLYLYDRPEKLIITHIAVPPAGIRPTY--QSGSRLNENELTTKLWEIVQINHTLIDH  292

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             ++   LP   + +WV LQ+ VA YINS++  LP   Q S+   G VQRLKGKQGRFR NL
Sbjct  293   VNKGNLPQYYMDTWVLLQVRVALYINSELPSLPLNYQPSKFEGGLVQRLKGKQGRFRSNL  352

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
              GKRV++TGRTVISPDPNLKITEVAIP LMA+ILT+ ERV+ HNIEKLRQCVRNGP KYP
Sbjct  353   EGKRVDFTGRTVISPDPNLKITEVAIPRLMAQILTYKERVTIHNIEKLRQCVRNGPVKYP  412

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA ++    G  +SL Y ++KR ADELK+G  V+RHLEDG+ VLFNRQPSLHRMSIMCHR
Sbjct  413   GANFVI-SGGDTLSLRYGNKKRKADELKFGDFVERHLEDGEIVLFNRQPSLHRMSIMCHR  471

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             AR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  472   ARVMPWRTLRFNESVCNPYNADFDGDEM  499



>ref|XP_002974416.1| hypothetical protein SELMODRAFT_442419 [Selaginella moellendorffii]
 gb|EFJ24638.1| hypothetical protein SELMODRAFT_442419 [Selaginella moellendorffii]
Length=1348

 Score =   539 bits (1389),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 270/508 (53%), Positives = 356/508 (70%), Gaps = 22/508 (4%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYR-GVYYDASKNPILNGLLDPR  1300
             + FTK  +++D GPRKIKS++FST S  EV K+AEV+++   +Y    + P+  G+LD R
Sbjct  16    INFTKGLHLDDAGPRKIKSMRFSTMSSEEVTKTAEVQIFEHSLYQLPERKPLPYGVLDTR  75

Query  1299  MGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCS---RIL  1129
             +G  NK   C TC+G   +CPGH+GY+ L LPVF++GY   I+ IL+CICK       ++
Sbjct  76    LGTSNKKGQCTTCDGKLADCPGHFGYIKLELPVFHIGYFKDIIVILQCICKASFSFLEVV  135

Query  1128  LGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--  955
               ++ER  + R+M+N + E L+K E  K++   C      +K   C RCG +NG+VKK  
Sbjct  136   ASQEERQKWQRRMQNPRSEILRKKEYLKKINDLC------KKVRACPRCGDINGVVKKLG  189

Query  954   GPLKIIHEYGSQ----FLDECHN-----AVSNKTKGSI-TVPPELDSKTVHSLFKKMIDE  805
               LKIIH+  ++    F +  H       V+ + KG +  +  +L    V  LF+K+I E
Sbjct  190   STLKIIHDKYAKNYEAFEEMAHKFDDAVKVNKEMKGYMKNIQEDLTPLKVLGLFEKIIGE  249

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DC +L L D+PE+L+V  +PVPP+AIRPSV +D  + SNE+D+T +L  II+ N+ +R  
Sbjct  250   DCVVLDLVDRPEQLIVQHMPVPPVAIRPSVEMDAAVGSNEDDVTIKLMHIIEQNNQIRAC  309

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             +      A+ +  W  LQ++VA YINS++ GLPP MQ  +PL GFVQRLKGKQGRFRGNL
Sbjct  310   LESGLSIAKCMEIWDFLQIQVAMYINSELPGLPPNMQTGKPLRGFVQRLKGKQGRFRGNL  369

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRV++TGRTVISPDPNLK++EVA+PILMA+ LT+PE+VS HNIEKLRQ V NG  K+P
Sbjct  370   SGKRVDFTGRTVISPDPNLKVSEVAVPILMAQTLTYPEKVSAHNIEKLRQRVINGKEKHP  429

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA ++  PDG +  L +  RKR A ELKYG +V+RHLEDGD VLFNRQPSLHRMSIMCHR
Sbjct  430   GANFVVFPDGVKRFLKFGDRKRIASELKYGDVVERHLEDGDIVLFNRQPSLHRMSIMCHR  489

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             AR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  490   ARVMPWRTLRFNESVCNPYNADFDGDEM  517



>ref|XP_002985715.1| hypothetical protein SELMODRAFT_446351 [Selaginella moellendorffii]
 gb|EFJ13293.1| hypothetical protein SELMODRAFT_446351 [Selaginella moellendorffii]
Length=1393

 Score =   540 bits (1391),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 271/508 (53%), Positives = 356/508 (70%), Gaps = 22/508 (4%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYR-GVYYDASKNPILNGLLDPR  1300
             + FTK  +++D GPRKIKS++FST S  EV K+AEV+++   +Y    + P+  G+LD R
Sbjct  16    INFTKGLHLDDAGPRKIKSMRFSTMSSEEVTKTAEVQIFEHSLYQLPERKPLPYGVLDTR  75

Query  1299  MGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRIL---  1129
             +G  NK   C TC+G   +CPGH+GY+ L LPVF++GY   I+ IL+CICK    +L   
Sbjct  76    LGTSNKKGQCTTCDGKLADCPGHFGYIKLELPVFHIGYFKDIIVILQCICKASFSLLEVV  135

Query  1128  LGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--  955
               ++ER  + R+M+N + E L+K E  K++   C      +K   C RCG +NG+VKK  
Sbjct  136   ASQEERQKWQRRMQNPRSEILRKKEYLKKINDLC------KKVRACPRCGDINGVVKKLG  189

Query  954   GPLKIIHEYGSQ----FLDECHN-----AVSNKTKGSI-TVPPELDSKTVHSLFKKMIDE  805
               LKIIH+  ++    F +  H       V+ + KG +  +  +L    V  LF+K+I E
Sbjct  190   STLKIIHDKYAKNYEAFEEMAHKFDDAVKVNKEMKGYMKNIQEDLTPLKVLGLFEKIIGE  249

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DC +L L D+PE+L+V  +PVPP+AIRPSV +D  + SNE+D+T +L  II+ N+ +R  
Sbjct  250   DCVVLDLVDRPEQLIVQHMPVPPVAIRPSVEMDAAVGSNEDDVTIKLMHIIEQNNQIRAC  309

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             +      A+ +  W  LQ++VA YINS++ GLPP MQ  +PL GFVQRLKGKQGRFRGNL
Sbjct  310   LESGLSIAKCMEIWDFLQIQVAMYINSELPGLPPNMQTGKPLRGFVQRLKGKQGRFRGNL  369

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRV++TGRTVISPDPNLK++EVA+PILMA+ LT+PE+VS HNIEKLRQ V NG  K+P
Sbjct  370   SGKRVDFTGRTVISPDPNLKVSEVAVPILMAQTLTYPEKVSAHNIEKLRQRVINGKEKHP  429

Query  264   GAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             GA ++  PDG +  L +  RKR A ELKYG +V+RHLEDGD VLFNRQPSLHRMSIMCHR
Sbjct  430   GANFVVFPDGVKRFLKFGDRKRIASELKYGDVVERHLEDGDIVLFNRQPSLHRMSIMCHR  489

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             AR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  490   ARVMPWRTLRFNESVCNPYNADFDGDEM  517



>ref|XP_007217796.1| hypothetical protein PRUPE_ppa023322mg, partial [Prunus persica]
 gb|EMJ18995.1| hypothetical protein PRUPE_ppa023322mg, partial [Prunus persica]
Length=1248

 Score =   533 bits (1374),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 274/494 (55%), Positives = 345/494 (70%), Gaps = 57/494 (12%)
 Frame = -3

Query  1467  TKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGPP  1288
             T+QP+IE    R+++ ++F+  S SE+MK AEVE++RG            GLLDPR+GP 
Sbjct  12    TRQPFIEVEQDRRVEQLKFTVMSPSEIMKMAEVEIFRG-----------GGLLDPRLGPQ  60

Query  1287  N-KTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKER  1111
             N K  +CATC  ++K+CPGH+GYL LAL V+NVGY+  +VDILKCICK CS +LL ++ R
Sbjct  61    NNKFGNCATCGANYKDCPGHFGYLALALLVYNVGYMGTVVDILKCICKSCSGLLLKQEMR  120

Query  1110  LDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKII  937
             ++ LR+MRN KL  LKK EL K VVK+C  + +  + V CS+CG +NG VKK  G + II
Sbjct  121   VELLRRMRNPKLGPLKKTELMKMVVKKCNGLAANNRPVECSKCGYLNGSVKKATGMVAII  180

Query  936   HEYG--SQFLDECHNAVSNKTKGSITVPPE---LDSKTVHSLFKKMIDEDCELLYLSDKP  772
             H+    S  +DE  + +S     S     E   ++   V SLFK+M+DEDCELLYL  +P
Sbjct  181   HDRSKFSGVMDELRSTISETKVSSAPFSLETHLMNPGEVFSLFKQMLDEDCELLYLCTRP  240

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             E LL+ +IPVPP AIRPSV VD   ++NENDITERLK I                   + 
Sbjct  241   ENLLIMNIPVPPTAIRPSVLVDDS-RTNENDITERLKNI-------------------AA  280

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
              SW +L++EVAQYINS+VR +P  MQ+  PL GF+QR+KGKQGRFRGNLS KRVEYTGR+
Sbjct  281   YSWDELRVEVAQYINSEVR-VPFAMQSGNPLGGFMQRIKGKQGRFRGNLSAKRVEYTGRS  339

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             V+SPDPNLKI EV +PI MA+ILT+PERVSR+NIEKLR+CV NG   YPGA+Y       
Sbjct  340   VVSPDPNLKINEVGLPIQMAQILTYPERVSRYNIEKLRKCVSNGIYTYPGARYA------  393

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
                        +AD L+YG IV+RHLEDGD +LFNRQP+LHRMS+MCHRA++M WRTLRF
Sbjct  394   -----------YADILQYGDIVERHLEDGDFLLFNRQPNLHRMSVMCHRAKVMSWRTLRF  442

Query  51    NESVCNPYNADFDG  10
             NESVCNPYNADFDG
Sbjct  443   NESVCNPYNADFDG  456



>ref|XP_009350016.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III 
subunit rpc1-like [Pyrus x bretschneideri]
Length=1397

 Score =   536 bits (1382),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 277/502 (55%), Positives = 358/502 (71%), Gaps = 15/502 (3%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRM  1297
             + FT+QP+IE      +K ++F+  S +E+MK  EV++Y G YY++   PI  GLLD R+
Sbjct  9     LDFTRQPFIEPDKHHTVKELKFTVMSPAEIMKLVEVQIYIGAYYNSGWKPIEGGLLDLRL  68

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             GP +K   CATC G+  +CPGH+ YL LALPV+NVGYL  +V+ILKCICK CSR LL ++
Sbjct  69    GPASKRLICATCGGNHVKCPGHFRYLALALPVYNVGYLGTVVNILKCICKNCSRFLLKDE  128

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LK  943
               +++LRKMRN K + +KK EL K VVK+C A+ +  + + C +CG VNG VKK    + 
Sbjct  129   MWVEYLRKMRNLK-DPIKKMELIKIVVKKCIALCASNRRLECWKCGYVNGTVKKAGRMIG  187

Query  942   IIHEYGSQF---LDECHNAVSNK--TKGSITVPPELDSKTVHSLFKKMIDEDCELLYLSD  778
             I+H++ S+F   +DE    +     +   ++V   LD   V +L K+M DEDCE+ YL  
Sbjct  188   ILHDH-SKFEDVMDELRKTMEGTKVSAAGLSVEAMLDLAKVFTLLKEMSDEDCEVFYLFT  246

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             + E LL+T+I VPP  IRPS+ V GG  SN+NDIT RLK+IIQ+N+ L +++ D  L   
Sbjct  247   RSENLLITNILVPPTVIRPSILV-GGEVSNKNDITVRLKQIIQSNARLTRDLFDLRLGYA  305

Query  597   SLA--SWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
             S    SW +LQ+EVAQYINS+VR +P  MQ   PL  FVQRLKGKQGRFRGNLS KRVEY
Sbjct  306   SGVKRSWDELQVEVAQYINSEVR-VPFTMQGGNPLKDFVQRLKGKQGRFRGNLSAKRVEY  364

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             TGR+VIS +PN KI EV +PI MA+ILT+P+ V+ HNIEKLR+CV N P+KYPGA+ + H
Sbjct  365   TGRSVISSNPNXKINEVGVPIEMAQILTYPKWVTCHNIEKLRKCVCNRPHKYPGARSL-H  423

Query  243   PDGTEISLMYSS-RKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
              DG E SL  +   K  AD L+YG IV RHLEDGD +LFN+QPSLH+MS M H+A++MPW
Sbjct  424   RDGEEFSLAITRISKNLADGLQYGDIVGRHLEDGDILLFNKQPSLHKMSFMSHQAKVMPW  483

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RTLRFNESVCNPYNADFDGDEM
Sbjct  484   RTLRFNESVCNPYNADFDGDEM  505



>ref|XP_010236212.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
[Brachypodium distachyon]
Length=1382

 Score =   535 bits (1377),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 270/484 (56%), Positives = 338/484 (70%), Gaps = 26/484 (5%)
 Frame = -3

Query  1419  IQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGPPNKTKSCATCNGDFKEC  1240
             ++F T SG E+ +SA  +V+    YD+S  P+ NGLLDPRMG  +K   CATC+G + EC
Sbjct  1     MRFCTLSGKEIRQSAAAQVWNTRIYDSSLKPVPNGLLDPRMGASDKCGECATCHGSYTEC  60

Query  1239  PGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKK  1060
             PGH+GY+ LALPVFNVGY   I+ +LKCICKGCSR+LL E    +FL+KMRN + +   +
Sbjct  61    PGHFGYIKLALPVFNVGYFNKILAVLKCICKGCSRVLLTENIHQEFLKKMRNPRAD---R  117

Query  1059  NELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-------GPLKIIHEYGSQF---LD  910
             + +  +V  +C       +   CS CG +NG+VKK         + I+H+         +
Sbjct  118   SSIMIKVRDKC-------RPSRCSWCGYINGIVKKEGRRALKQTVVIVHDCSKNLDASTE  170

Query  909   ECHNAVSNK-TKGSITVPPELDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPI  733
             E  + +S+K  K SIT    LD  TV SLF+++ DEDCELL + ++PE L++T I VPP+
Sbjct  171   EVRSVLSHKKEKLSITSVHTLDPVTVLSLFRRITDEDCELLAIGERPENLIITDIAVPPV  230

Query  732   AIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQY  553
              IRPS FV G   SNE+ IT  L+ I+ ANS L+  I D  +P +    W  LQ  V +Y
Sbjct  231   PIRPSRFVAGTTMSNEDSITSILRNIVNANSHLKLTIQDGQVPMKCFTWWEQLQDNVIEY  290

Query  552   INSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEV  373
             INSD   L    Q S+   G +QRLKGK GRFRGNLSGKR E+TGRTVISPDPNL+ITEV
Sbjct  291   INSDASSL----QDSKD-CGLIQRLKGKTGRFRGNLSGKRTEHTGRTVISPDPNLRITEV  345

Query  372   AIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHA  193
             AIP+LMAR+LT+PERV+ +NIEKLRQC+RNGP+K+PGA +I  PD T++ L Y  R R A
Sbjct  346   AIPVLMARVLTYPERVTYYNIEKLRQCIRNGPHKHPGANFIIQPDETKLHLNYCDRSRAA  405

Query  192   DELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFD  13
              +LKYG IV+RHLEDGD VLFNRQPSLHRMSIM HRARIMPWRTLRFNESVCNPYNADFD
Sbjct  406   RDLKYGCIVERHLEDGDIVLFNRQPSLHRMSIMSHRARIMPWRTLRFNESVCNPYNADFD  465

Query  12    GDEM  1
             GDEM
Sbjct  466   GDEM  469



>ref|XP_001757221.1| predicted protein [Physcomitrella patens]
 gb|EDQ78080.1| predicted protein [Physcomitrella patens]
Length=1397

 Score =   531 bits (1367),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 267/512 (52%), Positives = 362/512 (71%), Gaps = 31/512 (6%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA-SKNPILNGLLDPR  1300
             + F+K+P+IEDVGPRKI+SI+F T S  +++K++E+ VY  + Y    +NP    ++D R
Sbjct  12    INFSKRPFIEDVGPRKIESIRFGTMSKQDIVKASELHVYESMLYTMPERNPAPYSVVDTR  71

Query  1299  MGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGE  1120
             +G  NK   C+TC G   +CPGH+G+  L +PVF++GYL  I+ IL+CICK C+RIL+ E
Sbjct  72    LGTTNKKGECSTCFGKLADCPGHFGHTKLEMPVFHIGYLKNILQILQCICKSCARILMPE  131

Query  1119  KERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---P  949
             +E    LRKMRN ++E L++  + K+V+ RC      ++  +C+RCG  NG+VKK    P
Sbjct  132   EECKLILRKMRNPRIEVLQRRAVLKKVIDRC------KRVRVCTRCGDYNGVVKKMAQPP  185

Query  948   LKIIHEYGSQFLDECHNAVSNKTKGSITVPPEL-----------DSKTVHSLFKKMIDED  802
             +K+IH+   + LD     + +  + ++   PEL           D   V  LF+ MI++D
Sbjct  186   VKLIHDKYGKALDLKEEMIVS-LEDAMKCKPELKNCINRVYDNLDPMRVLQLFESMIEQD  244

Query  801   CELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             CE+L L+++PEKL+VT + VPP+AIRPSV ++    SNE+DIT RL  I+  N+SLR  +
Sbjct  245   CEVLDLAERPEKLIVTHLIVPPVAIRPSVEMESAAGSNEDDITVRLLGILNCNNSLRTCV  304

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSG-----FVQRLKGKQGRF  457
                    +++ +W  LQ +V+Q INS+     P  ++ +P SG     FVQRLKGKQGRF
Sbjct  305   EQGLAAEKTMETWELLQSQVSQLINSET----PVPRSEQPTSGKQPRGFVQRLKGKQGRF  360

Query  456   RGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGP  277
             RGNLSGKRV++TGRTVISPDPNLKITEVA+P+LMA++LT+PE+VSR+NI+KLR  + NG 
Sbjct  361   RGNLSGKRVDFTGRTVISPDPNLKITEVAVPLLMAQLLTYPEKVSRYNIDKLRGRIINGM  420

Query  276   NKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              K+PGA +I  PDG ++ L +  R+R+A ELKYG IV+RHLEDGD VLFNRQPSLHRMSI
Sbjct  421   TKHPGANFIIFPDGNKLYLKFGDRRRYAAELKYGDIVERHLEDGDIVLFNRQPSLHRMSI  480

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M HRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  481   MSHRARIMPWRTLRFNESVCNPYNADFDGDEM  512



>ref|XP_004505924.1| PREDICTED: DNA-directed RNA polymerase III subunit rpc1-like 
isoform X2 [Cicer arietinum]
Length=1291

 Score =   511 bits (1317),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 256/400 (64%), Positives = 315/400 (79%), Gaps = 16/400 (4%)
 Frame = -3

Query  1176  IVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAV  997
             +V ILKCICKGC+ ILL E  R  +L+KMRN+KL+ L+K +L + ++KR  +     K +
Sbjct  1     MVKILKCICKGCAGILLDEDTRKKYLKKMRNSKLDELQKIQLLESIMKRFRSA----KFI  56

Query  996   ICSRCGCVNGMVK--KGPLKIIHE--YG-SQFLDECHNAVSNKTKGSIT---VPPELDSK  841
              C RCG +NG+VK  +  L+I+H+  +G +  + E  +A+S+  +   T       LD K
Sbjct  57    KCQRCGYINGIVKLTRSTLRIVHDCSHGKNDVVSELQSALSHMKEYRATNDLASRNLDPK  116

Query  840   TVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLK  661
             +VHSLF KM DEDC LLYL+++PEKL++T+I VPPI IRPSV +DG  QSNENDITE+L+
Sbjct  117   SVHSLFTKMSDEDCALLYLAERPEKLIITNIAVPPIVIRPSVIMDGS-QSNENDITEKLR  175

Query  660   RIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQR  481
             +IIQAN++L +E+ ++T   +    +  LQ  VAQYINSDV+G P  MQAS+PL+GFVQR
Sbjct  176   KIIQANAALHKELEEST---KFQGGFEMLQFLVAQYINSDVKGGPYSMQASKPLTGFVQR  232

Query  480   LKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKL  301
             +KGKQGRFR NLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+ HNIEKL
Sbjct  233   IKGKQGRFRSNLSGKRVEYTGRTVISPDPNLKITEVAIPIHMARILTYPERVTHHNIEKL  292

Query  300   RQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQ  121
             RQC+RNGP+KYPGAK ++H  GT  +L  S RKR ADEL++G IVDRHLEDGD VLFNRQ
Sbjct  293   RQCLRNGPDKYPGAKLLRHAGGTTWNLKVSCRKRLADELRFGDIVDRHLEDGDVVLFNRQ  352

Query  120   PSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             PSLHRMS+MCHRARIMPWRTLRFNESVCNPYNADFDGDEM
Sbjct  353   PSLHRMSMMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  392



>gb|KDO73040.1| hypothetical protein CISIN_1g000828mg [Citrus sinensis]
 gb|KDO73041.1| hypothetical protein CISIN_1g000828mg [Citrus sinensis]
Length=1265

 Score =   506 bits (1304),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 255/371 (69%), Positives = 298/371 (80%), Gaps = 10/371 (3%)
 Frame = -3

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LKIIHEYG--  925
             MRN K+E L+K +L K +VK+C+ M S  KAV C RCG +NGMVKK    L IIH+    
Sbjct  1     MRNPKMEALRKTDLMKSIVKKCSTMAS--KAVKCPRCGYINGMVKKAVAVLGIIHDRSKV  58

Query  924   SQFLDECHNAVSN--KTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVT  754
             ++ L E  +A+++  ++K ++ V    L+   V  LFK+M D DCE+LYLS++PEKL++T
Sbjct  59    TESLQEFASAITHTKESKAAVNVATYILNPVNVLFLFKRMTDTDCEVLYLSERPEKLIIT  118

Query  753   SIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVDL  574
             +I VPPIAIRPSV +DG  QSNENDITERLKRIIQ N+SL+QE+ +     +SLA W  L
Sbjct  119   NIAVPPIAIRPSVIMDGS-QSNENDITERLKRIIQTNASLQQELVEANSAFKSLAGWETL  177

Query  573   QMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDP  394
             Q+EVAQYINSDVRG+P  MQ +RPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDP
Sbjct  178   QVEVAQYINSDVRGVPFSMQVARPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDP  237

Query  393   NLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMY  214
             NLKITEVAIPI MARILT+PERVS HNIEKLRQC++NGP+KYPGA+ I++PDGT   L  
Sbjct  238   NLKITEVAIPIRMARILTYPERVSDHNIEKLRQCIQNGPDKYPGARMIRYPDGTARVLYG  297

Query  213   SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCN  34
               R + A ELK G IVDRHLEDGD VLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCN
Sbjct  298   KFRNQLAVELKSGCIVDRHLEDGDVVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCN  357

Query  33    PYNADFDGDEM  1
             PYNADFDGDEM
Sbjct  358   PYNADFDGDEM  368



>ref|XP_004306240.1| PREDICTED: LOW QUALITY PROTEIN: DNA-directed RNA polymerase III 
subunit RPC1-like [Fragaria vesca subsp. vesca]
Length=1379

 Score =   508 bits (1308),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 269/494 (54%), Positives = 341/494 (69%), Gaps = 37/494 (7%)
 Frame = -3

Query  1431  KIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA-SKNPILNGLLDPRMGPPNK-TKSCATCN  1258
             +I   +F+  S SE+ K AE ++++ +YYD+ + NPI  GLLDPR+GP N+ + +CATC+
Sbjct  6     RIAQWEFNVLSQSEIAKMAEAQIFQSMYYDSVTGNPIPGGLLDPRLGPANRYSGNCATCS  65

Query  1257  GDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTK  1078
                  CPGH+GY  L+LPVFNVGYL ++V+ILKCICK CSRIL  EK R           
Sbjct  66    A---XCPGHFGYFMLSLPVFNVGYLNVVVNILKCICKLCSRILFDEKLR-----------  111

Query  1077  LEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LKIIHEYGSQ-----  919
                    ++ +  VK C    +  +AV CS CG VNG V++ P  + I H+   +     
Sbjct  112   ----SGQKMMRETVKECVKPLTNHRAVKCSHCGYVNGNVRRDPGDVGIQHDRSQRTVNGV  167

Query  918   --FLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIP  745
                ++E  + V  K   ++     LD   V+SLF+KM+D DC+ L L  +PE LL T I 
Sbjct  168   GVVVEEFKSVVPAKAVNNVQQSFLLDPVRVYSLFRKMLDVDCQFLCLKTRPENLLFTCIL  227

Query  744   VPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDT-TLPARSLASWVDLQM  568
             VPP+AIR SV + GG QSNE+D+T RL+RIIQAN+ LR ++S   + PA  LA W +LQ+
Sbjct  228   VPPVAIRSSVIM-GGSQSNEDDVTVRLQRIIQANARLRLQLSSAGSSPAGVLACWQELQI  286

Query  567   EVAQYINSDVRGLPPQMQAS----RPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISP  400
             EVAQYINS+ R + P    +    +PLSG VQRLKGK G FRG LSGKRVEYTGR+VISP
Sbjct  287   EVAQYINSEARVIVPLSSRAHKPMKPLSGLVQRLKGKTGXFRGTLSGKRVEYTGRSVISP  346

Query  399   DPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISL  220
             DPNLKITEV IP+ MA+ L++PERVS+HNI+KLR CV NGP KYPGA+ ++ PDG+ +  
Sbjct  347   DPNLKITEVGIPMEMAKTLSYPERVSKHNIDKLRLCVSNGPYKYPGAEMLRKPDGS-LCT  405

Query  219   MYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP-WRTLRFNES  43
             M  +R   A  L+YG IVDRHLEDGD +LFNRQPSLHRMS+MCHRARIMP WRTLRFNES
Sbjct  406   MKVNRHGRALGLEYGDIVDRHLEDGDILLFNRQPSLHRMSVMCHRARIMPHWRTLRFNES  465

Query  42    VCNPYNADFDGDEM  1
             VCNPYNADFDGDEM
Sbjct  466   VCNPYNADFDGDEM  479



>ref|XP_002502032.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63290.1| predicted protein [Micromonas sp. RCC299]
Length=1479

 Score =   497 bits (1280),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 252/509 (50%), Positives = 347/509 (68%), Gaps = 21/509 (4%)
 Frame = -3

Query  1482  EEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLD  1306
             E ++F+K P+ E   PRKI+S++FS  S  E+ K     V+ R +Y    + P+ NG+LD
Sbjct  18    EPLEFSKAPFNELNAPRKIRSVRFSLMSPQEIGKCGVFHVFERNLYQMPQRVPLKNGILD  77

Query  1305  PRMGPPNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRIL  1129
             PRMG  +K  + CATC G   +C GH+GY+ L LPVF++GY   I+ IL+ +CK CSR++
Sbjct  78    PRMGTTDKKGTECATCKGKLIDCAGHFGYVKLELPVFHIGYFKNIIAILQQVCKECSRVM  137

Query  1128  LGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--  955
             L E+ER  +L++ RN +LE + K  L K++  +C      ++  IC  CG  NG VK+  
Sbjct  138   LPEEERQQYLKRFRNPRLEIVPKRALSKKLADKC------KRCRICPSCGAANGAVKRTG  191

Query  954   GPLKIIHEYGSQ-------FLDECHNAV--SNKTKGSIT-VPPELDSKTVHSLFKKMIDE  805
               LKI+HE  S+       ++ E   AV  +++ K ++  V  +L+   V S+  K+   
Sbjct  192   ASLKIVHEKYSKNPELMEAYVKEFEEAVKHNDQLKANLARVQDDLNPIRVESILSKISPM  251

Query  804   DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             DCELL ++D+PE L++T +PVPP+ IRPSV ++G   SNE+DIT +L +II+ N+ LRQ 
Sbjct  252   DCELLDVADRPEHLILTHLPVPPVCIRPSVEMEGQAGSNEDDITMKLIQIIEVNNVLRQG  311

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGN  448
             +         + +W  LQ++ A YINS++ GL  Q Q   +PL GFVQRLKGKQGRFRGN
Sbjct  312   LEKGLAINNLMENWDFLQIQCAMYINSELPGLSAQYQGPGKPLRGFVQRLKGKQGRFRGN  371

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I EV +P+ +A+++T+PE VSRHNIE +R+ VRNG NK+
Sbjct  372   LSGKRVDFSGRTVISPDPNLRIDEVGVPMHIAKMMTYPEVVSRHNIEMIRERVRNGMNKH  431

Query  267   PGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             PGA +++   G    L Y  R+R A ELKYG +V+RHL DGD +LFNRQPSLH+MSIM H
Sbjct  432   PGANFVRFKSGGTQYLKYGDRRRVASELKYGDVVERHLHDGDVLLFNRQPSLHKMSIMAH  491

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RAR+MPWRTLRFNE VC PYNADFDGDEM
Sbjct  492   RARVMPWRTLRFNECVCTPYNADFDGDEM  520



>ref|XP_003057499.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59144.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1591

 Score =   497 bits (1279),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 249/511 (49%), Positives = 351/511 (69%), Gaps = 21/511 (4%)
 Frame = -3

Query  1488  KREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGL  1312
             K + ++FTK P+ E   PRKI+S++FS  S  E+ K     VY R +Y    + P+  G+
Sbjct  16    KPQPVEFTKDPFEEPTAPRKIRSVRFSLMSPQEISKVGVFHVYERNLYQMPQRVPLPGGI  75

Query  1311  LDPRMGPPNKTKS-CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSR  1135
             LDPRMG  +K  + CATC G   +C GH+GY+ L LPVF++GY   ++ IL+ +CK CSR
Sbjct  76    LDPRMGTTDKKGAECATCKGKLIDCAGHFGYVKLELPVFHIGYFKNVISILQQVCKTCSR  135

Query  1134  ILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK  955
             ++L E+E   +LR+ RN +LE++ +  L K++  RC      ++   C  CG  NG+VK+
Sbjct  136   VMLPEEEHEQYLRRFRNPRLENVPRRALSKKMADRC------KRCRTCYYCGAANGVVKR  189

Query  954   G--PLKIIHEYGS-------QFLDECHNAV--SNKTKGSIT-VPPELDSKTVHSLFKKMI  811
                 LKI+HE  S       ++L +   AV  +++ K +++ V  +L+   V S+F+++ 
Sbjct  190   AGQSLKIVHEKYSKNPELMEEYLKQFEEAVKFNDQLKQNLSRVQDDLNPIRVISIFRRIS  249

Query  810   DEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               DCELL ++D+PE L++T +PVPP+ IRPSV +DG   SNE+DIT +L +II+ N+ LR
Sbjct  250   PMDCELLDIADRPEHLILTHLPVPPVCIRPSVEMDGVAGSNEDDITMKLIQIIEVNNVLR  309

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFR  454
             Q +      A  + +W  LQ+++A Y NS++ GL  Q Q   +PL GFVQRLKGKQGRFR
Sbjct  310   QGLEKGLAIANLMENWDFLQVQIAMYFNSELPGLSLQYQGPGKPLRGFVQRLKGKQGRFR  369

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EV +P+ +A+++T+PE +S+HNIE +R+ VRNG N
Sbjct  370   GNLSGKRVDFSGRTVISPDPNLRIDEVGVPMHIAKLMTYPEVISKHNIEHIRERVRNGMN  429

Query  273   KYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             K+PGA +++   G    L Y  R+R A ELK+G +V+RHL DGD +LFNRQPSLH+MSIM
Sbjct  430   KHPGANFVRFKSGGTQYLKYGDRRRVASELKFGDVVERHLNDGDVLLFNRQPSLHKMSIM  489

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HRA+IMPWRTLRFNE VC PYNADFDGDEM
Sbjct  490   AHRAKIMPWRTLRFNECVCAPYNADFDGDEM  520



>ref|XP_003075225.1| RNA polymerase I, large subunit (ISS) [Ostreococcus tauri]
Length=1406

 Score =   492 bits (1267),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/507 (49%), Positives = 342/507 (67%), Gaps = 21/507 (4%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPR  1300
             ++FTK P+     PRKI+S++FS  S SE+ ++    V+ R +Y    + P++NG+LDPR
Sbjct  19    IEFTKIPFAPASTPRKIRSVKFSLMSSSEIARAGVFHVFERNLYQMPQRTPMVNGILDPR  78

Query  1299  MGPPNK-TKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLG  1123
             MG  +K    CATC G   +C GH+GY+ L LPVF++GY   I+ +L+C+CKGCSRILL 
Sbjct  79    MGTTDKRGGECATCRGSMVDCAGHFGYIKLELPVFHIGYFKNIISVLQCVCKGCSRILLN  138

Query  1122  EKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG--P  949
             E ++  FL++ RN +LE  ++  L+K++ ++C      ++  IC  CG  NG+ K+    
Sbjct  139   EDDQATFLKRYRNPRLELTQRRLLYKKLTEKC------KRCRICPHCGDYNGVTKRAGQT  192

Query  948   LKIIHEYGS-------QFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDC  799
             LKI+HE  S       +FL E   A+    +   ++P    +L+   V S+ +++ D+DC
Sbjct  193   LKIVHEKYSKNPALLEEFLKEFETALKYNEQLRASLPKVQDDLNPIRVLSILQRITDQDC  252

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL ++D+PE LL+T +PVPP  IRPSV +DG   SNE+DIT +L +II+ N+ LRQ + 
Sbjct  253   ELLDIADRPEHLLLTHLPVPPCCIRPSVEMDGVSGSNEDDITMKLIQIIEVNNVLRQGLE  312

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGNLS  442
                     + +W  LQ++ A YINS++ GL  Q Q   +PL GFVQRLKGKQGRFRGNLS
Sbjct  313   KGLTINNLMENWDFLQIQCAMYINSELPGLSLQYQGPGKPLRGFVQRLKGKQGRFRGNLS  372

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++ RTVISPDPNL I EV IPI +A+ +T+PE V+RHNI  LR+ VRNG  ++PG
Sbjct  373   GKRVDFSARTVISPDPNLGIDEVGIPIYIAKTMTYPEVVNRHNIAMLRERVRNGMAEHPG  432

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A ++K   G    L Y  R++ A EL++G IV+RHL DGD +LFNRQPSLH+MSIM H+A
Sbjct  433   ANFVKFASGGMQYLKYGDRRKIASELRFGDIVERHLHDGDILLFNRQPSLHKMSIMAHKA  492

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             R+MP RTLR NE VC PYNADFDGDEM
Sbjct  493   RVMPCRTLRLNECVCTPYNADFDGDEM  519



>emb|CEG01150.1| DNA-directed RNA polymerase III largest subunit [Ostreococcus 
tauri]
Length=1422

 Score =   492 bits (1266),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/507 (49%), Positives = 342/507 (67%), Gaps = 21/507 (4%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPR  1300
             ++FTK P+     PRKI+S++FS  S SE+ ++    V+ R +Y    + P++NG+LDPR
Sbjct  19    IEFTKIPFAPASTPRKIRSVKFSLMSSSEIARAGVFHVFERNLYQMPQRTPMVNGILDPR  78

Query  1299  MGPPNK-TKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLG  1123
             MG  +K    CATC G   +C GH+GY+ L LPVF++GY   I+ +L+C+CKGCSRILL 
Sbjct  79    MGTTDKRGGECATCRGSMVDCAGHFGYIKLELPVFHIGYFKNIISVLQCVCKGCSRILLN  138

Query  1122  EKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG--P  949
             E ++  FL++ RN +LE  ++  L+K++ ++C      ++  IC  CG  NG+ K+    
Sbjct  139   EDDQATFLKRYRNPRLELTQRRLLYKKLTEKC------KRCRICPHCGDYNGVTKRAGQT  192

Query  948   LKIIHEYGS-------QFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDC  799
             LKI+HE  S       +FL E   A+    +   ++P    +L+   V S+ +++ D+DC
Sbjct  193   LKIVHEKYSKNPALLEEFLKEFETALKYNEQLRASLPKVQDDLNPIRVLSILQRITDQDC  252

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL ++D+PE LL+T +PVPP  IRPSV +DG   SNE+DIT +L +II+ N+ LRQ + 
Sbjct  253   ELLDIADRPEHLLLTHLPVPPCCIRPSVEMDGVSGSNEDDITMKLIQIIEVNNVLRQGLE  312

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGNLS  442
                     + +W  LQ++ A YINS++ GL  Q Q   +PL GFVQRLKGKQGRFRGNLS
Sbjct  313   KGLTINNLMENWDFLQIQCAMYINSELPGLSLQYQGPGKPLRGFVQRLKGKQGRFRGNLS  372

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++ RTVISPDPNL I EV IPI +A+ +T+PE V+RHNI  LR+ VRNG  ++PG
Sbjct  373   GKRVDFSARTVISPDPNLGIDEVGIPIYIAKTMTYPEVVNRHNIAMLRERVRNGMAEHPG  432

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A ++K   G    L Y  R++ A EL++G IV+RHL DGD +LFNRQPSLH+MSIM H+A
Sbjct  433   ANFVKFASGGMQYLKYGDRRKIASELRFGDIVERHLHDGDILLFNRQPSLHKMSIMAHKA  492

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             R+MP RTLR NE VC PYNADFDGDEM
Sbjct  493   RVMPCRTLRLNECVCTPYNADFDGDEM  519



>gb|KFM26649.1| DNA-directed RNA polymerase III subunit rpc1 [Auxenochlorella 
protothecoides]
Length=1488

 Score =   493 bits (1268),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 249/511 (49%), Positives = 343/511 (67%), Gaps = 21/511 (4%)
 Frame = -3

Query  1488  KREEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGL  1312
             +R ++  +K+ Y E   PR+IK ++FS  S SE+++++E+ VY R +Y    + P  NG+
Sbjct  13    ERSKLCSSKESYEEPNVPRRIKQLRFSLMSPSEIIQTSEMHVYERALYKMPERRPQPNGV  72

Query  1311  LDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRI  1132
             LD R+G  NK   C TC     +C GH+GY+ L LPVF++GYL   V IL+C+CK CSR+
Sbjct  73    LDGRLGVSNKRAICETCGQHLSDCTGHFGYIKLELPVFHIGYLKNTVQILQCVCKTCSRV  132

Query  1131  LLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-  955
             LL   ER  FLR+ R+ + E +++  +FKRV+ RC      ++  +C  CG  NG+VKK 
Sbjct  133   LLPAGERSAFLRRFRSLRTERVQREAVFKRVLDRC------KRTKLCPHCGAENGVVKKV  186

Query  954   -GPLKIIHE-------YGSQFLDECHNAV--SNKTKGSIT-VPPELDSKTVHSLFKKMID  808
              G LKIIH+             D+   A   +++ +G++  V  +L+   V  LF  +  
Sbjct  187   TGTLKIIHDPFTRNKGRADVIQDDLAMACQYNDQLRGNLARVMDDLNPLRVRQLFTNIPQ  246

Query  807   EDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
              D ELL ++ +PE LL++++PVPP+ IRPSV +D G  SNE+DIT RL  I++ N++LRQ
Sbjct  247   ADLELLDVAGRPEDLLISAVPVPPVCIRPSVEMDAGAGSNEDDITMRLANIVETNATLRQ  306

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQ--ASRPLSGFVQRLKGKQGRFR  454
             +++     +  +  W  LQ   A  INSD+ GL    Q   ++P  G VQRLKGKQGRFR
Sbjct  307   DLAAGAPASNLMEHWDYLQFLCATVINSDLPGLSAMYQTGGAKPTRGLVQRLKGKQGRFR  366

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+++EV +P LMA  LT+PERV+ HN+EKL+Q V  G +
Sbjct  367   GNLSGKRVDFSGRTVISPDPNLRVSEVCVPRLMALTLTYPERVTAHNMEKLKQRVLAGAS  426

Query  273   KYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
              +PGA ++  P+G ++ L +  R+R A ELK G IV+RHLEDGD VLFNRQPSLHRMSIM
Sbjct  427   HWPGASFVIFPNGDKVFLRFGDRRRIASELKIGDIVERHLEDGDIVLFNRQPSLHRMSIM  486

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HRAR+MPWRTLRFNE VC+PYNADFDGDEM
Sbjct  487   AHRARVMPWRTLRFNECVCSPYNADFDGDEM  517



>gb|KDP44150.1| hypothetical protein JCGZ_05617 [Jatropha curcas]
Length=1275

 Score =   480 bits (1235),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 245/373 (66%), Positives = 295/373 (79%), Gaps = 12/373 (3%)
 Frame = -3

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG--PLKIIHEYG--  925
             MR+  LEHLK+ +L K++VK+C+AM S  KAV C RCG +NGMVKK    L IIH+ G  
Sbjct  1     MRSRNLEHLKRTDLVKKIVKKCSAMAS-NKAVRCMRCGDMNGMVKKAGSALSIIHDRGKL  59

Query  924   -SQFLDECHNAVSNKTKGSITVPPE---LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLV  757
                +L+EC +A+S+  +    + P    L+   V SLF+++ +EDCE+L L D+PEKL++
Sbjct  60    IDGYLEECKSAISHTKEFRAPISPATYILNPARVLSLFERIPEEDCEVLGLRDRPEKLII  119

Query  756   TSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPA-RSLASWV  580
             T+I VPP++IRPSV V G  QSNENDITERLK+IIQAN+SLR E+ +    A + L SW 
Sbjct  120   TNIAVPPLSIRPSV-VMGETQSNENDITERLKQIIQANASLRMELLEGRRSANKYLDSWD  178

Query  579   DLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISP  400
              LQ  VA Y+NSDVR +P  ++  +PLSGFVQRLKGK GRFRGNL GKRVEYTGRTVISP
Sbjct  179   GLQAAVALYVNSDVR-VPNNVEVGKPLSGFVQRLKGKTGRFRGNLCGKRVEYTGRTVISP  237

Query  399   DPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISL  220
             DPNLKITEVA+PI MA+IL++PERVS HNIEKLRQCVRNG NKYPGAK +++PDG++  L
Sbjct  238   DPNLKITEVAVPIHMAKILSYPERVSNHNIEKLRQCVRNGSNKYPGAKMVRYPDGSQKVL  297

Query  219   MYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESV  40
             + + RKR A+ELK G IVDRHLEDGD VLFNRQPSLHRMSIMCHRARIMPWRTLRFNESV
Sbjct  298   IGNYRKRVAEELKIGCIVDRHLEDGDVVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESV  357

Query  39    CNPYNADFDGDEM  1
             CNPYNADFDGDEM
Sbjct  358   CNPYNADFDGDEM  370



>ref|XP_001416093.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94385.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1395

 Score =   474 bits (1221),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 241/507 (48%), Positives = 336/507 (66%), Gaps = 21/507 (4%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPR  1300
             + FTK P+     PRKI +++FS  S SE+ ++    V+ R +Y    + P+ NG+LDPR
Sbjct  18    IDFTKTPFAPASTPRKISAVRFSLMSSSEIGRAGVFHVFERNLYQMPQRTPMPNGILDPR  77

Query  1299  MGPPNK-TKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLG  1123
             MG  +K    CATC G+  +C GH+GY+ L LPVF++GY   I+ +L+C+CK CSRILL 
Sbjct  78    MGTTDKRGGECATCRGNMVDCAGHFGYIKLELPVFHIGYFKNIISVLQCVCKNCSRILLN  137

Query  1122  EKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG--P  949
             E ++  FL++ RN +LE  ++  L+K++ ++C      ++   C  CG  NG+ K+    
Sbjct  138   EDDQDMFLKRYRNPRLEITQRRLLYKKLTEKC------KRCRTCPHCGDYNGVTKRAGQT  191

Query  948   LKIIHEYGS-------QFLDECHNAVSNKTKGSITVPP---ELDSKTVHSLFKKMIDEDC  799
             LKI+HE  S       +F+ E   A+    +   ++P    +L+   V  + +++   DC
Sbjct  192   LKIVHEKYSKNPALLEEFMKEFETALKYNEQLRASLPKVQDDLNPIRVLGILQRVTSADC  251

Query  798   ELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
             ELL ++D+PE LL+T +PVPP  IRPSV +DG   SNE+DIT +L +II+ N+ LRQ + 
Sbjct  252   ELLDIADRPEHLLLTHLPVPPCCIRPSVEMDGVSGSNEDDITMKLIQIIEVNNVLRQGLE  311

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGNLS  442
                     + +W  LQ++ A YINS++ GL  Q Q   +PL GFVQRLKGKQGRFRGNLS
Sbjct  312   KGLAVNNMMENWDFLQIQCAMYINSELPGLSLQYQGPGKPLRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++ RTVISPDPNL+I EV +PI +A+ +T+PE V++HN+  LR+ VRNG  K+PG
Sbjct  372   GKRVDFSARTVISPDPNLRIDEVGVPIHIAKTMTYPEVVNKHNMVMLRERVRNGMAKHPG  431

Query  261   AKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             A ++K   G    L Y  R++ A ELK+G IV+RHL DGD +LFNRQPSLH+MSIM H+A
Sbjct  432   ANFVKFASGGMQYLKYGDRRKIASELKFGDIVERHLHDGDILLFNRQPSLHKMSIMAHKA  491

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             RIM  RTLRFNE VC PYNADFDGDEM
Sbjct  492   RIMECRTLRFNECVCTPYNADFDGDEM  518



>gb|KGN64727.1| hypothetical protein Csa_1G084260 [Cucumis sativus]
Length=1084

 Score =   455 bits (1171),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/276 (78%), Positives = 243/276 (88%), Gaps = 1/276 (0%)
 Frame = -3

Query  828  LFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQ  649
            LF++M DEDCELL+LS++PEKL++T++ VPPIAIRPSV +DG  QSNENDITERLKRIIQ
Sbjct  51   LFQRMSDEDCELLFLSNRPEKLIITNVLVPPIAIRPSVIMDGS-QSNENDITERLKRIIQ  109

Query  648  ANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGK  469
             N+S+ QE+S +   A+ L SW  LQ EVAQ INSDVRG+P  MQ S+PL+GFVQRLKGK
Sbjct  110  QNASVSQELSTSNSQAKCLESWDMLQSEVAQLINSDVRGIPFSMQVSKPLAGFVQRLKGK  169

Query  468  QGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCV  289
            QGRFRGNL GKRVE+TGRTVISPDPNLKITEVA+PI MARILT+PERV+RHNIEKLRQCV
Sbjct  170  QGRFRGNLCGKRVEFTGRTVISPDPNLKITEVAVPIHMARILTYPERVTRHNIEKLRQCV  229

Query  288  RNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             NGP+KYPGA+ ++H DG+  SLM S RKR ADELKYG IV+RHLEDGD VLFNRQPSLH
Sbjct  230  SNGPDKYPGARMLRHLDGSMRSLMISGRKRLADELKYGEIVERHLEDGDVVLFNRQPSLH  289

Query  108  RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
            RMSIMCHR R+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  290  RMSIMCHRVRVMPWRTLRFNESVCNPYNADFDGDEM  325



>emb|CDP06311.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   429 bits (1103),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 208/304 (68%), Positives = 251/304 (83%), Gaps = 8/304 (3%)
 Frame = -3

Query  1476  MQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRM  1297
             +QFTKQPYIEDVGPRKI+SIQFSTF  SE++K+AEV+VYRGVYYD++K P  NGLLDP M
Sbjct  9     IQFTKQPYIEDVGPRKIESIQFSTFGESEILKAAEVQVYRGVYYDSAKKPWENGLLDPHM  68

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             GP NK   C TC+G+F+ECPGHYGYL LALPV+NVGYL  ++DILKCICK CS +LLGEK
Sbjct  69    GPANKNGICETCHGNFRECPGHYGYLTLALPVYNVGYLITVLDILKCICKQCSHVLLGEK  128

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LK  943
             ERL+FL+KMRN K+E L+K+EL K VVKRC A+ S RKA  CSRCG VNGMVKK    L 
Sbjct  129   ERLNFLKKMRNPKMEPLRKSELQKMVVKRCNALASSRKAATCSRCGYVNGMVKKNTKMLG  188

Query  942   IIHE---YGSQFLDECHNAVSNKTK---GSITVPPELDSKTVHSLFKKMIDEDCELLYLS  781
             I+HE       FL+E  +A+S+  +    + +VP E+D K V+SL K+M+DEDCELLYL+
Sbjct  189   IMHERTKVNDSFLNEYGSAISHTKESNTSNFSVPDEIDPKVVYSLLKRMLDEDCELLYLN  248

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPA  601
             D+PEKL++++IPVPPIAIRPSVFVDGGMQSNEND TERLKRIIQAN+SLRQEISDT+LP+
Sbjct  249   DRPEKLMISTIPVPPIAIRPSVFVDGGMQSNENDTTERLKRIIQANASLRQEISDTSLPS  308

Query  600   RSLA  589
             +SL 
Sbjct  309   KSLV  312



>gb|EFA78358.1| RNA polymerase III [Polysphondylium pallidum PN500]
Length=1393

 Score =   459 bits (1180),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 240/498 (48%), Positives = 328/498 (66%), Gaps = 23/498 (5%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDAS-KNPILNGLLDPRMGPPNKTKSC  1270
             D GP+KI  IQF   S  +++  + VE+     +D S + P+  G LD R+G  +K+  C
Sbjct  9     DDGPKKIGHIQFGILSPDDMISLSHVEIINRELFDQSNRGPMQYGCLDNRLGTSDKSIIC  68

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC     +C GH+GY+ L LPVF++GY   I +IL+ ICKGCS ILL ++++  FLRK+
Sbjct  69    KTCGLSIVDCVGHFGYIKLQLPVFHIGYFKNITNILQMICKGCSAILLDDEKKTTFLRKI  128

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE------  931
             RN KL+ L++  L K++   C      RK   C RC  V G VKK   LK++HE      
Sbjct  129   RNRKLDVLQRRALLKKIYLEC------RKKKFCPRCNMVQGTVKKVSALKLVHERYKGKN  182

Query  930   --YGSQFLDECHNAV--SNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLS---DK  775
               Y   FL     A+  +++ KG I    E L+     +LFK++  +D ELL ++    +
Sbjct  183   DEYIRDFLSNFDEAIKYNSEMKGHIKKAQEDLNPLVALNLFKRITSQDTELLDMNPELGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+L++T I VPP+ IRPSV +DGG  SNE+D+T +L  I+  N ++R  +    + A  
Sbjct  243   PERLILTHILVPPVCIRPSVPMDGGSGSNEDDLTMKLSDILHINENIRTNVDKMEMVA-I  301

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ   A YINS++ GLP QM+  +P+ G  QRLKGK GRFRGNLSGKRV+++GR
Sbjct  302   MEDWDYLQASCAIYINSELPGLPLQMKPQKPIRGLSQRLKGKTGRFRGNLSGKRVDFSGR  361

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL I EVA+P L+A  +T+PERV+ +N+ +L++ V NGP+K+PGA YI +PDG
Sbjct  362   TVISPDPNLNIDEVAVPHLIALTMTYPERVAEYNLTRLQKYVINGPDKHPGANYIIYPDG  421

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              +  L Y +R++ A ELK G IV+RH+ DGD VLFNRQPSLH++SIM H+AR+MPWRTLR
Sbjct  422   EKKWLKYGNREKLAAELKPGDIVERHIIDGDVVLFNRQPSLHKLSIMAHKARVMPWRTLR  481

Query  54    FNESVCNPYNADFDGDEM  1
             FNE VC PYNADFDGDEM
Sbjct  482   FNECVCTPYNADFDGDEM  499



>ref|XP_004360352.1| RNA polymerase III [Dictyostelium fasciculatum]
 gb|EGG22501.1| RNA polymerase III [Dictyostelium fasciculatum]
Length=1507

 Score =   456 bits (1173),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 236/499 (47%), Positives = 330/499 (66%), Gaps = 25/499 (5%)
 Frame = -3

Query  1449  EDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTKS  1273
             ED GP+KI  IQF   S  ++++ + V +  R ++    + P+  G LD ++G  +K  +
Sbjct  100   EDDGPKKIGHIQFGILSPEDMIRLSHVHIINRELFSQEKRAPMPYGCLDNKLGTSDKGVN  159

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC     +C GH+GY++L LPVF++GY   I +IL+ ICK CS +LL ++ +  +LRK
Sbjct  160   CQTCGLSIVDCVGHFGYIDLQLPVFHIGYFKNITNILQMICKNCSTVLLDDEPKATYLRK  219

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQF  916
             MRN KL+ L++  LFK+V   C      RK  IC +C  VNG VKK   LK+IHE   + 
Sbjct  220   MRNRKLDVLQRRALFKKVYTDC------RKKKICPKCNSVNGPVKKVSALKLIHEKYKK-  272

Query  915   LDECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDCELLYLS---D  778
              +E H  +  + + ++    E           L+   V +LFK++  +D ELL +     
Sbjct  273   -EEEHRDLIEQFEDALKANAEMRNHVKKAQEDLNPLVVFNLFKRISYQDTELLDMDPDVG  331

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE+L++T + VPP++IRPSV +DGG  SNE+D+T +L  I+  N  ++  +    + A 
Sbjct  332   RPERLILTHLLVPPVSIRPSVPMDGGSGSNEDDLTMKLSEILHINDHIKTNVDRLEMQA-  390

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ  VA YINS++ GLP QM+  +P+ G  QRLKGK GRFRGNLSGKRV+++G
Sbjct  391   VVEDWDYLQASVAIYINSELPGLPLQMKPQKPIRGLSQRLKGKTGRFRGNLSGKRVDFSG  450

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNL I EVAIP L+A  +T+PER +  NI++L++ + NGP+K+PGA YI +PD
Sbjct  451   RTVISPDPNLNIDEVAIPQLIAVTMTYPERCTSFNIQRLQKYIINGPDKHPGANYIIYPD  510

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L Y +R++ A ELK G IV+RHL DGD +LFNRQPSLH++SIMCH+AR+MPWRTL
Sbjct  511   GEKKWLKYGNREKFAAELKIGDIVERHLIDGDVMLFNRQPSLHKLSIMCHKARVMPWRTL  570

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC PYNADFDGDEM
Sbjct  571   RFNECVCTPYNADFDGDEM  589



>gb|ETP12595.1| hypothetical protein F441_12060 [Phytophthora parasitica CJ01A1]
Length=1534

 Score =   456 bits (1172),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  16    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  75

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  76    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  135

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  136   REVFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  189

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  190   LVHEKYRAKATHDLRNVFVAQFAEAQANNLEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  249

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  250   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  309

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  310   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  369

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  370   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  429

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  430   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  488

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  489   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  519



>ref|XP_005644352.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Coccomyxa subellipsoidea C-169]
 gb|EIE19808.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Coccomyxa subellipsoidea C-169]
Length=1328

 Score =   452 bits (1163),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 238/486 (49%), Positives = 311/486 (64%), Gaps = 48/486 (10%)
 Frame = -3

Query  1404  FSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTKSCATCNGDFKECPGHY  1228
              S  E++K++E++VY R +Y    + P  NG LDPR+G  N++  C+TC  +  +C GH+
Sbjct  1     MSPDEIIKASELQVYERSLYKMPERKPAPNGTLDPRLGVSNRSSKCSTCGQNLADCTGHF  60

Query  1227  GYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELF  1048
             GY+ L LPVF++GYL   +  L+CICK CS ILL E++   FLR  RN +LE + +  LF
Sbjct  61    GYIKLWLPVFHIGYLKSTLTTLQCICKTCSSILLPEEDYRRFLRLFRNPRLERVARAGLF  120

Query  1047  KRVVKRCTAMTSGRKAVICSRCGCVNGMVKK--GPLKIIH-----------EYGSQFLDE  907
             KRV ++C      ++   C+ CG  NG+V+   G LK+ H           EY ++F DE
Sbjct  121   KRVAEKC------KRVRQCTHCGSTNGVVRHVPGGLKLFHDKYARNIKEHEEYAAEF-DE  173

Query  906   C--HNAVSNKTKGSI-TVPPELDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPP  736
                HN    + K  +  V  +L+   V +LF  + DE CELL L+ +PE L++T +PVPP
Sbjct  174   AVLHN---EQMKHCLHKVGDDLNPIRVLALFSAITDEACELLDLAGRPEHLIMTHLPVPP  230

Query  735   IAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQ  556
             + IRPSV +D G  +NE+DIT +L  II  N+ LR+ +       + + SW  LQ+  A 
Sbjct  231   VCIRPSVEMDSGGGTNEDDITMKLMNIIDTNNGLREALHLGLQADKLVDSWDFLQVNCAM  290

Query  555   YINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITE  376
                                 GFVQRLKGKQGRFRGNLSGKRV+++GRTVISPDPNL I E
Sbjct  291   --------------------GFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLAINE  330

Query  375   VAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI-KHPDGTEISLMYSSRKR  199
             V IP+ +A ILTFPERV+ HNI +L++C+ NGP  +PGA ++    DG   SL Y  R+R
Sbjct  331   VGIPMHVAVILTFPERVTSHNISRLQKCIMNGPGVWPGANFVLVAKDGARKSLKYGDRRR  390

Query  198   HADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNAD  19
              A ELK G +V+RHL DGD VLFNRQPSLHRMSIM HRARIMPWRT RFNE VCNPYNAD
Sbjct  391   TAAELKIGDVVERHLRDGDIVLFNRQPSLHRMSIMAHRARIMPWRTFRFNECVCNPYNAD  450

Query  18    FDGDEM  1
             FDGDEM
Sbjct  451   FDGDEM  456



>gb|ETK82878.1| hypothetical protein L915_11809, partial [Phytophthora parasitica]
 gb|ETL36258.1| hypothetical protein L916_11734, partial [Phytophthora parasitica]
Length=1552

 Score =   456 bits (1172),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  34    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  93

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  94    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  153

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  154   REVFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  207

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  208   LVHEKYRAKATHDLRNVFVAQFAEAQANNLEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  267

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  268   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  327

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  328   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  387

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  388   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  447

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  448   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  506

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  507   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  537



>emb|CEI95644.1| Putative DNA-directed RNA polymerase [Rhizopus microsporus]
Length=523

 Score =   429 bits (1104),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 226/499 (45%), Positives = 319/499 (64%), Gaps = 25/499 (5%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSC  1270
             D  P+KI+ +QF   S   ++K AE EV  R +Y   S+ P+  G+LD R+G   K   C
Sbjct  7     DNTPKKIRYLQFGVLSPQNMVKIAEFEVTQRDLYKPESRIPVRGGVLDLRLGTTLKDAVC  66

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC    +EC GH+GY+ L LP+F+VGY   +++IL+ ICK CSR++L E +R  +LR++
Sbjct  67    ETCGQKMQECAGHWGYVKLVLPIFHVGYFRPVINILQEICKTCSRVMLEEADRRMYLRRL  126

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--SQ  919
             R   L++L++N + K++ ++C      +K   C  C  VNG+VKK GPLKI H+     +
Sbjct  127   RAPGLDNLQRNRVLKQIQEKC------KKVTYCMHCNAVNGVVKKVGPLKITHDKYRLKR  180

Query  918   FLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD---  778
               DE      +    + ++P           +L+   V  LF+++  EDCELL LS+   
Sbjct  181   VADEAEQFRKSFETAAASMPELKPHLSKAQDDLNPLRVLRLFQRISPEDCELLGLSEEHG  240

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +PVPP  IRPSV V     SNE+D+T +L  II  N+ +R  +      + 
Sbjct  241   RPEWYIWQYLPVPPSCIRPSV-VQEDNTSNEDDLTAKLTEIIFTNAIIRAGLERGVAVST  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+  A YINS++ G+     A +P  G  QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   LMEQWEFLQLAAALYINSELPGVL-NANAGKPTRGLCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPN++I +VA+P  +A++LTFPERV+RHNI++LRQ + NGP  +PGA +++  +
Sbjct  359   RTVISPDPNMRIDQVAVPERVAKVLTFPERVNRHNIDRLRQNIINGPFVHPGANFVEKAN  418

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   A +L+ G IV+RHL D D VLFNRQPSLHR+SIM H A++MPWRT 
Sbjct  419   GFKRFLKFGNRAEIAADLQIGDIVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTF  478

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC+PYNADFDGDEM
Sbjct  479   RFNECVCSPYNADFDGDEM  497



>ref|XP_008908367.1| hypothetical protein PPTG_13738 [Phytophthora parasitica INRA-310]
 gb|ETN06398.1| hypothetical protein PPTG_13738 [Phytophthora parasitica INRA-310]
Length=1534

 Score =   455 bits (1170),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  16    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  75

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  76    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  135

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  136   RELFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  189

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  190   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  249

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  250   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  309

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  310   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  369

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  370   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  429

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  430   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  488

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  489   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  519



>gb|ETI42839.1| hypothetical protein F443_12095, partial [Phytophthora parasitica 
P1569]
 gb|ETM42752.1| hypothetical protein L914_11645, partial [Phytophthora parasitica]
Length=1552

 Score =   455 bits (1171),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  34    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  93

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  94    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  153

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  154   REVFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  207

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  208   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  267

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  268   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  327

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  328   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  387

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  388   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  447

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  448   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  506

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  507   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  537



>gb|ETO71469.1| hypothetical protein F444_12201, partial [Phytophthora parasitica 
P1976]
Length=1552

 Score =   455 bits (1170),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  34    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  93

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  94    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  153

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  154   REVFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  207

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  208   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  267

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  268   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  327

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  328   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  387

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  388   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  447

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  448   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  506

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  507   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  537



>gb|ETL89477.1| hypothetical protein L917_11596, partial [Phytophthora parasitica]
Length=1552

 Score =   455 bits (1170),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  34    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  93

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  94    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  153

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  154   RELFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKVTSTTLK  207

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  208   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  267

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  268   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  327

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  328   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  387

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  388   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  447

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  448   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  506

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  507   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  537



>gb|ETP40691.1| hypothetical protein F442_12013, partial [Phytophthora parasitica 
P10297]
Length=1552

 Score =   455 bits (1170),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 238/511 (47%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  34    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQANGVLDKRLG  93

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  94    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPTE  153

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  154   REVFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDVINGTVRKVTSTTLK  207

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  208   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  267

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  268   ELLWVDADGGRPEKLILNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  327

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  328   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  387

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  388   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  447

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  448   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  506

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  507   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  537



>gb|KCW52758.1| hypothetical protein EUGRSUZ_J02108 [Eucalyptus grandis]
Length=1084

 Score =   445 bits (1144),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 245/284 (86%), Gaps = 5/284 (2%)
 Frame = -3

Query  852  LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDIT  673
            ++ + V SLF++M DEDCELL ++D+PEK ++T+I VPPIAIRPSV ++G  QSNENDIT
Sbjct  6    INPRDVLSLFERMSDEDCELLNIADRPEKFMITTIAVPPIAIRPSVMMEGS-QSNENDIT  64

Query  672  ERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSG  493
            ERLKRIIQ N+SL+QE+ D     +++A+W  LQ EV  YINSDVRG+P   Q ++PL+G
Sbjct  65   ERLKRIIQVNASLQQELQDM----KNMAAWDHLQAEVGLYINSDVRGVPYPFQVAKPLAG  120

Query  492  FVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHN  313
            F+QRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+++N
Sbjct  121  FIQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPIQMARILTYPERVNQYN  180

Query  312  IEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVL  133
            IEKLRQCVRNGP KYPGA+ I++PDG    LM S RKR ADEL +G IVDRHLEDGD VL
Sbjct  181  IEKLRQCVRNGPYKYPGARMIRYPDGEMRLLMGSFRKRLADELGFGVIVDRHLEDGDVVL  240

Query  132  FNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
            FNRQPSLHRMSIMCHRAR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  241  FNRQPSLHRMSIMCHRARVMPWRTLRFNESVCNPYNADFDGDEM  284



>gb|KCW52757.1| hypothetical protein EUGRSUZ_J02108 [Eucalyptus grandis]
Length=1184

 Score =   446 bits (1147),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 245/284 (86%), Gaps = 5/284 (2%)
 Frame = -3

Query  852  LDSKTVHSLFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDIT  673
            ++ + V SLF++M DEDCELL ++D+PEK ++T+I VPPIAIRPSV ++G  QSNENDIT
Sbjct  6    INPRDVLSLFERMSDEDCELLNIADRPEKFMITTIAVPPIAIRPSVMMEGS-QSNENDIT  64

Query  672  ERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSG  493
            ERLKRIIQ N+SL+QE+ D     +++A+W  LQ EV  YINSDVRG+P   Q ++PL+G
Sbjct  65   ERLKRIIQVNASLQQELQDM----KNMAAWDHLQAEVGLYINSDVRGVPYPFQVAKPLAG  120

Query  492  FVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHN  313
            F+QRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERV+++N
Sbjct  121  FIQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPIQMARILTYPERVNQYN  180

Query  312  IEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVL  133
            IEKLRQCVRNGP KYPGA+ I++PDG    LM S RKR ADEL +G IVDRHLEDGD VL
Sbjct  181  IEKLRQCVRNGPYKYPGARMIRYPDGEMRLLMGSFRKRLADELGFGVIVDRHLEDGDVVL  240

Query  132  FNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
            FNRQPSLHRMSIMCHRAR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  241  FNRQPSLHRMSIMCHRARVMPWRTLRFNESVCNPYNADFDGDEM  284



>ref|XP_642724.1| RNA polymerase III, largest subunit [Dictyostelium discoideum 
AX4]
 sp|Q86AQ5.1|RPC1_DICDI RecName: Full=DNA-directed RNA polymerase III subunit rpc1; Short=RNA 
polymerase III subunit C1; AltName: Full=DNA-directed 
RNA polymerase III subunit A [Dictyostelium discoideum]
 gb|EAL68785.1| RNA polymerase III, largest subunit [Dictyostelium discoideum 
AX4]
Length=1450

 Score =   451 bits (1159),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 325/499 (65%), Gaps = 24/499 (5%)
 Frame = -3

Query  1449  EDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASK-NPILNGLLDPRMGPPNKTKS  1273
             ED  P+KI  IQF   S  ++++ + V++     +D  K  P   G+LD ++G  +K   
Sbjct  7     EDDAPKKIGHIQFGLLSEDDIVRLSHVQIVNRELFDLVKRKPTPYGVLDNKLGTSDKQAM  66

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC     +C GH+GY+ L LPVF++GYL  I++IL+ ICK CS ILL E+++  +LRK
Sbjct  67    CTTCGLSIVDCVGHFGYIKLQLPVFHIGYLKNIMNILQMICKSCSTILLNEEKKQYYLRK  126

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQF  916
             MRN K+++L++  L K++   C      RK   C +CG  NGM+KK G  KIIHE     
Sbjct  127   MRNKKMDNLQRKSLLKKIFLEC------RKTKECLKCGSTNGMIKKSGAFKIIHEKYKGK  180

Query  915   LDECHNAVSNKTKGSITVPPELDSK-----------TVHSLFKKMIDEDCELLYLS---D  778
              +   +  +     +I   PE+ S               +LFKK+  +D E++ +     
Sbjct  181   TESLQDYYA-LYDDAIKYNPEMKSHIKKAQDDLNPLVALNLFKKISYQDIEIMNMDPVIG  239

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE+L++T + VPP++IRPSV +DGG  +NE+D+T +L  I+  N  +R  +    + A 
Sbjct  240   RPERLILTYMLVPPVSIRPSVPMDGGSGTNEDDLTMKLSEILHINEHIRSNVDRAEMSA-  298

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ   A YINSDV GLP QM+ ++ + G  QRLKGK GRFRGNLSGKRV+++G
Sbjct  299   IMEDWDYLQASCAIYINSDVPGLPLQMKPTKAVRGLSQRLKGKTGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNL I EVA+P L+A  +T+PERV+ +NIE+L++ V NGP+++PGA YI + D
Sbjct  359   RTVISPDPNLNIDEVAVPQLIALTMTYPERVTDYNIERLQKYVINGPDRHPGANYIIYAD  418

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R++ A ELK G IV+RH+ DGD +LFNRQPSLH++SIM H+AR+MPWRTL
Sbjct  419   GVKKWLKFGNREKFAAELKIGDIVERHIIDGDIMLFNRQPSLHKLSIMSHKARVMPWRTL  478

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC PYNADFDGDEM
Sbjct  479   RFNECVCTPYNADFDGDEM  497



>ref|XP_009493070.1| DNA-directed RNA polymerase III subunit RPC1 [Fonticula alba]
 gb|KCV73369.1| DNA-directed RNA polymerase III subunit RPC1 [Fonticula alba]
Length=1505

 Score =   451 bits (1160),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 232/503 (46%), Positives = 322/503 (64%), Gaps = 30/503 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+KIK++ F   S  ++ + AE EV  R +Y    +NP  NG LD R+G  +K  +C T
Sbjct  12    APKKIKALHFGIMSPQDIYQVAEFEVVNRELYTIPDRNPTPNGCLDRRLGTSDKMSTCET  71

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     EC GH+ ++ L LPVF++G+   I+ IL+ +CK CSRIL+ E E  ++L ++RN
Sbjct  72    CGHKLAECSGHFAHIRLELPVFHIGFFKGIITILQSVCKTCSRILVDEAEAQNYLFRIRN  131

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG----SQ  919
              +L+ L++  L KR+ ++C      +KA  C  CG  NG +KK G LK+ HE      S+
Sbjct  132   PRLDGLQRRGLVKRIHEKC------KKAAHCPHCGSANGTIKKTGALKLYHERARGRPSE  185

Query  918   FLDECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDCELLYL---S  781
                +       + + +I   P+           L+   V S+F+ + D D ELL +    
Sbjct  186   RDQQLKVDREKQFEAAIEANPDVKTHLSRANEDLNPMRVLSIFQNISDADVELLGMCPVE  245

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPA  601
              +PE+L+ T IPVPP+ IRPSV +D    SNE+D+T +L  II  N+ +RQ I     P 
Sbjct  246   GRPEQLIWTHIPVPPVCIRPSVAMDAAAGSNEDDLTIKLMEIIHVNNVIRQSIEKGAQPQ  305

Query  600   RSLASWVDLQMEVAQYINSDVRG--LPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
               + +W  LQ+  A YINS++ G  LP QMQ ++P  GF QRLKGK GRFRGNLSGKRV+
Sbjct  306   VLIENWDMLQIYCAMYINSELPGVQLPQQMQ-TKPTRGFCQRLKGKTGRFRGNLSGKRVD  364

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             ++GRTVISPDP+L I EVA+P L+A++LT+PERV+RHNI+K+RQ + NGP+ +PGA Y+ 
Sbjct  365   FSGRTVISPDPDLAINEVAVPELVAKVLTYPERVTRHNIKKMRQLIINGPDVHPGANYLA  424

Query  246   HPDGTEISLMY-SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
              PDG ++ L Y   R+R A +L  G IV+RH++DGD VLFNRQPSLH++SIMCH  ++ P
Sbjct  425   TPDGRKLHLKYVRDRERTAAQLNIGDIVERHIDDGDVVLFNRQPSLHKLSIMCHYVKVRP  484

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRT R NE  C PYNADFDGDEM
Sbjct  485   WRTFRLNECACTPYNADFDGDEM  507



>ref|XP_009525720.1| hypothetical protein PHYSODRAFT_500633 [Phytophthora sojae]
 gb|EGZ16662.1| hypothetical protein PHYSODRAFT_500633 [Phytophthora sojae]
Length=1532

 Score =   451 bits (1160),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/511 (46%), Positives = 331/511 (65%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V+ + ++   ++ P  +G+LD R+G
Sbjct  12    LVKQLVLENDRPAKISHLNFGLLSDVDMMQMSELRVHSKDLFKVQTREPAADGVLDKRLG  71

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  72    VSNKKDTCDTCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKSCSRVLLPPAE  131

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ + + L+   L K++   C      +K + C  C  +NG V+K     LK
Sbjct  132   RETFLRRMRDPRADVLRLVGLRKKIAALC------KKTIKCPYCDAINGSVRKITSTTLK  185

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  186   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVLQLFKEIPDQDC  245

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++   + +PE+L++ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  246   ELLWVDADNGRPERLILNSVLVPPVCIRPSVAMDGGSGSNEDDITVKLQEIVQVNFALRA  305

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  306   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKSGIRGLCQRLKGKQGRFRGN  365

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGPN +
Sbjct  366   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPNVH  425

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  LMY  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  426   PGANIIR-IEGQKFTKNLMYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  484

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  485   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  515



>ref|XP_002903770.1| DNA-directed RNA polymerase III largest subunit [Phytophthora 
infestans T30-4]
 gb|EEY54825.1| DNA-directed RNA polymerase III largest subunit [Phytophthora 
infestans T30-4]
Length=1534

 Score =   451 bits (1159),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/511 (46%), Positives = 329/511 (64%), Gaps = 28/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S  ++M+ +E+ V  + ++   ++ P  NG+LD R+G
Sbjct  16    LVKQLVLENDRPAKISHLNFGLLSDVDMMRMSELRVQSKDLFKVQTREPQGNGVLDKRLG  75

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TC+    +C GH+GY+ L LPVF++GY   I +IL+ ICK CSR+LL   E
Sbjct  76    VSNKKDTCETCHLKLADCVGHFGYIKLELPVFHIGYFKAITEILQNICKCCSRVLLPPTE  135

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+ K + L+   L K++   C      +K V C  C  +NG V+K     LK
Sbjct  136   RELFLRRMRDPKADVLRLVGLRKKIATLC------KKTVKCPHCDAINGTVRKITSTTLK  189

Query  942   IIHE-YGSQ--------FLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDEDC  799
             ++HE Y ++        F+ +   A +N  +    +P    +L    V  LFK++ D+DC
Sbjct  190   LVHEKYRAKATHDLRNVFVAQFAEAQANNPEIGAHLPKAQEDLSPLVVQQLFKEIPDQDC  249

Query  798   ELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKLL+ S+ VPP+ IRPSV +DGG  SNE+DIT +L+ I+Q N +LR 
Sbjct  250   ELLWVDADGGRPEKLLLNSVLVPPVCIRPSVAMDGGTGSNEDDITVKLQEIVQVNFALRA  309

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ +N D  GL     A   + G  QRLKGKQGRFRGN
Sbjct  310   ALQKGASLKMVMEDWDFLQIQVAQLMNGDTPGLVKPPGAKTGIRGLCQRLKGKQGRFRGN  369

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NIEKLR+CV NGP+ +
Sbjct  370   LSGKRVDFSGRTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIEKLRKCVVNGPHVH  429

Query  267   PGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             PGA  I+  +G + +  L+Y  R   ADELK G IV+RH+EDGD VLFNRQPSLH+MSIM
Sbjct  430   PGANVIR-IEGQKFTKNLLYGDRASLADELKIGDIVERHMEDGDIVLFNRQPSLHKMSIM  488

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              HR ++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  489   SHRVKVMPWRTFRFNECVCSPYNADFDGDEM  519



>dbj|GAM24976.1| hypothetical protein SAMD00019534_081510 [Acytostelium subglobosum 
LB1]
Length=1400

 Score =   448 bits (1153),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 237/506 (47%), Positives = 328/506 (65%), Gaps = 23/506 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
              TK+    D GP+KI  IQF   S  ++++ + VE+  R ++    +  +  G LD R+G
Sbjct  1     MTKELIKMDDGPKKIGHIQFGILSPDDMIRLSHVEIINRELFNQEKRTAMAYGCLDNRLG  60

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               +K+  C TC     +C GH+GY+ L LPVF++GY   I +IL+ ICK C+ ILL E +
Sbjct  61    TSDKSVICQTCGLSIVDCVGHFGYIELQLPVFHIGYFKNITNILQMICKNCACILLDEDK  120

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKII  937
             +  FLRK+RN KL+ L++  L K++   C      RK   C RC  V G VKK   LK+I
Sbjct  121   KQLFLRKIRNRKLDVLQRRSLLKKIYTEC------RKKKTCPRCNSVQGSVKKVSALKLI  174

Query  936   HE--------YGSQFLDECHNAV--SNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCELL  790
             HE        Y   F+     A+  +++ K  I    E L+   V +LFK++  +D ELL
Sbjct  175   HERYKGKNDEYIRDFISNFDEAIKYNSELKAHIKKAQEDLNPLVVLNLFKRISFQDTELL  234

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              +S    +PE+L++T + VPP++IRPSV +DGG  SNE+D+T +L  I+  N  +R  + 
Sbjct  235   DMSPELGRPERLILTHLLVPPVSIRPSVPMDGGSGSNEDDLTMKLSDILHINEHIRSNVD  294

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                + A  +  W  LQ   A YINS++ GLP  ++  +P+ G  QRLKGK GRFRGNLSG
Sbjct  295   KVDMGA-IMEDWDYLQASCAIYINSELPGLPLHLKPQKPIRGLSQRLKGKTGRFRGNLSG  353

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL I EVA+P L+A  +TFPERV+ +N+++L++ V NGP+K+PGA
Sbjct  354   KRVDFSGRTVISPDPNLNIDEVAVPHLIALTMTFPERVAEYNLKRLQRYVLNGPDKHPGA  413

Query  258   KYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRAR  79
              YI + DG +  L Y +R++ A ELK G IV+RH+ DGD VLFNRQPSLH++SIM H+AR
Sbjct  414   NYIIYADGEKKWLKYGNREKFAAELKPGDIVERHIIDGDVVLFNRQPSLHKLSIMAHKAR  473

Query  78    IMPWRTLRFNESVCNPYNADFDGDEM  1
             +MPWRTLRFNE VC PYNADFDGDEM
Sbjct  474   VMPWRTLRFNECVCTPYNADFDGDEM  499



>ref|XP_009551792.1| hypothetical protein HETIRDRAFT_389945 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW76932.1| hypothetical protein HETIRDRAFT_389945 [Heterobasidion irregulare 
TC 32-1]
Length=1406

 Score =   448 bits (1152),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 238/502 (47%), Positives = 324/502 (65%), Gaps = 35/502 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDAS--KNPILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK +QF+TF+  +++K +E +V     Y AS  + P  +G+LD R+G   K+  C T
Sbjct  10    PKVIKHLQFTTFNAQDIVKISEFQVTHRDLYTASSERAPAKDGMLDRRLGTVEKSAFCET  69

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ L +PVF++GY    + +L+CICK C+R+LL E ER  FL++ R 
Sbjct  70    CGLNSVDCVGHYAYIKLVVPVFHIGYFKHTIGVLQCICKTCARVLLEESERRAFLKRFRR  129

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               LE++ +  + K +       T+ RK + C  C  +NG+VKK G LK+IH+   +F  +
Sbjct  130   PNLENVHRLAIVKAL------NTAARKKIYCPFCSAINGVVKKAGALKVIHD---KFRAK  180

Query  906   CHNAVSNKTKGS----ITVPPELD---SKTVHS---------LFKKMIDEDCELLYL---  784
                    K KG+    I    EL     KTVH          LFK++ DEDCELL L   
Sbjct  181   KTADDLEKWKGTFASAIAAQKELGMYIHKTVHEDLNPLKALDLFKRISDEDCELLGLRPE  240

Query  783   SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
              ++PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ L+Q I+     
Sbjct  241   HNRPEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALLKQGIAKGAPT  298

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
             A+ +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV++
Sbjct  299   AQFMEQWEFLQLSVAMYINSEMPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDF  357

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             +GRTVISPDPNL+I EVA+P  +A+ILT+PERV+  NIEKLRQ VRNG + +PGA Y+  
Sbjct  358   SGRTVISPDPNLRIDEVAVPERIAKILTYPERVTMFNIEKLRQAVRNGCDVHPGANYVTA  417

Query  243   PD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
              + G +  L + +R   AD L+YG +V+RH+ DGD  LFNRQPSLH++SIMCHR R+ PW
Sbjct  418   SNSGFKKYLKFGNRNAIADGLRYGDVVERHIVDGDVALFNRQPSLHKISIMCHRVRVRPW  477

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RT R NE VC PYNADFDGDEM
Sbjct  478   RTFRLNECVCGPYNADFDGDEM  499



>gb|KDO23974.1| hypothetical protein SPRG_10671 [Saprolegnia parasitica CBS 223.65]
Length=1153

 Score =   442 bits (1137),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 329/518 (64%), Gaps = 41/518 (8%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S +++M+ +E+ V+ + ++   ++ P   G+LD R+G
Sbjct  16    LVKQFVLENDRPSKISHLNFGLLSSTDMMQMSEIPVHSKDLFTMPAREPAKFGVLDKRLG  75

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NKT  C TC+    +C GH+GY+NL LPVF++GY+   ++IL+ ICK CSR+LL    
Sbjct  76    ISNKTDECDTCHLKLSDCVGHFGYVNLELPVFHIGYIKATLEILQNICKECSRVLLAPDV  135

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  +LR+MR+   + LKK    K++   C      +K V C  C  +NG V+K     LK
Sbjct  136   RESYLRRMRDPTADALKKINTRKKISALC------KKVVRCPHCDGINGTVRKIACPTLK  189

Query  942   IIHE-------------YGSQFLD------ECHNAVSNKTKGSITVPPELDSKTVHSLFK  820
             ++HE             + +QF        E  NA+  K +       +L    V  LFK
Sbjct  190   LVHEKYRAKAAHDMRTVFVAQFAQAQSQNAEMTNALLAKAQ------EDLSPLVVQELFK  243

Query  819   KMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQ  649
             ++ D+DC+LL+++    +PEKL++ S+ VPP+ IRPSV +D G  SNE+D+T +L+ IIQ
Sbjct  244   RIPDQDCDLLWVNADVGRPEKLILNSLLVPPVCIRPSVAMDVGSGSNEDDLTVKLQEIIQ  303

Query  648   ANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGK  469
              N +L+  +S        +  W  LQ++VAQ+IN D  GL     A +P+ G  QRLKGK
Sbjct  304   VNFALQAALSKGATLKMVMEDWDFLQIQVAQFINGDTPGLTKLQGAPKPIRGLCQRLKGK  363

Query  468   QGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCV  289
             QGRFRGNLSGKRV+++ RTVISPDPNL+I +V +P  +AR++T+PE+V+R+NI KLRQCV
Sbjct  364   QGRFRGNLSGKRVDFSARTVISPDPNLRIDQVGVPEHVARVMTYPEKVTRYNIAKLRQCV  423

Query  288   RNGPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPS  115
              NGP  +PGA  I+  +G + +  LMY  R   AD+LK G IV+RH+ED D VLFNRQPS
Sbjct  424   INGPAVHPGANAIR-IEGQKYTKNLMYGDRASLADDLKEGDIVERHMEDDDIVLFNRQPS  482

Query  114   LHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LH+MSIM HRA+++ WRT RFNE VC+PYNADFDGDEM
Sbjct  483   LHKMSIMSHRAKVLQWRTFRFNECVCSPYNADFDGDEM  520



>gb|KDD75278.1| domain 1 of RNA polymerase Rpb1, partial [Helicosporidium sp. 
ATCC 50920]
Length=952

 Score =   437 bits (1123),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 228/505 (45%), Positives = 320/505 (63%), Gaps = 23/505 (5%)
 Frame = -3

Query  1467  TKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGP  1291
             +K+ ++E   PRKIK I F      E++ +AE +V+ R +Y    + P   G+LD R+G 
Sbjct  20    SKEQFVEPNVPRKIKKISFGIMPPHEMINNAEFQVHERTLYKMPERRPAPGGVLDARLGV  79

Query  1290  PNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKER  1111
              +K   C TC     +C GH+GY+ LALPVF++GY    V  L+CICK CSR+LL   ++
Sbjct  80    SSKRAQCETCGLGLTDCVGHFGYIKLALPVFHIGYFKSTVQTLQCICKSCSRVLLPPSDK  139

Query  1110  LDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP--LKII  937
                LR++ +T++E   +   F+RV++RC      ++   C  CG  NG+VKK P  LKI+
Sbjct  140   RTLLRRLASTRMERTAREAAFRRVLERC------KRTRACPYCGADNGVVKKAPGSLKIL  193

Query  936   HEYGSQFL--------DECHNAVSNKTKGSITVPPELDSK---TVHSLFKKMIDEDCELL  790
             H+   +          D   +A  N+   +  +P  LD      V +L   + D D  LL
Sbjct  194   HDPSPRSRGADRPTPGDLSESARRNELLKA-ALPRALDDLHPLRVSALLAAIPDADVALL  252

Query  789   YLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTT  610
              ++ +PE  LV+ +PVPP+ IRPSV +DGG  SNE+D++ +L +I++ N+ LR  ++   
Sbjct  253   DVAGRPEHALVSVLPVPPVCIRPSVEMDGGAGSNEDDLSMKLMQIVEVNNVLRAGLAKGL  312

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQGRFRGNLSGKR  433
                  + +W  LQ++ A YIN+D+ GL    Q   +P+ GFVQRLKGK GRFRGNLSGKR
Sbjct  313   ACVSLMENWDFLQVQCAMYINADLPGLSASYQMPGKPMRGFVQRLKGKSGRFRGNLSGKR  372

Query  432   VEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY  253
             V+++GRTVISPDPNL I++VA+P  MA  LTFPE V+ HN+ +LR  V NG +++PGA +
Sbjct  373   VDFSGRTVISPDPNLAISQVAVPRAMASTLTFPETVTPHNLARLRALVFNGQSRWPGAAF  432

Query  252   IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIM  73
             +   +   + L Y   +R A EL+ G +V+RHL DGD VLFNRQPSLHRMSIM H  R++
Sbjct  433   VVLRNQDRVWLKYGDCRRIASELRPGDVVERHLLDGDVVLFNRQPSLHRMSIMAHTVRVI  492

Query  72    -PWRTLRFNESVCNPYNADFDGDEM  1
              PWRTLRFNESVC+PYNADFDGDEM
Sbjct  493   GPWRTLRFNESVCSPYNADFDGDEM  517



>emb|CCA19646.1| DNAdirected RNA polymerase III largest subunit puta [Albugo laibachii 
Nc14]
 emb|CCA23078.1| RNA polymerase III putative [Albugo laibachii Nc14]
Length=1543

 Score =   449 bits (1154),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 227/510 (45%), Positives = 326/510 (64%), Gaps = 26/510 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E   P KI  + F   S  E+M+ +E+ V  R ++   S++P  NG+LD R+G
Sbjct  21    LVKQFVLEKDRPVKISHLNFGLLSEVEMMRMSEMRVTSRDLFAVQSRDPAKNGVLDKRLG  80

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK+ +C TC+    +C GH+GY+ L LPVF++G+   I++IL+ ICK CSR+LL   +
Sbjct  81    VSNKSDTCDTCSLRLSDCVGHFGYIKLELPVFHIGFFKAILEILQMICKECSRVLLSPSD  140

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FL+++R+ + + L+   L K++   C      ++ V C  C  VNG V+K     LK
Sbjct  141   RESFLQRVRDPRADALRLKALRKKMATLC------KRVVKCPHCQSVNGTVRKVNSSTLK  194

Query  942   IIHE-YGSQFLDECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDC  799
             ++HE + ++   +  N    + + + T+ PE           L    V  LF+++ D+DC
Sbjct  195   LLHEKFRAKSAQDLRNVFVAQFREAQTINPEIRQHLPKAQQDLSPVIVQELFERIPDQDC  254

Query  798   ELLYLSD---KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKL++ S+ VPP+ IRPSV +D G  SNE+D+T +L+ I+Q N +L  
Sbjct  255   ELLWIDSSLGRPEKLILNSLLVPPVCIRPSVAMDAGAGSNEDDLTIKLQEILQVNFALHA  314

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ ++ D  GL   M A + + G+ QRLKGKQGRFRGN
Sbjct  315   ALRQGATLTMVMEDWDFLQIQVAQLMHGDTPGLVKPMNAPKSIRGYCQRLKGKQGRFRGN  374

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NI KLR+CV NGPN +
Sbjct  375   LSGKRVDFSGRTVISPDPNLRIDQVGVPQHVAKTMTYPEKVTRYNINKLRKCVVNGPNVH  434

Query  267   PGAKYIK-HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             PGA  I+        +L Y  R   AD+LK G  V+RH+EDGD VLFNRQPSLH+MSIM 
Sbjct  435   PGANIIQLQGQNLTKNLSYGDRANMADDLKIGDTVERHMEDGDVVLFNRQPSLHKMSIMA  494

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRA++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  495   HRAKVMPWRTFRFNECVCSPYNADFDGDEM  524



>ref|XP_002291242.1| DNA directed RNA polymerase III, largest subunit [Thalassiosira 
pseudonana CCMP1335]
 gb|EED91349.1| DNA directed RNA polymerase III, largest subunit [Thalassiosira 
pseudonana CCMP1335]
Length=1422

 Score =   447 bits (1149),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 237/502 (47%), Positives = 323/502 (64%), Gaps = 31/502 (6%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P++I  +QF   S S++ + AE +V  R ++    + P  NG+LDPR+G  +K  +CATC
Sbjct  35    PKQISHLQFGLLSPSDMQRLAEFQVTSRDLFTMPQRLPARNGVLDPRLGVSDKVSTCATC  94

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                  +C GH+GY+ LALPVF++GYL   +++L+CICK CSR+LL + ER   L+KMRN 
Sbjct  95    KLKLADCAGHFGYIRLALPVFHIGYLKHTLNLLQCICKSCSRVLLTDAERKMLLKKMRNP  154

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GP-LKIIHEY--GSQ  919
             + + L K  +FK+V+ +C      +KA  C  C   NG VKK    P LKIIHE   G  
Sbjct  155   RTDVLGKASVFKKVLDKC------KKAHQCPYCHKPNGTVKKVHGAPTLKIIHERYKGRH  208

Query  918   FLDECHNAVSNKTKGSIT----------VPPELDSKTVHSLFKKMIDEDCELLYLS---D  778
               DE  + + +     IT             +L    V  LFK M D+DCE+L+++    
Sbjct  209   MEDEVEDLLQSLQGAMITNLEINHALRVAVEDLLPTRVLELFKGMTDDDCEVLWVAPWIG  268

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE L++  I VPP+ IRPSV +D G  SNE+D+T +L  +I  N +L   ++       
Sbjct  269   RPENLILEHILVPPVPIRPSVAMDVGGGSNEDDLTVKLLEVINVNVALELNMTRNPQTKT  328

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ +VAQYIN D+ GL  +M   +P+ G  QRLKGKQGRFRGNLSGKRV+++ 
Sbjct  329   IMEGWDVLQSQVAQYINGDMPGLKKEM-GHKPIRGLCQRLKGKQGRFRGNLSGKRVDFSA  387

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPNL++ +V +P+ +A+I+T+PE VSR+NIEKLRQ V NGP+ +PGA  I+ P 
Sbjct  388   RTVISPDPNLRVDQVGVPVHVAKIMTYPETVSRYNIEKLRQRVLNGPDVHPGANLIR-PG  446

Query  237   GTEI---SLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
             G      SL Y+ R+R A  L+ G IV+RH+EDGD VLFNRQPSLH++SIM H+ ++MPW
Sbjct  447   GENSFVKSLAYADRERAAQTLRIGDIVERHMEDGDVVLFNRQPSLHKLSIMSHQVKVMPW  506

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RT RFN  VC PYNADFDGDEM
Sbjct  507   RTFRFNICVCAPYNADFDGDEM  528



>emb|CCI39585.1| unnamed protein product [Albugo candida]
Length=1546

 Score =   448 bits (1153),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/510 (45%), Positives = 323/510 (63%), Gaps = 26/510 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E   P KI  + F   S  E+M+ +E+ V  R ++   S++P  NG+LD R+G
Sbjct  21    LIKQFVLEKDRPVKISHLNFGLLSEIEMMRLSEIRVTSRDLFAIQSRDPAKNGVLDKRLG  80

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK  +C TCN    +C GH+GY+ L LPVF++GY    ++IL+ ICK CSR+LL   +
Sbjct  81    VSNKADTCDTCNLRLSDCVGHFGYIKLELPVFHIGYFKATLEILQMICKECSRVLLSLND  140

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FL+++R+ + + L+   L K++   C      ++ V C  C  VNG V+K     LK
Sbjct  141   RELFLQRVRDPRADALRLKALRKKMATLC------KRVVKCPHCQSVNGTVRKVNSSTLK  194

Query  942   IIHE-YGSQFLDECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDC  799
             ++HE + ++   +  N    + + + T+ PE           L    V  LF+++ D+DC
Sbjct  195   LVHEKFRAKSAQDLRNVFVAQFREAQTINPEIRQHLPKAQQDLSPLVVQELFERIPDQDC  254

Query  798   ELLYLSD---KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             ELL++     +PEKLL+ S+ VPP+ IRPSV +D G  SNE+D+T +L+ I+Q N +L  
Sbjct  255   ELLWIDSSLGRPEKLLLNSLLVPPVCIRPSVAMDAGAGSNEDDLTIKLQEILQVNFALHA  314

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGN  448
              +         +  W  LQ++VAQ ++ D  GL   M A + + G+ QRLKGKQGRFRGN
Sbjct  315   ALRQGATLTMVMEDWDFLQIQVAQLMHGDTPGLAKPMNAPKSIRGYCQRLKGKQGRFRGN  374

Query  447   LSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKY  268
             LSGKRV+++GRTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NI KLR+CV NGP  +
Sbjct  375   LSGKRVDFSGRTVISPDPNLRIDQVGVPQHVAKTMTYPEKVTRYNIHKLRKCVVNGPTVH  434

Query  267   PGAKYIK-HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMC  91
             PGA  I+        +L Y  R   AD+LK G  V+RH+EDGD VLFNRQPSLH+MSIM 
Sbjct  435   PGANVIRLQGQNLTKNLSYGDRANMADDLKIGDTVERHMEDGDVVLFNRQPSLHKMSIMA  494

Query  90    HRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HRA++MPWRT RFNE VC+PYNADFDGDEM
Sbjct  495   HRAKVMPWRTFRFNECVCSPYNADFDGDEM  524



>ref|XP_007514262.1| DNA-directed RNA polymerase III largest subunit [Bathycoccus 
prasinos]
 emb|CCO15699.1| DNA-directed RNA polymerase III largest subunit [Bathycoccus 
prasinos]
Length=1499

 Score =   446 bits (1146),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 234/520 (45%), Positives = 338/520 (65%), Gaps = 35/520 (7%)
 Frame = -3

Query  1482  EEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLD  1306
             ++++ +K+ +++   PR+IK + FST SGSE+ ++  + V  R +Y    + P+  G+LD
Sbjct  18    KKIETSKESFVKANAPRRIKKVTFSTMSGSEIARAGVLHVTERTLYTPTERMPLEGGILD  77

Query  1305  PRMGPPNKTK-SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRIL  1129
             PR+G  NK++  C TC G   +C GH+GYL L LPVF+VGY   IV  L+C+CK CS +L
Sbjct  78    PRLGTTNKSQPECQTCKGKIMDCSGHFGYLKLELPVFHVGYFKAIVHCLQCVCKECSCLL  137

Query  1128  LGEKERLDFLRKMRNTK-----LEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGM  964
             + E+E+ + L K+R+ +     ++H  +  +FK+++++C      ++  +C +C  VNG 
Sbjct  138   MKEEEQEEMLTKLRSREKKIGGVDHAYRRVMFKKLLEKC------KRTKVCFQCEAVNGP  191

Query  963   VKKGP--LKIIHE-YGSQFLDE-----------CHNAVSNKTKGSIT-VPPELDSKTVHS  829
             VK+    LKIIHE Y S   ++            HN   ++ +  I+    +L+   V  
Sbjct  192   VKRAGQNLKIIHEKYTSNKAEQEKRERAFEEAMKHN---DQLRQHISRAQDDLNPIRVLQ  248

Query  828   LFKKMIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQ  649
             +FK++ ++D  LL L+ +PE +++T + VPP  IRPSV +DG   S E+DI+ +L +II+
Sbjct  249   IFKRIAEKDLSLLDLAQRPENMVITHLSVPPCCIRPSVELDGQAGSTEDDISMKLVQIIE  308

Query  648   ANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKG  472
              N+ LRQ +         + +W  LQ++ A YINS++ G+  Q Q+  +PL GFVQRLKG
Sbjct  309   INNVLRQGLERGLAVTNMMENWEFLQIQFAMYINSELPGISSQYQSPGKPLRGFVQRLKG  368

Query  471   KQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQC  292
             KQGRFRGNLSGKRV++T RTVISPDPNL+I EV +P  +A  LT+PE V+ +NI +LRQ 
Sbjct  369   KQGRFRGNLSGKRVDFTARTVISPDPNLRIDEVGLPQHIAMQLTYPETVNNNNIAELRQL  428

Query  291   VRNGPNKYPGAKYIKHPDGTEIS---LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQ  121
             + NG  K+PGA ++K       S   L Y  R R A +LK G IV+RH+ DGD VLFNRQ
Sbjct  429   IINGEGKWPGANFVKSKQSGHFSAQYLKYGDRNRVAKKLKPGDIVERHVRDGDIVLFNRQ  488

Query  120   PSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             PSLH+MSIM HRA++MPWRTLRFNE VC PYNADFDGDEM
Sbjct  489   PSLHKMSIMAHRAKVMPWRTLRFNECVCAPYNADFDGDEM  528



>ref|XP_001841218.1| DNA-directed RNA polymerase III largest subunit [Coprinopsis 
cinerea okayama7#130]
 gb|EAU80581.1| DNA-directed RNA polymerase III largest subunit [Coprinopsis 
cinerea okayama7#130]
Length=1403

 Score =   443 bits (1139),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 234/498 (47%), Positives = 317/498 (64%), Gaps = 28/498 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E EV +R +Y    + P+ +G+LD R+G   K+  C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFEVTHRDLYTPTERLPVKHGVLDRRLGTTEKSAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GHY Y+ L +PVF++GY    + IL+ ICK C+R+LL E +R  +L++ R 
Sbjct  69    CGQSSVNCVGHYAYIKLCVPVFHIGYFKHTIGILQSICKSCARVLLEEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVK-KGPLKIIHEY--GSQFL  913
               LE++ +  LFK V       +  RK V C  C   NG VK  G LKIIH+     +  
Sbjct  129   PNLENIHRQALFKAV------NSMARKVVYCPYCSATNGAVKTAGALKIIHDKFRAKKTA  182

Query  912   DECHN-------AVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             DE          AV  + +  +     V  +L+   V  LF+++ DEDCELL L     +
Sbjct  183   DELEKWKKTFVAAVEAQKELGMYLNKAVVEDLNPLKVLDLFRRISDEDCELLGLRPEWGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   + VPP+ IRPSV  DG   SNE+DIT +L  I+  N+ ++Q +S      + 
Sbjct  243   PEQFIWQYLSVPPVCIRPSVAQDGA--SNEDDITVKLTEIVFTNALIKQGLSKGAPTPQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNIE LRQ +RNGP+ +PGA Y+   + 
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTMHNIETLRQAIRNGPDVHPGANYVARGE-  418

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
             T+  L + +R+  AD L  G IV+RH+ DGD VLFNRQPSLH++SIMCHRA+I PWRT R
Sbjct  419   TKKFLKFGNRQAIADNLAIGDIVERHVIDGDIVLFNRQPSLHKLSIMCHRAKIRPWRTFR  478

Query  54    FNESVCNPYNADFDGDEM  1
              NE VC PYNADFDGDEM
Sbjct  479   LNECVCGPYNADFDGDEM  496



>ref|XP_007381679.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN10167.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Punctularia strigosozonata HHB-11173 SS5]
Length=1405

 Score =   442 bits (1137),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 317/499 (64%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK ++F+  +  + +K +E EV +R +Y    + P+ NG+LD R+G   K   C T
Sbjct  9     APKVIKKLRFTLLNAQDTVKLSEFEVTHRDLYTALDRTPVKNGVLDRRLGTSEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C   + +C GHY Y+ L +PVF++GY    +  L+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLSYVDCVGHYAYIKLVVPVFHIGYFKHTIAALQCICKTCARVLLEEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------  934
               LE+L++  L K V       ++ RK V C  C   NG VKK G LKIIH         
Sbjct  129   PNLENLQRQALCKAV------NSAARKVVYCPYCAATNGTVKKAGALKIIHDKFRAKKTA  182

Query  933   EYGSQFLDECHNAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYL---SDK  775
             E   ++     NAV  + + +      V  +L+   V  LF+++ DEDCELL +     +
Sbjct  183   EEMERWKKTFSNAVDAQKELATYIGRAVHEDLNPLKVLDLFRRISDEDCELLGMKPEQGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+AIRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++      + 
Sbjct  243   PEEFIWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAPTPQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNIEKLRQ VRNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTAHNIEKLRQAVRNGCDIHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L +  R   AD L+ G IV+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWRT 
Sbjct  420   GFKKFLKFGKRDAIADGLRIGDIVERHIIDGDIVLFNRQPSLHKLSIMCHRVKVRPWRTF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCGPYNADFDGDEM  498



>ref|XP_007852652.1| dna-directed rna polymerase iii largest subunit [Moniliophthora 
roreri MCA 2997]
 gb|ESK88045.1| dna-directed rna polymerase iii largest subunit [Moniliophthora 
roreri MCA 2997]
Length=1405

 Score =   442 bits (1137),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 231/498 (46%), Positives = 320/498 (64%), Gaps = 28/498 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E EV +R +Y  + + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFEVTHRDLYNPSDRLPVKDGVLDRRLGTTEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  D   C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGQDSVNCVGHYAYIKLVVPVFHIGYFKHTIQILQCICKTCARVLLEEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQFL  913
               LE++++  LFK V       T  RK V C  C   NG VKK G LKIIH+     +  
Sbjct  129   PNLENIQRQALFKAV------NTMARKMVYCPYCTATNGAVKKAGALKIIHDKFRAKKTA  182

Query  912   DECHN-------AVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             +E          AV ++   ++    TV  +L+   V  LF+++ DEDCELL L     +
Sbjct  183   EEMEKWKRTFGPAVESQKDLAVFLNKTVHEDLNPLKVLDLFRRITDEDCELLGLQPEHGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   + VPP AIRPSV  DG   SNE+D+T +L  I+  N+ ++Q +S      + 
Sbjct  243   PEEFIWQYLSVPPPAIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLSKGAPTPQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI+ L+Q +RNG + +PGA Y+ +  G
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTIHNIDILKQAIRNGTDVHPGANYVSNDRG  419

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              +  L + +R   AD L  G +V+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ R
Sbjct  420   KKY-LKFGNRALIADTLAIGDVVERHIVDGDVVLFNRQPSLHKLSIMCHRVKVRPWRSFR  478

Query  54    FNESVCNPYNADFDGDEM  1
              NE VC PYNADFDGDEM
Sbjct  479   LNECVCGPYNADFDGDEM  496



>ref|XP_002951663.1| hypothetical protein VOLCADRAFT_81566 [Volvox carteri f. nagariensis]
 gb|EFJ47114.1| hypothetical protein VOLCADRAFT_81566 [Volvox carteri f. nagariensis]
Length=1365

 Score =   441 bits (1135),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 230/454 (51%), Positives = 310/454 (68%), Gaps = 25/454 (6%)
 Frame = -3

Query  1329  PILNGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCIC  1150
             P  NG+LD R+G  NK   C TC     +C GH+GY+ L LPVF++GY    + IL+CIC
Sbjct  6     PHPNGVLDRRLGISNKNYVCETCGQRLADCAGHFGYIRLELPVFHIGYFKNTIQILQCIC  65

Query  1149  KGCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVN  970
             K CSR+LL E+ER  +L++ RN ++E +++  +F+++  RC      ++   C  CG  N
Sbjct  66    KTCSRVLLPEEERKIWLKRFRNPRVERVQRVFMFRKLNDRC------KRQKNCPHCGEYN  119

Query  969   GMVKK--GPLKIIHEYGSQFLDECHNAVSNKTKGSITVPPELDSKT-------VHSLFKK  817
               VKK  G LKIIHE  ++     + ++++  K +  + P L           V +LF+ 
Sbjct  120   ATVKKATGVLKIIHERYAK-----NESLADAIKYNDQLKPHLHRMADDLHPLRVRALFEN  174

Query  816   MIDEDCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSS  637
             + DED +LL +  +PE L+ T + VPP+AIRPSV +DG   SNE+DIT +L +II  N+ 
Sbjct  175   IPDEDLDLLDIQGRPEDLVTTHLAVPPVAIRPSVEMDG--SSNEDDITMKLMQIIDVNNV  232

Query  636   LRQEISDTTLPARSLA-SWVDLQMEVAQYINSDVRGLPPQMQA-SRPLSGFVQRLKGKQG  463
             LRQ + +  LP  +L  +W  LQ++ A  INSD+ GLP QMQ   RPL GFVQRLKGKQG
Sbjct  233   LRQGL-EKGLPINNLMENWDFLQVQCAMLINSDLPGLPAQMQMPGRPLRGFVQRLKGKQG  291

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I +V +P  MA +LT+PERV+RHNI+KLRQ V N
Sbjct  292   RFRGNLSGKRVDFSGRTVISPDPNLQIFQVCVPQHMAVVLTYPERVTRHNIDKLRQRVLN  351

Query  282   GPNKYPGAKYIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             G + +PGA ++  PDG +  L +  R++ A ELK G+IV+RHLEDGD VLFNRQPSLHR+
Sbjct  352   GISTWPGANFVVTPDGDKQFLKFGDRRKIAAELKVGHIVERHLEDGDVVLFNRQPSLHRI  411

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM  RA++  WRTLRFNE  C+P+NADFDGDEM
Sbjct  412   SIMAFRAKVRTWRTLRFNECACSPFNADFDGDEM  445



>ref|XP_007391616.1| hypothetical protein PHACADRAFT_169499 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59037.1| hypothetical protein PHACADRAFT_169499 [Phanerochaete carnosa 
HHB-10118-sp]
Length=1403

 Score =   442 bits (1136),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 232/499 (46%), Positives = 323/499 (65%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS F+  + +K AE EV +R +Y    + P+ NG+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLFNSQDTVKLAEFEVTHRDLYTATDRLPVKNGVLDRRLGTTEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ LA+PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLNSVDCVGHYAYIKLAVPVFHIGYFKHCITILQCICKSCARVLLEEPDRRSYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG-PLKIIHE--YGSQFL  913
               LE++++  L K V     A+   RK V C  C   NG VKK   LKIIH+     + +
Sbjct  129   PSLENIQRQALIKAV----NAL--ARKTVYCPYCASTNGAVKKASALKIIHDKFRAKKTV  182

Query  912   DECH-------NAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             DE         +A+  +   ++     V  EL+   V  LFK++ DEDCELL L     +
Sbjct  183   DEMEKWKKTFSSAIEAQKDLAMYVNRAVHEELNPLKVLDLFKRISDEDCELLGLRPEFAR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+AIRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++     A+ 
Sbjct  243   PEEYIWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAPTAQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ +A YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWDFLQLSIAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV++HN+E L++ +RNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTQHNLEILKKAIRNGCDVHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G IV+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ 
Sbjct  420   GFKKFLKFGNRNAIADGLRVGDIVERHIVDGDIVLFNRQPSLHKLSIMCHRVKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCGPYNADFDGDEM  498



>ref|XP_003026267.1| hypothetical protein SCHCODRAFT_71335 [Schizophyllum commune 
H4-8]
 gb|EFI91364.1| hypothetical protein SCHCODRAFT_71335 [Schizophyllum commune 
H4-8]
Length=1402

 Score =   441 bits (1134),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 231/497 (46%), Positives = 321/497 (65%), Gaps = 28/497 (6%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P+ IK +QFS F+  + +K +E E+ +R +Y    + P+ +G+LD R+G  +K+  C TC
Sbjct  10    PKVIKQLQFSLFNPQDTVKLSEFEITHRDLYTATDRLPVKDGVLDRRLGTTDKSAFCETC  69

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                   C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E ER  FL++ R +
Sbjct  70    GQSSVNCVGHYAYIKLCVPVFHIGYFKHTIGILQCICKTCARVLLEEPERRTFLKRFRRS  129

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--YGSQFLD  910
              LE++++  L K V       T+ RK V C  C   NG VKK G LKIIH+     +  D
Sbjct  130   NLENMQRQALTKAV------NTAARKVVYCPYCAATNGTVKKAGALKIIHDKFRSKKTAD  183

Query  909   ECH-------NAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLSDK---P  772
             E         +A+  + + +      V  +L+   V  LF+++ DEDCELL L  K   P
Sbjct  184   EMERWKRTFASAIEAQKELAQFLNKAVNEDLNPLKVLDLFRRISDEDCELLGLRPKFGRP  243

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             E+ L   I VPP+AIRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++      + +
Sbjct  244   EEFLWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAPTPQFM  301

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
               W  LQ+ VA YINS++ G+P Q    RP+ GFVQRLKGKQGRFRGNLSGKRV+++GRT
Sbjct  302   EQWEFLQLSVAMYINSELPGVPSQ-PGQRPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRT  360

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             VISPDPNL+I EVA+P  +A+ILT+PERV+ HN+E LR+ V NGP+ +PGA ++   +  
Sbjct  361   VISPDPNLRIDEVAVPERVAKILTYPERVTVHNMEGLRKAVLNGPDVHPGANFVARGENK  420

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
             +  L + +RK  A+ L  G +V+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ R 
Sbjct  421   KF-LKFGNRKAVAENLAIGDVVERHIIDGDIVLFNRQPSLHKLSIMCHRVKVRPWRSFRL  479

Query  51    NESVCNPYNADFDGDEM  1
             NE VC PYNADFDGDEM
Sbjct  480   NECVCGPYNADFDGDEM  496



>ref|XP_003284018.1| RNA polymerase III, largest subunit [Dictyostelium purpureum]
 gb|EGC39460.1| RNA polymerase III, largest subunit [Dictyostelium purpureum]
Length=1396

 Score =   441 bits (1134),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 229/491 (47%), Positives = 327/491 (67%), Gaps = 28/491 (6%)
 Frame = -3

Query  1419  IQFSTFSGSEVMKSAEVEVYRGVYYDASK-NPILNGLLDPRMGPPNKTKSCATCNGDFKE  1243
             IQF   S  ++++ + V++     +D  K  P   G+LD ++G  +K ++C TC     +
Sbjct  13    IQFGLLSEEDIVRLSHVQLVNRELFDLLKRKPQPYGVLDNKLGTSDKQQNCTTCGLSIVD  72

Query  1242  CPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLK  1063
             C GH+GY+ L LPVF++GYL  I++IL+ ICK CS ILL E+++  +LRKMRN KL++L+
Sbjct  73    CVGHFGYIKLQLPVFHIGYLKNIMNILQMICKNCSSILLDEEKKSTYLRKMRNKKLDNLQ  132

Query  1062  KNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQFLDECHNAV  892
             +  L K++   C      RK   C +C   NGM++K G  KIIHE   G Q   + + A+
Sbjct  133   RKSLLKKIFLDC------RKTKECFKCKSTNGMIRKSGAFKIIHEKYKGKQENLQEYYAL  186

Query  891   SNKTKGSITVPPELDSK-----------TVHSLFKKMIDEDCELLYLS---DKPEKLLVT  754
              ++   ++   PE+ S               +LFKK+  +D E++ ++    +PE+L++T
Sbjct  187   YDE---AVKYNPEMKSHIKKAQEDLNPLVALNLFKKISYQDIEIMNMNPIVGRPERLILT  243

Query  753   SIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVDL  574
              + VPP++IRPSV +DGG  +NE+D+T +L  II  N  +R  +    + +  +  W  L
Sbjct  244   YMLVPPVSIRPSVPMDGGSGTNEDDLTMKLSEIIHINEHIRTNVDRAEMYS-IMEDWDYL  302

Query  573   QMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDP  394
             Q   A YINSDV GLP QM+ ++P+ G  QRLKGK GRFRGNLSGKRV+++GRTVISPDP
Sbjct  303   QATCAIYINSDVPGLPLQMKPTKPVRGLSQRLKGKTGRFRGNLSGKRVDFSGRTVISPDP  362

Query  393   NLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLMY  214
             NL I EVA+P L+A  +T+PERVS +NIE+L++ V NGP+++PGA YI + DG +  L +
Sbjct  363   NLNIDEVAVPQLIALTMTYPERVSDYNIERLQKYVINGPDRHPGANYIIYQDGVKKWLKF  422

Query  213   SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCN  34
              +R++ A ELK G IV+RH+ DGD +LFNRQPSLH++SIM H+AR+MPWRTLRFNE VC 
Sbjct  423   GNREKFAAELKVGDIVERHIIDGDIMLFNRQPSLHKLSIMSHKARVMPWRTLRFNECVCT  482

Query  33    PYNADFDGDEM  1
             PYNADFDGDEM
Sbjct  483   PYNADFDGDEM  493



>gb|KDQ14148.1| hypothetical protein BOTBODRAFT_188045 [Botryobasidium botryosum 
FD-172 SS1]
Length=1403

 Score =   441 bits (1134),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 233/502 (46%), Positives = 318/502 (63%), Gaps = 27/502 (5%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             + D  P+KIK IQFS  S  +V++ +E EV +R +Y   ++ P+ +G+LD R+G  +K+ 
Sbjct  5     VVDNNPKKIKHIQFSLLSAQDVVRISEFEVTHRDLYTAENRAPVKDGVLDRRLGTVDKST  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
              C TC      C GHY Y+ L LPVF+VGY   ++ IL+ ICK C+R+LL E +R  FL+
Sbjct  65    FCETCGQPATTCVGHYAYIKLILPVFHVGYFKHVITILQDICKTCARVLLEESDRRRFLK  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--  925
             + RN KLE++ +  L K V   C      RK V C  C  +NG VKK G LKI+HE    
Sbjct  125   RFRNPKLENIARQALAKTVNTAC------RKQVYCPYCTAINGTVKKSGTLKIVHERFRA  178

Query  924   ---SQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKMIDEDCELLYLS--  781
                S   ++     SN       + P       +L+   V  LFK++  ED ELL L   
Sbjct  179   KKVSDEFEKWKGTFSNAVANQKELAPLLNKAHEDLNPLKVLELFKRISAEDAELLGLRPD  238

Query  780   -DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
               +PE+ +   + VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++  T  
Sbjct  239   FGRPEEYIWQYMSVPPVCIRPSVQQDGA--SNEDDLTVKLTEIVFTNALIKQALAKGTTT  296

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
                +  W  LQ+ VA YINS++ G+P      RP+ GF QRLKGKQGRFRGNLSGKRV+Y
Sbjct  297   QALMEQWEFLQISVAMYINSELPGVPAA-AGQRPIRGFCQRLKGKQGRFRGNLSGKRVDY  355

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             +GRTVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI +LR+ V  G + +PGA Y+  
Sbjct  356   SGRTVISPDPNLRIDEVAVPERVAKILTYPERVTPHNINRLREAVARGADVHPGANYLTF  415

Query  243   -PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
                G++  L +  R   A++++ G +V+RH+ DGD VLFNRQPSLH++SIMCHRA+I PW
Sbjct  416   TASGSKKFLRHEKRFEWAEQMRVGDLVERHIHDGDIVLFNRQPSLHKLSIMCHRAKIRPW  475

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             R+ R NE VCNPYNADFDGDEM
Sbjct  476   RSFRLNECVCNPYNADFDGDEM  497



>gb|EXX55206.1| Rpo31p [Rhizophagus irregularis DAOM 197198w]
Length=1415

 Score =   441 bits (1133),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 227/503 (45%), Positives = 323/503 (64%), Gaps = 29/503 (6%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPILNGLLDPRMGPPNKTKS  1273
             I +  PR+IK IQFS  S  E++K+A++ +     ++ ++ P+ NG+LD R+G  +    
Sbjct  5     ILEQAPRRIKHIQFSVLSPQEIVKNAQLAITHRDLFNDNRKPMENGVLDTRLGTSDHDTL  64

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC     +C GH+GY+ L LPVF++GY   ++++L+ ICK CSR+LL E +R  +L++
Sbjct  65    CQTCGEKMAQCIGHFGYVKLILPVFHIGYFKAVINMLQNICKTCSRVLLNEDDRRSYLKR  124

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQ  919
             +R ++ E   + +L K +   C      +K V C  CG +NG VKK G LKI+HE + S+
Sbjct  125   IRASR-ESSARQKLEKAINTLC------KKEVDCPHCGAINGSVKKVGALKIVHEKFKSK  177

Query  918   FLDECHNAVSNKTKGSITVPPEL-----------DSKTVHSLFKKMIDEDCELLYL---S  781
                E H    +    +I   P+L           ++  V  LFK++ D+DCELL L   +
Sbjct  178   KAHEEHEKFKSTFNNAIEYTPDLRPHLHKAQEDLNAMKVLDLFKRISDDDCELLGLDPQN  237

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPA  601
              +PE  +   +PVPP+AIRPS+  D    S E+D+T +L  I+Q N+++   ++      
Sbjct  238   ARPELFIWQRLPVPPVAIRPSIAQDNA--STEDDLTVKLSEIVQTNTNITAALTKGVTIT  295

Query  600   RSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYT  421
             + +  W  LQ+ +A YI+S++ GL   M   +P  G  QRLKGKQGRFRGNLSGKRV+++
Sbjct  296   QLMEQWDYLQLTIAMYIHSEMPGLG-NMAGIKPSRGLCQRLKGKQGRFRGNLSGKRVDFS  354

Query  420   GRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHP  241
             GRTVISPDPNL+I EVA+P L+A+ILT+PERV  HNI+KLRQCV NG + +PGA ++KH 
Sbjct  355   GRTVISPDPNLRIDEVAVPELVAKILTYPERVFAHNIDKLRQCVINGADVHPGANFVKHK  414

Query  240   DGTEISLMY---SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
              G +  L Y   +S+   A EL+ G +V+RHL D D VLFNRQPSLH++SIM H  R+ P
Sbjct  415   SGGKRFLKYADQASKDACAAELQIGDVVERHLRDDDVVLFNRQPSLHKLSIMAHYVRVKP  474

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRT RFNE VC+PYNADFDGDEM
Sbjct  475   WRTFRFNECVCSPYNADFDGDEM  497



>gb|EPB83498.1| DNA-directed RNA polymerase III subunit RPC1 [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=1392

 Score =   439 bits (1128),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 319/499 (64%), Gaps = 25/499 (5%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSC  1270
             D  P+KI+ IQF   S   ++K AE E+  R +Y   S+ PI  G+LD R+G   K  +C
Sbjct  7     DNTPKKIRYIQFGVLSPQNMVKIAEFEITQRDLYMPESRTPIKGGVLDLRLGTTMKDATC  66

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC    +EC GH+GY+ L LP+F++GY   +++IL+ ICK CSR++L E +R  +LR++
Sbjct  67    ETCGQKMQECAGHWGYIKLVLPIFHIGYFRPVINILQEICKTCSRVMLDESDRRMYLRRL  126

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQF  916
             R   L++L++N + K+V ++C      +K   C  C  VNG+VKK GP+KI H+ Y  + 
Sbjct  127   RAPGLDNLQRNRIIKQVNEKC------KKVTYCPHCNAVNGVVKKVGPMKITHDKYRLKR  180

Query  915   LDECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDCELLYLSD---  778
             +D          + +    PE           L+   V  LF+++  EDCELL LS+   
Sbjct  181   VDAEAEQFRKTFEAAAASMPEIKPHISKAQDDLNPLRVLRLFQRISPEDCELLGLSEEHG  240

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +P+PP  IRPSV  D    SNE+D+T +L  II  N+ +R  +        
Sbjct  241   RPEWYIWQYLPIPPSCIRPSVLQDDN-SSNEDDLTAKLTEIIFTNAIIRAGLERGVTVMN  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+  A YINS++ G+P    + +P  G  QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   LMEQWEFLQLAAAMYINSELPGVP-NANSGKPSRGLCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPN++I +VA+P  +A++LTFPERV+RHNI KLRQ V NGP  +PGA +++  +
Sbjct  359   RTVISPDPNMRIDQVAVPERVAKVLTFPERVNRHNIHKLRQNVINGPFVHPGANFVQGAN  418

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R+  A +L+ G +V+RHL D D VLFNRQPSLHR+SIM H A++MPWRT 
Sbjct  419   GFKRFLKFGNRQEIAADLQIGDLVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTF  478

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC+PYNADFDGDEM
Sbjct  479   RFNECVCSPYNADFDGDEM  497



>ref|XP_008613145.1| hypothetical protein SDRG_09014 [Saprolegnia diclina VS20]
 gb|EQC33505.1| hypothetical protein SDRG_09014 [Saprolegnia diclina VS20]
Length=1507

 Score =   440 bits (1132),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 326/512 (64%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S +++M+ +E+ V+ + ++   ++ P   G+LD R+G
Sbjct  16    LVKQFVLENDRPSKISHLNFGLLSSTDMMQMSEIPVHSKDLFTMPTREPAKFGVLDKRLG  75

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NKT  C TC+    +C GH+GY+NL LPVF++GY+   ++IL+ ICK CSR+LL    
Sbjct  76    ISNKTDECDTCHLKLSDCVGHFGYVNLELPVFHIGYIKATLEILQNICKECSRVLLAPDV  135

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  +LR+MR+   + LKK    K++   C      +K V C  C  +NG V+K     LK
Sbjct  136   REGYLRRMRDPTADALKKINTRKKISALC------KKVVRCPHCDGINGTVRKIACPTLK  189

Query  942   IIHE-YGSQFLDECHNAVSNKTKGSITVPPELDSK------------TVHSLFKKMIDED  802
             ++HE Y ++   +       +   +     E+ S              V  LFK++ D+D
Sbjct  190   LVHEKYRAKAAHDMRTVFVAQFAQAQAQNAEMTSALLAKAQEDLSPLVVQELFKRIPDQD  249

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             C+LL+++    +PEKL++ S+ VPP+ IRPSV +D G  SNE+D+T +L+ IIQ N +L+
Sbjct  250   CDLLWVNADVGRPEKLILNSLLVPPVCIRPSVAMDVGSGSNEDDLTVKLQEIIQVNFALQ  309

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
               +S        +  W  LQ++VAQ+IN D  GL     A +P+ G  QRLKGKQGRFRG
Sbjct  310   AALSKGATLKMVMEDWDFLQIQVAQFINGDTPGLTKLQGAPKPIRGLCQRLKGKQGRFRG  369

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++ RTVISPDPNL+I +V +P  +AR++T+PE+V+R+NI KLRQCV NGP  
Sbjct  370   NLSGKRVDFSARTVISPDPNLRIDQVGVPEHVARVMTYPEKVTRYNIAKLRQCVINGPAV  429

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA  I+  +G + +  LMY  R   AD+LK G +V+RH+ED D VLFNRQPSLH+MSI
Sbjct  430   HPGANAIR-IEGQKYTKNLMYGDRASLADDLKEGDVVERHMEDDDIVLFNRQPSLHKMSI  488

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M HRA+++ WRT RFNE VC+PYNADFDGDEM
Sbjct  489   MSHRAKVLQWRTFRFNECVCSPYNADFDGDEM  520



>emb|CCM03577.1| predicted protein [Fibroporia radiculosa]
Length=1403

 Score =   438 bits (1127),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 232/500 (46%), Positives = 321/500 (64%), Gaps = 30/500 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  E +K +E EV +R +Y    ++P+ NG+LD R+G   K+  C T
Sbjct  9     APKIIKKLQFSLLNNQEAVKLSEFEVTHRDLYTPVDRHPVKNGVLDRRLGTTEKSAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLSSVDCVGHYAYIRLTVPVFHIGYFKHTIAILQCICKTCARVLLEEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--YGSQFL  913
               LE++++  L K V       T  RKAV C  C   NG VKK G LKIIH+     +  
Sbjct  129   PNLENIQRQALSKAV------NTLARKAVYCPYCSSTNGTVKKAGALKIIHDKFRAKKTA  182

Query  912   DECHNAVSNKTKGSITVPPELD---SKTVH---------SLFKKMIDEDCELLYL---SD  778
             DE     +  T  ++    EL    +K VH         +LFK++ DEDCELL L     
Sbjct  183   DEMEKWKTTFT-SAVEAQKELGMYLNKAVHEDLNPLKVLNLFKRISDEDCELLGLRPAHG  241

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++     A+
Sbjct  242   RPEEYVWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAPTAQ  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   FMEQWDFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-P  241
             RTVISPDPNL+I EVA+P  +++ILT+PERV+ HNI+ L++ VRNG + +PGA Y+    
Sbjct  359   RTVISPDPNLRIDEVAVPERVSKILTYPERVTAHNIDMLKKAVRNGCDVHPGANYVTAGS  418

Query  240   DGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRT  61
             +G +  L + +R   AD L+ G +V+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+
Sbjct  419   NGFKKYLKFGNRNAIADGLRIGDVVERHIIDGDVVLFNRQPSLHKLSIMCHRVKVRPWRS  478

Query  60    LRFNESVCNPYNADFDGDEM  1
              R NE VC PYNADFDGDEM
Sbjct  479   FRLNECVCGPYNADFDGDEM  498



>ref|NP_595506.1| DNA-directed RNA polymerase III complex large subunit Rpc1 (predicted) 
[Schizosaccharomyces pombe 972h-]
 sp|O94666.1|RPC1_SCHPO RecName: Full=DNA-directed RNA polymerase III subunit rpc1; Short=RNA 
polymerase III subunit C1; AltName: Full=DNA-directed 
RNA polymerase III largest subunit; AltName: Full=RPC158 
[Schizosaccharomyces pombe 972h-]
 emb|CAB37604.1| DNA-directed RNA polymerase III complex large subunit Rpc1 (predicted) 
[Schizosaccharomyces pombe]
 gb|ABA54855.1| RNA polymerase III largest subunit Rpc1 [Schizosaccharomyces 
pombe]
Length=1405

 Score =   438 bits (1126),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 230/503 (46%), Positives = 320/503 (64%), Gaps = 27/503 (5%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYR-GVYYDASKNPILNGLLDPRMGPPNKTK  1276
             I+D  P++IK +QF      E +K   VEV R  +Y    ++P  +G LD  MG  NK  
Sbjct  5     IDDQIPKRIKHLQFGINGPEEFVKDGTVEVSRRDLYTMTDRSPAEHGALDLHMGTSNKQI  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +CATC     +C GH+GY+ LALPVF++GY    + IL+ ICK CS +LL ++E+  FL+
Sbjct  65    NCATCGESMADCMGHFGYVKLALPVFHIGYFKATLTILQNICKDCSSVLLSDQEKRQFLK  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE---Y  928
              +R   +++L+++++ KR+   C  M        CS+C  + G+VKK GPLKIIHE   Y
Sbjct  125   DLRRPGIDNLRRSQICKRINDHCKKMRR------CSKCDAMQGVVKKAGPLKIIHERFRY  178

Query  927   GSQFLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLS-  781
               +  D+  N   +  +   T+P           +L+   V +LFK++   DCELL +  
Sbjct  179   VRKSQDDEENFRHSFDEALKTIPELKMHLSKAHDDLNPLKVLNLFKQITPVDCELLGMDP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE LL   +P PP+ IRPSV  +G   + E+D+T ++  II  +S +R  +S  T 
Sbjct  239   EHGRPENLLWRYVPAPPVCIRPSVAQEGA--TTEDDLTVKITEIIWTSSLIRAALSKGTP  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              +  +  W  +Q+ +A YINS++ GL P    S+P+ GF QRLKGKQGRFRGNLSGKRV+
Sbjct  297   ISNLMEQWEFMQLSIAMYINSEMPGLRPSDMPSKPIRGFCQRLKGKQGRFRGNLSGKRVD  356

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY-I  250
             ++GRTVISPDPNL+I +VA+P  +A+ILTFPERV+  N + L+ C+RNGP+ +PGA Y I
Sbjct  357   FSGRTVISPDPNLRIDQVAVPYRIAKILTFPERVTTQNKKHLQDCIRNGPDVHPGANYVI  416

Query  249   KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                 G +  L + +R R AD+LK G IV+RHL D D VLFNRQPSLH++SIM H  ++ P
Sbjct  417   DRESGFKRFLRFGNRNRIADDLKIGDIVERHLHDNDVVLFNRQPSLHKLSIMAHLVKVRP  476

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRTLRFNE VC PYNADFDGDEM
Sbjct  477   WRTLRFNECVCGPYNADFDGDEM  499



>ref|XP_006959589.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Wallemia sebi CBS 633.66]
 gb|EIM20332.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Wallemia sebi CBS 633.66]
Length=1409

 Score =   437 bits (1125),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 233/503 (46%), Positives = 322/503 (64%), Gaps = 34/503 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDAS--KNPILNGLLDPRMGPPNKTKSCA  1267
              P++IK +QFST S  E++K +E EV     Y+ +  + P  NG+LD R G  +K+ SC 
Sbjct  9     APKRIKHVQFSTLSPQELVKISETEVTHNGLYNPTPDRAPQRNGVLDRRFGTSDKSGSCD  68

Query  1266  TCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMR  1087
             TC     EC GHYGY+ LALPVF++GY   I+ IL+ ICK C+R+LL E++R  +L++ R
Sbjct  69    TCGESMAECVGHYGYIKLALPVFHIGYFRDIIAILQDICKNCARVLLTEEQRRSYLKRFR  128

Query  1086  NTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-------  931
                LE+L++    K V   C      RK + C  C   NG+VKK G LKI+HE       
Sbjct  129   RPNLENLQRQTACKAVNTAC------RKNLYCPYCQSTNGVVKKTGLLKIVHEKFRAKKT  182

Query  930   YGSQFLDECHNAVSNKTKGSITVPPELDSKT-------VHSLFKKMIDEDCELLYLSDK-  775
              G Q   E  N  +     S  + P L+          V  LF ++ +EDCELL ++ K 
Sbjct  183   QGEQ--QEFVNTFNTAINMSKEIAPHLNKAQDDLNPLRVLDLFTRISNEDCELLGMNPKE  240

Query  774   --PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD-TTLP  604
               PE+ +   + VPP+ IRPSV  DG   +NE+DIT +L  I+Q +  ++  +S   +  
Sbjct  241   ARPEQYVWQYMHVPPVCIRPSVAQDGA--TNEDDITVKLGEIVQTSQIIKMGMSSGKSTT  298

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
             ++ +  W  LQ+  A YIN+++ G+P   +A++P+ GFVQRLKGKQGRFRGNLSGKRV++
Sbjct  299   SQLMEQWELLQLACAMYINAEMPGVPSD-KATKPIRGFVQRLKGKQGRFRGNLSGKRVDF  357

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH  244
             +GRTVI PDPNL + EVA+P  +A++LT+PERV  HNIE LRQ VRNGP+ +PGA Y+++
Sbjct  358   SGRTVIGPDPNLSVNEVAVPQRIAKVLTYPERVFEHNIESLRQAVRNGPDVHPGANYVQN  417

Query  243   P--DGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                +G +  L + +R+  A+ L+ G IV+RHL D D +LFNRQPSLHR+SIMCH  ++ P
Sbjct  418   GGVNGFKRFLKFGNREEIANRLRIGDIVERHLRDRDLILFNRQPSLHRLSIMCHYVKVRP  477

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRTLR NE  CNPYNADFDGDEM
Sbjct  478   WRTLRLNECACNPYNADFDGDEM  500



>ref|XP_007862648.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Gloeophyllum trabeum ATCC 11539]
 gb|EPQ59744.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Gloeophyllum trabeum ATCC 11539]
Length=1404

 Score =   437 bits (1124),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 230/499 (46%), Positives = 315/499 (63%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  +V+K +E EV +R +Y    + P+ NG+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLLNAQDVVKVSEFEVTHRDLYTATDRAPVKNGVLDRRLGTSEKNAYCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ L LPVF++GY    + IL+CICK C+R+LL E +R  FL++ R 
Sbjct  69    CGLNSVDCVGHYAYIKLVLPVFHIGYFKHTIGILQCICKTCARVLLEEPDRRTFLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--------  931
               LE+ ++  + K +       T  RKAV C  CG  NG VKK G LKIIH+        
Sbjct  129   PNLENYQRQGITKAL------NTLARKAVYCPHCGATNGTVKKAGALKIIHDKFRAKKTA  182

Query  930   -----YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
                  +   F              S  V  +L+   V  LFK++ DEDCELL L     +
Sbjct  183   EEMERWKRTFAPAVEAQKELGVYVSRAVHEDLNPLKVLDLFKRISDEDCELLGLRPEFGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ +++ ++      + 
Sbjct  243   PEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKKGLTTGAPTPQL  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             + SW  LQ+ VA YINS++ G+P Q    RP+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MESWEFLQLSVAMYINSELPGVPSQ-PGQRPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD-  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV++HN+E LR+ VRNG + +PGA Y+   + 
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTQHNLETLRKAVRNGCDVHPGANYVTAGNS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   A++L+ G +V+RH+ DGD VLFNRQPSLHR+SIM HR ++ PWR+ 
Sbjct  420   GFKKFLKFGNRAAIAEQLRIGDVVERHIVDGDIVLFNRQPSLHRLSIMSHRVKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCTPYNADFDGDEM  498



>ref|XP_007305513.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Stereum hirsutum FP-91666 SS1]
 gb|EIM85461.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Stereum hirsutum FP-91666 SS1]
Length=1404

 Score =   437 bits (1123),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 231/499 (46%), Positives = 321/499 (64%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFST +  +V+K +E +V +R +Y    + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKRLQFSTLNSQDVVKISEFQVTHRDLYTATDRVPVKDGVLDRRLGTSEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  F+++ R 
Sbjct  69    CGLNSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRRVFIKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------  934
               LE++++  +FK V        + RK V C  C   NG VKK G LKI+H         
Sbjct  129   PNLENVQRQAIFKAV------NGAARKTVYCPYCSATNGAVKKAGALKIVHDKFRAKKTA  182

Query  933   EYGSQFLDECHNAV-SNKTKGSI---TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             E   +F      AV + K  G      V  +L++  V  LFK++  EDCELL L    ++
Sbjct  183   EEMEKFKRSFAPAVEAQKELGQYINKAVMEDLNALKVLDLFKRISAEDCELLGLRPEYNR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ +RQ ++     A+ 
Sbjct  243   PEEFIWQYISVPPVCIRPSVQQDGA--SNEDDLTVKLTEIVFTNALIRQGLAKGAPTAQL  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ V  YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVGMYINSEMPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV+  NI++LR+ VRNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTGFNIDRLRKAVRNGCDVHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R+  AD L+ G IV+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ 
Sbjct  420   GFKKYLKFGNREGIADGLRTGDIVERHIIDGDIVLFNRQPSLHKLSIMCHRVKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VCNPYNADFDGDEM
Sbjct  480   RLNECVCNPYNADFDGDEM  498



>gb|KFH65268.1| DNA-directed RNA polymerase III subunit C1 [Mortierella verticillata 
NRRL 6337]
Length=1394

 Score =   437 bits (1123),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 228/498 (46%), Positives = 315/498 (63%), Gaps = 27/498 (5%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+KIK IQF   S  E++  +E EV  R +Y   ++ P+  G+LD R+G  +K  +C T
Sbjct  9     APKKIKHIQFGVLSPQEIVNVSEFEVTQRDLYTVENRQPVKYGMLDLRLGTSDKMATCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C    ++C GH+ ++ L LPVF++GY    + IL+CICK CSR++L EK+R  +LRK+R 
Sbjct  69    CGLKQQDCIGHFAHIKLCLPVFHIGYFRSAIVILQCICKTCSRVMLSEKDRRKYLRKLRA  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQFL  913
               LE+L +    + V   C      +K VIC  C  +NG VKK G L+I+HE     +  
Sbjct  129   PNLENLTRKSTLRAVNDTC------KKVVICPYCEGINGTVKKVGALRIVHEKFRAKKVA  182

Query  912   DECHNAVSNKTKGSITVP----------PELDSKTVHSLFKKMIDEDCELLYLS---DKP  772
             DE      +     +  P           +++   V +LFK + D+DCELL ++    +P
Sbjct  183   DEYEKFKESFNNAVVAAPDMRPHISKAHEDMNPLKVLNLFKAISDDDCELLGMNPDIGRP  242

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             E  L  +I VPP+ IRPSV  DG   SNE+DIT +L  +I  N+ ++  + +       +
Sbjct  243   EMYLWQNISVPPVCIRPSVQQDGA--SNEDDITVKLTEVIFTNAHMQAGLKEGIAIHNLM  300

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
               W  LQ+ VA YINS++ G+   MQ  +P+ GF QRLKGKQGRFRGNLSGKRV+++GRT
Sbjct  301   EQWDFLQLSVAMYINSELPGIS-NMQPGKPVRGFCQRLKGKQGRFRGNLSGKRVDFSGRT  359

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK-HPDG  235
             VISPDPNL+I +VA+P L+A+ LT+PERV+ HNIE+LR+ ++NG   +PGA Y+      
Sbjct  360   VISPDPNLRIDQVAVPELVAKNLTYPERVTSHNIERLRKAIQNGTEVHPGANYVTLGSSN  419

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              + SL +  R R A E++ G +V+RHL DGD VLFNRQPSLH++SIM H A+I PWRT R
Sbjct  420   MKKSLKFGDRARVAAEIQVGDLVERHLSDGDVVLFNRQPSLHKLSIMAHYAKIRPWRTFR  479

Query  54    FNESVCNPYNADFDGDEM  1
             FNE VCNPYNADFDGDEM
Sbjct  480   FNECVCNPYNADFDGDEM  497



>ref|XP_008874445.1| hypothetical protein H310_09988 [Aphanomyces invadans]
 gb|ETV97199.1| hypothetical protein H310_09988 [Aphanomyces invadans]
Length=1498

 Score =   437 bits (1125),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 323/512 (63%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S +++M+ +E+ ++ + ++   ++ P  NG+LD R+G
Sbjct  17    LVKQFVLENDRPSKISHLNFGLLSSTDMMRMSEIPIHSKDLFLMPTREPAPNGVLDKRLG  76

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK   C TC+    +C GH+GY+ L LPVF++GY+   ++IL+ ICK CSR+LLG   
Sbjct  77    VSNKVDDCETCHQKLSDCVGHFGYIQLELPVFHIGYIKATIEILQNICKSCSRVLLGGDV  136

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+MR+   + LKK    KR+   C      +K V C  C  +NG V+K     LK
Sbjct  137   RESFLRRMRDPSADALKKINTRKRISLLC------KKVVRCPHCDAINGTVRKVTSPTLK  190

Query  942   IIHE-YGSQFLDECHNAVSNKTKGSITVPPELDSK------------TVHSLFKKMIDED  802
             IIHE Y ++   +       +   +    P+L +              V  LF+++ D+D
Sbjct  191   IIHEKYRAKSAHDMRTVFVAQFAQAQAANPDLTNSLLSKAQEDLSPVVVQELFERIPDQD  250

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             C LL+L   + +PEKL++ ++ VPP+ IRPSV +D G  SNE+D+T +L+ IIQ N +L+
Sbjct  251   CPLLWLNAFAGRPEKLVLNAMLVPPVCIRPSVAMDVGSGSNEDDLTVKLQEIIQVNFALK  310

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
               +         +  W  LQ++VAQ++N D  GL     A +P+ G  QRLKGKQGRFRG
Sbjct  311   AALQKGATLKMVMEDWDFLQIQVAQFMNGDTPGLTKLQGAPKPIRGLCQRLKGKQGRFRG  370

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++ RTVISPDPNL+I +V +P  +A+ +T+PE+V+R+NI KLRQ V NGP  
Sbjct  371   NLSGKRVDFSARTVISPDPNLRIDQVGVPEHVAKTMTYPEKVTRYNIAKLRQRVINGPAV  430

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA  I+  +G + +  LMY  R   AD+LK G IV+RH+ED D VLFNRQPSLH+MSI
Sbjct  431   HPGANSIR-IEGQKYTKNLMYGDRASLADDLKEGDIVERHMEDDDIVLFNRQPSLHKMSI  489

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M HRA+++ WRT RFNE VC+PYNADFDGDEM
Sbjct  490   MSHRAKVLQWRTFRFNECVCSPYNADFDGDEM  521



>gb|EPS95906.1| hypothetical protein FOMPIDRAFT_151299 [Fomitopsis pinicola FP-58527 
SS1]
Length=1404

 Score =   436 bits (1121),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 231/508 (45%), Positives = 326/508 (64%), Gaps = 31/508 (6%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPP  1288
             K+P +    P+ IK +QFS  +  + +K +E EV +R +Y    ++P+ NG+LD R+G  
Sbjct  2     KEP-VSHQAPKVIKKLQFSLLNNQDTVKISEFEVTHRDLYTAVDRHPVKNGVLDRRLGTT  60

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K   C TC     +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R 
Sbjct  61    EKGAFCETCGLSSVDCVGHYAYIKLCVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRR  120

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTS-GRKAVICSRCGCVNGMVKK-GPLKIIH  934
              +L++ R   LE++++  L       C A+ +  RK V C  C   NG+VKK G LKIIH
Sbjct  121   TYLKRFRRPNLENIQRQAL-------CKAVNALARKTVYCPYCSSTNGIVKKAGALKIIH  173

Query  933   ---------EYGSQFLDECHNAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCEL  793
                      E   +F     +AV  + +  I     V  +L+   V +LF+++ DEDCEL
Sbjct  174   DKFRAKKTAEEMERFKATFASAVEAQKELGIYVNKAVHEDLNPLKVLNLFRRVSDEDCEL  233

Query  792   LYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L     +PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+ +N+ ++Q +
Sbjct  234   LGLRPQYGRPEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFSNALIKQGL  291

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
             +     A+ +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLS
Sbjct  292   AKGAPTAQFMEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLS  350

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI+ L++ +RNG + +PG
Sbjct  351   GKRVDFSGRTVISPDPNLRIDEVAVPERVAKILTYPERVTAHNIDMLKKAIRNGCDVHPG  410

Query  261   AKYIKH-PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y+    +G +  L + +R   AD L+ G IV+RH+ DGD VLFNRQPSLH++SIMCHR
Sbjct  411   ANYVTAGSNGFKKYLKFGNRAAIADGLRIGDIVERHVIDGDIVLFNRQPSLHKLSIMCHR  470

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
              ++ PWR+ R NE VC PYNADFDGDEM
Sbjct  471   VKVRPWRSFRLNECVCGPYNADFDGDEM  498



>emb|CBJ31607.1| RNA polymerase III, largest subunit [Ectocarpus siliculosus]
Length=1518

 Score =   437 bits (1124),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 227/507 (45%), Positives = 322/507 (64%), Gaps = 28/507 (6%)
 Frame = -3

Query  1449  EDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTKS  1273
             E   P++I  IQF      EV + +E +V+ R ++    +    NG LDPR+G  +KT  
Sbjct  55    ETHAPKRISHIQFGLLDAEEVERMSEFQVWSRELFKMPERIAAPNGCLDPRLGVSDKTAV  114

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC+    +C GHYG++ L LPVF++GY    + +L+CICK CSR+LL +  R+ +L++
Sbjct  115   CETCSKLLVDCAGHYGHIKLELPVFHIGYFKHTLTMLQCICKTCSRVLLHDASRVKYLKR  174

Query  1092  MRNTK-LEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK----GPLKIIHEY  928
             MRN + +  L++  L K++V  C   TS         C  VNG VKK      LK++H+ 
Sbjct  175   MRNPRGMGALERGNLHKKIVTECKKSTS----CFHESCYAVNGTVKKVTGSQTLKLVHDR  230

Query  927   G-----SQFLDECHNAVSNKTKGSITVP-------PELDSKTVHSLFKKMIDEDCELLYL  784
                      L E    +    + +  +P        +L +  V  LF++M DED ELL++
Sbjct  231   FKGKPPGNVLQELTADMKVAAQANREIPKHLGMAMEDLSALRVLHLFQRMTDEDAELLWM  290

Query  783   S---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDT  613
                  +PE L++ ++ VPP+ IRPSV +D G  SNE+D+T +L+ II  N S++  + + 
Sbjct  291   DARVGRPENLIIENLLVPPVPIRPSVAMDLGGGSNEDDLTVKLQEIIDVNVSVKAALDNG  350

Query  612   TLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKR  433
                   + +W  LQ+EVAQYIN ++ GLP  +Q ++P+ G  QRLKGK GRFRGNLSGKR
Sbjct  351   ANVKMIMENWDFLQLEVAQYINGEMPGLPRPIQTTKPIRGLCQRLKGKSGRFRGNLSGKR  410

Query  432   VEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY  253
             V+++ RTVISPDPNL++ +V +P  +A+I+TFPE VSR+NIEKLR+ VRNGP+ +PGA  
Sbjct  411   VDFSARTVISPDPNLRVDQVGVPERVAKIMTFPEMVSRYNIEKLRKVVRNGPDVHPGANQ  470

Query  252   IKHPDGTEIS---LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             ++   G        +   R++ ++ELK G IV+RH+EDGD VLFNRQPSLH+MSIM HRA
Sbjct  471   VRLDGGDGFVKKLFIEHVREQLSEELKIGDIVERHMEDGDVVLFNRQPSLHKMSIMSHRA  530

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             +IMPWRT RFNE VC+PYNADFDGDEM
Sbjct  531   KIMPWRTFRFNECVCSPYNADFDGDEM  557



>ref|XP_009268946.1| DNA-directed RNA polymerase III subunit rpc1 [Wallemia ichthyophaga 
EXF-994]
 gb|EOR00157.1| DNA-directed RNA polymerase III subunit rpc1 [Wallemia ichthyophaga 
EXF-994]
Length=1408

 Score =   436 bits (1120),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 230/501 (46%), Positives = 324/501 (65%), Gaps = 30/501 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDA-SKNPILNGLLDPRMGPPNKTKSCA  1267
              P++IK IQFST S  E++K +E EV + G+Y     + P  NG+LD R G  +K+ SC 
Sbjct  9     APKRIKHIQFSTLSPQELVKISETEVTHNGLYSQTPDRAPQRNGVLDRRFGTSDKSGSCD  68

Query  1266  TCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMR  1087
             TC     EC GHYGY+ LALPVF++GY   I+ IL+ ICK C+R+LL E +R  +L+K R
Sbjct  69    TCGESMAECVGHYGYIKLALPVFHIGYFRDIIAILQDICKNCARVLLTEDQRRSYLKKFR  128

Query  1086  NTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQFL  913
                +E+L++    K V   C      RK + C  C   NG+VKK G LKI+HE + ++  
Sbjct  129   RPNMENLQRQTTCKAVNTAC------RKQLYCPYCQSTNGVVKKTGLLKIVHEKFRAKKT  182

Query  912   DECHNAVSNKTKGSITVPPE-----------LDSKTVHSLFKKMIDEDCELLYLSDK---  775
                H    N    ++++  E           L+   V  LF ++ +EDCELL ++ K   
Sbjct  183   HVEHEEFVNTFNTAVSLSKEIAPHINKAQDDLNPLRVLDLFTRISNEDCELLGMNPKEAR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD-TTLPAR  598
             PE+ +   + VPP+ IRPSV  DG   +NE+DIT +L  I+Q +  ++  +    +  ++
Sbjct  243   PEQYVWQYMHVPPVCIRPSVAQDGA--TNEDDITVKLGEIVQTSQIIKIGMGGGKSTTSQ  300

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+  A YIN+++ G+P   +A++P+ GFVQRLKGKQGRFRGNLSGKRV+++G
Sbjct  301   LMEQWELLQLACAMYINAEMPGVPSD-KATKPIRGFVQRLKGKQGRFRGNLSGKRVDFSG  359

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHP-  241
             RTVI PDPNL + EVA+P  +A++LT+PERV  HNIE LR+ +RNGP+++PGA Y+++  
Sbjct  360   RTVIGPDPNLSVNEVAVPQRIAKVLTYPERVFEHNIEPLREAIRNGPDEHPGANYVQNGG  419

Query  240   -DGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
              +G +  L + +R+  A  L+ G IV+RHL DGD +LFNRQPSLHR+SIMCH  ++ PWR
Sbjct  420   VNGFKRFLKFGNREEIAKRLRIGDIVERHLRDGDLILFNRQPSLHRLSIMCHYVKVRPWR  479

Query  63    TLRFNESVCNPYNADFDGDEM  1
             TLR NE  CNPYNADFDGDEM
Sbjct  480   TLRLNECACNPYNADFDGDEM  500



>ref|XP_009544254.1| hypothetical protein HETIRDRAFT_473329 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW84605.1| hypothetical protein HETIRDRAFT_473329 [Heterobasidion irregulare 
TC 32-1]
Length=1403

 Score =   435 bits (1118),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 226/499 (45%), Positives = 314/499 (63%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QF T +   V+K +E +V +R +Y    + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKQLQFGTLNAQNVVKLSEFQVTHRDLYTPTDRQPVKDGVLDRRLGTSEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLKSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRRVYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--------  931
               LE++ +  L K V       TS RK V C  C   NG VKK G +KIIH+        
Sbjct  129   PNLENVHRQALNKAV------NTSARKVVYCPYCSATNGAVKKVGAMKIIHDKFRAKKTA  182

Query  930   -----YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
                  +   F+             +  V  +L+   V  LFK++ DEDCELL L    ++
Sbjct  183   EEMEKWKKTFIPAVEAQKELGMYINKAVHEDLNPLKVLDLFKRISDEDCELLGLRPAYNR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++      + 
Sbjct  243   PEEFVWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAPTPQL  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV+  NIEKL++ VRNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTTFNIEKLKKAVRNGCDVHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R + AD L++G +V+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ 
Sbjct  420   GFKKYLKFGNRAQIADGLRFGDVVERHIIDGDIVLFNRQPSLHKLSIMCHRVKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCGPYNADFDGDEM  498



>ref|XP_007364474.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Dichomitus squalens LYAD-421 SS1]
 gb|EJF63128.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Dichomitus squalens LYAD-421 SS1]
Length=1404

 Score =   435 bits (1118),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 230/499 (46%), Positives = 320/499 (64%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K AE EV +R +Y    + P+ NG+LD R+G   K+  C T
Sbjct  9     APKVIKKLQFSLLNNQDTVKLAEFEVTHRDLYTPIDRLPVKNGVLDRRLGTTEKSAYCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLNSVDCVGHYAYIKLVVPVFHIGYFKHTISILQCICKTCARVLLEEPDRRAYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQFLD  910
               LE+L++  L K V      +   RK V C  C   NG+VKK G LKIIH+ + ++   
Sbjct  129   PNLENLQRLNLCKAV------LALARKTVYCPYCSATNGVVKKAGALKIIHDKFRAKKTA  182

Query  909   ECHNAVSNKTKGSITVPPELD---SKTVHS---------LFKKMIDEDCELLYLS---DK  775
             E           ++    EL    +K VH          LFK++ +EDCELL L     +
Sbjct  183   EEMEKWKRTFGPAVEAQKELGMYINKAVHEDLNPLKVLDLFKRISNEDCELLGLRPEFGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+AIRPSV  DG   SNE+D+T +L  I+ +N+ ++Q +      A+ 
Sbjct  243   PEQFIWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFSNALIKQGLLKGAPTAQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI++L++ VRNG + +PGA Y+    +
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTAHNIDRLKKAVRNGCDVHPGANYVTAGSN  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G IV+RH+ DGD  LFNRQPSLH++SIMCHR ++ PWR+ 
Sbjct  420   GFKKYLKFGNRTAIADGLRVGDIVERHVIDGDIALFNRQPSLHKLSIMCHRIKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCGPYNADFDGDEM  498



>ref|XP_007333657.1| hypothetical protein AGABI1DRAFT_79519 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM75752.1| hypothetical protein AGABI1DRAFT_79519 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=1402

 Score =   435 bits (1118),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 226/497 (45%), Positives = 317/497 (64%), Gaps = 28/497 (6%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P+ IK +QFS  +  + +K +E E+ +R +Y    + P+ NG+LD R+G  +K   C TC
Sbjct  10    PKVIKKLQFSLLNAQDTVKISEFEITHRDLYTPVDRLPVQNGVLDRRLGTTDKNAFCETC  69

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                +  C GHY Y+ L +PVF++GY   I+ +L+ ICK C+R+LL E +R  F+++ R  
Sbjct  70    GQSYVHCVGHYAYIKLVVPVFHIGYFKHIISVLQAICKTCARVLLEEPDRRTFIKRFRRP  129

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------E  931
              LE++++  L K V        + RK V C  C  +NG VKK G LKIIH         E
Sbjct  130   NLENIQRQALSKSV------NATARKVVHCPYCSAINGTVKKAGALKIIHDKFRAKKTAE  183

Query  930   YGSQFLDECHNAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DKP  772
                ++      AV  + + S+        EL+   V  LF+++ DEDCELL L     +P
Sbjct  184   EMEKWKKTFTKAVEAQKELSMYLNKAAHEELNPLKVLDLFRRVSDEDCELLGLQPAWGRP  243

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             E+ +   + VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ +++ +   +   + +
Sbjct  244   EEFVWQYLSVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKKGLLRGSPTPQFM  301

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
               W  LQ+ VA Y+NS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GRT
Sbjct  302   EQWDFLQLSVAMYVNSELPGVPSQ-PGQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRT  360

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             VISPDPNL+I EVA+P  +A+ILT+PERV+ HNIE LR+ VRNGP+ +PGA Y+   +  
Sbjct  361   VISPDPNLRIDEVAVPERVAKILTYPERVTPHNIEMLRKAVRNGPDVHPGANYVSRAETK  420

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
             +I L + +R   AD L  G +V+R + DGD VLFNRQPSLH++SIMCHRA++ PWRT R 
Sbjct  421   KI-LRFPNRNSIADGLAVGDVVERQIIDGDIVLFNRQPSLHKLSIMCHRAKVRPWRTFRL  479

Query  51    NESVCNPYNADFDGDEM  1
             NE VC PYNADFDGDEM
Sbjct  480   NECVCGPYNADFDGDEM  496



>ref|XP_008035936.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Trametes versicolor FP-101664 SS1]
 gb|EIW62320.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Trametes versicolor FP-101664 SS1]
Length=1403

 Score =   434 bits (1117),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 233/507 (46%), Positives = 325/507 (64%), Gaps = 29/507 (6%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPP  1288
             K+P +    P+ IK++QFS  +  + +K AE EV +R +Y    + P+ NG+LD R+G  
Sbjct  2     KEP-VSHQAPKVIKALQFSLLNNQDTVKLAEFEVTHRDLYTPIDRLPVKNGVLDRRLGTT  60

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K+  C TC  +  +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R 
Sbjct  61    EKSAFCETCGLNSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRR  120

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              +L++ R   LE+L++  L    VK   A+   RK V C  C   NG VKK G LKIIH+
Sbjct  121   SYLKRFRRPNLENLQRMTL----VKSVNAL--ARKTVYCPYCAATNGTVKKAGALKIIHD  174

Query  930   -YGSQFLDECHNAVSNKTKGSITVPPELD---SKTVHS---------LFKKMIDEDCELL  790
              + ++   E           +I    EL    +K +H          LFK++ DEDCELL
Sbjct  175   KFRAKKTAEEMEKWKRTFAPAIEAQKELGMYVNKAIHEDLNPLKVLDLFKRISDEDCELL  234

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              L     +PE+ +   I VPP+AIRPSV  DG   SNE+D+T +L  I+ +N+ ++Q + 
Sbjct  235   GLRPEYGRPEQYIWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFSNALIKQGLV  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                  A+ +  W  LQ+ VA YINS++ G+P Q+   +P+ GF QRLKGKQGRFRGNLSG
Sbjct  293   KGAPTAQFMEQWEFLQLSVAMYINSELPGVPSQL-GQKPIRGFCQRLKGKQGRFRGNLSG  351

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI++L++ VRNG + +PGA
Sbjct  352   KRVDFSGRTVISPDPNLRIDEVAVPERVAKILTYPERVTGHNIDRLKKAVRNGCDVHPGA  411

Query  258   KYIKH-PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
              Y+    +G +  L + +R   AD L+ G IV+RH+ DGD  LFNRQPSLH++SIMCHR 
Sbjct  412   NYVTAGSNGFKKYLKFGNRTAIADGLRIGDIVERHVIDGDIALFNRQPSLHKLSIMCHRI  471

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++ PWR+ R NE VC PYNADFDGDEM
Sbjct  472   KVRPWRSFRLNECVCGPYNADFDGDEM  498



>ref|XP_009832829.1| hypothetical protein H257_08583 [Aphanomyces astaci]
 gb|ETV77719.1| hypothetical protein H257_08583 [Aphanomyces astaci]
Length=1500

 Score =   436 bits (1121),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 325/512 (63%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMG  1294
               KQ  +E+  P KI  + F   S +++M+ +EV ++ + ++   ++ P  NG+LD R+G
Sbjct  17    LVKQFVLENDRPSKISHLNFGMLSATDMMRMSEVPIHSKDLFIMPTREPAPNGVLDKRLG  76

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
               NK+  C TC+    +C GH+GY+ L LPVF++GY+   ++IL+ ICK CSR+LLG   
Sbjct  77    VSNKSDDCETCHQKLTDCVGHFGYIQLELPVFHIGYIKATIEILQNICKSCSRVLLGGDV  136

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLK  943
             R  FLR+M++   + LKK    KR+   C      +K V C  C  +NG V+K     LK
Sbjct  137   RESFLRRMKDPTADALKKINTRKRISLLC------KKVVRCPHCDAINGTVRKIASPTLK  190

Query  942   IIHE-YGSQFLDECHNAV-----------SNKTKGSITVPPE-LDSKTVHSLFKKMIDED  802
             IIHE + ++   +                S+ T   ++   E L    V  LF+++ D+D
Sbjct  191   IIHEKFRAKSAHDMRTVFVAQFAQAQAANSDLTNALLSKAQEDLSPVVVQELFERIPDQD  250

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             C LL+L   + +PEKL++ ++ VPP+ IRPSV +D G  SNE+D+T +L+ IIQ N +L+
Sbjct  251   CALLWLNAFAGRPEKLVMNAMLVPPVCIRPSVAMDVGSGSNEDDLTVKLQEIIQVNFALK  310

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
               +         +  W  LQ++VAQ++N D  GL     A +P+ G  QRLKGKQGRFRG
Sbjct  311   AALQKGATLKMVMEDWDFLQIQVAQFMNGDTPGLTKLQGAPKPIRGLCQRLKGKQGRFRG  370

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++ RTVISPDPNL+I +V +P  +AR +T+PE+V+R+NI KLRQ V NGP  
Sbjct  371   NLSGKRVDFSARTVISPDPNLRIDQVGVPEHVARTMTYPEKVTRYNIAKLRQRVINGPAV  430

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA  I+  +G + +  LMY  R   AD+LK G +V+RH+ED D VLFNRQPSLH+MSI
Sbjct  431   HPGANSIR-IEGQKYTKNLMYGDRASLADDLKEGDVVERHMEDDDIVLFNRQPSLHKMSI  489

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M HRA+++ WRT RFNE VC+PYNADFDGDEM
Sbjct  490   MSHRAKVLQWRTFRFNECVCSPYNADFDGDEM  521



>ref|XP_006459816.1| hypothetical protein AGABI2DRAFT_202225 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV47947.1| hypothetical protein AGABI2DRAFT_202225 [Agaricus bisporus var. 
bisporus H97]
Length=1402

 Score =   434 bits (1117),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 226/497 (45%), Positives = 317/497 (64%), Gaps = 28/497 (6%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P+ IK +QFS  +  + +K +E E+ +R +Y    + P+ NG+LD R+G  +K   C TC
Sbjct  10    PKVIKKLQFSLLNAQDTVKISEFEITHRDLYTPVDRLPVQNGVLDRRLGTTDKNAFCETC  69

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                +  C GHY Y+ L +PVF++GY   I+ +L+ ICK C+R+LL E +R  F+++ R  
Sbjct  70    GQSYVHCVGHYAYIKLVVPVFHIGYFKHIISVLQAICKTCARVLLEEPDRRTFIKRFRRP  129

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------E  931
              LE++++  L K V        + RK V C  C  +NG VKK G LKIIH         E
Sbjct  130   NLENIQRQALSKSV------NATARKVVHCPYCSAINGTVKKAGALKIIHDKFRAKKTAE  183

Query  930   YGSQFLDECHNAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DKP  772
                ++      AV  + + S+        EL+   V  LF+++ DEDCELL L     +P
Sbjct  184   EMEKWKKTFTKAVEAQKELSMYLNKAAHEELNPLKVLDLFRRVSDEDCELLGLQPAWGRP  243

Query  771   EKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSL  592
             E+ +   + VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ +++ +   +   + +
Sbjct  244   EEFVWQYLSVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKKGLLRGSPTPQFM  301

Query  591   ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRT  412
               W  LQ+ VA Y+NS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GRT
Sbjct  302   EQWDFLQLSVAMYVNSELPGVPSQ-PGQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGRT  360

Query  411   VISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGT  232
             VISPDPNL+I EVA+P  +A+ILT+PERV+ HNIE LR+ VRNGP+ +PGA Y+   +  
Sbjct  361   VISPDPNLRIDEVAVPERVAKILTYPERVTPHNIEMLRKAVRNGPDVHPGANYVSRAETK  420

Query  231   EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
             +I L + +R   AD L  G +V+R + DGD VLFNRQPSLH++SIMCHRA++ PWRT R 
Sbjct  421   KI-LRFPNRNSIADGLAVGDVVERQIIDGDIVLFNRQPSLHKLSIMCHRAKVRPWRTFRL  479

Query  51    NESVCNPYNADFDGDEM  1
             NE VC PYNADFDGDEM
Sbjct  480   NECVCGPYNADFDGDEM  496



>emb|CDH60837.1| beta and beta-prime subunits of dna dependentrna-polymerase [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=1394

 Score =   434 bits (1116),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 227/502 (45%), Positives = 319/502 (64%), Gaps = 26/502 (5%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             + D  P+KI+ IQF   S   ++K  E+EV  R +Y   S+ P+  G+LD RMG  NK  
Sbjct  5     VYDNTPKKIRHIQFGVMSPQNMVKIGELEVTQRDLYQPESRTPVKGGVLDLRMGTSNKQS  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +C TC    ++C GH+GY+ L LP+F++GY    ++IL+ ICK CSR++L E ER  +L+
Sbjct  65    TCETCGKGMQDCAGHWGYMKLVLPIFHIGYFRATINILQDICKTCSRVMLEEPERRMYLK  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--  925
             ++R   L+++++ ++ K + ++C      +K   C  C  VNG+VKK GP+KI H+    
Sbjct  125   RLRAPGLDNMQRMKIVKAINEKC------KKVTYCPHCKEVNGVVKKIGPMKITHDKYRL  178

Query  924   SQFLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD-  778
              +   E        +  + T+P           +L+   V  LF+K+  EDCELL LS+ 
Sbjct  179   KRVAAEAEEFRKTFSTAAATMPELKPHISKAQDDLNPLRVLRLFQKVTPEDCELLGLSEE  238

Query  777   --KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLP  604
               +PE  +   +PVPP  IRPSV  D    SNE+D+T +L  I+  N+ +R  +      
Sbjct  239   HGRPEWYIWQYLPVPPACIRPSVMQDDN-TSNEDDLTAKLTEIVFTNAIIRAGLEKGITV  297

Query  603   ARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEY  424
                +  W  LQ+  A YINS++ G+P   Q  +P  G  QRLKGKQGRFRGNLSGKRV++
Sbjct  298   MNLMEQWEFLQLAAAMYINSELPGVPNANQG-KPSRGLSQRLKGKQGRFRGNLSGKRVDF  356

Query  423   TGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK-  247
             +GRTVISPDPN++I +VA+P  +A+ILTFPERV++HNI KLRQ + NGP+ +PGA Y++ 
Sbjct  357   SGRTVISPDPNMRIDQVAVPERVAKILTFPERVNKHNIHKLRQNIINGPDVHPGANYVQS  416

Query  246   HPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPW  67
                G +  L + +R+R A +LK G  V+RHL D D VLFNRQPSLHR+SIM H A++MPW
Sbjct  417   QHGGFKKYLRFGNRERIASDLKIGDTVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPW  476

Query  66    RTLRFNESVCNPYNADFDGDEM  1
             RT RFNE VC+PYNADFDGDEM
Sbjct  477   RTFRFNECVCSPYNADFDGDEM  498



>ref|XP_007349199.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Auricularia delicata TFB-10046 SS5]
 gb|EJD42702.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Auricularia delicata TFB-10046 SS5]
Length=1404

 Score =   434 bits (1116),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 233/503 (46%), Positives = 314/503 (62%), Gaps = 28/503 (6%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             +    P+ +  IQFS  +  ++++ +E EV +R +Y      P  NG LD R+G   K  
Sbjct  5     VSHAAPKVVTKIQFSLLNPQQIVQLSEFEVTHRDLYIPEDHVPAKNGPLDRRLGTVEKNT  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +C TC    ++C GHY Y+ L LPVF+VGY    ++IL+ ICK C+R++L E ER  +L 
Sbjct  65    TCETCGHPTQDCVGHYAYIKLMLPVFHVGYFRHTINILQQICKTCARVMLSESERRTYLA  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG-PLKIIHE----  931
             + R   LE+L++  L K V   C      RK ++C  C  +NG VKKG  LKI+H+    
Sbjct  125   RFRRPGLENLQRLTLCKAVNTLC------RKVIVCPYCASINGTVKKGGTLKIVHDKYRA  178

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYLS-  781
                      + S F           T  S  V  EL+   V  LFK++ DEDCELL +  
Sbjct  179   KKTADEMEKFKSTFKSAVEFQKDLGTYLSKAVIEELNPLKVLDLFKRISDEDCELLGMKP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE  L   I VPP+ IRPSV  DGG  SNE+D+T +L  I+ +N+ ++Q I     
Sbjct  239   VHGRPEHYLWQYISVPPVCIRPSVAQDGG--SNEDDLTVKLAEIVFSNTLIKQGIQKGAP  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
               + +  W  LQ+ VA YINS++ GL  Q    RP+ GF QRLKGKQGRFRGNLSGKRV+
Sbjct  297   IQQLMEQWEFLQISVAVYINSEMPGLQNQPN-QRPIRGFCQRLKGKQGRFRGNLSGKRVD  355

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY-I  250
             ++GRTVISPDPNL+I EVA+P  +A+ILT+PERV+  N+EKLR  VRNGP+ +PGA Y +
Sbjct  356   FSGRTVISPDPNLRIDEVAVPQRVAKILTYPERVTSSNLEKLRLAVRNGPDVHPGANYVV  415

Query  249   KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                +G +  L + +R   AD+L+ G +V+RH+ DGD +LFNRQPSLH++SIMCHRA++ P
Sbjct  416   AASNGFKKFLKFGNRDDVADKLRVGDVVERHVIDGDIILFNRQPSLHKLSIMCHRAKVRP  475

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRT R NE VC PYNADFDGDEM
Sbjct  476   WRTFRLNECVCTPYNADFDGDEM  498



>ref|XP_002559913.1| Pc13g15170 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP92586.1| Pc13g15170 [Penicillium rubens Wisconsin 54-1255]
Length=1448

 Score =   434 bits (1117),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 237/512 (46%), Positives = 322/512 (63%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYD--ASKNPILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   +  +++  A VEV    ++D   ++  + NG LDPRMG  NKT S
Sbjct  18    DSVPKVIKELKFGVLTNDDIVGQAVVEVSDRKFFDLDQTRTVVSNGPLDPRMGISNKTDS  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATC  + K+C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  +LR+
Sbjct  78    CATCGNNLKDCNGHFGHVRLVLPSFHVGYFKRVISILQEICKECSNILLPEAERRTYLRE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHE---  931
             MR   L++L++ ++ KR+ +RC      RK   C+ CG +NG+VKK     LKI H+   
Sbjct  138   MRRPGLDNLRRTQIAKRINERC------RKTRECTYCGAINGVVKKTGTSALKITHDKFR  191

Query  930   ------------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                               + + FL E   A     K       +++   V  LFKKM D 
Sbjct  192   AFNASVSVKKQTPISKDVFDNSFL-EARGANPEVEKHFKKAQDDMNPLRVLKLFKKMSDS  250

Query  804   DCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             DCEL+ ++ K   PE  L   IP PP+ IRPSV  DG   S E+D+T +L  I+Q+N +L
Sbjct  251   DCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGA--STEDDLTAKLGDIVQSNINL  308

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             +  +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFR
Sbjct  309   KNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q + NG N
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPELVTRYNKEKLQQRICNGSN  427

Query  273   KYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             K+PGA  I K   G    L YS+ +R AD+L+ G +V+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   KWPGANLIVKKGTGFRQMLKYSNTQRMADQLQEGDLVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H A+I P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFAKIRPHRTFRLNECVCNPYNADFDGDEM  519



>emb|CCA67009.1| probable RPO31-DNA-directed RNA polymerase III, 160 KD subunit 
[Piriformospora indica DSM 11827]
Length=1371

 Score =   433 bits (1114),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 243/503 (48%), Positives = 318/503 (63%), Gaps = 29/503 (6%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             ++   P+ IK +QFS  S  +++K  E EV +R +Y  A + P  NG+LD R+G   K+ 
Sbjct  5     VQHTHPKVIKQLQFSLLSAQDIVKLGEFEVTHRDLYTPADRLPSQNGVLDRRLGTTEKSA  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +C TC  +  +C GH+ Y+ LALPVF++GY   I+ IL+CICK C+R++L E  R  FLR
Sbjct  65    NCETCGLNTVDCVGHFAYMKLALPVFHIGYFRHILTILQCICKTCARVMLTESARRAFLR  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP-LKIIHEYGSQ  919
             + R   LE+L +  L K+V      +   RK   C  CG +NG VKK   LKI+HE   Q
Sbjct  125   RFRRPTLENLARQSLCKQV------LAISRKVNTCQHCGAINGTVKKAAALKIVHERFRQ  178

Query  918   -----FLDECHNAVSNKTKG--------SITVPPELDSKTVHSLFKKMIDEDCELLYLS-  781
                    ++   + SN  K         SI    EL+   V  LFK+M  EDCEL+ +  
Sbjct  179   KKLTEEAEKWRQSFSNAIKVQNDLDRALSIKGAEELNPLKVLDLFKRMTAEDCELVGMKP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE  L   I VPP+AIRPSV  DG   SNE+D+T +L  I   NS ++Q ++ +T 
Sbjct  239   SHSRPEHYLWQYIAVPPVAIRPSVNQDGA--SNEDDLTTKLSEIAFGNSLIKQSLNKSTN  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              ++ +  W  LQ  VA YINSD  G+  Q   S+PL GF QRLKGKQGRFRGNLSGKRV+
Sbjct  297   TSKLMELWEFLQHSVALYINSDAPGI--QQSDSKPLRGFCQRLKGKQGRFRGNLSGKRVD  354

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             ++GRTVISPDPNL+I EVAIP  +ARILT+P +V+ HN+E+LRQ V  GP+K  GA +++
Sbjct  355   FSGRTVISPDPNLRIDEVAIPEKVARILTYPAKVTVHNLEQLRQAVLRGPDKPGGANFVQ  414

Query  246   H-PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                 G +  L Y+     A +L+ G IV+RHL DGD VLFNRQPSLHR+SIMCHRA+I P
Sbjct  415   SGTSGFKKFLKYADPLDVAKKLRIGDIVERHLIDGDIVLFNRQPSLHRLSIMCHRAKIRP  474

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRT R NE VC PYNADFDGDEM
Sbjct  475   WRTFRLNECVCGPYNADFDGDEM  497



>ref|XP_007268076.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Fomitiporia mediterranea MF3/22]
 gb|EJD00799.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Fomitiporia mediterranea MF3/22]
Length=1403

 Score =   433 bits (1114),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 228/499 (46%), Positives = 318/499 (64%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK IQFS  +  +++K +E +V ++ +Y    + P+ +G+LD R+G   K+  C T
Sbjct  9     APKVIKQIQFSLLNAQDIVKLSEFQVTHQDLYTPVDRVPVRDGVLDRRLGTTEKSAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ LALPVF+VGYL  IV IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLSSADCVGHYAYIKLALPVFHVGYLKHIVTILQCICKSCARVLLSEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY-----GS  922
               LE++ +  L K +       +S RK V C  C   NG VKK G +KI+H+       +
Sbjct  129   PHLENIHRTSLVKSI------NSSARKVVYCPYCSSTNGTVKKAGAIKIVHDKFRAKKTA  182

Query  921   QFLDECHNAVSNKTKG--------SITVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
               L+    + +   +G        +  V  +L+   V  LF+++ DEDCELL L+    +
Sbjct  183   DELERFKRSFAKAIEGQKEIGMYINKAVQEDLNPLKVLDLFRRISDEDCELLGLNPSHGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  ++ ++Q ++      + 
Sbjct  243   PEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTSALIKQGLAKGAPTQQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS+  G+P QM A +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWDFLQVSVAIYINSETPGIPIQM-AQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVAIP  +A+ILT+PERV+ HN+  LR  VRNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAIPERVAKILTYPERVTAHNVNVLRYAVRNGCDVHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G +V+RHL DGD VLFNRQPSLH++SIMCHR ++ PWR+ 
Sbjct  420   GFKKFLKFGNRNAIADGLRIGDVVERHLIDGDVVLFNRQPSLHKLSIMCHRVKVRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PY ADFDGDEM
Sbjct  480   RLNECVCGPYGADFDGDEM  498



>ref|XP_004256178.1| DNA-directed RNA polymerase III subunit RPC1, putative [Entamoeba 
invadens IP1]
 gb|ELP89407.1| DNA-directed RNA polymerase III subunit RPC1, putative [Entamoeba 
invadens IP1]
Length=1381

 Score =   432 bits (1112),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 221/497 (44%), Positives = 322/497 (65%), Gaps = 26/497 (5%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYR-GVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P KI +IQF+ F  +++ +  E EV +  ++   S+ P  +G+LD R+G  +   +C TC
Sbjct  35    PSKITTIQFTMFDKTQMNRIGEFEVNQPNLFVIGSRQPNPDGVLDRRLGVCDSVNTCKTC  94

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
               +  EC GH+G +NLALPVF++G+   I+ +L+C+CK C+R+LL ++ER  +L++MRN 
Sbjct  95    GKNVDECCGHFGEINLALPVFHIGFFRPIIQVLQCVCKNCNRLLLTDEEREYYLKRMRNK  154

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE---------  931
               + +++  L + ++ +C    +G     C  C  +NG V+K G +K++H+         
Sbjct  155   TTDTIQRTMLVRALIVQCRKHYNG-----CPHCNAINGSVRKYGNIKLVHDKYHKDPNLN  209

Query  930   YGSQFLDECHNAVS-NKTKGSI--TVPPELDSKTVHSLFKKMIDEDCELLYLSDK--PEK  766
               ++F D    ++  +K  G+       +LD   V ++FK ++ ED E +  S    PEK
Sbjct  210   EMNEFYDGFDESIKMDKEIGAFLGNAQEDLDPLRVLNIFKSLVREDIEAMDFSPDAPPEK  269

Query  765   LLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLAS  586
             L++TS+PVPP+ IRPSV +DGG  SNE+D+T +LK +++ N+ +   +     P +   +
Sbjct  270   LILTSVPVPPLTIRPSVSMDGGNASNEDDLTTQLKEVVECNTKIIALMEKGYSPYQFYEA  329

Query  585   WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVI  406
             W  L + V+  INSD   LP   +  +PL    QRLKGK GRFRGNL GKRV+++GRTVI
Sbjct  330   WDQLTVAVSLIINSD---LPMCEEKGKPLRSLCQRLKGKHGRFRGNLLGKRVDFSGRTVI  386

Query  405   SPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEI  226
             SPDPNL + ++ +P LMA  LT+PERV+R+NIEK+RQ VRNGP+ YPG   I   DG   
Sbjct  387   SPDPNLDVEQLGVPQLMAITLTYPERVTRYNIEKMRQLVRNGPDTYPGCNGIIMIDGNRR  446

Query  225   SLMY--SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRF  52
             S+M     R++ A EL+ G IV+RHLEDGD VLFNRQPSLHR+SIMCH A+++PWRT+RF
Sbjct  447   SMMIKPEMREKFAKELRIGEIVERHLEDGDIVLFNRQPSLHRISIMCHIAKVLPWRTMRF  506

Query  51    NESVCNPYNADFDGDEM  1
             NE VC PYNADFDGDEM
Sbjct  507   NECVCTPYNADFDGDEM  523



>ref|XP_007441426.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like, 
partial [Python bivittatus]
Length=636

 Score =   414 bits (1064),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 234/512 (46%), Positives = 313/512 (61%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               KQ + E    +KI  I F   S  E+ + A ++V     Y  D + +P+L G+LD RM
Sbjct  1     MVKQQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHSPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  EC GHYGY++L LP F+VGY   ++ IL+ ICK C RILL  +
Sbjct  61    GTSEKDRPCETCGKNLAECLGHYGYIDLELPCFHVGYFKAVIGILQMICKTCCRILLTSE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K+V ++C      RK   C  CG  NG VKK G LKI
Sbjct  121   EQKQFLDYLKRPGLTYLQKRGLKKKVSEKC------RKKNTCPHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVS-NKTKGSI--TVPPELDSKTVHSLFKKMIDED  802
             IHE             S F+     A+  NK   S+       L+   V ++ K++  ED
Sbjct  175   IHEKYKTTKKIVDPIVSNFIQSFDTAIEHNKEIESLLGKAQENLNPLVVLNILKRIPAED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   S KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   IPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  +R+ VRNGP  
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANIGFMRKLVRNGPEV  414

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH++SI
Sbjct  415   HPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDIVLFNRQPSLHKLSI  473

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  474   MAHIARVKPHRTFRFNECVCTPYNADFDGDEM  505



>emb|CEG69560.1| Putative DNA-directed RNA polymerase [Rhizopus microsporus]
Length=1392

 Score =   432 bits (1111),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 319/499 (64%), Gaps = 25/499 (5%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSC  1270
             D  P+KI+ +QF   S   ++K AE EV  R +Y   S+ P+  G+LD R+G   K   C
Sbjct  7     DNTPKKIRYLQFGVLSPQNMVKIAEFEVTQRDLYKPESRIPVRGGVLDLRLGTTLKDAVC  66

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC    +EC GH+GY+ L LP+F+VGY   +++IL+ ICK CSR++L E +R  +LR++
Sbjct  67    ETCGQKMQECAGHWGYVKLVLPIFHVGYFRPVINILQEICKTCSRVMLEEADRRMYLRRL  126

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--SQ  919
             R   L++L++N + K++ ++C      +K   C  C  VNG+VKK GPLKI H+     +
Sbjct  127   RAPGLDNLQRNRVLKQIQEKC------KKVTYCMHCNAVNGVVKKVGPLKITHDKYRLKR  180

Query  918   FLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD---  778
               DE      +    + ++P           +L+   V  LF+++  EDCELL LS+   
Sbjct  181   VADEAEQFRKSFETAAASMPELKPHLSKAQDDLNPLRVLRLFQRISPEDCELLGLSEEHG  240

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +PVPP  IRPSV V     SNE+D+T +L  II  N+ +R  +      + 
Sbjct  241   RPEWYIWQYLPVPPSCIRPSV-VQEDNTSNEDDLTAKLTEIIFTNAIIRAGLERGVAVST  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+  A YINS++ G+     A +P  G  QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   LMEQWEFLQLAAALYINSELPGVL-NANAGKPTRGLCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPN++I +VA+P  +A++LTFPERV+RHNI+KLRQ + NGP  +PGA +++  +
Sbjct  359   RTVISPDPNMRIDQVAVPERVAKVLTFPERVNRHNIDKLRQNIINGPFVHPGANFVEKTN  418

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   A +L+ G IV+RHL D D VLFNRQPSLHR+SIM H A++MPWRT 
Sbjct  419   GFKRFLKFGNRAEIAADLQIGDIVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTF  478

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC+PYNADFDGDEM
Sbjct  479   RFNECVCSPYNADFDGDEM  497



>gb|EMD31809.1| hypothetical protein CERSUDRAFT_144684 [Ceriporiopsis subvermispora 
B]
Length=1403

 Score =   432 bits (1111),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 233/507 (46%), Positives = 319/507 (63%), Gaps = 29/507 (6%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPP  1288
             K+P +    P+  K +QFS  +  + ++ +E EV +R +Y    + P+ NG+LD R+G  
Sbjct  2     KEP-VSHQAPKVSKKLQFSLLNNQDAVQISEFEVTHRDLYTAVDRLPVKNGVLDRRLGTT  60

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K   C TC  +  +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R 
Sbjct  61    EKGAFCETCGLNSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRR  120

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              +L++ R   LE+L++  L K V          RK V C  C   NG VKK G LKIIH+
Sbjct  121   TYLKRFRRPNLENLQRQSLIKAV------NGLARKTVYCPYCSATNGAVKKAGTLKIIHD  174

Query  930   --YGSQFLDECHN-------AVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELL  790
                  +  DE          A+  + +  +     V  +L+   V  LFK++ DEDCELL
Sbjct  175   KFRAKKTADEMEKWKRTFAPAIEAQKELGMYINKAVHEDLNPLKVLDLFKRISDEDCELL  234

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              L     +PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++
Sbjct  235   GLRPEYGRPEEYVWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLA  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                  A+ +  W  LQ+ VA YINS++ G+P QM   RP+ GF QRLKGKQGRFRGNLSG
Sbjct  293   KGAPTAQFMEQWDFLQLSVAMYINSELPGVPTQM-GQRPIRGFCQRLKGKQGRFRGNLSG  351

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL+I EVA+P  +A++LT+PERV+ HNIE LR+ VRNG + +PGA
Sbjct  352   KRVDFSGRTVISPDPNLRIDEVAVPERVAKVLTYPERVTAHNIEVLRRAVRNGCDVHPGA  411

Query  258   KYIKH-PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
              Y+     G +  L + +R   AD L+ G IV+RH+ DGD VLFNRQPSLH++SIMCHR 
Sbjct  412   NYVTTGGTGFKKFLKFGNRAAIADGLRIGDIVERHIIDGDIVLFNRQPSLHKLSIMCHRV  471

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++ PWRT R NE VC PYNADFDGDEM
Sbjct  472   KVRPWRTFRLNECVCGPYNADFDGDEM  498



>emb|CDM28351.1| DNA-directed RNA polymerase III subunit RPC1 [Penicillium roqueforti 
FM164]
Length=1448

 Score =   432 bits (1112),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 235/512 (46%), Positives = 321/512 (63%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYD--ASKNPILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   +  +++  A VEV    ++D   ++  + NG LD RMG  NKT S
Sbjct  18    DSVPKVIKELKFGVLTNDDIVAQAVVEVSDRKFFDLDQTRTVVANGPLDQRMGISNKTDS  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATC  + K+C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  +LR 
Sbjct  78    CATCGNNLKDCNGHFGHVRLVLPSFHVGYFKRVISILQEICKECSNILLPEAERRTYLRD  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHE---  931
             MR   L++L++ ++ KR+ +RC      RK   C+ CG +NG+VKK     LKI H+   
Sbjct  138   MRRPGLDNLRRTQIAKRINERC------RKTRKCTYCGAINGVVKKTGTSALKITHDKFR  191

Query  930   ------------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                               + + FL E   A     K       +++   V  LFKKM D 
Sbjct  192   AFNVSVSVKKETPISKDVFDNSFL-EARGANPEVEKHFKKAQDDMNPLRVLKLFKKMSDS  250

Query  804   DCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             DCEL+ ++ K   PE  L   IP PP+ IRPSV  DG   S E+D+T +L  I+Q+N +L
Sbjct  251   DCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGA--STEDDLTAKLGDIVQSNINL  308

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             +  +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFR
Sbjct  309   KNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL++ EVA+P L+A+++T+PE V+R+N EKL++ + NG N
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKVMTYPELVTRYNKEKLQRRICNGSN  427

Query  273   KYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             K+PGA  I K   G    L YS+ +R AD+L+ G +V+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   KWPGANLIVKKGTGFRQMLKYSNTQRMADQLQEGDVVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H A+I P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFAKIRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_002165029.2| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like, 
partial [Hydra vulgaris]
Length=537

 Score =   410 bits (1053),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 219/499 (44%), Positives = 306/499 (61%), Gaps = 27/499 (5%)
 Frame = -3

Query  1434  RKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCATC  1261
             + + SI F  FS  ++ + + V+      Y  DA++ P+  G+LD ++G   K K C TC
Sbjct  16    QSLGSISFGLFSADQIQQLSTVQCVTKTLYSQDAARTPVPYGVLDKKLGISGKDKVCDTC  75

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                  +C GHYGY++L LPVF++GY    + IL+ ICK CSRILL +++R  +++ +R  
Sbjct  76    GKTLVDCVGHYGYIDLELPVFHIGYFRSTIVILQQICKNCSRILLNDEDRTTYIKALRRP  135

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGS--QFL  913
              L  L++  L K+++ +C      +K   C  C   NG VKK G +KI+HE Y +  +  
Sbjct  136   GLTSLQRKTLHKKIIMKC------KKVTTCFYCNDRNGNVKKLGMMKILHEKYKTTRKVD  189

Query  912   DECHNAVSNKTKGSITVPPELDSKT-----------VHSLFKKMIDEDCELLYL---SDK  775
             D       N    +I    ELD  T           V  +F+ + DEDC LL +   S +
Sbjct  190   DGIITDFKNSFNEAIVYNKELDGITSKMNLVLNPLKVFHIFQNITDEDCYLLGMVPASGR  249

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE L++T +PVPP  IRPSV  +    SNE+D+T +L  +I  N  +R+  S        
Sbjct  250   PEDLIITRVPVPPACIRPSVISELQAGSNEDDLTMKLTEMIFLNDVIRKHRSTGAKVQII  309

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ++ A YIN ++ G+P  MQ  +   GFVQRL GKQGRFRGNLSGKRV+++GR
Sbjct  310   MEDWDFLQLQCALYINGEMSGIPMNMQPKKATRGFVQRLNGKQGRFRGNLSGKRVDFSGR  369

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY-IKHPD  238
             TVISPDPNL+I +VA+PI +A++LTFPE V++ NI+ +++ V+NG + +PGA + I    
Sbjct  370   TVISPDPNLRIDQVAVPIHVAKVLTFPEPVNKFNIKLMKELVKNGADIHPGANFVISKNT  429

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L Y +R   A+EL+YG IV+RHL D D VLFNRQPSLHR+SIM H A + P RT 
Sbjct  430   GIKRYLKYGNRALVANELRYGDIVERHLMDNDVVLFNRQPSLHRLSIMAHYATVRPHRTF  489

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC PYNADFDGDEM
Sbjct  490   RFNECVCTPYNADFDGDEM  508



>emb|CCD46881.1| similar to DNA-directed RNA polymerase iii largest subunit [Botrytis 
cinerea T4]
Length=1442

 Score =   432 bits (1112),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 230/507 (45%), Positives = 315/507 (62%), Gaps = 38/507 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + Y  DA +  I +G +DPR+G  +K+  C T
Sbjct  19    PKRFKELKFGIQSNQDIVNQGVIEVSNKMLYNVDAGRTAIPHGPVDPRLGTSSKSGRCDT  78

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C+   ++C GH+G++ L LP F++GYL +I+ IL+ +CK C+R+LL + ER  FL+++R 
Sbjct  79    CDKGLQDCNGHFGHVRLPLPAFHIGYLKLIIMILQNVCKTCARVLLTDAERRQFLKELRK  138

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------  934
               +++LK+ ++ K++ ++C      RKA  C  C   NG ++K  P+++ H         
Sbjct  139   PGIDNLKRTQICKKINEQC------RKASQCPHCNATNGQIRKISPVRLAHDKYTKYNKS  192

Query  933   ------------EYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELL  790
                         EY   F +E     +   K    V  +L    V +LFK +   DCELL
Sbjct  193   TAAKKVVPPGMAEYQKSF-EEAKKHNTELEKHVKKVYEDLHPLRVLNLFKLITPSDCELL  251

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              ++    +PE  L   +P PPI IRPSV  DGG  SNE+DIT +L  I+   S LR  + 
Sbjct  252   GINPAEGRPEMFLWQFVPAPPICIRPSVQQDGG--SNEDDITTKLAEIVSMASLLRAALH  309

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                     +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGRFRGNLSG
Sbjct  310   KGQAVQTIMEQWDFLQLQIAMYVNSDVPGLQ-QPGFGKAIRGFCQRLKGKQGRFRGNLSG  368

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL I EVA+PIL+A+ LT+PERV R NIEKLRQCV NGPN +PGA
Sbjct  369   KRVDFSGRTVISPDPNLGIDEVAVPILVAKNLTYPERVQRQNIEKLRQCVINGPNVHPGA  428

Query  258   KYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             + I   D   +ISL ++ R   A  LK G +V+RHLEDGD VLFNRQPSLH++SIM H A
Sbjct  429   QQIIKKDSNHKISLKFAKRDNEAKFLKIGDVVERHLEDGDIVLFNRQPSLHKLSIMSHYA  488

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             +I PWRT R NE VCNPYNADFDGDEM
Sbjct  489   KIRPWRTFRLNECVCNPYNADFDGDEM  515



>gb|KID64990.1| DNA-directed RNA polymerase III largest subunit, partial [Metarhizium 
anisopliae ARSEF 549]
Length=1422

 Score =   432 bits (1111),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 228/501 (46%), Positives = 319/501 (64%), Gaps = 30/501 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA--SKNPILNGLLDPRM  1297
               KQ  +++V P+++K I+F   S  ++   A VEV   + YD   S+ P  +G LDPR+
Sbjct  8     LAKQQLVDEV-PKRLKGIKFGIQSNQDLTNQAVVEVSNRLLYDIQNSRAPYAHGPLDPRL  66

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G  NK   C+TC+   K C GH+GY+NL LP F++GYL  IV IL+ ICK CSR+LL + 
Sbjct  67    GTSNKFGKCSTCHETLKNCNGHFGYVNLPLPAFHIGYLRFIVTILQNICKTCSRVLLQDN  126

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             +R  FL+++R   L++L+++++ KR+ + C      RK   C  C  +NG V+K G LK+
Sbjct  127   DRQTFLKELRRPHLDNLRRSQICKRINEHC------RKVKSCPHCSSINGQVRKIGVLKL  180

Query  939   IHEYGSQFLDECHNAVSNKTKGSITVPPELDSK---TVHSLFKKMIDEDCELLYLS---D  778
              H+  S +         NK+  +  +PP   ++   +V  LF+++   DCELL L+    
Sbjct  181   THDKFSSY---------NKSTSAKKIPPAAKTQFDESVLGLFQRIGSVDCELLGLNPSEG  231

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +P PP+ IRPS+  D    SNE+D+T +L  I+  +  +R  +   +    
Sbjct  232   RPEMFIWQYLPAPPVCIRPSIAQDNA--SNEDDLTTKLADIVWVSGMIRSALQKGSPIQT  289

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ +VA YINSDV GL  Q    +P+    QRLKGKQGRFRGNLSGKRV+++G
Sbjct  290   IMEQWEYLQTQVAIYINSDVPGLQ-QPGFGKPIREICQRLKGKQGRFRGNLSGKRVDFSG  348

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI--KH  244
             RTVISPDPNL I EVA+P L+A+ LT+PER  R NIEKLR+C+RNGPN +PGA+ +    
Sbjct  349   RTVISPDPNLGIDEVAVPQLVAKNLTYPERAQRQNIEKLRRCIRNGPNVWPGAQCVLKMR  408

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
               G +ISL ++  +  A+ L  G +V+RH+EDGD VLFNRQPSLH++SIM H  ++ PWR
Sbjct  409   EGGYKISLKFADTELIANNLCIGDVVERHIEDGDIVLFNRQPSLHKLSIMSHFVKVRPWR  468

Query  63    TLRFNESVCNPYNADFDGDEM  1
             T R NE VCNPYNADFDGDEM
Sbjct  469   TFRLNECVCNPYNADFDGDEM  489



>ref|XP_001550869.1| conserved hypothetical protein [Botrytis cinerea B05.10]
 gb|EMR87039.1| putative dna-directed rna polymerase iii subunit rpc1 protein 
[Botrytis cinerea BcDW1]
Length=1468

 Score =   432 bits (1111),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 230/507 (45%), Positives = 315/507 (62%), Gaps = 38/507 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + Y  DA +  I +G +DPR+G  +K+  C T
Sbjct  16    PKRFKELKFGIQSNQDIVNQGVIEVSNKMLYNVDAGRTAIPHGPVDPRLGTSSKSGRCDT  75

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C+   ++C GH+G++ L LP F++GYL +I+ IL+ +CK C+R+LL + ER  FL+++R 
Sbjct  76    CDKGLQDCNGHFGHVRLPLPAFHIGYLKLIIMILQNVCKTCARVLLTDAERRQFLKELRK  135

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------  934
               +++LK+ ++ K++ ++C      RKA  C  C   NG ++K  P+++ H         
Sbjct  136   PGIDNLKRTQICKKINEQC------RKASQCPHCNATNGQIRKISPVRLAHDKYTKYNKS  189

Query  933   ------------EYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELL  790
                         EY   F +E     +   K    V  +L    V +LFK +   DCELL
Sbjct  190   TAAKKVVPPGMAEYQKSF-EEAKKHNTELEKHVKKVYEDLHPLRVLNLFKLITPSDCELL  248

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              ++    +PE  L   +P PPI IRPSV  DGG  SNE+DIT +L  I+   S LR  + 
Sbjct  249   GINPAEGRPEMFLWQFVPAPPICIRPSVQQDGG--SNEDDITTKLAEIVSMASLLRAALH  306

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                     +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGRFRGNLSG
Sbjct  307   KGQAVQTIMEQWDFLQLQIAMYVNSDVPGLQ-QPGFGKAIRGFCQRLKGKQGRFRGNLSG  365

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL I EVA+PIL+A+ LT+PERV R NIEKLRQCV NGPN +PGA
Sbjct  366   KRVDFSGRTVISPDPNLGIDEVAVPILVAKNLTYPERVQRQNIEKLRQCVINGPNVHPGA  425

Query  258   KYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             + I   D   +ISL ++ R   A  LK G +V+RHLEDGD VLFNRQPSLH++SIM H A
Sbjct  426   QQIIKKDSNHKISLKFAKRDNEAKFLKIGDVVERHLEDGDIVLFNRQPSLHKLSIMSHYA  485

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             +I PWRT R NE VCNPYNADFDGDEM
Sbjct  486   KIRPWRTFRLNECVCNPYNADFDGDEM  512



>ref|XP_010781572.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like 
[Notothenia coriiceps]
Length=647

 Score =   412 bits (1060),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 315/512 (62%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  I F   S  ++ K A ++V     Y  D    P+  G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSAEQMRKQAHIQVVSKNLYSQDTKHTPLAYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGYL+L LP F+VGY   I+ IL+ ICK CS I+L ++
Sbjct  61    GTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAIIGILQMICKTCSSIMLTKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ++L F+  ++   L +L+K  L K++  +C      RK  IC  C   NG VKK G LKI
Sbjct  121   DKLLFMDMLKRPNLAYLQKRGLKKKISDKC------RKKTICMSCAAFNGPVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVS-NKTKGSITVPPE--LDSKTVHSLFKKMIDED  802
             IHE           + + FL     A+  NK    +    +  L+   V ++FK++  ED
Sbjct  175   IHEKYKTNKKVVDVFVTDFLQSFDTAIEHNKVVEPLLTRAQENLNPLVVLNMFKRIPQED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   IPLLLMNPEAGKPADLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRMTGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILT+PE+V++ N+E LR+ VRNGP  
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANLELLRKLVRNGPEV  414

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA +I++   T++   L Y +R++ A EL++G +V+RH+ DGD VLFNRQPSLH++SI
Sbjct  415   HPGANFIQN-RSTQMKRFLKYGNREKIAQELRFGDVVERHMIDGDIVLFNRQPSLHKLSI  473

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M H ARI P RT RFNE VC PYNADFDGDEM
Sbjct  474   MAHIARIKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_001588093.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980]
 gb|EDN94665.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980 
UF-70]
Length=1459

 Score =   432 bits (1110),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 229/507 (45%), Positives = 313/507 (62%), Gaps = 38/507 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV     Y  D  + PI +G LDPR+G  +K   C T
Sbjct  19    PKRFKELKFGILSNQDIVNQGVIEVSNKTLYNVDNGRTPIPHGPLDPRLGTSSKAGRCET  78

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C+   ++C GH+G++ L LP F++GYL +I+ IL+ ICK C+R+LL + ER  FLR++R 
Sbjct  79    CDKGLQDCNGHFGHVRLPLPAFHIGYLKLIIMILQNICKTCARVLLTDAERRQFLRELRK  138

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH---------  934
               +++LK+ ++ K++ ++C      RKA  C  C   NG ++K   +++ H         
Sbjct  139   PGIDNLKRTQICKKINEQC------RKASQCPHCDATNGQIRKVSVVRLAHDKYTKYNKS  192

Query  933   ------------EYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELL  790
                         EY   F +E     +   K    V  +L    V +LFK +   DCELL
Sbjct  193   TAAKKVAPPGMAEYQKSF-EEAKKNNTELEKHVKKVYEDLHPLRVLNLFKLITPSDCELL  251

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              ++    +PE  L   +P PPI IRPSV  DGG  SNE+D+T +L  I+  +S +R  + 
Sbjct  252   GINPAEGRPEMFLWQFVPAPPICIRPSVAQDGG--SNEDDLTAKLAEIVNMSSLIRAALQ  309

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
                     +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGRFRGNLSG
Sbjct  310   KGQAVQTIMEQWDFLQLQIAMYVNSDVPGLQ-QPGFGKAIRGFCQRLKGKQGRFRGNLSG  368

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL I EVA+PIL+A+ LT+PERV R NIEKLR+CV NGPN +PGA
Sbjct  369   KRVDFSGRTVISPDPNLGIDEVAVPILVAKNLTYPERVQRQNIEKLRKCVINGPNVHPGA  428

Query  258   KYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
             + I   D   +ISL ++ R   A  LK G +V+RHLEDGD VLFNRQPSLH++SIM H A
Sbjct  429   QQIVKKDSNHKISLKFAKRDNEAKFLKIGDVVERHLEDGDIVLFNRQPSLHKLSIMSHYA  488

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             +I PWRT R NE VCNPYNADFDGDEM
Sbjct  489   KIRPWRTFRLNECVCNPYNADFDGDEM  515



>gb|AAH53071.1| Polr3a protein [Mus musculus]
Length=649

 Score =   412 bits (1059),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 228/511 (45%), Positives = 309/511 (60%), Gaps = 27/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK   C  CG  NG VKK G LKI
Sbjct  121   EKQQFLDFLKRPGLTYLQKRGLKKKISDKC------RKKSTCHYCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITV---PPELDSKTVHSLFKKMIDED  802
             IHE             S FL     A+ +  +    +      L+   V +LFK++  ED
Sbjct  175   IHEKYKTNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   S KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   VPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRNGP+ 
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDV  414

Query  270   YPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             +PGA +I+      +  L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH++SIM
Sbjct  415   HPGANFIQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIM  474

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  475   AHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>emb|CEI97176.1| Putative DNA-directed RNA polymerase [Rhizopus microsporus]
Length=1588

 Score =   432 bits (1112),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 319/499 (64%), Gaps = 25/499 (5%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSC  1270
             D  P+KI+ +QF   S   ++K AE EV  R +Y   S+ P+  G+LD R+G   K   C
Sbjct  7     DNTPKKIRYLQFGVLSPQNMVKIAEFEVTQRDLYKPESRIPVRGGVLDLRLGTTLKDAVC  66

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC    +EC GH+GY+ L LP+F+VGY   +++IL+ ICK CSR++L E +R  +LR++
Sbjct  67    ETCGQKMQECAGHWGYVKLVLPIFHVGYFRPVINILQEICKTCSRVMLEEADRRMYLRRL  126

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--SQ  919
             R   L++L++N + K++ ++C      +K   C  C  VNG+VKK GPLKI H+     +
Sbjct  127   RAPGLDNLQRNRVLKQIQEKC------KKVTYCMHCNAVNGVVKKVGPLKITHDKYRLKR  180

Query  918   FLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD---  778
               DE      +    + ++P           +L+   V  LF+++  EDCELL LS+   
Sbjct  181   VADEAEQFRKSFETAAASMPELKPHLSKAQDDLNPLRVLRLFQRISPEDCELLGLSEEHG  240

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +PVPP  IRPSV V     SNE+D+T +L  II  N+ +R  +      + 
Sbjct  241   RPEWYIWQYLPVPPSCIRPSV-VQEDNTSNEDDLTAKLTEIIFTNAIIRAGLERGVAVST  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+  A YINS++ G+     A +P  G  QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   LMEQWEFLQLAAALYINSELPGVL-NANAGKPTRGLCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPD  238
             RTVISPDPN++I +VA+P  +A++LTFPERV+RHNI+KLRQ + NGP  +PGA +++  +
Sbjct  359   RTVISPDPNMRIDQVAVPERVAKVLTFPERVNRHNIDKLRQNIINGPFVHPGANFVEKTN  418

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   A +L+ G IV+RHL D D VLFNRQPSLHR+SIM H A++MPWRT 
Sbjct  419   GFKRFLKFGNRAEIAADLQIGDIVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTF  478

Query  57    RFNESVCNPYNADFDGDEM  1
             RFNE VC+PYNADFDGDEM
Sbjct  479   RFNECVCSPYNADFDGDEM  497



>gb|KDQ28805.1| hypothetical protein PLEOSDRAFT_1092688 [Pleurotus ostreatus 
PC15]
Length=1402

 Score =   430 bits (1105),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 228/498 (46%), Positives = 313/498 (63%), Gaps = 28/498 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E EV +R +Y    + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFEVTHRDLYTPIDRLPVKDGVLDRRLGTTEKGAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GHY Y+ L +PVF++GY    + IL+ ICK C+R+LL E +R  +L++ R 
Sbjct  69    CGQSSVNCVGHYAYIKLVVPVFHIGYFKHTIAILQGICKTCARVLLEEPDRRIYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQFLD  910
               LE++++  L K V       T  RK V C  C   NG +KK G LKIIH+ + ++   
Sbjct  129   PNLENIQRQALCKAV------NTLARKVVYCPYCSATNGTIKKAGALKIIHDKFRAKKTA  182

Query  909   ECHNAVSNKTKGSITVPPELD---SKTVHS---------LFKKMIDEDCELLYLS---DK  775
             E           ++    EL    +K VH          LF+++ DEDCELL L     +
Sbjct  183   EEMERWKKTFAAAVEAQKELGLYLNKAVHEDMNPLKVLDLFRRISDEDCELLGLRPEFGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ L   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q +      A+ 
Sbjct  243   PEEFLWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLVKGAPTAQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQ-PGQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL+I EVA+P  +++ILT+PERV+ HNIE L+Q VRNG + +PGA ++   D 
Sbjct  360   TVISPDPNLRIDEVAVPERVSKILTYPERVTIHNIEMLKQAVRNGCDVHPGANFVARGDN  419

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              +  L + +R   AD LKYG +V+RH+ DGD VLFNRQPSLH++SIMCHR ++ PWR+ R
Sbjct  420   KKF-LKFGNRAAIADGLKYGDVVERHIIDGDIVLFNRQPSLHKLSIMCHRVKVRPWRSFR  478

Query  54    FNESVCNPYNADFDGDEM  1
              NE VC PYNADFDGDEM
Sbjct  479   LNECVCGPYNADFDGDEM  496



>tpe|CBF87003.1| TPA: hypothetical protein similar to RNA polymerase III (Broad) 
[Aspergillus nidulans FGSC A4]
Length=1445

 Score =   430 bits (1106),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 234/508 (46%), Positives = 317/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    ++  +  ++ + NG LD RMG  NKT +C T
Sbjct  21    PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFNLENDRSIVPNGPLDARMGISNKTSTCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  FLR+MR 
Sbjct  81    CGGALQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSHILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGSQF-  916
              +L++L++ ++ KRV  RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  141   PRLDNLRRMQIAKRVNDRC------RKTRTCENCGAVNGVVKKTGTSSLKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                L+E  ++     K       +L++  V +LFK++ D DCEL
Sbjct  195   ASTSAKKIPPPSKIVFDRSLEEARSSNPEVEKHHKKAQDDLNALRVLNLFKRISDSDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L  K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLDPKEARPEMFLWQFIPAPPVCIRPSVGQDAS--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+QCVRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVNRYNKEKLQQCVRNGQKKWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK  +  +  L Y + K  AD+L+ G IV+RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIIKKGNPLKTMLKYGNLKFIADQLQEGDIVERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|KFY23590.1| hypothetical protein V493_05772 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=1478

 Score =   431 bits (1107),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 226/514 (44%), Positives = 315/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     VPPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVVPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NIEKLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIEKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>ref|XP_007408913.1| hypothetical protein MELLADRAFT_47986 [Melampsora larici-populina 
98AG31]
 gb|EGG07581.1| hypothetical protein MELLADRAFT_47986 [Melampsora larici-populina 
98AG31]
Length=1421

 Score =   429 bits (1104),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 230/531 (43%), Positives = 323/531 (61%), Gaps = 53/531 (10%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDAS-----------------  1336
             KQ  +++  P+KIK IQFS  S  E++  +E E  +   Y  S                 
Sbjct  2     KQLVVQE-APKKIKHIQFSVLSSQEIVAISEYESTQRDLYSMSGSTDPSGFAIPGAPEPL  60

Query  1335  -KNPILNGLLDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILK  1159
              K P   G+LD R+G  +K+ +C TCN    +C GHY Y+ L LPVF++GY   ++ +L+
Sbjct  61    VKKPAKGGVLDTRLGTSDKSGTCGTCNAKMADCVGHYSYIKLILPVFHIGYFRAVIQMLQ  120

Query  1158  CICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCG  979
              ICK C+R++L E++R  +L++ R   LE+L++    K+V   C      RK + C  CG
Sbjct  121   DICKTCARVMLSEEDRRVYLQRFRRPNLENLQRQHYAKQVNTAC------RKVLTCPYCG  174

Query  978   CVNGMVKK-GPLKIIHEY-----GSQFLDECHNAVSNKTKGSITVPPELDSKT-------  838
               NG+VKK G L+I+HE       +  L+   +   N  K +  + P L           
Sbjct  175   ATNGIVKKVGALRIVHEKFRAKKKADELEAFRDTFINAIKETRELAPHLHKAQEDMNPLR  234

Query  837   VHSLFKKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITER  667
             V +LF+++   DCELL L     +PE+ +   I VPP+ IRPSV  +    +NE+D+T +
Sbjct  235   VLNLFRRVTPSDCELLGLDPEVGRPEEYIWQYIHVPPVCIRPSVTQEAA--TNEDDVTVK  292

Query  666   LKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFV  487
             L  +I  N+ ++  +         +  W  LQ+ VA YIN+++ G+P QM A +P+ GF 
Sbjct  293   LTEMIFTNTLIKTGLVKGVPTQNIMEQWEFLQLSVAMYINAELPGVPSQMGA-KPIKGFC  351

Query  486   QRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIE  307
             QRLKGK GRFRGNLSGKRV+++GRTVI PDPNL ITEVA+P  MA++LT+PERV+ HN++
Sbjct  352   QRLKGKTGRFRGNLSGKRVDFSGRTVIGPDPNLSITEVAVPDRMAKVLTYPERVTAHNLD  411

Query  306   KLRQCVRNGPNKYPGAKYI--KHPDGT-------EISLMYSSRKRHADELKYGYIVDRHL  154
             +LRQC+RNGP+ +PGA Y+      GT       + SL + +R + A+ L+ G  V+RHL
Sbjct  412   RLRQCIRNGPDVHPGANYLIASGAPGTAGAATQFKRSLRFGNRNQIANTLRMGDTVERHL  471

Query  153   EDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              DGD VLFNRQPSLH++SIM HRA+I PWRTLRFNE VC PYNADFDGDEM
Sbjct  472   HDGDVVLFNRQPSLHKLSIMSHRAKIRPWRTLRFNECVCTPYNADFDGDEM  522



>ref|XP_004327781.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like, 
partial [Tursiops truncatus]
Length=774

 Score =   415 bits (1066),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 230/515 (45%), Positives = 309/515 (60%), Gaps = 35/515 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSAEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK   C  CG  NG VKK G LKI
Sbjct  121   EKKQFLDYLKRPGLTYLQKRGLKKKISDKC------RKKNTCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPIVSNFLQSFETAIEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHR  106
             GP  +PGA +I+      +  L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH+
Sbjct  411   GPEVHPGANFIQQRHMQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHK  470

Query  105   MSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             +SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  471   LSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_001884255.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR04865.1| predicted protein [Laccaria bicolor S238N-H82]
Length=1397

 Score =   429 bits (1103),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 229/498 (46%), Positives = 317/498 (64%), Gaps = 28/498 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK IQFS  +  + +K +E EV +R +Y    + P+ NG+LD R+G  +K   C T
Sbjct  9     APKVIKKIQFSLLNAQDTVKISEFEVTHRDLYTPTDRQPVKNGVLDRRLGTTDKGAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GHY Y+ L +PVF++GY    + +L+ ICK C+R+LL E +R  F+++ R 
Sbjct  69    CGQSSVNCVGHYAYIKLVVPVFHIGYFKHTIAVLQAICKTCARVLLEETDRRIFIKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQFL  913
               LE++++  L K V       T  RK V C  C   NG VKK G LKIIH+     +  
Sbjct  129   PNLENMQRQSLSKAV------NTMARKVVYCPYCSATNGAVKKAGALKIIHDKFRAKKTA  182

Query  912   DECHN-------AVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             DE          A+  + + ++     V  +L++  V  LF+++ DEDCELL L     +
Sbjct  183   DELERWKKTFAPALEAQKELAMYINKAVHEDLNALKVLDLFRRISDEDCELLGLHPDWGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   + VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ +RQ ++  +   + 
Sbjct  243   PEQFIWQYLSVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIRQGLAKGSPTPQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQ-PGQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI  LRQ +RNGP+ +PGA ++   D 
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTTHNINALRQAIRNGPDVHPGANFVARGDN  419

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              +  L + +R   AD L  G +V+RH+ DGD +LFNRQPSLH++SIMCHRA+I PWRT R
Sbjct  420   KKF-LRFGNRAAIADGLGIGDVVERHIIDGDIILFNRQPSLHKLSIMCHRAKIRPWRTFR  478

Query  54    FNESVCNPYNADFDGDEM  1
              NE VC PYNADFDGDEM
Sbjct  479   LNECVCGPYNADFDGDEM  496



>gb|ERE87513.1| DNA-directed RNA polymerase III subunit RPC1-like protein, partial 
[Cricetulus griseus]
Length=697

 Score =   412 bits (1059),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 227/511 (44%), Positives = 309/511 (60%), Gaps = 27/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK   C  CG  NG VKK G LKI
Sbjct  121   EKQQFLDFLKRPGLTYLQKRGLKKKISDKC------RKKSTCHYCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITV---PPELDSKTVHSLFKKMIDED  802
             IHE             S FL     A+ +  +    +      L+   V +LFK++  ED
Sbjct  175   IHEKYKTNKKVVDPVVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   VPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRNGP+ 
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDV  414

Query  270   YPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             +PGA +I+      +  L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH++SIM
Sbjct  415   HPGANFIQQRHMQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIM  474

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  475   AHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>gb|AFR96255.2| DNA-directed RNA polymerase III subunit RPC1 [Cryptococcus neoformans 
var. grubii H99]
Length=1466

 Score =   429 bits (1103),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 232/513 (45%), Positives = 316/513 (62%), Gaps = 38/513 (7%)
 Frame = -3

Query  1455  YIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY----DASKNPILNGLLDPRMGPP  1288
             Y+    PR+IK IQF  F+  ++++ +EV+V     Y    D S+   L G LD RMGP 
Sbjct  14    YVSSDVPRRIKHIQFQPFTPKDIVRISEVQVSIAELYQNNEDGSRTTALQGPLDARMGPN  73

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K K CATC  D ++C GHYGY+ L LPVF++GY    +++L CICK C+R+LL E ER 
Sbjct  74    EKGKKCATCGEDTQKCVGHYGYIKLVLPVFHIGYFRPTINMLSCICKTCARVLLPETERA  133

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              FL++ R   LE L++    K V+  C      +K  IC+ CG  NG+VKK GPL+I HE
Sbjct  134   SFLKRFRRPNLESLQRQSAAKAVLAAC------KKQNICTYCGAPNGIVKKSGPLRISHE  187

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKT---VHSLFKKMIDEDCELLY  787
                         +++    NAV+     +  +   +D      V +LF+++  EDCELL 
Sbjct  188   PYRAAKMASMKDEWMATFKNAVAENQAVATHLSKAVDDLNPLKVLNLFERITAEDCELLS  247

Query  786   LS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             L     +PE  +   I VPP  IRPSV  + G  +NE+D+T +L  I+  N++L   +  
Sbjct  248   LHPDVGRPEDYIWQYISVPPPCIRPSVASEAG--NNEDDLTAKLAEIVNYNNTLALMMDL  305

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGK  436
                     ++W  L   VA YINS   G+  Q   S+P+ GFVQRLKGKQGRFRGNLSGK
Sbjct  306   GRGIEMISSNWEVLGQAVALYINSQAPGM--QTIGSKPIRGFVQRLKGKQGRFRGNLSGK  363

Query  435   RVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAK  256
             RV+++GRTVI PDPNL+I EVA+P  +A  L++PERV+ +NI+ +RQ + NG   +PGA 
Sbjct  364   RVDFSGRTVIGPDPNLRIDEVAVPEKVAVKLSYPERVTDYNIQLMRQAIINGSKLHPGAN  423

Query  255   YI--KHPDGTEISLMYS------SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
              +  KH +G+ + +  +      +RKR+A EL+ G +V RH+ DGD VLFNRQPSLH++S
Sbjct  424   VLERKHENGSTVRISLNVMKDLEARKRYARELQIGDVVHRHVRDGDIVLFNRQPSLHKLS  483

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHR R+ PWRT R NE VCNPYNADFDGDEM
Sbjct  484   IMCHRVRVRPWRTFRLNECVCNPYNADFDGDEM  516



>ref|XP_008855890.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
nuttalli P19]
 gb|EKE41776.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
nuttalli P19]
Length=1379

 Score =   427 bits (1099),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 317/514 (62%), Gaps = 44/514 (9%)
 Frame = -3

Query  1452  IEDVGPR----KIKSIQFSTFSGSEVMKSAEVEVYRGVYYD-ASKNPILNGLLDPRMGPP  1288
             IE VGP     K+  IQF+ FS  E+ + +E EV     +   ++ P  NG+LD R+G  
Sbjct  22    IEFVGPSERPGKVCDIQFTMFSQEEMNRESEFEVTEHFLFQPNTRKPNPNGVLDRRLGVC  81

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             +    C TC    +EC GH+  +NL LPVF++G+   I+ +L+C+CK C+RILL  +ER 
Sbjct  82    DSLSVCETCGKRIEECSGHFAVINLELPVFHIGFFRPIIQVLQCVCKNCNRILLTNEERD  141

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH-  934
              +LR+MRN K + + +  L + ++ +C    +      C  C  +NG +KK G L+++H 
Sbjct  142   FYLRRMRNKKTDTVARTYLVRALIAQCRKHYNS-----CPHCNAINGSIKKYGNLRLVHD  196

Query  933   ------------EYGSQF-----LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                         E+   F     LD+  NA  N  +       +LD + V S+F+ +I E
Sbjct  197   KYHRDPTITEMNEFYDGFEESIKLDKDINAFVNNAQ------EDLDPRKVLSIFRSLIRE  250

Query  804   DCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             D E +     +  PE +++TS+PVPPIAIRPSV +DGG  SNE+D+T +LK I++ N  +
Sbjct  251   DIETMDFDPDNAPPENMILTSVPVPPIAIRPSVAMDGGNASNEDDLTTQLKEIMECNDRI  310

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             ++ I     P +   SW  L + V+ +INS+   LP      +PL    QRLKGK GRFR
Sbjct  311   KEMIKRGASPYQYYDSWDQLTVAVSMFINSE---LPGCDDKGKPLRAICQRLKGKHGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNL GKRV+++GRTVISPDPNL I ++ +P LMA  LT+PERV++HNI+KLRQ V NG N
Sbjct  368   GNLLGKRVDFSGRTVISPDPNLDIEQIGVPKLMAVKLTYPERVTKHNIDKLRQLVINGSN  427

Query  273   KYPGAK-YIKHPDGTEISL--MYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
              YPG    I   DG   S+      R++ A +LK G IV+RHLED D VLFNRQPSLHR+
Sbjct  428   NYPGCNSIIGGSDGLRRSMCIKLEMREKFAKDLKIGDIVERHLEDNDIVLFNRQPSLHRI  487

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIMCHRA+I+PWRTLRFNE VC PYNADFDGDEM
Sbjct  488   SIMCHRAKILPWRTLRFNECVCTPYNADFDGDEM  521



>gb|EPX74198.1| DNA-directed RNA polymerase III complex large subunit Rpc1 [Schizosaccharomyces 
octosporus yFS286]
Length=1405

 Score =   428 bits (1100),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 226/503 (45%), Positives = 317/503 (63%), Gaps = 27/503 (5%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             I++  P+KIK +QF      E +K A VEV+ R +Y    ++P  +G LD  MG  NKT 
Sbjct  5     IDNQVPKKIKHLQFGISGPKEFVKDATVEVFSRDLYTMTDRSPAEHGALDLHMGTSNKTI  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +C TC     +C GH+GY+ LALPVF++GY    + IL+ ICK CS +LL + E+  FL+
Sbjct  65    NCTTCGESMADCMGHFGYVKLALPVFHIGYFKAAMTILQNICKDCSSVLLSDPEKRQFLK  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE---Y  928
             ++R   +++LK++++ KR+  +C      +K   C  C  + G+VKK GPLKIIHE   Y
Sbjct  125   ELRRPGIDNLKRSQICKRINDQC------KKTRRCPVCDSMQGVVKKAGPLKIIHERFRY  178

Query  927   GSQFLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLS-  781
               +  D+         +   T+P           +L+   V +LFK++   DCELL +  
Sbjct  179   ARKSQDDEGEFRHTFDEAIKTIPELKMHISKAHDDLNPLKVLNLFKQINPVDCELLGMDP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE LL   +P PPI IRPSV  +G   + E+D+T ++  I+  +S +R  +S  T 
Sbjct  239   EFGRPENLLWQYVPAPPICIRPSVAQEGA--TTEDDLTVKITEIVWTSSLIRAALSKGTP  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              +  +  W  +Q+ +A YINS++ GL P    S+P+ G  QRLKGK GRFRGNLSGKRV+
Sbjct  297   VSNLMEQWEFMQLSIAMYINSEMPGLRPSDMPSKPVRGLCQRLKGKSGRFRGNLSGKRVD  356

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY-I  250
             ++GRTVISPDPNL+I +VA+P  +A+ILTFPERV+  N   L+QC++NGP+ +PGA Y I
Sbjct  357   FSGRTVISPDPNLRIDQVAVPYRIAKILTFPERVTTQNKTYLQQCIKNGPDVHPGANYII  416

Query  249   KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                   +  L + +R R AD+LK G IV+RHL D D +LFNRQPSLH++SIM H  ++ P
Sbjct  417   DRESDLKRFLRFGNRNRIADDLKIGDIVERHLNDNDVILFNRQPSLHKLSIMAHLVKVRP  476

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRTLRFNE VC PYNADFDGDEM
Sbjct  477   WRTLRFNECVCGPYNADFDGDEM  499



>ref|XP_007315238.1| hypothetical protein SERLADRAFT_446372 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO27147.1| hypothetical protein SERLADRAFT_446372 [Serpula lacrymans var. 
lacrymans S7.9]
Length=1403

 Score =   428 bits (1100),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 228/499 (46%), Positives = 314/499 (63%), Gaps = 28/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E +V +R +Y    + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFQVTHRDLYTPTDRLPVKDGVLDRRLGTTEKNTFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ L +PVF++GY    + IL+C+CK C+R+LL E +R  +L++ R 
Sbjct  69    CGLSSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCVCKTCARVLLEEPDRRVYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQFLD  910
               LE++++  L K V       T  RK V C  C   NG VKK G LKIIH+ + ++   
Sbjct  129   PNLENIQRQSLSKAV------NTMSRKCVYCPYCSATNGAVKKAGALKIIHDKFRAKKTA  182

Query  909   ECHNAVSNKTKGSITVPPELD---SKTVHS---------LFKKMIDEDCELLYL---SDK  775
             E           ++    EL    +K VH          LFK++ DEDCELL L     +
Sbjct  183   EEMEKWKRTFAPAVEAQKELGMYLNKAVHEDLNPLKVLDLFKRISDEDCELLGLRPAHGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q +S     A+ 
Sbjct  243   PEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLSKGAPTAQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEHWEFLQLSVAMYINSELPGVPSQ-PGQKPMRGFVQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A++LT+PERV+ HNIE L+Q VRNG + +PGA Y+     
Sbjct  360   TVISPDPNLRIDEVAVPERVAKVLTYPERVTPHNIEGLKQAVRNGCDVHPGANYVTAGSS  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G  V+RH+ +GD VLFNRQPSLH++SIMCHR +I PWR+ 
Sbjct  420   GFKKFLKFGNRNAVADTLRVGDTVERHIINGDIVLFNRQPSLHKLSIMCHRVKIRPWRSF  479

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  480   RLNECVCGPYNADFDGDEM  498



>gb|EGE03118.1| DNA-directed RNA polymerase III largest subunit [Trichophyton 
equinum CBS 127.97]
Length=1427

 Score =   428 bits (1100),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 230/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  17    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  76

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  77    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  136

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  137   LRRPGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFR  190

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   A  +  K    V  +L+   V  LF+++ +ED
Sbjct  191   AFNASLSAKKIPPPSKLAFDRSFEEAKKANPDIEKHYRRVFDDLNPLRVLKLFRRISNED  250

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  251   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  308

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  309   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  366

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  367   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  426

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLEDGD VLFNRQPSLH++SI
Sbjct  427   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLEDGDIVLFNRQPSLHKLSI  486

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  487   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  518



>ref|XP_653748.1| DNA-directed RNA polymerase III largest subunit [Entamoeba histolytica 
HM-1:IMSS]
 gb|EAL48362.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
histolytica HM-1:IMSS]
 gb|EMD45780.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
histolytica KU27]
 gb|EMH78008.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
histolytica HM-1:IMSS-B]
 gb|EMS16984.1| DNA-directed RNA polymerase III largest subunit [Entamoeba histolytica 
HM-3:IMSS]
 gb|ENY62320.1| DNA-directed RNA polymerase III largest subunit, putative [Entamoeba 
histolytica HM-1:IMSS-A]
Length=1379

 Score =   427 bits (1098),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 232/514 (45%), Positives = 317/514 (62%), Gaps = 44/514 (9%)
 Frame = -3

Query  1452  IEDVGPR----KIKSIQFSTFSGSEVMKSAEVEVYRGVYYD-ASKNPILNGLLDPRMGPP  1288
             IE VGP     K+  IQF+ FS  E+ + +E EV     +   ++ P  NG+LD R+G  
Sbjct  22    IEFVGPSERPGKVCDIQFTMFSQEEMNRESEFEVTEHFLFQPNTRKPNPNGVLDRRLGVC  81

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             +    C TC    +EC GH+  +NL LPVF++G+   I+ +L+C+CK C+RILL  +ER 
Sbjct  82    DSLSVCETCGKRIEECSGHFAVINLELPVFHIGFFRPIIQVLQCVCKNCNRILLTNEERD  141

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH-  934
              +LR+MRN K + + +  L + ++ +C    +      C  C  +NG +KK G L+++H 
Sbjct  142   FYLRRMRNKKTDTVARTYLVRALIAQCRKHYNS-----CPHCNAINGSIKKYGNLRLVHD  196

Query  933   ------------EYGSQF-----LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                         E+   F     LD+  NA  N  +       +LD + V S+F+ +I E
Sbjct  197   KYHRDPTITEMNEFYDGFEESIKLDKDINAFINNAQ------EDLDPRKVLSIFRSLIRE  250

Query  804   DCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             D E +     +  PE +++TS+PVPPIAIRPSV +DGG  SNE+D+T +LK I++ N  +
Sbjct  251   DIETMDFDPDNAPPENMILTSVPVPPIAIRPSVAMDGGNASNEDDLTTQLKEIMECNDRI  310

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             ++ I     P +   SW  L + V+ +INS+   LP      +PL    QRLKGK GRFR
Sbjct  311   KEMIKRGASPYQYYDSWDQLTVAVSMFINSE---LPGCDDKGKPLRAICQRLKGKHGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNL GKRV+++GRTVISPDPNL I ++ +P LMA  LT+PERV++HNI+KLRQ V NG N
Sbjct  368   GNLLGKRVDFSGRTVISPDPNLDIEQIGVPKLMAVKLTYPERVTKHNIDKLRQLVINGSN  427

Query  273   KYPGAK-YIKHPDGTEISL--MYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
              YPG    I   DG   S+      R++ A +LK G IV+RHLED D VLFNRQPSLHR+
Sbjct  428   NYPGCNSIIGGSDGLRRSMCIKLEMREKFAKDLKIGDIVERHLEDNDIVLFNRQPSLHRI  487

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIMCHRA+I+PWRTLRFNE VC PYNADFDGDEM
Sbjct  488   SIMCHRAKILPWRTLRFNECVCTPYNADFDGDEM  521



>ref|XP_002851111.1| DNA-directed RNA polymerase III largest subunit [Arthroderma 
otae CBS 113480]
 gb|EEQ28327.1| DNA-directed RNA polymerase III largest subunit [Arthroderma 
otae CBS 113480]
Length=1443

 Score =   428 bits (1101),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 230/509 (45%), Positives = 317/509 (62%), Gaps = 40/509 (8%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKSCAT  1264
             P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +C T
Sbjct  20    PKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDTCET  79

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L+++R 
Sbjct  80    CGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKELRR  139

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGSQF-  916
               L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+    F 
Sbjct  140   PGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFRAFN  193

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 +E   +  +  K    V  +L+   V  LF+++ DEDCEL
Sbjct  194   ASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISDEDCEL  253

Query  792   LYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+  +
Sbjct  254   LSLNVDEARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLKMAL  311

Query  621   SDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
              D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFRGNL
Sbjct  312   -DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKSIRGLCQRLKGKQGRFRGNL  369

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQCVRNG   +P
Sbjct  370   SGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCVRNGTKTWP  429

Query  264   GAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCH  88
             GA Y IK  +   + L Y +    A++L  G IV+RHLEDGD VLFNRQPSLH++SI+ H
Sbjct  430   GANYLIKQGNSFRLFLKYGNLNMIANQLSEGDIVERHLEDGDIVLFNRQPSLHKLSILSH  489

Query  87    RARIMPWRTLRFNESVCNPYNADFDGDEM  1
               ++ P RT R NE VCNPYNADFDGDEM
Sbjct  490   FVKVRPHRTFRLNECVCNPYNADFDGDEM  518



>gb|EGD93894.1| DNA-directed RNA polymerase III largest subunit [Trichophyton 
tonsurans CBS 112818]
Length=1444

 Score =   428 bits (1100),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 230/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  18    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  78    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  138   LRRPGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   A  +  K    V  +L+   V  LF+++ +ED
Sbjct  192   AFNASLSAKKIPPPSKLAFDRSFEEAKKANPDIEKHYRRVFDDLNPLRVLKLFRRISNED  251

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  309

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  310   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  427

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|KFZ24317.1| hypothetical protein V502_01212 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=1478

 Score =   428 bits (1101),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>gb|KFY50921.1| hypothetical protein V496_09085 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY92786.1| hypothetical protein V498_04756 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=1478

 Score =   428 bits (1100),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>gb|KFY87787.1| hypothetical protein V500_06760 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=1478

 Score =   428 bits (1100),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>gb|ELR04038.1| hypothetical protein GMDG_06549 [Pseudogymnoascus destructans 
20631-21]
Length=1478

 Score =   428 bits (1100),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAARKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>emb|CBQ71425.1| probable RPO31-DNA-directed RNA polymerase III, 160 KD subunit 
[Sporisorium reilianum SRZ2]
Length=1400

 Score =   427 bits (1097),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 239/505 (47%), Positives = 314/505 (62%), Gaps = 34/505 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYY--DASKNPILNGLLDPRMGPPNKTKSC  1270
              P+KIK IQF   S  +++  +E+EV  R +Y   +A + P+ NG LD R+G  +K   C
Sbjct  9     APKKIKHIQFGVLSKQDIVNMSEIEVTTRDLYTIGEAERKPVANGTLDRRLGVSDKNSLC  68

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC+    +C GHYGY+ L LPVF+VG+    V IL+ ICK C+ +LL E +R  FL++ 
Sbjct  69    ETCHLKMADCVGHYGYIKLVLPVFHVGFFKHTVAILQSICKNCATVLLEEPDRRKFLKRF  128

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY-----  928
             R   LE+L +   FK V       T  RK + C +CG  NG VKK G LKI+HE      
Sbjct  129   RKPNLENLDRTRTFKAV------NTIARKVLYCPKCGYTNGTVKKQGQLKIVHEKFRAKK  182

Query  927   GSQFLDECHNAVSNKTK-GSITVPPELDSKT-------VHSLFKKMIDEDCELLYLS---  781
              +   DE   + S   K G+  + P L+             LFK++ DEDCELL L    
Sbjct  183   TAAEHDEFKASFSTNIKMGNGDISPHLNKAQEDLNPLKALDLFKRISDEDCELLGLRPEF  242

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI---SDTT  610
              +PE+ +   I VPP+ IRPSV  DG   +NE+D+T +L  +I  NS L+  +      T
Sbjct  243   GRPEEYIWQYICVPPVCIRPSVAQDGA--TNEDDVTIKLTEVIFTNSLLKLGLVKGGKGT  300

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRV  430
               ++ +  W  LQ+ VA YINS++ G+P Q    +P  GF QRLKGKQGRFRGNLSGKRV
Sbjct  301   TTSQLVQQWEFLQLTVALYINSELPGVPVQ-PGQKPSRGFCQRLKGKQGRFRGNLSGKRV  359

Query  429   EYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI  250
             +++GRTVI PDPNLKI EVA+P  +A+ILT+PERV  HNIE+LRQ VRNG + +PGA Y+
Sbjct  360   DFSGRTVIGPDPNLKIDEVAVPQRVAKILTYPERVFEHNIEQLRQAVRNGTDVHPGANYL  419

Query  249   KH-PDGTEISLMY-SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARI  76
                  G +  L +   R+  A +L+ G IV+RH+ DGD VLFNRQPSLH++SIM HRA+I
Sbjct  420   MDGKTGFKRFLKFPGMREELAQKLRVGDIVERHIRDGDIVLFNRQPSLHKLSIMSHRAKI  479

Query  75    MPWRTLRFNESVCNPYNADFDGDEM  1
              PWRT R NE  CNPYNADFDGDEM
Sbjct  480   RPWRTFRLNECACNPYNADFDGDEM  504



>gb|KDQ65120.1| hypothetical protein JAAARDRAFT_28779 [Jaapia argillacea MUCL 
33604]
Length=1402

 Score =   427 bits (1097),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 231/500 (46%), Positives = 313/500 (63%), Gaps = 30/500 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK++QF+  +  +V+K +E EV +R +Y    + P+ NG+LD R+G   K   C T
Sbjct  9     APKVIKALQFTLLNAQDVVKISEFEVTHRDLYTPTDRVPVKNGVLDRRLGTSEKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLSSVDCVGHYAYIKLIVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRRAYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTS-GRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQF  916
               LE+  +  L       C A+    RK V C  C   NG+VKK G LKIIH+     + 
Sbjct  129   PNLENYHRTGL-------CKAVNGMARKVVYCPYCSATNGVVKKAGALKIIHDKFRAKKT  181

Query  915   LDECHN-------AVSNKTKGSITVPPELDSKT----VHSLFKKMIDEDCELLYLS---D  778
              DE          A+  + +  I V   L        V  LFK++ DEDCELL L     
Sbjct  182   ADEMERWKQSFAPAIEAQKELGIYVNKALHEDMNPLKVLDLFKRISDEDCELLGLRPEFG  241

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE+ L   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q +S      +
Sbjct  242   RPEEYLWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLSKGAPTPQ  299

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+ VA YINS++ G+P Q    RP+ GF QRLKGKQGRFRGNLSGKRV+++G
Sbjct  300   FMEYWDFLQLSVAMYINSELPGVPSQ-PGQRPIRGFCQRLKGKQGRFRGNLSGKRVDFSG  358

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-P  241
             RTVISPDPNL+I EVA+P  +++ILT+PERV+ HNIE LR+ VRNG + +PGA Y+    
Sbjct  359   RTVISPDPNLRIDEVAVPERVSKILTYPERVTNHNIELLRKAVRNGCDVHPGANYVTAGS  418

Query  240   DGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRT  61
             +G +  L + +R   AD L+ G +V+RH+ DGD VLFNRQPSLHR+SIM HR ++ PWR+
Sbjct  419   NGFKKFLKFGNRNAIADSLRIGDVVERHIIDGDIVLFNRQPSLHRLSIMSHRVKVRPWRS  478

Query  60    LRFNESVCNPYNADFDGDEM  1
              R NE VC PYNADFDGDEM
Sbjct  479   FRLNECVCTPYNADFDGDEM  498



>gb|KFY71978.1| hypothetical protein V499_07873 [Pseudogymnoascus pannorum VKM 
F-103]
 gb|KFZ17563.1| hypothetical protein V501_01652 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=1478

 Score =   428 bits (1100),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTETERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>ref|XP_571468.1| DNA-directed RNA polymerase iii largest subunit [Cryptococcus 
neoformans var. neoformans JEC21]
 gb|AAW44161.1| DNA-directed RNA polymerase iii largest subunit, putative [Cryptococcus 
neoformans var. neoformans JEC21]
Length=1466

 Score =   427 bits (1099),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 231/513 (45%), Positives = 316/513 (62%), Gaps = 38/513 (7%)
 Frame = -3

Query  1455  YIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY----DASKNPILNGLLDPRMGPP  1288
             Y+    PR+IK IQF  F+  ++++ +EV+V     Y    D ++   L G LD RMGP 
Sbjct  14    YVSSDVPRRIKHIQFQPFTPKDIVRISEVQVSIAELYQNNEDGTRTTALQGPLDARMGPN  73

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K K CATC  D ++C GHYGY+ L LPVF++GY    +++L CICK C+R+LL E ER 
Sbjct  74    EKGKKCATCGEDTQKCVGHYGYIKLVLPVFHIGYFRPTINMLSCICKTCARVLLPETERA  133

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              FL++ R   LE L++    K V+  C      +K  IC+ CG  NG+VKK GPL+I HE
Sbjct  134   SFLKRFRRPNLESLQRQSAAKAVLAAC------KKQNICTYCGAPNGIVKKSGPLRISHE  187

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKT---VHSLFKKMIDEDCELLY  787
                         +++    NAV+     +  +   +D      V +LF+++  EDCELL 
Sbjct  188   PYRAAKMASMKDEWMATFKNAVAENQAVATHLAKAVDDLNPLKVLNLFERITAEDCELLS  247

Query  786   LS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             L     +PE  +   I VPP  IRPSV  + G  +NE+D+T +L  I+  N++L   +  
Sbjct  248   LHPEVGRPEDYIWQYISVPPPCIRPSVASEAG--NNEDDLTAKLAEIVNYNNTLALMMDL  305

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGK  436
                     ++W  L   VA YINS   G+  Q   S+P+ GFVQRLKGKQGRFRGNLSGK
Sbjct  306   GRGIEMISSNWEVLGQAVALYINSQAPGM--QTIGSKPIRGFVQRLKGKQGRFRGNLSGK  363

Query  435   RVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAK  256
             RV+++GRTVI PDPNL+I EVA+P  +A  L++PERV+ +N++ +RQ + NG   +PGA 
Sbjct  364   RVDFSGRTVIGPDPNLRIDEVAVPEKVAVKLSYPERVTDYNLQLMRQAIINGSKLHPGAN  423

Query  255   YI--KHPDGTEISLMYS------SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
              +  KH +G+ + +  +      +RKR+A EL+ G IV RH+ DGD VLFNRQPSLH++S
Sbjct  424   VLERKHENGSTVRISLNVMKDLEARKRYARELQIGDIVHRHVRDGDIVLFNRQPSLHKLS  483

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHR R+ PWRT R NE VCNPYNADFDGDEM
Sbjct  484   IMCHRVRVRPWRTFRLNECVCNPYNADFDGDEM  516



>gb|KFY13380.1| hypothetical protein V491_06416 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=1478

 Score =   427 bits (1099),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 314/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTETERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +PPE                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPPEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNINKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>ref|XP_007767849.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Coniophora puteana RWD-64-598 SS2]
 gb|EIW82038.1| beta and beta-prime subunits of DNA dependent RNA-polymerase 
[Coniophora puteana RWD-64-598 SS2]
Length=1407

 Score =   426 bits (1096),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 227/503 (45%), Positives = 316/503 (63%), Gaps = 38/503 (8%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P+ IK +QFS  +  + +K +E +V +R +Y    + P+ +G+LD R+G   K+  C TC
Sbjct  10    PKVIKKLQFSLLNAQDTVKLSEFQVTHRDLYTPTDRLPVKDGVLDRRLGTTEKSAFCETC  69

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
                  +C GHY Y+ LA+PV+++GY    + IL+ ICK C+R+LL E +R  +L++ R  
Sbjct  70    GLSSVDCVGHYAYIKLAVPVYHIGYFKHSIAILQAICKTCARVLLEEPDRRTYLKRFRRP  129

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDEC  904
              LE++++  L K V       T  RK V C  C   NG VKK G LKIIH+   +F    
Sbjct  130   NLENIQRQALCKAV------NTMARKVVYCPYCSATNGAVKKAGALKIIHD---KF--RA  178

Query  903   HNAVSNKTKGSITVPPELDS---------KTVHS---------LFKKMIDEDCELLYLS-  781
                V    K   +  P +++         K VH          LFK+M +EDCELL L  
Sbjct  179   KKTVEEMEKWKRSFAPAVEAQKELGIYLNKAVHEDINPLRALDLFKRMSNEDCELLGLKP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q ++    
Sbjct  239   SFGRPEQYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLAKGAP  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              A+ +  W  LQ+ VA YINS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+
Sbjct  297   IAQFMEHWEFLQLSVAMYINSELPGVPSQ-AGQKPMRGFVQRLKGKQGRFRGNLSGKRVD  355

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK  247
             ++GRTVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI+ L+Q VRNG + +PGA Y+ 
Sbjct  356   FSGRTVISPDPNLRIDEVAVPERVAKILTYPERVTSHNIDNLKQAVRNGCDVHPGANYVT  415

Query  246   H-PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                 G +  L + +R   AD L+ G +V+RH+ +GD VLFNRQPSLH++SIMCHR ++ P
Sbjct  416   AGSSGFKKYLKFGNRNAIADGLRIGDVVERHIINGDVVLFNRQPSLHKLSIMCHRVKVRP  475

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WR+ R NE VC PYNADFDGDEM
Sbjct  476   WRSFRLNECVCGPYNADFDGDEM  498



>gb|KGB75776.1| DNA-directed RNA polymerase III largest subunit [Cryptococcus 
gattii R265]
Length=1466

 Score =   427 bits (1098),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 231/513 (45%), Positives = 316/513 (62%), Gaps = 38/513 (7%)
 Frame = -3

Query  1455  YIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY----DASKNPILNGLLDPRMGPP  1288
             Y+    PR+IK IQF  F+  ++++ +EV+V     Y    D S+   L G LD RMGP 
Sbjct  14    YVSSDVPRRIKHIQFQPFTPKDIVRISEVQVSIAELYQNNEDGSRTTALQGPLDARMGPN  73

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K K CATC  D ++C GHYGY+ L LPVF++GY    +++L CICK C+R+LL E ER 
Sbjct  74    EKGKKCATCGEDTQKCVGHYGYIKLVLPVFHIGYFRPTINMLSCICKTCARVLLPETERA  133

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              FL++ R   LE L++    K V+  C      +K  IC+ CG  NG+VKK GPL+I HE
Sbjct  134   SFLKRFRRPNLESLQRQSAAKAVLAAC------KKQNICTYCGAPNGIVKKSGPLRISHE  187

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKT---VHSLFKKMIDEDCELLY  787
                         +++    NAV+     +  +   +D      V +LF+++  EDCELL 
Sbjct  188   PYRAAKMASMKDEWMATFKNAVAENQAVATHLGKAVDDLNPLKVLNLFERITAEDCELLS  247

Query  786   LS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             L     +PE  +   I VPP  IRPSV  + G  +NE+D+T +L  I+  N++L   +  
Sbjct  248   LHPDVGRPEDYIWQYISVPPPCIRPSVASEAG--NNEDDLTAKLAEIVNYNNTLALMMDL  305

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGK  436
                     ++W  L   VA YINS   G+  Q   S+P+ GFVQRLKGKQGRFRGNLSGK
Sbjct  306   GRGIEMISSNWEVLGQAVALYINSQAPGM--QTIGSKPIRGFVQRLKGKQGRFRGNLSGK  363

Query  435   RVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAK  256
             RV+++GRTVI PDPNL+I EVA+P  +A  L++PERV+ +N++ +RQ + NG   +PGA 
Sbjct  364   RVDFSGRTVIGPDPNLRIDEVAVPEKVAVKLSYPERVTDYNLQLMRQAIINGSKLHPGAN  423

Query  255   YI--KHPDGTEISLMYS------SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
              +  KH +G+ + +  +      +RKR+A EL+ G +V RH+ DGD VLFNRQPSLH++S
Sbjct  424   VLERKHENGSTVRISLNVMKDLEARKRYARELQIGDVVHRHVRDGDIVLFNRQPSLHKLS  483

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHR R+ PWRT R NE VCNPYNADFDGDEM
Sbjct  484   IMCHRVRVRPWRTFRLNECVCNPYNADFDGDEM  516



>ref|XP_774751.1| hypothetical protein CNBF4300 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20104.1| hypothetical protein CNBF4300 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=1466

 Score =   427 bits (1098),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 231/513 (45%), Positives = 316/513 (62%), Gaps = 38/513 (7%)
 Frame = -3

Query  1455  YIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY----DASKNPILNGLLDPRMGPP  1288
             Y+    PR+IK IQF  F+  ++++ +EV+V     Y    D ++   L G LD RMGP 
Sbjct  14    YVSSDVPRRIKHIQFQPFTPKDIVRISEVQVSIAELYQNNEDGTRTTALQGPLDARMGPN  73

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K K CATC  D ++C GHYGY+ L LPVF++GY    +++L CICK C+R+LL E ER 
Sbjct  74    EKGKKCATCGEDTQKCVGHYGYIKLVLPVFHIGYFRPTINMLSCICKTCARVLLPETERA  133

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              FL++ R   LE L++    K V+  C      +K  IC+ CG  NG+VKK GPL+I HE
Sbjct  134   SFLKRFRRPNLESLQRQSAAKAVLAAC------KKQNICTYCGAPNGIVKKSGPLRISHE  187

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKT---VHSLFKKMIDEDCELLY  787
                         +++    NAV+     +  +   +D      V +LF+++  EDCELL 
Sbjct  188   PYRAAKMASMKDEWMATFKNAVAENQAVATHLAKAVDDLNPLKVLNLFERITAEDCELLS  247

Query  786   LS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             L     +PE  +   I VPP  IRPSV  + G  +NE+D+T +L  I+  N++L   +  
Sbjct  248   LHPEVGRPEDYIWQYISVPPPCIRPSVASEAG--NNEDDLTAKLAEIVNYNNTLALMMDL  305

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGK  436
                     ++W  L   VA YINS   G+  Q   S+P+ GFVQRLKGKQGRFRGNLSGK
Sbjct  306   GRGIEMISSNWEVLGQAVALYINSQAPGM--QTIGSKPIRGFVQRLKGKQGRFRGNLSGK  363

Query  435   RVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAK  256
             RV+++GRTVI PDPNL+I EVA+P  +A  L++PERV+ +N++ +RQ + NG   +PGA 
Sbjct  364   RVDFSGRTVIGPDPNLRIDEVAVPEKVAVKLSYPERVTDYNLQFMRQAIINGSKLHPGAN  423

Query  255   YI--KHPDGTEISLMYS------SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
              +  KH +G+ + +  +      +RKR+A EL+ G IV RH+ DGD VLFNRQPSLH++S
Sbjct  424   VLERKHENGSTVRISLNVMKDLEARKRYARELQIGDIVHRHVRDGDIVLFNRQPSLHKLS  483

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHR R+ PWRT R NE VCNPYNADFDGDEM
Sbjct  484   IMCHRVRVRPWRTFRLNECVCNPYNADFDGDEM  516



>gb|EZF31547.1| hypothetical protein H101_04849 [Trichophyton interdigitale H6]
 gb|KDB27388.1| hypothetical protein H109_00819 [Trichophyton interdigitale MR816]
Length=1444

 Score =   427 bits (1097),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 229/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  18    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  78    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  138   LRRPGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   +  +  K    V  +L+   V  LF+++ +ED
Sbjct  192   AFNASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISNED  251

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  309

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  310   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  427

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  519



>emb|CCF48724.1| probable RPO31-DNA-directed RNA polymerase III, 160 KD subunit 
[Ustilago hordei]
Length=1400

 Score =   426 bits (1095),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 238/505 (47%), Positives = 314/505 (62%), Gaps = 34/505 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYY--DASKNPILNGLLDPRMGPPNKTKSC  1270
              P+KIK IQF   S  +++  +E+EV  R +Y   +A + P+ NG LD R+G  +K   C
Sbjct  9     APKKIKHIQFGVLSKQDIVNMSEIEVTTRDLYTIGEAERKPVANGTLDRRLGVSDKNSLC  68

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC+    +C GHYGY+ L LPVF+VG+    + IL+ ICK C+ +LL E +R  FL++ 
Sbjct  69    ETCHLKMADCVGHYGYIKLVLPVFHVGFFKHTIAILQSICKNCATVLLEEPDRRKFLKRF  128

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY-----  928
             R   LE+L +   FK V       T  RK + C +CG  NG VKK G LKI+HE      
Sbjct  129   RKPNLENLDRTRAFKAV------NTIARKVLYCPKCGYTNGTVKKQGQLKIVHEKFRAKK  182

Query  927   GSQFLDECHNAVSNKTK-GSITVPPELDSKT-------VHSLFKKMIDEDCELLYLS---  781
              +   DE   + +   K G+  + P L+             LFK++ DEDCELL L    
Sbjct  183   TAAEHDEFRASFATNIKMGNGDISPHLNRAQEDLNPLKALDLFKRISDEDCELLGLRPEF  242

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI---SDTT  610
              +PE+ +   I VPP+ IRPSV  DG   +NE+D+T +L  II  NS L+  +      T
Sbjct  243   GRPEEYIWQYICVPPVCIRPSVAQDGA--TNEDDVTIKLTEIIFTNSLLKLGLVKGGKGT  300

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRV  430
               ++ +  W  LQ+ VA YINS++ G+P Q    +P  GF QRLKGKQGRFRGNLSGKRV
Sbjct  301   TTSQLVQQWEFLQLTVALYINSELPGVPTQ-PGQKPSRGFCQRLKGKQGRFRGNLSGKRV  359

Query  429   EYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI  250
             +++GRTVI PDPNLKI EVA+P  +A+ILT+PERV  HNIE+LRQ VRNG + +PGA Y+
Sbjct  360   DFSGRTVIGPDPNLKIDEVAVPQRVAKILTYPERVFEHNIEQLRQAVRNGTDVHPGANYL  419

Query  249   KH-PDGTEISLMYSS-RKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARI  76
                  G +  L +   R+  A +L+ G IV+RH+ DGD VLFNRQPSLH++SIM HRA+I
Sbjct  420   MDGKTGFKRFLKFPGMREELAQKLRVGDIVERHIRDGDIVLFNRQPSLHKLSIMSHRAKI  479

Query  75    MPWRTLRFNESVCNPYNADFDGDEM  1
              PWRT R NE  CNPYNADFDGDEM
Sbjct  480   RPWRTFRLNECACNPYNADFDGDEM  504



>ref|XP_003194994.1| DNA-directed RNA polymerase III largest subunit [Cryptococcus 
gattii WM276]
 gb|ADV23207.1| DNA-directed RNA polymerase III largest subunit, putative [Cryptococcus 
gattii WM276]
Length=1463

 Score =   427 bits (1098),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 231/513 (45%), Positives = 316/513 (62%), Gaps = 38/513 (7%)
 Frame = -3

Query  1455  YIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY----DASKNPILNGLLDPRMGPP  1288
             Y+    PR+IK IQF  F+  ++++ +EV+V     Y    D S+   L G LD RMGP 
Sbjct  14    YVSSDVPRRIKHIQFQPFTPKDIVRISEVQVSIAELYQNNEDGSRTTALQGPLDARMGPN  73

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
              K K CATC  D ++C GHYGY+ L LPVF++GY    +++L CICK C+R+LL E ER 
Sbjct  74    EKGKKCATCGEDTQKCVGHYGYIKLVLPVFHIGYFRPTINMLSCICKTCARVLLPETERA  133

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              FL++ R   LE L++    K V+  C      +K  IC+ CG  NG+VKK GPL+I HE
Sbjct  134   SFLKRFRRPNLESLQRQSAAKAVLAAC------KKQNICTYCGAPNGIVKKSGPLRISHE  187

Query  930   ---------YGSQFLDECHNAVSNKTKGSITVPPELDSKT---VHSLFKKMIDEDCELLY  787
                         +++    NAV+     +  +   +D      V +LF+++  EDCELL 
Sbjct  188   PYRAAKMASMKDEWMATFKNAVAENQAVATHLGKAVDDLNPLKVLNLFERVTAEDCELLS  247

Query  786   LS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISD  616
             L     +PE  +   I VPP  IRPSV  + G  +NE+D+T +L  I+  N++L   +  
Sbjct  248   LHPDVGRPEDYIWQYISVPPPCIRPSVASEAG--NNEDDLTAKLAEIVNYNNTLALMMDL  305

Query  615   TTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGK  436
                     ++W  L   VA YINS   G+  Q   S+P+ GFVQRLKGKQGRFRGNLSGK
Sbjct  306   GRGIEMISSNWEVLGQAVALYINSQAPGM--QTIGSKPIRGFVQRLKGKQGRFRGNLSGK  363

Query  435   RVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAK  256
             RV+++GRTVI PDPNL+I EVA+P  +A  L++PERV+ +N++ +RQ + NG   +PGA 
Sbjct  364   RVDFSGRTVIGPDPNLRIDEVAVPEKVAVKLSYPERVTDYNLQLMRQAIINGSKLHPGAN  423

Query  255   YI--KHPDGTEISLMYS------SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMS  100
              +  KH +G+ + +  +      +RKR+A EL+ G +V RH+ DGD VLFNRQPSLH++S
Sbjct  424   VLERKHENGSTVRISLNVMKDLEARKRYARELQIGDVVHRHVRDGDIVLFNRQPSLHKLS  483

Query  99    IMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             IMCHR R+ PWRT R NE VCNPYNADFDGDEM
Sbjct  484   IMCHRVRVRPWRTFRLNECVCNPYNADFDGDEM  516



>ref|XP_010120226.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like, 
partial [Chlamydotis macqueenii]
Length=509

 Score =   403 bits (1036),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 304/495 (61%), Gaps = 29/495 (6%)
 Frame = -3

Query  1419  IQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCATCNGDFK  1246
             I F   S  E+ + A ++V     Y  D   +P+  G+LD RMG   K + C TC     
Sbjct  3     ICFGMKSPEEMRQQAHIQVVSKNLYSQDNHHSPLQYGVLDHRMGTSEKDRPCETCGKSLA  62

Query  1245  ECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHL  1066
             +C GHYGY++L LP F+VGY   ++ IL+ ICK C RI+L  +E+  FL  ++   L +L
Sbjct  63    DCLGHYGYIDLELPCFHVGYFKAVIGILQMICKTCCRIMLSLEEKKQFLDYLKRPGLTYL  122

Query  1065  KKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-----------YGS  922
             +K  L K+V ++C      RK   C  CG  NG VKK G LKIIHE             S
Sbjct  123   QKRGLKKKVSEKC------RKKNTCPYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPVVS  176

Query  921   QFLDECHNAVSNKTKGSITV---PPELDSKTVHSLFKKMIDEDCELLYL---SDKPEKLL  760
              FL     A+ +  +    +      L+   V +LFK++  ED  LL +   + KP  L+
Sbjct  177   TFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDIPLLLMNPEAGKPSDLI  236

Query  759   VTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWV  580
             +T + VPP+ IRPSV  D    +NE+D+T +L  II  N  +++           +  W 
Sbjct  237   LTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWD  296

Query  579   DLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISP  400
              LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRGNLSGKRV+++GRTVISP
Sbjct  297   FLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISP  356

Query  399   DPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEIS-  223
             DPNL+I EVA+PI +A+ILTFPE+V++ NI  +R+ VRNGP+ +PGA +I+    T++  
Sbjct  357   DPNLRIDEVAVPIHVAKILTFPEKVNKANINFMRKLVRNGPDVHPGANFIQQ-RHTQMKR  415

Query  222   -LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNE  46
              L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH++SIM H AR+ P RT RFNE
Sbjct  416   FLKYGNREKMAQELKFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNE  475

Query  45    SVCNPYNADFDGDEM  1
              VC PYNADFDGDEM
Sbjct  476   CVCTPYNADFDGDEM  490



>ref|XP_003012110.1| hypothetical protein ARB_01618 [Arthroderma benhamiae CBS 112371]
 gb|EFE31470.1| hypothetical protein ARB_01618 [Arthroderma benhamiae CBS 112371]
Length=1444

 Score =   427 bits (1097),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 229/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  18    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  78    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  138   LRRPGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   +  +  K    V  +L+   V  LF+++ +ED
Sbjct  192   AFNASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISNED  251

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  309

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  310   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  427

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|KFM60620.1| DNA-directed RNA polymerase III subunit RPC1, partial [Stegodyphus 
mimosarum]
Length=783

 Score =   412 bits (1058),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 313/512 (61%), Gaps = 30/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL-NGLLDPRMG  1294
               K+ + E    +KI  I F   S  ++ + A V       Y+ + +  +  G+LDP+MG
Sbjct  1     MVKEQFRESHLSKKISKISFGLQSAIDIRQQAHVSCVNMTLYEGNTHEAVPYGVLDPKMG  60

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
                K + CATC     +C GH+GY++L LPVF+VGY    + IL+ ICK CSR+LL   E
Sbjct  61    TSRKNQKCATCGKQVSDCIGHFGYIDLKLPVFHVGYFRSTITILQTICKTCSRVLLNSNE  120

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKII  937
             R  F   ++   + +L+K  L K++V  C       K  +C  C  VNG VKK G LKI+
Sbjct  121   RKKFSEILKRPNISYLQKKTLRKQIVDLCM------KKSVCPYCQAVNGQVKKAGCLKIV  174

Query  936   HEYGS----------QFLDECHNAVSNKT-----KGSITVPPELDSKTVHSLFKKMIDED  802
             H+             ++LDE   A+ N       K  +T+   LD   V  LFK+++DED
Sbjct  175   HDKYKKEKRSDPVLLEYLDEFDEAMKNNKELEHCKNKLTLI-NLDPLKVLDLFKRIVDED  233

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL ++    +PE L++T +PVPP+ IRPSV  +    +NE+D+T +L  IIQ N  ++
Sbjct  234   IPLLLMNPHVGRPEHLILTKLPVPPLCIRPSVISEVKSGTNEDDMTTKLTGIIQLNQEIQ  293

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLS-GFVQRLKGKQGRFR  454
                +   L    +  W +LQ  VA YINSD+ G+  +MQ  +    G VQRLKGK GRFR
Sbjct  294   MHGASAPL-KHVMKVWDNLQTHVALYINSDLSGVNMEMQLLKTTGRGIVQRLKGKHGRFR  352

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRVE+TGRTVISPDPNL I +V IP  +A+ILT+PE V++HN+++L+  + NG  
Sbjct  353   GNLSGKRVEFTGRTVISPDPNLPIDQVGIPEHVAKILTYPEMVTKHNMKQLKALILNGGY  412

Query  273   KYPGAK-YIKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             K+PGA  YI+     +  L Y++R+R AD LK G IV+RH+ DGD VLFNRQPSLH++SI
Sbjct  413   KHPGANFYIERNTKMKSDLNYANRRRIADNLKCGDIVERHMLDGDVVLFNRQPSLHKLSI  472

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M H+A+I+P RT RFNE VC PYNADFDGDEM
Sbjct  473   MAHKAKIVPTRTFRFNECVCTPYNADFDGDEM  504



>ref|XP_001393726.1| DNA-directed RNA polymerase III subunit RPO31 [Aspergillus niger 
CBS 513.88]
 emb|CAK96852.1| unnamed protein product [Aspergillus niger]
Length=1450

 Score =   427 bits (1097),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    ++D   +   + NG LD RMG  NKT SC T
Sbjct  21    PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFDLDHDRAVVANGPLDARMGISNKTSSCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ +CK CSRILL E +R  +LR+MR 
Sbjct  81    CGGTLQICNGHFGHVRLVLPAFHVGYFKRVITILQEVCKECSRILLPEADRRAYLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRGQIAKRINERC------RKTRNCEACGAVNGVVKKAGTSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   + +   K       ++++  V +LFKK+ D DCEL
Sbjct  195   ASTSVKKVPPPSKIVFDRSFDEARTSNAEVEKHYKKAQDDMNALRVLNLFKKISDTDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  431

Query  261   AKYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A YI     T ++ L Y +    AD+L+ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIMKKGQTFKLFLKYGNLNMIADQLQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_003177700.1| DNA-directed RNA polymerase III subunit RPC1 [Microsporum gypseum 
CBS 118893]
 gb|EFQ98748.1| DNA-directed RNA polymerase III subunit RPC1 [Microsporum gypseum 
CBS 118893]
Length=1429

 Score =   426 bits (1096),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 229/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  17    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  76

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  77    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  136

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  IC  C  +NG VKK   G LKI+H+   
Sbjct  137   LRRPGLDNLRRMQINKRINVRC------RKTPICYYCNAINGTVKKASTGALKIVHDKFR  190

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   +  +  K    V  +L+   V  LF+++ +ED
Sbjct  191   AFNASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISNED  250

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  251   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  308

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  309   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  366

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  367   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  426

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G +V+RHLEDGD VLFNRQPSLH++SI
Sbjct  427   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDVVERHLEDGDIVLFNRQPSLHKLSI  486

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  487   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  518



>ref|XP_009951311.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like, 
partial [Leptosomus discolor]
Length=509

 Score =   403 bits (1035),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 224/495 (45%), Positives = 305/495 (62%), Gaps = 29/495 (6%)
 Frame = -3

Query  1419  IQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCATCNGDFK  1246
             I F   S  E+ + A ++V     Y  D   +P+  G+LD RMG   K + C TC  +  
Sbjct  3     ICFGMKSPEEMRQQAHIQVVSKNLYSQDNHHSPLQYGVLDHRMGTSEKDRPCETCGKNLA  62

Query  1245  ECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHL  1066
             +C GHYGY++L LP F+VGY   ++ IL+ ICK C RI+L  +E+  FL  ++   L +L
Sbjct  63    DCLGHYGYIDLELPCFHVGYFKAVIGILQMICKTCCRIMLSVEEKKQFLDYLKRPGLTYL  122

Query  1065  KKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-----------YGS  922
             +K  L K+V ++C      RK   C  CG  NG VKK G LKIIHE             S
Sbjct  123   QKRGLKKKVSEKC------RKKNTCPYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVS  176

Query  921   QFLDECHNAVSNKTKGSITV---PPELDSKTVHSLFKKMIDEDCELLYL---SDKPEKLL  760
              FL     A+ +  +    +      L+   V +LFK++  ED  LL +   + KP  L+
Sbjct  177   TFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDIPLLLMNPEAGKPSDLI  236

Query  759   VTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWV  580
             +T + VPP+ IRPSV  D    +NE+D+T +L  II  N  +++           +  W 
Sbjct  237   LTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWD  296

Query  579   DLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISP  400
              LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRGNLSGKRV+++GRTVISP
Sbjct  297   FLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISP  356

Query  399   DPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEIS-  223
             DPNL+I EVA+PI +A+ILTFPE+V++ NI  +R+ VRNGP+ +PGA +I+    T++  
Sbjct  357   DPNLRIDEVAVPIHVAKILTFPEKVNKANINFMRKLVRNGPDVHPGANFIQQ-RHTQMKR  415

Query  222   -LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNE  46
              L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH++SIM H A++ P RT RFNE
Sbjct  416   FLKYGNREKMAQELKFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIAKVKPHRTFRFNE  475

Query  45    SVCNPYNADFDGDEM  1
              VC PYNADFDGDEM
Sbjct  476   CVCTPYNADFDGDEM  490



>ref|XP_003232017.1| DNA-directed RNA polymerase III largest subunit [Trichophyton 
rubrum CBS 118892]
Length=1444

 Score =   426 bits (1095),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  18    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  78    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  138   LRRPGLDNLRRMQINKRINVRC------RKTPVCFYCNAINGTVKKASTGALKIVHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   +  +  K    V  +L+   V  LF+++ +ED
Sbjct  192   AFNASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISNED  251

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEGA--STEDDLTAKLGDIVQSNLNLK  309

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A Y+NSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  310   MAL-DKGAPVQTIIECWDYMQLQIAVYVNSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQC+RNG  
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQCIRNGTK  427

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLEDGD VLFNRQPSLH++SI
Sbjct  428   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLEDGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|EPS27070.1| hypothetical protein PDE_02011 [Penicillium oxalicum 114-2]
Length=1447

 Score =   426 bits (1095),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 233/508 (46%), Positives = 314/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   +  +++  A VEV    ++D   +   + NG LD RMG  NKT  C T
Sbjct  21    PKVIKELKFGVLTNDDIVSQAVVEVSDRKFFDLDHDRAVVSNGPLDARMGISNKTAQCKT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C    KEC GH+G++ L LP F+VGY   ++ IL+ ICK CSRILL E ER  FLR+MR 
Sbjct  81    CGHMLKECNGHFGHVRLVLPAFHVGYFKRVIGILQEICKECSRILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  C  +NG+VKK     LKIIH+    F 
Sbjct  141   PGLDNLRRMQIAKRINERC------RKTRQCEHCQAINGVVKKAGSSALKIIHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                  E  NA S   K       ++++  V  LFKK+ + DCEL
Sbjct  195   SSTSVKKQPPISKTVFDDSFAEARNANSEIEKHFKKAQDDMNALRVLKLFKKISNSDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L  K   PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLDPKEARPEMFLWQFIPAPPVCIRPSVGQEGA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL++ V NG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQKRVLNGSKKWPG  431

Query  261   AKYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y+   D T ++ L Y + K  A+EL+ G  V+RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYLMKKDSTFKMMLKYGNLKHVANELQEGDTVERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             AR+ P RT R NE VCNPYNADFDGDEM
Sbjct  492   ARVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|EWM23672.1| rna polymerase largest subunit [Nannochloropsis gaditana]
Length=1491

 Score =   427 bits (1097),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 227/514 (44%), Positives = 322/514 (63%), Gaps = 34/514 (7%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRG-VYYDASKNPILNGLLDPRMGPP  1288
             K+P   ++ P+KI  IQF   S +++ + +E +VYR  ++    + P  N  LDPR+G  
Sbjct  2     KEPVRGEIAPKKISHIQFGLLSANQMERISEFQVYRSDLFTMPHRAPAPNSPLDPRLGVS  61

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             +KT SCATC     +C GH+G++ LALPVF++G+      +L CICK C R+LL E ER 
Sbjct  62    DKTSSCATCKRKLTDCAGHFGHVKLALPVFHIGFFKHCQTLLACICKTCGRVLLPEAERR  121

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK----GPLKI  940
              FLR+MR+   + L+K  +FKRVV++C      +KA  C  C  VNG +KK      LK+
Sbjct  122   SFLRQMRSPSADALRKAGIFKRVVEKC------KKASYCFECKAVNGKIKKIAGAATLKL  175

Query  939   IHE-YGSQFLDECHNAVSNKTKGSIT----VPPELDSKT-------VHSLFKKMIDEDCE  796
             +HE Y  +     H A+    K ++     +   LD          V+ LF+K+ DED  
Sbjct  176   VHERYSGRNGGVEHQALVRAMKTALAHNREIANHLDKAQEDMSPLRVYQLFQKITDEDAV  235

Query  795   LLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
             +L+L  K   PE LL+ ++ VPP+ IRPSV ++ G  SNE+D+T +L  I+Q N S+R  
Sbjct  236   VLWLDPKHGRPEDLLLHNLLVPPVPIRPSVAMEVGGGSNEDDLTTQLVEILQINHSVRML  295

Query  624   ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
             ++        +  W   Q +V+++IN ++ G   Q    + + G  QRLKGK GRFRGNL
Sbjct  296   LAGGGQQQSIMEQWGFEQAQVSRFINGELPG-SQQHYGEKKIRGLCQRLKGKSGRFRGNL  354

Query  444   SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
             SGKRV+++GRTVISPDPNL I +V +P+ +A+I+T+PERVS  N E+L++ V NGP+ +P
Sbjct  355   SGKRVDFSGRTVISPDPNLAIDQVGVPLQVAKIMTYPERVSASNRERLKRLVLNGPSHHP  414

Query  264   GAKYIKHPDGTEI---SLMYS---SRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             GA  I+ P G      SL Y+    R++ A++LK G +V+RH+ D D VLFNRQPSLH++
Sbjct  415   GANIIR-PSGDNAFTKSLSYADERQRRKMAEDLKLGDVVERHMVDEDVVLFNRQPSLHKL  473

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM HR ++MPWRT RFNE VC PYNADFDGDEM
Sbjct  474   SIMAHRVKVMPWRTFRFNECVCAPYNADFDGDEM  507



>ref|XP_001737245.1| DNA-directed RNA polymerase III subunit RPC1 [Entamoeba dispar 
SAW760]
 gb|EDR26493.1| DNA-directed RNA polymerase III subunit RPC1, putative [Entamoeba 
dispar SAW760]
Length=1379

 Score =   425 bits (1092),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 231/514 (45%), Positives = 317/514 (62%), Gaps = 44/514 (9%)
 Frame = -3

Query  1452  IEDVGPR----KIKSIQFSTFSGSEVMKSAEVEVYRGVYYD-ASKNPILNGLLDPRMGPP  1288
             IE VGP     K+  IQF+ FS  E+ + +E EV     +   ++ P  NG+LD R+G  
Sbjct  22    IEFVGPSERPGKVCDIQFTMFSQEEMNRESEFEVTEHFLFQPNTRKPNPNGVLDRRLGVC  81

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             +    C TC    +EC GH+  +NL LPVF++G+   I+ +L+C+CK C+RILL  +ER 
Sbjct  82    DSLSVCETCGKRIEECSGHFAVINLELPVFHIGFFRPIIQVLQCVCKNCNRILLTNEERD  141

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH-  934
              +LR+MRN K + + +  L + ++ +C    +      C  C  +NG +KK G L+++H 
Sbjct  142   FYLRRMRNKKTDTVARTYLVRALITQCRKHYNS-----CPHCNAINGSIKKYGNLRLVHD  196

Query  933   ------------EYGSQF-----LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                         E+   F     LD+  NA  +  +       +LD + V S+F+ +I E
Sbjct  197   KYHRDATITEMNEFYDGFEESIKLDKDINAFVDNAQ------EDLDPRKVLSIFRSLIRE  250

Query  804   DCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             D E +     +  PE +++TS+PVPPIAIRPSV +DGG  SNE+D+T +LK I++ N  +
Sbjct  251   DIETMDFDPDNAPPENMILTSVPVPPIAIRPSVAMDGGNASNEDDLTTQLKEIMECNDRI  310

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             ++ I     P +   SW  L + V+ +INSD   LP      +PL    QRLKGK GRFR
Sbjct  311   KEMIKRGASPYQYYDSWDQLTIAVSMFINSD---LPGCDDKGKPLRSICQRLKGKHGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNL GKRV+++GRTVISPDPNL I ++ +P LMA  LT+PERV++HNI+KLRQ V NG N
Sbjct  368   GNLLGKRVDFSGRTVISPDPNLDIEQIGVPKLMAIKLTYPERVTKHNIDKLRQLVINGSN  427

Query  273   KYPGAK-YIKHPDGTEISL--MYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
              YPG    I   DG   S+      R++ A +LK G IV+RHLED D VLFNRQPSLHR+
Sbjct  428   IYPGCNSIIGGTDGLRRSMCIKLEMREKFAKDLKIGDIVERHLEDNDIVLFNRQPSLHRI  487

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIMCH+A+I+PWRTLRFNE VC PYNADFDGDEM
Sbjct  488   SIMCHKAKILPWRTLRFNECVCTPYNADFDGDEM  521



>gb|EMS18619.1| DNA-directed RNA polymerase III subunit RPC1 [Rhodosporidium 
toruloides NP11]
 emb|CDR49616.1| RHTO0S28e01750g1_1 [Rhodosporidium toruloides]
Length=1418

 Score =   425 bits (1093),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 227/515 (44%), Positives = 307/515 (60%), Gaps = 40/515 (8%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             + D  P++IK IQFS  S  E +  AE E   R +Y    + P+ +G+LD R+G  +KT 
Sbjct  5     VADSAPKRIKHIQFSVLSSREAVAIAEFEANQRDLYTPGDRRPVEHGVLDKRLGTSDKTG  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
              C TC     +C GHY Y+ L LPVF++GY   I+ IL+CICK CSRILL   +   +L 
Sbjct  65    KCDTCGLGLADCVGHYAYIKLVLPVFHIGYFKHILSILQCICKTCSRILLDSSQHRKYLA  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--YG  925
               R   L+ L      K++   C      RK   C  CG +NG+VKK G ++I HE   G
Sbjct  125   LFRRPNLDSLTIAAYSKQLAALC------RKCTTCPHCGAINGVVKKIGTMRIGHEKWRG  178

Query  924   SQFLDECHNAVSNKTKGSIT---------------VPPELDSKT-------VHSLFKKMI  811
                  +       + KG+ T               + P +D          V +LF+K+ 
Sbjct  179   RNLKKDAGGRDGAEGKGNYTAWRESFAEAVKEDKMLEPHIDKAIDDLNPLKVLTLFRKIT  238

Query  810   DEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL L   + +PE+ L   I VPP+ IRPSV  +    +NE+D+T +L  I+  N+
Sbjct  239   SSDCELLGLDPTAGRPEEFLWQYISVPPVCIRPSVAQEAA--TNEDDLTVKLTEIVFMNA  296

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              ++  ++        +  W  LQ+ VA YINS++ G+P  M   +P+ G  QRLKGKQGR
Sbjct  297   VIKTGLAKGVTTQNLMEQWDFLQLAVATYINSEMPGIPTAM-GQKPMRGLCQRLKGKQGR  355

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I +VA+P  +A+ILT+PERV+ HNIE+LRQ VRNG
Sbjct  356   FRGNLSGKRVDFSGRTVISPDPNLMIDQVAVPERVAKILTYPERVTAHNIERLRQAVRNG  415

Query  279   PNKYPGAKYIKH--PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHR  106
              + +PGA +I     DG++  L Y  R+  AD+L+ G +V+RHL D D VLFNRQPSLHR
Sbjct  416   TDVHPGANFINQGGGDGSKKFLKYGDREFMADKLRVGDVVERHLRDDDIVLFNRQPSLHR  475

Query  105   MSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             +SI+ HR ++ PWRT R NE VC PYNADFDGDEM
Sbjct  476   LSILSHRVKVRPWRTFRLNECVCTPYNADFDGDEM  510



>gb|EKV16185.1| DNA-directed RNA polymerase [Penicillium digitatum PHI26]
 gb|EKV19382.1| DNA-directed RNA polymerase [Penicillium digitatum Pd1]
Length=2075

 Score =   430 bits (1106),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 235/512 (46%), Positives = 321/512 (63%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYD--ASKNPILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   +  +++  A VEV    ++D   ++  + NG LD RMG  NKT +
Sbjct  645   DSVPKVIKELKFGVLTNDDIVGQAVVEVSDRKFFDLDQTRTVVANGPLDQRMGISNKTDA  704

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATC  + K+C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  +LR+
Sbjct  705   CATCGNNLKDCNGHFGHVRLILPSFHVGYFKRVISILQEICKECSNILLPEAERRSYLRE  764

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHE---  931
             MR   L++L++ ++ KR+ +RC      RK   C+ CG +NG+VKK     LKI H+   
Sbjct  765   MRRPGLDNLRRTQIAKRINERC------RKTRECTYCGAINGVVKKTGTSALKITHDKFR  818

Query  930   ------------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                               + + FL E   A  +  K       +++   V  LFKKM D 
Sbjct  819   AFNVSVSVKKQTPISKDVFDNSFL-EARGANPDVEKHFKKAQDDMNPLRVLKLFKKMSDS  877

Query  804   DCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             DCEL+ ++ K   PE  L   IP PP+ IRPSV  DG   S E+D+T +L  I+Q+N +L
Sbjct  878   DCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGA--STEDDLTAKLGDIVQSNINL  935

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             +  +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFR
Sbjct  936   KNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFR  994

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q + NG N
Sbjct  995   GNLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPELVTRYNKEKLQQRICNGSN  1054

Query  273   KYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             K+PGA  I K   G    L YS+ +R AD L+ G +V+RHLEDGD VLFNRQPSLH++SI
Sbjct  1055  KWPGANLIVKKGTGFRQMLKYSNTQRMADALQEGDLVERHLEDGDIVLFNRQPSLHKLSI  1114

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H A+I P RT R NE VCNPYNADFDGDEM
Sbjct  1115  LSHFAKIRPHRTFRLNECVCNPYNADFDGDEM  1146



>gb|KDR83341.1| hypothetical protein GALMADRAFT_235418 [Galerina marginata CBS 
339.88]
Length=1401

 Score =   425 bits (1093),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 225/498 (45%), Positives = 312/498 (63%), Gaps = 28/498 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E E+ +R +Y    + P+  G+LD R+G  +K   C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFEITHRDLYTPTDRLPVKGGVLDRRLGTTDKNAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GHY Y+ L +PVF++GY    + IL+ ICK C+R+LL E +R  +L++ R 
Sbjct  69    CGQSSVNCVGHYAYIKLVVPVFHIGYFKHTIAILQAICKTCARVLLDEPDRRTYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--GSQFL  913
               LE++++  L K V      M   RK V C  C   NG VKK G LKIIH+     +  
Sbjct  129   PVLENIQRQALSKAV----NGM--ARKVVYCPYCSATNGAVKKAGALKIIHDKFRAKKTA  182

Query  912   DECH-------NAVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             DE         +AV  + +  +     V  +L+   V  LF+++ DEDCELL L     +
Sbjct  183   DELEKFKMTFASAVEAQKELGMYINKAVHEDLNPLKVLDLFRRISDEDCELLGLHPEWGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N  ++  ++      + 
Sbjct  243   PEEFIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNQLIKSGLAKGAPTPQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P Q+   +P+ GFVQRLKGKQGRFRGNLSGKRV+++ R
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQL-GQKPIRGFVQRLKGKQGRFRGNLSGKRVDFSAR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDG  235
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNI  L++ VRNGP+ +PGA ++   D 
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTAHNIHLLKKAVRNGPDVHPGANFVARGDN  419

Query  234   TEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLR  55
              +  L + +R   AD L  G +V+RH+ DGD VLFNRQPSLH++SIMCHRA++ PWRT R
Sbjct  420   KKF-LRFGNRTAIADGLSIGDVVERHIIDGDIVLFNRQPSLHKLSIMCHRAKVRPWRTFR  478

Query  54    FNESVCNPYNADFDGDEM  1
              NE VC PYNADFDGDEM
Sbjct  479   LNECVCGPYNADFDGDEM  496



>gb|KFX97034.1| hypothetical protein V490_03019 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFY48473.1| hypothetical protein V495_01287 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY59214.1| hypothetical protein V497_04438 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=1479

 Score =   426 bits (1095),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 225/514 (44%), Positives = 312/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTESERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     VP E                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVVPLEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRMIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAADGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR C+R G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRDCIRRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>emb|CEG69561.1| Putative DNA-directed RNA polymerase [Rhizopus microsporus]
Length=1384

 Score =   424 bits (1091),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 223/492 (45%), Positives = 314/492 (64%), Gaps = 25/492 (5%)
 Frame = -3

Query  1425  KSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATCNGDF  1249
             + +QF   S   ++K AE EV  R +Y   S+ P+  G+LD R+G   K   C TC    
Sbjct  6     RYLQFGVLSPQNMVKIAEFEVTQRDLYKPESRIPVRGGVLDLRLGTTLKDAVCETCGQKM  65

Query  1248  KECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEH  1069
             +EC GH+GY+ L LP+F+VGY   +++IL+ ICK CSR++L E +R  +LR++R   L++
Sbjct  66    QECAGHWGYVKLVLPIFHVGYFRPVINILQEICKTCSRVMLEEADRRMYLRRLRAPGLDN  125

Query  1068  LKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--SQFLDECHN  898
             L++N + K++ ++C      +K   C  C  VNG+VKK GPLKI H+     +  DE   
Sbjct  126   LQRNRVLKQIQEKC------KKVTYCMHCNAVNGVVKKVGPLKITHDKYRLKRVADEAEQ  179

Query  897   AVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD---KPEKLLV  757
                +    + ++P           +L+   V  LF+++  EDCELL LS+   +PE  + 
Sbjct  180   FRKSFETAAASMPELKPHLSKAQDDLNPLRVLRLFQRISPEDCELLGLSEEHGRPEWYIW  239

Query  756   TSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVD  577
               +PVPP  IRPSV V     SNE+D+T +L  II  N+ +R  +      +  +  W  
Sbjct  240   QYLPVPPSCIRPSV-VQEDNTSNEDDLTAKLTEIIFTNAIIRAGLERGVAVSTLMEQWEF  298

Query  576   LQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPD  397
             LQ+  A YINS++ G+     A +P  G  QRLKGKQGRFRGNLSGKRV+++GRTVISPD
Sbjct  299   LQLAAALYINSELPGVL-NANAGKPTRGLCQRLKGKQGRFRGNLSGKRVDFSGRTVISPD  357

Query  396   PNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEISLM  217
             PN++I +VA+P  +A++LTFPERV+RHNI+KLRQ + NGP  +PGA +++  +G +  L 
Sbjct  358   PNMRIDQVAVPERVAKVLTFPERVNRHNIDKLRQNIINGPFVHPGANFVEKTNGFKRFLK  417

Query  216   YSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVC  37
             + +R   A +L+ G IV+RHL D D VLFNRQPSLHR+SIM H A++MPWRT RFNE VC
Sbjct  418   FGNRAEIAADLQIGDIVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTFRFNECVC  477

Query  36    NPYNADFDGDEM  1
             +PYNADFDGDEM
Sbjct  478   SPYNADFDGDEM  489



>ref|XP_003320172.2| DNA-directed RNA polymerase III subunit C1 [Puccinia graminis 
f. sp. tritici CRL 75-36-700-3]
 gb|EFP75753.2| DNA-directed RNA polymerase III subunit C1 [Puccinia graminis 
f. sp. tritici CRL 75-36-700-3]
Length=1419

 Score =   425 bits (1092),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 229/522 (44%), Positives = 312/522 (60%), Gaps = 51/522 (10%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVYR-----------------GVYYDASKNPILNGL  1312
              P+KIK IQFS  S  E++  +E E  +                 G      K P   G+
Sbjct  9     APQKIKHIQFSVLSSQEIVALSEYESTQRDLYSMVGSENNGISIPGAIEPLVKKPAKGGV  68

Query  1311  LDPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRI  1132
             LD R+G  +K+  C TCN    +C GHY Y+ L LPVF++GY   ++ +L+ ICK C+R+
Sbjct  69    LDSRLGTSDKSGICGTCNAKMADCVGHYSYIKLILPVFHIGYFRAVIQMLQDICKTCARV  128

Query  1131  LLGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-  955
             LL E++R  +L K R   LE+L++  L K+V   C      RK + C  CG  NG VKK 
Sbjct  129   LLSEEDRRLYLIKFRRPNLENLQRQHLAKQVNTAC------RKIITCPYCGATNGTVKKV  182

Query  954   GPLKIIHEY-----GSQFLDECHNAVSNKTKGSITVPPELDSKT-------VHSLFKKMI  811
             G L+IIHE       +  L    +      K +  + P L           V +LF+++ 
Sbjct  183   GALRIIHEKFRAKKKADELAAFRDTFITAVKETKELGPHLHKAQEDMNPLRVLNLFRRIT  242

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL L     +PE+ +   I VPP+ IRPSV  +    +NE+D+T +L  II  N+
Sbjct  243   PSDCELLGLDPEVGRPEEYIWQYIHVPPVCIRPSVAQEAA--TNEDDLTVKLTEIIFTNT  300

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              ++  +         +  W  +Q+ VA YIN+++ G+P QM   +P+ GF QRLKGK GR
Sbjct  301   LIKTGLVKGVPTQNIMEQWEFMQLSVAMYINAELPGVPSQM-GVKPIKGFCQRLKGKTGR  359

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL ITEVA+P  +A+ILT+PERV+ HNI++LRQC+RNG
Sbjct  360   FRGNLSGKRVDFSGRTVISPDPNLSITEVAVPDRVAKILTYPERVTAHNIDRLRQCIRNG  419

Query  279   PNKYPGAKYI-----KHPDGTEI----SLMYSSRKRHADELKYGYIVDRHLEDGDAVLFN  127
             P+ +PGA Y+      +  G+ +    SL + +R   A+ L+ G  V+RHL DGD VLFN
Sbjct  420   PDIHPGANYLVAGSTTNASGSALPFKRSLKFGNRNHVANTLRLGDTVERHLHDGDVVLFN  479

Query  126   RQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RQPSLH++SIM HRA+I PWRT RFNE VC PYNADFDGDEM
Sbjct  480   RQPSLHKLSIMSHRAKIRPWRTFRFNECVCTPYNADFDGDEM  521



>ref|XP_660116.1| hypothetical protein AN2512.2 [Aspergillus nidulans FGSC A4]
 gb|EAA63997.1| hypothetical protein AN2512.2 [Aspergillus nidulans FGSC A4]
Length=2092

 Score =   430 bits (1105),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 234/508 (46%), Positives = 317/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    ++  +  ++ + NG LD RMG  NKT +C T
Sbjct  668   PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFNLENDRSIVPNGPLDARMGISNKTSTCQT  727

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  FLR+MR 
Sbjct  728   CGGALQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSHILLPEAERRAFLREMRR  787

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGSQF-  916
              +L++L++ ++ KRV  RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  788   PRLDNLRRMQIAKRVNDRC------RKTRTCENCGAVNGVVKKTGTSSLKITHDKFRAFN  841

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                L+E  ++     K       +L++  V +LFK++ D DCEL
Sbjct  842   ASTSAKKIPPPSKIVFDRSLEEARSSNPEVEKHHKKAQDDLNALRVLNLFKRISDSDCEL  901

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L  K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  902   LGLDPKEARPEMFLWQFIPAPPVCIRPSVGQDAS--STEDDLTAKLGDIVQSNINLKNAL  959

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  960   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  1018

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+QCVRNG  K+PG
Sbjct  1019  GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVNRYNKEKLQQCVRNGQKKWPG  1078

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK  +  +  L Y + K  AD+L+ G IV+RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  1079  ANYIIKKGNPLKTMLKYGNLKFIADQLQEGDIVERHIEDGDIVLFNRQPSLHKLSILSHF  1138

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  1139  AKVRPHRTFRLNECVCNPYNADFDGDEM  1166



>ref|XP_001271388.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW09962.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
clavatus NRRL 1]
Length=1449

 Score =   425 bits (1092),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 230/508 (45%), Positives = 316/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    +++   +  +  +G LD RMG  +KT +C T
Sbjct  21    PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFNLEHDRAVVPHGPLDQRMGISSKTATCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CSRILL E ER  FLR+MR 
Sbjct  81    CGGSLQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSRILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRLQIAKRINERC------RKTRTCETCGTVNGVVKKAGNSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE  N+ +   K       ++++  V +LFKK+ D DCEL
Sbjct  195   ASTSVKKVPPPSKIVFDRSFDEARNSNAEVEKHYKKAQDDMNALRVLNLFKKISDTDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNSL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE VSR+N EKL+Q VRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVSRYNKEKLQQRVRNGTKKWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK     ++ L Y +    AD+L+ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIIKKGSDFKLFLKYGNLNMIADQLQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_004464895.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 isoform 
3 [Dasypus novemcinctus]
Length=979

 Score =   415 bits (1067),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 231/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSSEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK  IC  CG  NG VKK G LKI
Sbjct  121   EKKQFLDYLKKPGLTYLQKRGLKKKISDKC------RKKSICHHCGSFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKIVDPVVSNFLHSFETAIEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPADLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ V+N
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>emb|CDI57148.1| probable RPO31-DNA-directed RNA polymerase III, 160 KD subunit 
[Melanopsichium pennsylvanicum 4]
Length=1400

 Score =   424 bits (1090),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 238/505 (47%), Positives = 313/505 (62%), Gaps = 34/505 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYY--DASKNPILNGLLDPRMGPPNKTKSC  1270
              P+KIK IQF   S  +++  +E+EV  R +Y   ++ + P+ NG LD R+G  +K   C
Sbjct  9     APKKIKHIQFGVLSKQDIVNMSEIEVTTRDLYTIGESERKPVANGTLDRRLGVSDKNSLC  68

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC+    +C GHYGY+ L LPVF+VG+    V IL+ ICK C+ +LL E +R  FL++ 
Sbjct  69    ETCHLKMADCVGHYGYIKLVLPVFHVGFFKHTVAILQSICKNCATVLLEEPDRRKFLKRF  128

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY-----  928
             R   LE+L +   FK V       T  RK + C +CG  NG VKK G LKI+HE      
Sbjct  129   RKPNLENLDRTRSFKAV------NTIARKVLYCPKCGYTNGTVKKQGQLKIVHEKFRAKK  182

Query  927   GSQFLDECHNAVSNKTK---GSIT-----VPPELDSKTVHSLFKKMIDEDCELLYLS---  781
              +   DE   + +   K   G IT        +L+      LFK++ DEDCELL L    
Sbjct  183   TAAEHDEFKASFATNIKMGNGDITPHLNKAQEDLNPLKALDLFKRISDEDCELLGLRPEF  242

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI---SDTT  610
              +PE+ +   I VPP+ IRPSV  DG   +NE+D+T +L  II  NS L+  +      T
Sbjct  243   GRPEEYIWQYICVPPVCIRPSVAQDGA--TNEDDVTIKLTEIIFTNSLLKLGLVKGGKGT  300

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRV  430
               ++ +  W  LQ+ VA YINS++ GLP Q    +P  GF QRLKGKQGRFRGNLSGKRV
Sbjct  301   TTSQLVQQWEFLQLTVALYINSELPGLPTQ-PGQKPSRGFCQRLKGKQGRFRGNLSGKRV  359

Query  429   EYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI  250
             +++GRTVI PDPNLKI EVA+P  +A+ILT+PERV  HNIE+LRQ VRNG + +PGA Y+
Sbjct  360   DFSGRTVIGPDPNLKIDEVAVPQRVAKILTYPERVFEHNIEQLRQAVRNGTDVHPGANYL  419

Query  249   KH-PDGTEISLMY-SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARI  76
                  G +  L +   R+  A +L+ G IV+RH+ DGD VLFNRQPSLH++SIM HR ++
Sbjct  420   MDGKTGFKRFLKFPGMREELAQKLRVGDIVERHIRDGDIVLFNRQPSLHKLSIMSHRVKV  479

Query  75    MPWRTLRFNESVCNPYNADFDGDEM  1
              PWRT R NE  CNPYNADFDGDEM
Sbjct  480   RPWRTFRLNECACNPYNADFDGDEM  504



>ref|XP_002176004.1| DNA-directed RNA polymerase III complex large subunit Rpc1 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB09711.1| DNA-directed RNA polymerase III complex large subunit Rpc1 [Schizosaccharomyces 
japonicus yFS275]
Length=1406

 Score =   424 bits (1089),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 225/507 (44%), Positives = 321/507 (63%), Gaps = 28/507 (6%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPP  1288
             K+P ++D  P++I+ +QF      E +K A VEV  R +Y    + P+ +G LD RMG  
Sbjct  2     KEP-VDDQVPKRIRHLQFCLSGPKEFVKDAVVEVSTRDLYTMTERKPVEHGALDRRMGTT  60

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             ++   CATC     +C GH+G++ LALPVFN+GY    + IL+ ICK C+ +L+ ++E+ 
Sbjct  61    DRNAVCATCGEGVADCIGHFGHVRLALPVFNIGYFKTTLTILQNICKDCATVLVSQREKQ  120

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
             +FL+++R   +++L++ ++ KR+   C      +K  +C  C    G+VKK GPLKIIHE
Sbjct  121   NFLKELRKPGIDNLRRTQICKRLNDAC------KKVRVCPYCNKTQGVVKKAGPLKIIHE  174

Query  930   ----------YGSQF---LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELL  790
                        G +F    D+   A+ +          +L+   V +LFK++   DCELL
Sbjct  175   RFRFNRKMQEEGGEFRQSFDQALKAMPDLRPHLHKAHDDLNPLRVLNLFKQITPMDCELL  234

Query  789   YLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEIS  619
              +     +PE LL   +P PP+ IRP+V  +G   + E+DIT +L  I+  +S +R  ++
Sbjct  235   GMDPEKGRPENLLWQYMPAPPVTIRPTVAQEGA--TTEDDITIKLTEIVWTSSLIRAALN  292

Query  618   DTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSG  439
               T     +  W  LQ+ VA YINS++ GL P    S+P  GF QRLKGKQGRFRGNLSG
Sbjct  293   KGTPINSLMEQWEFLQLSVALYINSELPGLRPPDMPSKPTRGFCQRLKGKQGRFRGNLSG  352

Query  438   KRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGA  259
             KRV+++GRTVISPDPNL+I +VA+P+ +A+ILT+PE+V+  NI+ LR  V NGP+ +PGA
Sbjct  353   KRVDFSGRTVISPDPNLQIDQVAVPLRIAKILTYPEKVTDQNIDALRTRVTNGPDVHPGA  412

Query  258   KYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRA  82
              Y+   D G +  L + +RKR A+EL  G  V+RHL+D D VLFNRQPSLH++SIM H  
Sbjct  413   NYVVDRDTGIKRFLRFGNRKRIAEELHVGDTVERHLQDNDVVLFNRQPSLHKLSIMAHLV  472

Query  81    RIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++ PWRTLRFNE VC PYNADFDGDEM
Sbjct  473   KVRPWRTLRFNECVCGPYNADFDGDEM  499



>gb|KFY39915.1| hypothetical protein V494_03749 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=1478

 Score =   425 bits (1092),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 223/514 (43%), Positives = 313/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTETERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +P E                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPAEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRLIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>gb|KGO42540.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
 gb|KGO58454.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
 gb|KGO71663.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium expansum]
Length=2075

 Score =   429 bits (1102),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 235/512 (46%), Positives = 319/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYD--ASKNPILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   +  +++  A VEV    ++D   ++  + NG LD RMG  NKT +
Sbjct  645   DSVPKVIKELKFGVLTNDDIVGQAVVEVSDRKFFDLDQTRTVVSNGPLDQRMGISNKTDA  704

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATC  + K+C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  +LR 
Sbjct  705   CATCGNNLKDCNGHFGHVRLVLPSFHVGYFKRVISILQEICKECSNILLPEAERRSYLRD  764

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHE---  931
             MR   L++L++ ++ KR+ +RC      RK   C+ CG +NG+VKK     LKI H+   
Sbjct  765   MRRPGLDNLRRTQIAKRINERC------RKTRECTYCGAINGVVKKTGTSALKITHDKFR  818

Query  930   ------------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
                               + + FL E   A     K       +++   V  LFKKM D 
Sbjct  819   AFNVSVSVKKQTPISKDVFDNSFL-EARGANPEVEKHFKKAQDDMNPLRVLKLFKKMSDS  877

Query  804   DCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             DCEL+ ++ K   PE  L   IP PP+ IRPSV  DG   S E+D+T +L  I+Q+N +L
Sbjct  878   DCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGA--STEDDLTAKLGDIVQSNINL  935

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
             +  +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFR
Sbjct  936   KNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFR  994

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q + NG N
Sbjct  995   GNLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPELVTRYNKEKLQQRICNGSN  1054

Query  273   KYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             K+PGA  I K   G    L YS+ +R AD L+ G +V+RHLEDGD VLFNRQPSLH++SI
Sbjct  1055  KWPGANLIVKKGTGFRQMLKYSNTQRMADALQEGDLVERHLEDGDIVLFNRQPSLHKLSI  1114

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H A+I P RT R NE VCNPYNADFDGDEM
Sbjct  1115  LSHFAKIRPHRTFRLNECVCNPYNADFDGDEM  1146



>gb|KGQ12286.1| DNA-directed RNA polymerase III subunit RPC1 [Beauveria bassiana 
D1-5]
Length=1480

 Score =   424 bits (1091),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 231/525 (44%), Positives = 318/525 (61%), Gaps = 56/525 (11%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGP  1291
             KQ  ++ V P++ + I+F   S  ++   A  E+   + YD   N  P  NG LD ++G 
Sbjct  47    KQQLVDKV-PKRFRGIKFGIQSNQDISNQAVTEISNRLLYDIENNRAPYQNGPLDYQLGT  105

Query  1290  PNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKER  1111
              +KT  CATCN   + C GH+GY+ L LPVF+VGYL  I+ IL+ ICK C R+LL E +R
Sbjct  106   SSKTGKCATCNESLQNCNGHFGYVRLPLPVFHVGYLRFIISILQEICKDCGRVLLDEPQR  165

Query  1110  LDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH  934
               FL ++R   +++L++ ++ K++ ++C      RK   C  CG VNG ++K G LK++H
Sbjct  166   QQFLSELRRPLIDNLRRTQICKKINEQC------RKTKNCPYCGSVNGQIRKFGVLKLVH  219

Query  933   EYGSQFLDECHNAVSNKTKGSITVPPE-----------------------------LDSK  841
             +   +F+        NK+     VPPE                             L+  
Sbjct  220   D---KFIS------YNKSTAIKKVPPESKILFDASFTEAKRENPELEKHLRKAMEDLNPL  270

Query  840   TVHSLFKKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITE  670
              V +LFK +   DCELL L+    +PE  +   +P PP+ IRPSV  D    SNE+DIT 
Sbjct  271   RVLNLFKLITATDCELLGLNATEGRPEMFIWQFLPAPPVCIRPSVAQDNA--SNEDDITT  328

Query  669   RLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGF  490
             +L  I+  +  +R  +   +     +  W  LQ ++A Y+NSDV GL  Q    + + GF
Sbjct  329   KLADIVWVSGMIRSALQKGSAIQTIMEQWEYLQTQIAMYVNSDVPGLQ-QPGFGKAMRGF  387

Query  489   VQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNI  310
              QRLKGKQGRFRGNLSGKRV+++GRTVISPDPNL I EVAIP L+A+ LT+PERV R NI
Sbjct  388   CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAIPQLVAKNLTYPERVQRQNI  447

Query  309   EKLRQCVRNGPNKYPGAKYIKHPD--GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAV  136
              KLRQCV+NGP+ +PGA+ +   D  G +I+L + +R   A +L+ G +V+RH+EDGD V
Sbjct  448   AKLRQCVKNGPDVWPGAQSVIKMDEGGYKINLKFGNRNMVARDLRIGDVVERHIEDGDIV  507

Query  135   LFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LFNRQPSLH++SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  508   LFNRQPSLHKLSIMSHLVKVRPWRTFRLNECVCNPYNADFDGDEM  552



>gb|KFY10944.1| hypothetical protein V492_04762 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=1478

 Score =   424 bits (1091),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 223/514 (43%), Positives = 313/514 (61%), Gaps = 52/514 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K ++F   S  +++    +EV   + YD  KN  P+ NG +DPR+G  +KT  C T
Sbjct  27    PKRFKELKFGVQSTRDIVNQGVLEVSDRMLYDVEKNRKPVPNGAVDPRLGTSSKTGRCET  86

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      C GH+G++ LALP F++GYL +++ IL+ ICK C+R+LL E ER  FL+++R 
Sbjct  87    CGEGLNNCNGHFGHVRLALPAFHIGYLKLVIAILQEICKDCARVLLTETERRQFLKELRR  146

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  C  VNG ++K G  K+ H+   +FL  
Sbjct  147   PNIDNLKRTQICKKINAQC------RKAKTCPYCSAVNGQIRKTGVFKLTHD---KFL--  195

Query  906   CHNAVSNKTKGSITVPPE----------------------------LDSKTVHSLFKKMI  811
                A +  T     +P E                            L+   V +LF+ + 
Sbjct  196   ---AYNKSTAAKKVIPAEKAAFDKSFVEAKKTNAELDKHLKKAMDDLNPLRVLNLFRLIT  252

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL ++    +PE  L   +P PPI IRPSV  DG   S E+D+T +L  I+  +S
Sbjct  253   PTDCELLGINPSEGRPEMFLWQYVPAPPICIRPSVAQDGA--STEDDLTSKLGDIVHISS  310

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              +R  +         +  W  LQ+++A Y+NSDV GL  Q    + + GF QRLKGKQGR
Sbjct  311   LIRSALQKGQPIQTIMEQWEYLQLQIAMYVNSDVPGL-QQPGFGKAIRGFCQRLKGKQGR  369

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++GRTVISPDPNL I EVAIPIL+A  +T+PERV   NI KLR+C++ G
Sbjct  370   FRGNLSGKRVDFSGRTVISPDPNLSIEEVAIPILVATNMTYPERVHDRNIHKLRECIKRG  429

Query  279   PNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRM  103
             P K+PGA  + K  DG ++SL ++ R+  A+ L+ G +V+RHLEDGD +LFNRQPSLH++
Sbjct  430   PGKWPGANIVEKKMDGRKVSLKHADREYTANTLRVGDVVERHLEDGDIILFNRQPSLHKL  489

Query  102   SIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SIM H  ++ PWRT RFNE VC PYNADFDGDEM
Sbjct  490   SIMSHYVKVRPWRTFRFNECVCGPYNADFDGDEM  523



>ref|XP_011112227.1| hypothetical protein H072_6431 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39758.1| hypothetical protein H072_6431 [Dactylellina haptotyla CBS 200.50]
Length=1439

 Score =   424 bits (1089),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 224/515 (43%), Positives = 322/515 (63%), Gaps = 56/515 (11%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRG-VYYDASKNPILNGLLDPRMGPPNKTKSCATC  1261
             P++IK ++F   S  +++K A +EV    ++ +  + P  NG+LDPRMG  NKT +C TC
Sbjct  22    PKRIKEVKFGILSTQDMVKQAVIEVSTDRLFNETGRQPTENGVLDPRMGISNKTDTCKTC  81

Query  1260  NGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNT  1081
               + + C GH+G++ LALP F++GY   I+ +L+ +CK CS ILL +  R  +LR++R  
Sbjct  82    GENLQACNGHFGHVKLALPAFHIGYFKHIISVLQNVCKECSCILLDDAMRRSYLREIRKP  141

Query  1080  KLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDEC  904
              +++L++ ++ K++ ++C      RK   C  CG +NG VKK GPLK+IH+    F    
Sbjct  142   GIDNLRRVQICKKINEQC------RKTKHCFGCGAINGTVKKVGPLKVIHDKFRAF----  191

Query  903   HNAVSNKTKGSITVPPE-----------------------------LDSKTVHSLFKKMI  811
                  N +  +  VPPE                             L+   V +LFKK+ 
Sbjct  192   -----NSSNAASKVPPESKVAFDKSFAEAKKTNQDLDKHLRKAMDDLNPLRVLNLFKKIS  246

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
               DCELL +     +PE  L   +P PP+ IRPSV  +    SNE+D+T +L +I + ++
Sbjct  247   PSDCELLGMDPAEGRPEMFLWQYMPAPPVCIRPSVSQEDA--SNEDDLTVKLAQITETSA  304

Query  639   SLRQEISDTTLPARSL-ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
              +R  +    +P ++L   W  +Q+++AQY+NSD+ G+  Q Q ++P+ G  QRLKGKQG
Sbjct  305   LIRAGLL-KGIPIQTLMEQWEWMQLQIAQYVNSDLPGV--QQQGTKPIRGICQRLKGKQG  361

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL I +VA+PIL+A+ LT+PERV+ +N  KL+  VRN
Sbjct  362   RFRGNLSGKRVDFSGRTVISPDPNLSIEQVAVPILVAKNLTYPERVTDYNRGKLQDLVRN  421

Query  282   GPNKYPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHR  106
             G +KYPGA Y+   D   +  L Y +R + A EL  G IV+RHLEDGD VLFNRQPSLH+
Sbjct  422   GADKYPGANYVVKKDLQYKTWLKYGNRDKTAHELAIGDIVERHLEDGDVVLFNRQPSLHK  481

Query  105   MSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             +SI+ H  ++ PW+T R NE VCNPYNADFDGDEM
Sbjct  482   LSILSHYVKVRPWKTFRLNECVCNPYNADFDGDEM  516



>ref|XP_449275.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG62249.1| unnamed protein product [Candida glabrata]
Length=1459

 Score =   424 bits (1089),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 231/518 (45%), Positives = 321/518 (62%), Gaps = 49/518 (9%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++I  ++FS  S ++++  +E+E+     +D   N  P   G LDPRMG    +  C T
Sbjct  10    PKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGVSASSMECTT  69

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C+G+   C GH+G++ LALPVF+VGY    + IL+ ICK CS ILL E+++  FL ++R 
Sbjct  70    CHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDKRHFLSELRR  129

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG-------PLKIIHE--  931
               +++L++  L K+V+ +C      +K   C  CG +NG+VKK         LKIIH+  
Sbjct  130   PGVDNLRRMALLKKVLDQC------KKQRRCLHCGALNGVVKKAAAGAGTASLKIIHDTF  183

Query  930   --YGSQFLDECHNAVSNKTKGSITVPPELDS------------KTVHSLFKKMIDEDCEL  793
                G +   E    + +  K  ++  PEL+             KT++ LFK++  EDCEL
Sbjct  184   RWVGKKSTPEKDKWIGD-WKEVLSHNPELERYVKRATDDLNPLKTLN-LFKQIASEDCEL  241

Query  792   LYL-----SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQ  628
             L +     + +PE  +   IP PP+ IRPSV +     SNE+D+T +L  I+  +S ++ 
Sbjct  242   LGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA  301

Query  627   EISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQAS--------RPLSGFVQRLKG  472
              I         +  W  LQM VA YINSD   + P M           +P+ GF QRLKG
Sbjct  302   GIEKGISINNMMEHWDYLQMTVAMYINSD--SINPAMLPGSSTGGGKVKPIRGFCQRLKG  359

Query  471   KQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQC  292
             KQGRFRGNLSGKRV+++GRTVISPDPNL I EVA+P L+A++LTFPE+V+R+NI+KLRQ 
Sbjct  360   KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQL  419

Query  291   VRNGPNKYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPS  115
             V+NGPN +PGA Y +K  +    +L Y  R++ A+ L+YG +V+RHLEDGD VLFNRQPS
Sbjct  420   VQNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPS  479

Query  114   LHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LHR+SI+ H A+I PWRT R NE VC PYNADFDGDEM
Sbjct  480   LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEM  517



>ref|XP_001263030.1| DNA-directed RNA polymerase III largest subunit, putative [Neosartorya 
fischeri NRRL 181]
 gb|EAW21133.1| DNA-directed RNA polymerase III largest subunit, putative [Neosartorya 
fischeri NRRL 181]
Length=1453

 Score =   423 bits (1088),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 228/508 (45%), Positives = 316/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++  A VEV    ++D   +  +  +G LD RMG  +KT +C T
Sbjct  21    PKVIKELKFGVLSNDDIVSQAVVEVSDRKFFDLEHDRAVVPHGPLDGRMGISSKTATCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CSRILL E ER  FLR+MR 
Sbjct  81    CGGSLQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSRILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  CG +NG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRLQIAKRINERC------RKTRTCEACGAINGVVKKAGNSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   + +   K       ++++  V +LFKK+ D DCEL
Sbjct  195   VSTSVKKVPPPSKIVFDRSFDEARTSNAEVEKHYKKAQDDMNALRVLNLFKKVSDTDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   MKGAPVQTIVECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK     ++ L Y +    AD+++ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIIKKGSDFKLFLKYGNLNMIADQIQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>emb|CCU82355.1| DNA-directed RNA polymerase III subunit RPC1 [Blumeria graminis 
f. sp. hordei DH14]
Length=1464

 Score =   424 bits (1089),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 231/515 (45%), Positives = 314/515 (61%), Gaps = 54/515 (10%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA--SKNPILNGLLDPRMGPPNKTKSCAT  1264
             P+K + ++F   S  ++   A +EV     YD    + P+ NG LDP MG  +KT +C T
Sbjct  18    PKKFRELKFGIQSIQQMAAQAVLEVSDRTLYDVENQRKPVKNGALDPLMGTSSKTGTCDT  77

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C    + C GH+G+  LALP F++GYL +I  +L+ ICK C+R+LL + ER  FL+++R 
Sbjct  78    CGEGLQTCNGHFGHCRLALPCFHIGYLKLIQMMLQNICKDCARVLLNDTERRSFLKELRR  137

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               +++LK+ ++ K++  +C      RKA  C  CG VNG ++K G LK++H+    F   
Sbjct  138   PGIDNLKRTQICKKINLQC------RKAKHCPSCGEVNGQIRKIGVLKLVHDKYQAF---  188

Query  906   CHNAVSNKTKGSITVPP------------------ELDSKT-----------VHSLFKKM  814
                   NK+  +  VPP                  ELD              V +LFK +
Sbjct  189   ------NKSTAAKKVPPPGLINFQKSFDEAKKNNNELDKHVKKAMEDLNPLRVLNLFKMI  242

Query  813   IDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
                DCELL ++    +PE  L   +P PPI IRPSV  +    S E+D+T +L  I+  +
Sbjct  243   TPPDCELLNINPAEGRPEMFLWQYVPAPPICIRPSVAQENA--STEDDLTTKLADIVHIS  300

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
             S +R  +         +  W  LQ+++A Y+NSDV GL  Q    +P+ GF QRLKGKQG
Sbjct  301   SLIRAALQKGQPIQTIVEQWDYLQLQIAMYVNSDVPGLQ-QPGFGKPIRGFCQRLKGKQG  359

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL I +VA+PIL+A+ LT+PERV R NIEKLR+CV N
Sbjct  360   RFRGNLSGKRVDFSGRTVISPDPNLGIDQVAVPILVAKNLTYPERVQRQNIEKLRKCVIN  419

Query  282   GPNKYPGAKYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHR  106
             GPN +PGA+ I   D   +ISL ++ R+  A  LK G +V+RHLEDGD VLFNRQPSLH+
Sbjct  420   GPNIHPGAQQIIKKDSDHKISLKFARRENEAKFLKIGDVVERHLEDGDIVLFNRQPSLHK  479

Query  105   MSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             +SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  480   LSIMSHYVKVRPWRTFRLNECVCNPYNADFDGDEM  514



>ref|XP_007558435.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like 
[Poecilia formosa]
Length=795

 Score =   409 bits (1051),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 224/512 (44%), Positives = 314/512 (61%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  I F   S  ++ K A ++V     Y  D  + P+  G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSAEQMRKQAHIQVVSKNLYSQDNKRTPLPYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGYL+L LP F+VGY   ++ IL+ ICK CS I+L ++
Sbjct  61    GTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSSIMLTKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ++  F+  ++   L +L+K  L K++  +C      RK  IC  CG  NG VKK G LKI
Sbjct  121   DKQQFMDYLKRPNLAYLQKRGLKKKISDKC------RKRTICLNCGAFNGSVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVP---PELDSKTVHSLFKKMIDED  802
             IHE           + S FL     A+ +       +P     L+   V +LF+++  ED
Sbjct  175   IHEKYKTTKKVVEPFVSDFLQSFDIAIEHNKLMEPLLPRAQENLNPLVVLNLFRRIPAED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   IPLLLMNPEAGKPADLIITRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRMTGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILT+PE+V++ N+E +R+ VRNGP+ 
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANLELMRKLVRNGPDV  414

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA +I+    T+I   L Y +R++ A EL+ G +V+RHL DGD VLFNRQPSLH++SI
Sbjct  415   HPGANFIQ-TRHTQIKRFLKYGNREKIAQELRIGDVVERHLIDGDIVLFNRQPSLHKLSI  473

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M H A++ P RT RFNE VC PYNADFDGDEM
Sbjct  474   MAHIAKVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_008594312.1| DNA-directed RNA polymerase III subunit RPC1 [Beauveria bassiana 
ARSEF 2860]
 gb|EJP70124.1| DNA-directed RNA polymerase III subunit RPC1 [Beauveria bassiana 
ARSEF 2860]
Length=1443

 Score =   423 bits (1087),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 230/525 (44%), Positives = 318/525 (61%), Gaps = 56/525 (11%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGP  1291
             KQ  ++ V P++ + I+F   S  ++   A  E+   + YD   N  P  NG LD ++G 
Sbjct  10    KQQLVDKV-PKRFRGIKFGIQSNQDISNQAVTEISNRLLYDIENNRAPYQNGPLDYQLGT  68

Query  1290  PNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKER  1111
              +KT  CATCN   + C GH+GY+ L LPVF+VGYL  I+ IL+ ICK C R+LL E +R
Sbjct  69    SSKTGKCATCNESLQNCNGHFGYVRLPLPVFHVGYLRFIISILQEICKDCGRVLLDEPQR  128

Query  1110  LDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIH  934
               FL ++R   +++L++ ++ K++ ++C      RK   C  CG VNG ++K G LK++H
Sbjct  129   QQFLSELRRPLIDNLRRTQICKKINEQC------RKTKNCPYCGSVNGQIRKFGVLKLVH  182

Query  933   EYGSQFLDECHNAVSNKTKGSITVPPE-----------------------------LDSK  841
             +   +F+        NK+     VPPE                             L+  
Sbjct  183   D---KFIS------YNKSTAIKKVPPESKILFDASFTEAKRENPELEKHLRKAMEDLNPL  233

Query  840   TVHSLFKKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITE  670
              V +LFK +   DCELL L+    +PE  +   +P PP+ IRPSV  D    SNE+DIT 
Sbjct  234   RVLNLFKLITATDCELLGLNATEGRPEMFIWQFLPAPPVCIRPSVAQDNA--SNEDDITT  291

Query  669   RLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGF  490
             +L  I+  +  +R  +   +     +  W  LQ ++A Y+NSDV GL  Q    + + GF
Sbjct  292   KLADIVWVSGMIRSALQKGSAIQTIMEQWEYLQTQIAMYVNSDVPGLQ-QPGFGKAMRGF  350

Query  489   VQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNI  310
              QRLKGKQGRFRGNLSGKRV+++GRTVISPDPNL I EVAIP L+A+ LT+PERV R N+
Sbjct  351   CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAIPQLVAKNLTYPERVQRQNM  410

Query  309   EKLRQCVRNGPNKYPGAKYIKHPD--GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAV  136
              KLRQCV+NGP+ +PGA+ +   D  G +I+L + +R   A +L+ G +V+RH+EDGD V
Sbjct  411   AKLRQCVKNGPDVWPGAQSVIKMDEGGYKINLKFGNRNMVARDLRIGDVVERHIEDGDIV  470

Query  135   LFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LFNRQPSLH++SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  471   LFNRQPSLHKLSIMSHLVKVRPWRTFRLNECVCNPYNADFDGDEM  515



>ref|XP_004624137.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Octodon 
degus]
Length=1390

 Score =   422 bits (1084),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 237/516 (46%), Positives = 313/516 (61%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L+G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLHGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   I+ IL+ ICK C  ILL + 
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAIIGILQMICKTCCHILLSKD  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ER  FL  +R   L +L+K  L K+V  RC      RK  +C  CG  NG VKK G LKI
Sbjct  121   ERQQFLDHLRRPGLTYLQKRGLRKKVSDRC------RKKSVCLHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+  TV SLF+++
Sbjct  175   IHEKYKTNKKVVDPMVSCFLQSFETAIEHNKE----VEPLLGRAQENLNPLTVLSLFRRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDIPLLLMNPDAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG +V+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQ-RYTQMKRFLKYGNREKMAQELKYGDVVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_010092991.1| DNA-directed RNA polymerase III subunit RPC1 [Morus notabilis]
 gb|EXB53229.1| DNA-directed RNA polymerase III subunit RPC1 [Morus notabilis]
Length=1179

 Score =   418 bits (1074),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/280 (73%), Positives = 230/280 (82%), Gaps = 13/280 (5%)
 Frame = -3

Query  804  DCELLYLSDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQE  625
            DCELLYLS +PE L++T+I VPPIAIRPSV +DG  QSNEND+TERLK+IIQ N++LRQ+
Sbjct  6    DCELLYLSVRPENLILTNISVPPIAIRPSVIMDGS-QSNENDLTERLKQIIQVNATLRQD  64

Query  624  ISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNL  445
            +S+ +  A+ L +W  LQ  VA YINSDVRG+PP     +  SGF+QRLKGKQGRFRGNL
Sbjct  65   LSEGSAAAKFLENWDALQAHVALYINSDVRGIPPPKPGEKQYSGFIQRLKGKQGRFRGNL  124

Query  444  SGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYP  265
            SGKRVEYTGRTVISPDPNLKITEVAIPI MARILT+PERVS HNIEKLRQCV NGP+KYP
Sbjct  125  SGKRVEYTGRTVISPDPNLKITEVAIPIRMARILTYPERVSHHNIEKLRQCVSNGPDKYP  184

Query  264  GAKYIKHPDGTE----ISLMY--------SSRKRHADELKYGYIVDRHLEDGDAVLFNRQ  121
            GA+ ++  DG+     I   Y         SRKR ADELKYG IV+RHLEDGD VLFNRQ
Sbjct  185  GARMLRRADGSTWQGLICFYYLCGHVSIRVSRKRLADELKYGDIVERHLEDGDIVLFNRQ  244

Query  120  PSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
            PSLHRMSIMCHRAR+MPWRTLRFNESVCNPYNADFDGDEM
Sbjct  245  PSLHRMSIMCHRARVMPWRTLRFNESVCNPYNADFDGDEM  284



>gb|EFY94113.2| DNA-directed RNA polymerase III [Metarhizium robertsii ARSEF 
23]
Length=1448

 Score =   422 bits (1086),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 230/522 (44%), Positives = 319/522 (61%), Gaps = 38/522 (7%)
 Frame = -3

Query  1482  EEMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA--SKNPILNGLL  1309
             E     KQ  +++V P++ K I+F   S  ++   A VEV   + YD   S+ P  +G L
Sbjct  4     ETQILAKQQLVDEV-PKRFKGIKFGIQSNQDLTNQAVVEVSNRLLYDIHNSRAPYAHGPL  62

Query  1308  DPRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRIL  1129
             DPR+G  NK   C+TC+   K C GH+GY+NL LP F++GYL  IV IL+ ICK CS +L
Sbjct  63    DPRLGTSNKFGKCSTCHETLKNCNGHFGYVNLPLPAFHIGYLRFIVTILQNICKTCSHVL  122

Query  1128  LGEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-G  952
             L + +R  FL+++R   L++L+++++ KR+ ++C      RK   C  C  +NG V+K G
Sbjct  123   LQDNDRQTFLKELRRPHLDNLRRSQICKRINEQC------RKVKSCPHCTSINGQVRKIG  176

Query  951   PLKIIHEYGSQF----------------LDECHNAVSNK----TKGSITVPPELDSKTVH  832
              LK+ H+  S +                 DE      N     +K       +L+   V 
Sbjct  177   VLKLTHDKFSSYNKSTSVKKVPPVAKTQFDESFATARNGNPELSKHLHKAVEDLNPLRVL  236

Query  831   SLFKKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLK  661
              LF+++   DCELL L+    +PE  +   +P PP+ IRPS+  D    SNE+D+T +L 
Sbjct  237   GLFQRIGSVDCELLGLNPSDGRPEMFIWQYLPAPPVCIRPSIAQDNA--SNEDDLTTKLA  294

Query  660   RIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQR  481
              I+  +  +R  +   +     +  W  LQ +VA YINSDV GL  Q    +P+ G  QR
Sbjct  295   DIVWVSGMIRSALQKGSPIQTIMEQWEYLQTQVAIYINSDVPGLQ-QPGFGKPIRGICQR  353

Query  480   LKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKL  301
             LKGKQGRFRGNLSGKRV+++GRTVISPDPNL I EVA+P L+A+ LT+PER  R NIEKL
Sbjct  354   LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAVPQLVAKNLTYPERAQRQNIEKL  413

Query  300   RQCVRNGPNKYPGAKYI--KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFN  127
             R+C+RNGPN +PGA+ +      G +ISL ++  +  A++L  G +V+RH+EDGD VLFN
Sbjct  414   RRCIRNGPNVWPGAQCVLKMREGGYKISLKFADTELIANKLCIGDVVERHIEDGDIVLFN  473

Query  126   RQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             RQPSLH++SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  474   RQPSLHKLSIMSHFVKVRPWRTFRLNECVCNPYNADFDGDEM  515



>gb|KEY77515.1| DNA directed RNA polymerase III largest subunit [Aspergillus 
fumigatus var. RP-2014]
Length=1453

 Score =   422 bits (1086),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++  A VEV    ++D   +  +  +G LD RMG  +KT +C T
Sbjct  21    PKVIKELKFGVLSNDDIVSQAVVEVSDRKFFDLEHDRAVVPHGPLDGRMGISSKTATCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CSRILL E ER  FLR+MR 
Sbjct  81    CGGSLQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSRILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KRV +RC      RK   C  CG +NG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRLQIAKRVNERC------RKTRTCEACGAINGVVKKAGNSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   +     K       ++++  V +LFKK+ D DCEL
Sbjct  195   VSTSVKKVPPPSKIVFDRSFDEARTSNPEVEKHYKKAQDDMNALRVLNLFKKVSDTDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   MKGAPVQTIVECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK     ++ L Y +    AD+++ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIIKKGSDFKLFLKYGNLNMIADQIQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|KHN86191.1| DNA-directed RNA polymerase III subunit RPC1 [Toxocara canis]
Length=492

 Score =   399 bits (1024),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 218/501 (44%), Positives = 308/501 (61%), Gaps = 35/501 (7%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN---PILNGLLDPRMG  1294
             K+ + E    RK+  +QF       + + A + V+    YD       P   G LDPR+G
Sbjct  3     KEQFRETDLARKVGGVQFVAGDAETMRQVAHIPVFNSKLYDECPGRWVPAPFGPLDPRLG  62

Query  1293  PPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKE  1114
                K   C TC  +  +C GH+GY++LALPVF+VG+  + + +L+CICK CS +LL  ++
Sbjct  63    TCQKNTDCQTCKQNLTDCVGHFGYVDLALPVFHVGFFRLTIQMLQCICKHCSGLLLSGEQ  122

Query  1113  RLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKGP---LK  943
             +  FLR++ N  L++L++  L KR+V      T+ +K  IC  CG  NG+VKK     LK
Sbjct  123   KKAFLRQVNNPNLDYLRRKALHKRIV------TASKKITICPHCGHKNGVVKKAVGAVLK  176

Query  942   IIHEYGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCELLYL-----SD  778
             I H           N +      S     + ++K + +L  K    D  LL +       
Sbjct  177   IAHM----------NPIPADKMSSFMCAAQ-ENKELANLLPK----DIPLLMVRPAGTHK  221

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
              P  +L + +PVPP  IRPSV  +    + E+DIT +L  I+  N  +R+   D   P +
Sbjct  222   HPVDVLFSRLPVPPCCIRPSVVSEVKSGTTEDDITMKLSEIMLINDVIRKHKRDGA-PTK  280

Query  597   SLA-SWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYT  421
             +++ +W  LQ++ A YINS++ GLPP MQ  +P+ GF QRLKGKQGRFRGNLSGKRV+++
Sbjct  281   TISEAWDHLQVQCALYINSELSGLPPDMQPKKPIRGFTQRLKGKQGRFRGNLSGKRVDFS  340

Query  420   GRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI-KH  244
             GRTVISPDPNL+I +V +PI +A+ILTFPE V+  N+E++R+ V NG + +PGA +I + 
Sbjct  341   GRTVISPDPNLRIDQVGVPIHVAKILTFPEIVNESNMERMRKLVINGDDIHPGANHIVER  400

Query  243   PDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWR  64
               G +  L Y +R++ A++LK G IV+RHL+D D VLFNRQPSLH++SIM HRA+IMP R
Sbjct  401   STGNKKFLRYGNREQTAEQLKVGDIVERHLDDDDVVLFNRQPSLHKISIMSHRAKIMPGR  460

Query  63    TLRFNESVCNPYNADFDGDEM  1
             T RFNE  C PYNADFDGDEM
Sbjct  461   TFRFNECACTPYNADFDGDEM  481



>gb|EPY49320.1| DNA-directed RNA polymerase III complex large subunit Rpc1 [Schizosaccharomyces 
cryophilus OY26]
Length=1405

 Score =   422 bits (1085),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 223/503 (44%), Positives = 315/503 (63%), Gaps = 27/503 (5%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             I++  P+KIK +QF      E +K A VEV+ R +Y    ++P  +G LD  MG  NK  
Sbjct  5     IDNQVPKKIKHLQFGISGPKEFVKDATVEVFSRDLYTMTDRSPAEHGALDLHMGTSNKQI  64

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
             +C TC     +C GH+GY+ LALPVF++GY    + IL+ ICK CS +LL + E+  FL+
Sbjct  65    TCTTCGESMADCMGHFGYVKLALPVFHIGYFKATMTILQNICKDCSSVLLTDPEKRQFLK  124

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE---Y  928
             ++R   +++L+++++ KR+  +C      +K   C  C  + G+VKK GPLKIIHE   Y
Sbjct  125   ELRRPGIDNLRRSQVCKRINDQC------KKTRQCPVCDSMQGVVKKAGPLKIIHERFRY  178

Query  927   GSQFLDECHNAVSNKTKGSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLS-  781
               +  D+         +   T+P           +L+   V +LFK++   DCELL +  
Sbjct  179   ARKSQDDEGEFRHTFDEAIKTIPELKMHLTKAHDDLNPLKVLNLFKQINPVDCELLGMDP  238

Query  780   --DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTL  607
                +PE LL   +P PP+ IRPSV  +G   + E+D+T ++  I+  +S +R  +S  T 
Sbjct  239   EFGRPENLLWQYVPAPPVCIRPSVAQEGA--TTEDDLTVKITEIVWTSSLIRAALSKGTP  296

Query  606   PARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVE  427
              +  +  W  +Q+ +A YINS++ GL P    S+P  G  QRLKGK GRFRGNLSGKRV+
Sbjct  297   VSNLMEQWEFMQLSIAMYINSEMPGLRPSDMPSKPTRGLCQRLKGKSGRFRGNLSGKRVD  356

Query  426   YTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKY-I  250
             ++GRTVISPDPNL+I +VA+P  +A+ILTFPERV+  N   L+QC++NGP+ +PGA Y I
Sbjct  357   FSGRTVISPDPNLRIDQVAVPYRIAKILTFPERVTTQNKLFLQQCIKNGPDVHPGANYII  416

Query  249   KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMP  70
                   +  L + +R R AD+LK G IV+RHL D D +LFNRQPSLH++SIM H  ++ P
Sbjct  417   DRESDLKRFLRFGNRNRIADDLKIGDIVERHLNDNDVILFNRQPSLHKLSIMAHLVKVRP  476

Query  69    WRTLRFNESVCNPYNADFDGDEM  1
             WRTLRFNE VC PYNADFDGDEM
Sbjct  477   WRTLRFNECVCGPYNADFDGDEM  499



>ref|XP_754189.1| DNA-directed RNA polymerase III largest subunit [Aspergillus 
fumigatus Af293]
 gb|EAL92151.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
fumigatus Af293]
 gb|EDP52322.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
fumigatus A1163]
Length=1453

 Score =   422 bits (1086),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++  A VEV    ++D   +  +  +G LD RMG  +KT +C T
Sbjct  21    PKIIKELKFGVLSNDDIVSQAVVEVSDRKFFDLEHDRAVVPHGPLDGRMGISSKTATCQT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CSRILL E ER  FLR+MR 
Sbjct  81    CGGSLQVCNGHFGHVRLVLPAFHVGYFKRVISILQEICKECSRILLPEAERRAFLREMRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KRV +RC      RK   C  CG +NG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRLQIAKRVNERC------RKTRTCEACGAINGVVKKAGNSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   +     K       ++++  V +LFKK+ D DCEL
Sbjct  195   VSTSVKKVPPPSKIVFDRSFDEARTSNPEVEKHYKKAQDDMNALRVLNLFKKVSDTDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  313   MKGAPVQTIVECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y IK     ++ L Y +    AD+++ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYIIKKGSDFKLFLKYGNLNMIADQIQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_004202788.1| Piso0_001648 [Millerozyma farinosa CBS 7064]
 emb|CCE79572.1| Piso0_001648 [Millerozyma farinosa CBS 7064]
Length=1454

 Score =   422 bits (1085),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 226/518 (44%), Positives = 319/518 (62%), Gaps = 43/518 (8%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKT  1279
             + DV P++IK +QF   S S+++  +EVEV     YD  K      +G LD RMG  + +
Sbjct  5     VYDVAPKRIKGVQFGALSASDIIAQSEVEVQTRDLYDLEKGRTAKESGALDTRMGISSNS  64

Query  1278  KSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFL  1099
               C+TC+G+   C GH+G++ LALPVF+VGY   I+ +L+ ICK C  ILL E  R  FL
Sbjct  65    SECSTCHGNLASCHGHFGHIRLALPVFHVGYFKNIMSVLQSICKNCGAILLDETTRRSFL  124

Query  1098  RKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-----GP--LKI  940
              ++R   L++LK+ ++ KR++++C      +K   C +C  +NG+VKK     GP  LKI
Sbjct  125   NELRRPNLDNLKRMKILKRILEQC------KKQRRCVKCNHINGVVKKAASGSGPAALKI  178

Query  939   IHE---------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
             +H+               +  +F DE         K S  V  +L+   V +LFK++   
Sbjct  179   VHDTFRWIGKKPTPEKALWNEEF-DEVFARNPELEKFSKRVYDDLNPLKVLNLFKQIEPA  237

Query  804   DCELLYL----SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSS  637
             DCELL +      +PE  +   +P PP+ IRPSV +D   QSNE+D+T +L  I+  +S 
Sbjct  238   DCELLGIDPARGGRPEMYIWRYLPAPPVCIRPSVMMD--TQSNEDDLTVKLTEIVWTSSL  295

Query  636   LRQEISDTTLPARSLASWVDLQMEVAQYINSDVRG---LPPQ--MQASRPLSGFVQRLKG  472
             +R  I         +  W  LQ+ VA YINSD      LP     ++++P+ GF QRLKG
Sbjct  296   IRAGIEKGITINNLMEQWDYLQLSVAMYINSDAANSAFLPSSGGSKSAKPIRGFCQRLKG  355

Query  471   KQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQC  292
             KQGRFRGNLSGKRV+++GRTV+SPDPNL+I EVA+P  +A++LT+PE  +R+N +KL++ 
Sbjct  356   KQGRFRGNLSGKRVDFSGRTVVSPDPNLRIDEVAVPDRVAKVLTYPEMCTRYNRKKLQRL  415

Query  291   VRNGPNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPS  115
             + NGPN YPGA Y+ K  +  + +L +  R + A  L  G +V+RH+EDGD VLFNRQPS
Sbjct  416   ILNGPNTYPGANYLMKQNEAAKRNLRFGDRVKLAKNLHIGDVVERHIEDGDVVLFNRQPS  475

Query  114   LHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LHR+SI+ H A++ PWRT R NE VC PYNADFDGDEM
Sbjct  476   LHRLSILSHFAKVRPWRTFRLNECVCTPYNADFDGDEM  513



>ref|XP_011120708.1| hypothetical protein AOL_s00075g95 [Arthrobotrys oligospora ATCC 
24927]
 gb|EGX50669.1| hypothetical protein AOL_s00075g95 [Arthrobotrys oligospora ATCC 
24927]
Length=1442

 Score =   422 bits (1084),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 223/524 (43%), Positives = 328/524 (63%), Gaps = 57/524 (11%)
 Frame = -3

Query  1464  KQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRG-VYYDASKNPILNGLLDPRMGPP  1288
             K+  + +V P++IK ++F   S  +++K A +EV    ++ +  + P  NG+LDPRMG  
Sbjct  14    KEQVVSNV-PKRIKEVKFGILSTQDMVKQAVIEVSTDRLFNETGRQPTENGVLDPRMGIS  72

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             NKT +C TC  + + C GH+G++ LALP F++GY   I+ +L+ ICK CS ILL    R 
Sbjct  73    NKTDTCKTCGENLQACNGHFGHVKLALPAFHIGYFKHIISVLQNICKECSAILLDSSMRR  132

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE  931
              +L+++R   +++L++ ++ K++ ++C      RK   C  CG +NG VKK GPLK+IH+
Sbjct  133   SYLKEIRKPGIDNLRRVQICKKINEQC------RKTKACFVCGAINGTVKKVGPLKVIHD  186

Query  930   YGSQFLDECHNAVSNKTKGSITVPPE-----------------------------LDSKT  838
                 F         N +  +  VPPE                             L+   
Sbjct  187   KFRAF---------NSSNAASKVPPEAKVIFDKSFMEAKKTNQDLDKHIRKAMDDLNPLK  237

Query  837   VHSLFKKMIDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITER  667
             V +LFKK+   DCELL +     +PE  L   +P PP+ IRPSV  +    SNE+D+T +
Sbjct  238   VLNLFKKVSPADCELLGMDPGQGRPEMFLWQYMPAPPVCIRPSVSQEDA--SNEDDLTVK  295

Query  666   LKRIIQANSSLRQEISDTTLPARSL-ASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGF  490
             L +I + ++ +R  +    +P ++L   W  +Q+++AQY+NSD+ G+  Q+Q ++P+ G 
Sbjct  296   LAQITETSALIRAGLL-KGIPIQTLMEQWEWMQLQIAQYVNSDLPGV--QLQGTKPIRGI  352

Query  489   VQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNI  310
              QRLKGKQGRFRGNLSGKRV+++GRTVISPDPNL I +VA+P+L+A+ LT+PERV+ +N 
Sbjct  353   CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIEQVAVPMLVAKNLTYPERVTDYNR  412

Query  309   EKLRQCVRNGPNKYPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVL  133
              KL++ VRNG +KYPGA ++   D   +  L + +R + A EL  G IV+RHLEDGD VL
Sbjct  413   GKLQELVRNGVDKYPGANFVVKKDLQYKTWLKFGNRDKTAQELAIGDIVERHLEDGDVVL  472

Query  132   FNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             FNRQPSLH++SI+ H  ++ PW+T R NE VCNPYNADFDGDEM
Sbjct  473   FNRQPSLHKLSILSHYVKVRPWKTFRLNECVCNPYNADFDGDEM  516



>ref|XP_006667572.1| DNA-directed RNA polymerase III [Cordyceps militaris CM01]
 gb|EGX94086.1| DNA-directed RNA polymerase III [Cordyceps militaris CM01]
Length=1486

 Score =   422 bits (1086),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 230/519 (44%), Positives = 312/519 (60%), Gaps = 55/519 (11%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKS  1273
             D  P++ + I+F   S  ++   A  E+   + YD   N  P  NG LD ++G  +KT  
Sbjct  60    DKVPKRFRGIKFGIQSNQDISNQAVTEISNRLLYDIENNRAPYQNGPLDYQLGTSSKTGK  119

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATCN   + C GH+GY+ L LPVF+VGYL  I+ IL+ ICK C R+LL E  R  FL +
Sbjct  120   CATCNESLQNCNGHFGYVRLPLPVFHVGYLRFIISILQEICKDCGRVLLEEPHRRQFLAE  179

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQF  916
             +R   +++L++ ++ KR+ ++C      RK   C+ CG VNG ++K G LK++H+  + F
Sbjct  180   LRRPFIDNLRRTQICKRINEQC------RKTKNCAYCGSVNGQIRKFGVLKLVHDKFASF  233

Query  915   LDECHNAVSNKTKGSITVPPE-----------------------------LDSKTVHSLF  823
                      NK+     VPPE                             L+   V +LF
Sbjct  234   ---------NKSTAIKKVPPESKVLFEASFTEAKRENPELEKHLRKAMEDLNPLRVLNLF  284

Query  822   KKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRII  652
             K +   DCELL L+    +PE  +   +P PP+ IRPSV  D    SNE+DIT +L  I+
Sbjct  285   KMITATDCELLGLNAAEGRPEMFIWQFLPAPPVCIRPSVAQDNA--SNEDDITTKLADIV  342

Query  651   QANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKG  472
               +  +R  +   +     +  W  LQ ++A Y+NSDV GL  Q    + + GF QRLKG
Sbjct  343   WVSGMIRSALQKGSAIQTIMEQWEYLQTQIAMYVNSDVPGLQ-QPGFGKAMRGFCQRLKG  401

Query  471   KQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQC  292
             KQGRFRGNLSGKRV+++GRTVISPDPNL I EVAIP L+A+ LT+PERV R N+ KLRQC
Sbjct  402   KQGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAIPQLVAKNLTYPERVQRQNMAKLRQC  461

Query  291   VRNGPNKYPGAKYIKHPD--GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQP  118
             V NG + +PGA+ +   D  G +I+L + +R   A +L+ G +V+RH+EDGD VLFNRQP
Sbjct  462   VTNGCDVWPGAQSVIKMDEGGYKINLKFGNRNMVARDLRIGDVVERHIEDGDIVLFNRQP  521

Query  117   SLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             SLH++SIM H A+I PWRT R NE VCNPYNADFDGDEM
Sbjct  522   SLHKLSIMSHLAKIRPWRTFRLNECVCNPYNADFDGDEM  560



>emb|CDS14109.1| Putative DNA-directed RNA polymerase [Absidia idahoensis var. 
thermophila]
Length=1392

 Score =   421 bits (1082),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 221/486 (45%), Positives = 309/486 (64%), Gaps = 26/486 (5%)
 Frame = -3

Query  1404  FSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCATCNGDFKECPGHY  1228
              S   ++K  E+EV  R +Y   S+ P+  G+LD RMG  NK  +C TC    ++C GH+
Sbjct  1     MSPQNMVKIGELEVTQRDLYQPESRTPVKGGVLDLRMGTSNKQSTCETCGKGMQDCAGHW  60

Query  1227  GYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLEHLKKNELF  1048
             GY+ L LP+F++GY    ++IL+ ICK CSR++L E ER  +L+++R   L+++++ ++ 
Sbjct  61    GYMKLVLPIFHIGYFRATINILQDICKTCSRVMLEEPERRMYLKRLRAPGLDNMQRMKIV  120

Query  1047  KRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYG--SQFLDECHNAVSNKTK  877
             K + ++C      +K   C  C  VNG+VKK GP+KI H+     +   E          
Sbjct  121   KAINEKC------KKVTYCPHCKEVNGVVKKIGPMKITHDKYRLKRVATEAEEFRKTFNT  174

Query  876   GSITVPP----------ELDSKTVHSLFKKMIDEDCELLYLSD---KPEKLLVTSIPVPP  736
              + T+P           +L+   V  LF+K+  EDCELL LS+   +PE  +   +PVPP
Sbjct  175   AAATMPELKPHISKAQDDLNPLRVLRLFQKVTPEDCELLGLSEEHGRPEWYIWQYLPVPP  234

Query  735   IAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASWVDLQMEVAQ  556
               IRPSV  D    SNE+D+T +L  I+  N+ +R  +         +  W  LQ+  A 
Sbjct  235   ACIRPSVMQDDN-TSNEDDLTAKLTEIVFTNAIIRAGLEKGITVMNLMEQWEFLQLAAAM  293

Query  555   YINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITE  376
             YINS++ G+P   Q  +P  G  QRLKGKQGRFRGNLSGKRV+++GRTVISPDPN++I +
Sbjct  294   YINSELPGVPNANQG-KPSRGLSQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNMRIDQ  352

Query  375   VAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIK-HPDGTEISLMYSSRKR  199
             VA+P  +A+ILTFPERV++HNI KLRQ + NGP+ +PGA Y++    G +  L + +R+R
Sbjct  353   VAVPERVAKILTFPERVNKHNIHKLRQNIINGPDVHPGANYVQSQHGGFKKYLRFGNRER  412

Query  198   HADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNAD  19
              A +LK G IV+RHL D D VLFNRQPSLHR+SIM H A++MPWRT RFNE VC+PYNAD
Sbjct  413   IASDLKIGDIVERHLSDNDVVLFNRQPSLHRLSIMAHFAKVMPWRTFRFNECVCSPYNAD  472

Query  18    FDGDEM  1
             FDGDEM
Sbjct  473   FDGDEM  478



>gb|EHA28411.1| hypothetical protein ASPNIDRAFT_128642 [Aspergillus niger ATCC 
1015]
Length=2063

 Score =   426 bits (1095),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    ++D   +   + NG LD RMG  NKT SC T
Sbjct  634   PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFDLDHDRAVVANGPLDARMGISNKTSSCQT  693

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ +CK CSRILL E +R  +LR+MR 
Sbjct  694   CGGTLQICNGHFGHVRLVLPAFHVGYFKRVITILQEVCKECSRILLPEADRRAYLREMRR  753

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  754   PGLDNLRRGQIAKRINERC------RKTRNCEACGAVNGVVKKAGTSALKITHDKFRAFN  807

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   + +   K       ++++  V +LFKK+ D DCEL
Sbjct  808   ASTSVKKVPPPSKIVFDRSFDEARTSNAEVEKHYKKAQDDMNALRVLNLFKKISDTDCEL  867

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  868   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  925

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  926   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  984

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  985   GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  1044

Query  261   AKYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A YI     T ++ L Y +    AD+L+ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  1045  ANYIMKKGQTFKLFLKYGNLNMIADQLQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  1104

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  1105  AKVRPHRTFRLNECVCNPYNADFDGDEM  1132



>dbj|GAD97439.1| DNA-directed RNA polymerase III subunit RPO31 [Byssochlamys spectabilis 
No. 5]
Length=1450

 Score =   422 bits (1084),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 226/508 (44%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++  A VEV     +D   +   + NG LD RMG  NK+ +C T
Sbjct  21    PKVIKELKFGVMSNDDIVSQAVVEVSDRKLFDLEHDRAVVKNGPLDGRMGISNKSGTCDT  80

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ +CK CSRILL E ER  +LR++R 
Sbjct  81    CGGALQVCNGHFGHVRLVLPAFHVGYFKRVIGILQEVCKECSRILLPEAERRSYLRELRR  140

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK  +C  CG +NG+VKK     LKI H+    F 
Sbjct  141   PGLDNLRRMQIAKRINERC------RKTRVCESCGAINGVVKKAGTSALKITHDKFRAFN  194

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 +E  N+     K       +L++  V +LFK++ D DCEL
Sbjct  195   ASTSVKKIPPPSKIVFDRSFEEARNSNPEVDKHVKKAQDDLNALRVLNLFKEITDSDCEL  254

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L  K   PE  L   IP PP+ IRPSV  +    S E+D+T +L  I+Q+N +L+  +
Sbjct  255   LGLDPKEARPEMFLWQFIPAPPVCIRPSVGQEAA--STEDDLTAKLGDIVQSNINLKNAL  312

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GF QRLKGKQGRFRGNLS
Sbjct  313   LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADFGKPIRGFCQRLKGKQGRFRGNLS  371

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+PIL+A+ +TFPE V+R+N EKL+Q VRNG  ++PG
Sbjct  372   GKRVDFSGRTVISPDPNLRVDEVAVPILVAKNMTFPEPVTRYNKEKLQQRVRNGTKQWPG  431

Query  261   AKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A Y +K     ++ L Y +    AD+L+ G +V+RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  432   ANYLVKKGTSFKMFLKYGNLNMMADQLQEGDVVERHIEDGDIVLFNRQPSLHKLSILSHF  491

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  492   AKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_004202165.1| Piso0_001648 [Millerozyma farinosa CBS 7064]
 emb|CCE88859.1| Piso0_001648 [Millerozyma farinosa CBS 7064]
Length=1454

 Score =   421 bits (1083),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 226/518 (44%), Positives = 319/518 (62%), Gaps = 43/518 (8%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKT  1279
             + DV P++IK +QF   S S+++  +EVEV     YD  K      +G LD RMG  + +
Sbjct  5     VYDVAPKRIKGVQFGALSASDIIAQSEVEVQTRDLYDLEKGRTAKESGALDTRMGISSNS  64

Query  1278  KSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFL  1099
               C+TC+G+   C GH+G++ LALPVF+VGY   I+ +L+ ICK C  ILL E  R  FL
Sbjct  65    SECSTCHGNLASCHGHFGHIRLALPVFHVGYFKNIMSVLQSICKNCGAILLDETTRRSFL  124

Query  1098  RKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-----GP--LKI  940
              ++R   L++LK+ ++ KR++++C      +K   C +C  +NG+VKK     GP  LKI
Sbjct  125   NELRRPNLDNLKRMKILKRILEQC------KKQRRCVKCNHINGVVKKAASGSGPAALKI  178

Query  939   IHE---------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDE  805
             +H+               +  +F DE         K S  V  +L+   V +LFK++   
Sbjct  179   VHDTFRWIGKKPTPEKALWNEEF-DEVFARNPELEKFSKRVYDDLNPLKVLNLFKQIEPA  237

Query  804   DCELLYL----SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSS  637
             DCELL +      +PE  +   +P PP+ IRPSV +D   QSNE+D+T +L  I+  +S 
Sbjct  238   DCELLGIDPARGGRPEMYIWRYLPAPPVCIRPSVMMD--TQSNEDDLTVKLTEIVWTSSL  295

Query  636   LRQEISDTTLPARSLASWVDLQMEVAQYINSDVRG---LPPQ--MQASRPLSGFVQRLKG  472
             +R  I         +  W  LQ+ VA YINSD      LP     ++++P+ GF QRLKG
Sbjct  296   IRAGIEKGITINNLMEQWDYLQLSVAMYINSDAANSAFLPSSGGSKSAKPIRGFCQRLKG  355

Query  471   KQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQC  292
             KQGRFRGNLSGKRV+++GRTV+SPDPNL+I EVA+P  +A++LT+PE  +R+N +KL++ 
Sbjct  356   KQGRFRGNLSGKRVDFSGRTVVSPDPNLRIDEVAVPDRVAKVLTYPEMCTRYNRKKLQRL  415

Query  291   VRNGPNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPS  115
             + NGPN YPGA Y+ K  +  + +L +  R + A  L  G +V+RH+EDGD VLFNRQPS
Sbjct  416   ILNGPNTYPGANYLMKQNEAAKRNLRFGDRVKLAKNLHIGDVVERHIEDGDVVLFNRQPS  475

Query  114   LHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LHR+SI+ H A++ PWRT R NE VC PYNADFDGDEM
Sbjct  476   LHRLSILSHFAKVRPWRTFRLNECVCTPYNADFDGDEM  513



>dbj|GAA88313.1| DNA-directed RNA polymerase III largest subunit [Aspergillus 
kawachii IFO 4308]
Length=2146

 Score =   426 bits (1096),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 229/508 (45%), Positives = 315/508 (62%), Gaps = 38/508 (7%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P+ IK ++F   S  +++    VEV    ++D   +   + NG LD RMG  NKT SC T
Sbjct  717   PKVIKELKFGVLSNDDIVSQGVVEVSDRKFFDLDHDRAVVANGPLDARMGISNKTSSCQT  776

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C G  + C GH+G++ L LP F+VGY   ++ IL+ +CK CSRILL E +R  +LR+MR 
Sbjct  777   CGGALQVCNGHFGHVRLVLPAFHVGYFKRVITILQEVCKECSRILLPEADRRAYLREMRR  836

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGSQF-  916
               L++L++ ++ KR+ +RC      RK   C  CG VNG+VKK     LKI H+    F 
Sbjct  837   PGLDNLRRGQIAKRINERC------RKTRNCEACGAVNGVVKKAGTSALKITHDKFRAFN  890

Query  915   -------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDEDCEL  793
                                 DE   + +   K       ++++  V +LFKK+ D DCEL
Sbjct  891   ASTSVKKVPPPSKIVFDRSFDEARTSNAEVEKHYKKAQDDMNALRVLNLFKKISDTDCEL  950

Query  792   LYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI  622
             L L+ K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+  +
Sbjct  951   LGLNPKEARPEMFLWQFIPAPPVCIRPSVGQDAA--STEDDLTAKLGDIVQSNINLKNAL  1008

Query  621   SDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLS  442
                      +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRGNLS
Sbjct  1009  LKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRGNLS  1067

Query  441   GKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPG  262
             GKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K+PG
Sbjct  1068  GKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKKWPG  1127

Query  261   AKYIKHPDGT-EISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHR  85
             A YI     T ++ L Y +    AD+L+ G +++RH+EDGD VLFNRQPSLH++SI+ H 
Sbjct  1128  ANYIMKKGQTFKLFLKYGNLNMIADQLQEGDVIERHIEDGDIVLFNRQPSLHKLSILSHF  1187

Query  84    ARIMPWRTLRFNESVCNPYNADFDGDEM  1
             A++ P RT R NE VCNPYNADFDGDEM
Sbjct  1188  AKVRPHRTFRLNECVCNPYNADFDGDEM  1215



>ref|XP_009045244.1| hypothetical protein LOTGIDRAFT_230094 [Lottia gigantea]
 gb|ESP03762.1| hypothetical protein LOTGIDRAFT_230094 [Lottia gigantea]
Length=1393

 Score =   420 bits (1080),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 220/512 (43%), Positives = 317/512 (62%), Gaps = 28/512 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  + F   +  ++ + + ++V     Y  D S+ PI+NG+LD RM
Sbjct  1     MVKEQFREADVAKKISHVTFGMMNSQQIQQLSHIQVVSKNLYNQDGSRKPIVNGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G  +K  SC +C     +C GHYGY++L LPVF++GY   ++ +L+ ICK CS ILL  +
Sbjct  61    GTSDKENSCESCGKGLVDCIGHYGYVDLELPVFHIGYFRTVITLLQMICKNCSNILLQPE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ++ +FL  ++ + + +L+K  + K++ ++C      RK   C  CG  NGM KK G LKI
Sbjct  121   DKKNFLDALKRSGMTYLQKKGMKKKIHEKC------RKVSKCPNCGEYNGMTKKCGMLKI  174

Query  939   IHEY-------GSQFLDECHNAVSNKTKGSITVPPEL-------DSKTVHSLFKKMIDED  802
             IH+        G Q L E   +  N  K +  + P L       +   V +LFK++ DED
Sbjct  175   IHDCYKAGRRGGEQILAEFVGSFDNAVKHNKELEPMLGKIQDVLNPLVVLNLFKQVKDED  234

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL ++    +PE +++T I VPPI IRPSV  D    +NE+DIT +   II  N  ++
Sbjct  235   IPLLMMNPSVGRPEDMILTRIVVPPICIRPSVVSDLKSGTNEDDITMKFTEIIFLNDVIQ  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +  +        +  W  LQ++VA   NS+  G+P  MQ  +   GFVQRLKGKQGRFRG
Sbjct  295   KHRASGAKMQMIMEDWDFLQLQVALLYNSETSGIPLHMQPKKSSRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPN++I +VA+P L+A+ILT+PE V+  NIE +R+ V+NG + 
Sbjct  355   NLSGKRVDFSGRTVISPDPNMRIDQVAVPTLVAKILTYPEHVTSANIELMRKLVKNGADN  414

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA +I+H  GT I   L Y  R++ A  L++G IV+RH+ DGD +LFNRQPSLH++SI
Sbjct  415   HPGANFIQHRGGTNIKRFLKYGDREKIASTLRFGDIVERHMIDGDIILFNRQPSLHKLSI  474

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
                 A++MP RT RFNE  CNP+NADFDGDEM
Sbjct  475   QAFYAKVMPNRTFRFNECCCNPFNADFDGDEM  506



>ref|NP_001263425.1| DNA-directed RNA polymerase III subunit RPC1 [Danio rerio]
Length=1390

 Score =   420 bits (1079),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 232/511 (45%), Positives = 314/511 (61%), Gaps = 27/511 (5%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    RKI  I F   S  ++ + A ++V     Y  D S  P+  G+LD RM
Sbjct  1     MVKEQFRETDVARKISHICFGMKSSEQMRQQAHIQVVSKNLYSQDTSHKPLQYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGYL+L LP F++GY   IV IL+ ICK CS ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYLDLELPCFHIGYFKAIVGILQMICKTCSHILLTKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+L FL  +R   L +L+K  L K++  +C      RK  +C  C   NG VKK G LKI
Sbjct  121   EKLQFLDYLRRPGLAYLQKRGLKKKISDKC------RKKTVCLNCNAFNGSVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVS-NKTKGSITVPPE--LDSKTVHSLFKKMIDED  802
             IHE             S FL     A+  NK   S+    +  L+   V +LF+++ D+D
Sbjct  175   IHEKYKSTKKVVDPAVSDFLQSFDVAIEHNKEVESLLTRAQENLNPLVVLNLFRRIPDKD  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   S KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   VPLLLMNPESGKPADLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRMTGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILT+PE+V++ NIE +R+ VRNGP  
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANIELMRKLVRNGPEV  414

Query  270   YPGAKYIKHPD-GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             +PGA +I+      +  L Y +R++ A ELK+G +V+RH+ DGD VLFNRQPSLH++SIM
Sbjct  415   HPGANFIQQRHMQMKRFLKYGNREKMAQELKFGDVVERHMIDGDIVLFNRQPSLHKLSIM  474

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  475   AHIARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_008057207.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Tarsius 
syrichta]
Length=1390

 Score =   420 bits (1079),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 313/516 (61%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y  D    P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNHHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY+NL LP F+VGY   ++ IL+ ICK C  ++L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYINLELPCFHVGYFRAVIGILQMICKTCCHVMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK  IC  CG  NG VKK G LKI
Sbjct  121   EKKQFLDFLKRPGLTYLQKRGLKKKISDKC------RKKNICHHCGSFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPIVSNFLQSFETAIEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEAHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+MP RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVMPHRTFRFNECVCTPYNADFDGDEM  505



>gb|KID75037.1| DNA-directed RNA polymerase III largest subunit, partial [Metarhizium 
brunneum ARSEF 3297]
Length=1448

 Score =   421 bits (1082),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 316/518 (61%), Gaps = 38/518 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA--SKNPILNGLLDPRM  1297
               KQ  +++V P++ K I+F   S  ++   A VEV   + YD    + P  +G LDPR+
Sbjct  8     LAKQQLVDEV-PKRFKGIKFGIQSNQDLTNQAVVEVSNRLLYDIQNGRAPYAHGPLDPRL  66

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G  NK   C+TC+   K C GH+GY+NL LP F++GYL  IV IL+ ICK CS +LL + 
Sbjct  67    GTSNKFGKCSTCHETLKNCNGHFGYVNLPLPAFHIGYLRFIVTILQNICKTCSHVLLQDN  126

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             +R  FL+++R   L++L+++++ KR+ + C      RK   C  C  +NG V+K G LK+
Sbjct  127   DRQTFLKELRRPHLDNLRRSQICKRINEHC------RKVKSCPHCTSINGQVRKIGVLKL  180

Query  939   IHEYGSQF----------------LDECHNAVSNK----TKGSITVPPELDSKTVHSLFK  820
              H+  S +                 DE      N     +K       +L+   V  LF+
Sbjct  181   THDKFSSYNKSTSVKKVPPVAKTQFDESFATARNGNPELSKHLHKAVEDLNPLRVLGLFQ  240

Query  819   KMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQ  649
             ++   DCELL L+    +PE  +   +P PP+ IRPS+  D    SNE+D+T +L  II 
Sbjct  241   RIGSVDCELLGLNPSEGRPEMFIWQYLPAPPVCIRPSIAQDNA--SNEDDLTTKLADIIW  298

Query  648   ANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGK  469
              +  +R  +   +     +  W  LQ +VA YINSDV GL  Q    +P+ G  QRLKGK
Sbjct  299   VSGMIRSALQKGSPIQTIMEQWEYLQTQVAIYINSDVPGLQ-QPGFGKPIRGICQRLKGK  357

Query  468   QGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCV  289
             QGRFRGNLSGKRV+++GRTVISPDPNL I EVA+P L+A+ LT+PER  R NIEKLR+C+
Sbjct  358   QGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAVPQLVAKNLTYPERAQRQNIEKLRRCI  417

Query  288   RNGPNKYPGAKYI--KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPS  115
             RNGPN +PGA+ +      G +ISL ++  +  A++L  G +V+RH+EDGD VLFNRQPS
Sbjct  418   RNGPNVWPGAQCVLKMREGGYKISLKFADTELIANKLCIGDVVERHIEDGDIVLFNRQPS  477

Query  114   LHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             LH++SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  478   LHKLSIMSHFVKVRPWRTFRLNECVCNPYNADFDGDEM  515



>gb|KDE05534.1| DNA-directed RNA polymerase III subunit rpc1 [Microbotryum violaceum 
p1A1 Lamole]
Length=1457

 Score =   421 bits (1082),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 224/516 (43%), Positives = 314/516 (61%), Gaps = 42/516 (8%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTK  1276
             ++D  P++IK IQFS  S  E++  +E E   R +Y    ++P+ +G+LD R+G  NKT 
Sbjct  6     VQDAAPKRIKHIQFSVLSSQEIVAISEFEANQRDLYKAEDRSPVPHGVLDRRLGTSNKTD  65

Query  1275  SCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLR  1096
              C TC     +C GH+ Y+ L LPVF++GY    ++IL+ ICK CSR+LL   E   FL 
Sbjct  66    RCETCGLALADCVGHHAYIKLVLPVFHIGYFRHCLNILQSICKNCSRVLLDATEYRRFLA  125

Query  1095  KMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY--G  925
               R   L+ L  + L +++  +C      RK  IC  CG +NG+VKK GP++I HE   G
Sbjct  126   LFRRPNLDTLTLSALSRQLQTQC------RKCAICPYCGSINGVVKKIGPMRIGHEKFRG  179

Query  924   SQFLDECHNAVSNKTKGSITVPPELDSKTVH----------------------SLFKKMI  811
                  E  +  S +T G+      + ++++H                      +LF+K++
Sbjct  180   RNKTREVGHDGSQETAGTYATWRAMFNESIHETKDLAPHIDKAVEDLNPLKVLNLFQKIL  239

Query  810   DEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANS  640
              +DCELL L     +PE+ L   I VPP+ IRPSV  +    +NE+DIT +L  II  N+
Sbjct  240   PDDCELLGLDPSVARPEEFLWQYISVPPVCIRPSVAQEAA--TNEDDITVKLTEIIFINA  297

Query  639   SLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGR  460
              ++  +         +  W  LQ+ VA YINS++ G+P  +   +P+ GF QRLKGKQGR
Sbjct  298   VIKTGLVKGVTTQNLMEQWEFLQLAVATYINSELPGIPTTI-GQKPIRGFCQRLKGKQGR  356

Query  459   FRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNG  280
             FRGNLSGKRV+++ RTVISPDPNL+I +VA+P  +A++LTFP+RV+ HNIE+LRQ +RNG
Sbjct  357   FRGNLSGKRVDFSARTVISPDPNLQIDQVAVPERIAKVLTFPDRVTPHNIERLRQAIRNG  416

Query  279   PNKYPGAKYIKHPDGTEI---SLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
              + +PGA ++    G+E     L +  R   AD L+ G IV+RHL D D VLFNRQPSLH
Sbjct  417   HDVHPGANFVL-AGGSETFKKFLKFGDRDMMADRLRIGDIVERHLRDDDIVLFNRQPSLH  475

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             R+SI+ HR ++ PWRT R NE VC PYNADFDGDEM
Sbjct  476   RLSILSHRVKVRPWRTFRLNECVCTPYNADFDGDEM  511



>ref|XP_003388237.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like 
[Amphimedon queenslandica]
Length=1402

 Score =   420 bits (1080),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 223/494 (45%), Positives = 307/494 (62%), Gaps = 24/494 (5%)
 Frame = -3

Query  1428  IKSIQFSTFSGSEVMKSAEVEVYR-GVYYDASKNPILNGLLDPRMGPPNKTKSCATCNGD  1252
             I  IQFS FS +++ + A V V+   +Y   S+ P+  G+LD +MG   K   C TC+  
Sbjct  16    IDRIQFSLFSPNKIQQQAHVHVFNSALYAQDSRIPVPFGVLDNKMGTNQKDSVCKTCDKS  75

Query  1251  FKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRNTKLE  1072
               +C GHYGY++L LPVF+VGY    + IL+ ICK CSR+L+   +R  +   +    + 
Sbjct  76    LSDCVGHYGYIDLQLPVFHVGYFRNTISILQVICKTCSRVLVTGTDRQSYFDLLSRPFIS  135

Query  1071  HLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY----------G  925
              L K  +FK++ ++C      +K   C  C   NG VKK G  KI+HE            
Sbjct  136   SLAKKTIFKKINEKC------KKISTCPHCQSTNGSVKKCGVFKILHEKIRKEKKFQSES  189

Query  924   SQFLDECHNAV--SNKTKGSITVPPE-LDSKTVHSLFKKMIDEDCELLYLS---DKPEKL  763
             S F +    AV  +   +  +    E L    V +LF+ + DED  LL ++    +PE L
Sbjct  190   SAFRETFAEAVIHNRDLEQYLNKAQEILTPLKVLNLFRNIPDEDIVLLGMTLAAGRPEDL  249

Query  762   LVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARSLASW  583
             +VT + VPP+ IRPSV  D    + E+D+T +L+ II AN  + +  +        L  W
Sbjct  250   IVTRLLVPPLCIRPSVVSDTQAGTTEDDVTIKLRDIIFANDVIHRHRTTGAKVEMILEMW  309

Query  582   VDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGRTVIS  403
               LQ++VA YINS+V G+PP M   +   GFVQRLKGKQGRFRGNLSGKRV+++GRTVIS
Sbjct  310   DYLQLQVALYINSEVSGIPPSMIPKKTTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVIS  369

Query  402   PDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKHPDGTEIS  223
             PDPN++I +VA+PI +A+I+T+PE+V++HNI  +RQ V NGP+K+PGA ++ H    +  
Sbjct  370   PDPNMRIDQVAVPIHVAKIMTYPEKVTKHNIGLMRQLVINGPDKHPGANFMTHKGQNKRF  429

Query  222   LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTLRFNES  43
             L Y  RK+ A ELK+G IV+RH+ DGD VLFNRQPSLH++SIM H  ++MP RT RFNE 
Sbjct  430   LKYGDRKKIASELKHGDIVERHMIDGDVVLFNRQPSLHKLSIMAHFVKVMPHRTFRFNEC  489

Query  42    VCNPYNADFDGDEM  1
             VC PYNADFDGDEM
Sbjct  490   VCTPYNADFDGDEM  503



>gb|EGO01485.1| hypothetical protein SERLA73DRAFT_103293 [Serpula lacrymans var. 
lacrymans S7.3]
Length=1400

 Score =   420 bits (1079),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 228/499 (46%), Positives = 312/499 (63%), Gaps = 31/499 (6%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K +E +V +R +Y    + P+ +G+LD R+G   K   C T
Sbjct  9     APKVIKKLQFSLLNAQDTVKISEFQVTHRDLYTPTDRLPVKDGVLDRRLGTTEKNTFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C     +C GHY Y+ L +PVF++GY    + IL+C C   +R+LL E +R  +L++ R 
Sbjct  69    CGLSSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCTC---ARVLLEEPDRRVYLKRFRR  125

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE-YGSQFLD  910
               LE++++  L K V       T  RK V C  C   NG VKK G LKIIH+ + ++   
Sbjct  126   PNLENIQRQSLSKAV------NTMSRKCVYCPYCSATNGAVKKAGALKIIHDKFRAKKTA  179

Query  909   ECHNAVSNKTKGSITVPPELD---SKTVHS---------LFKKMIDEDCELLYL---SDK  775
             E           ++    EL    +K VH          LFK++ DEDCELL L     +
Sbjct  180   EEMEKWKRTFAPAVEAQKELGMYLNKAVHEDLNPLKVLDLFKRISDEDCELLGLRPAHGR  239

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+ IRPSV  DG   SNE+D+T +L  I+  N+ ++Q +S     A+ 
Sbjct  240   PEEYIWQYISVPPVCIRPSVAQDGA--SNEDDLTVKLTEIVFTNALIKQGLSKGAPTAQF  297

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P Q    +P+ GFVQRLKGKQGRFRGNLSGKRV+++GR
Sbjct  298   MEHWEFLQLSVAMYINSELPGVPSQ-PGQKPMRGFVQRLKGKQGRFRGNLSGKRVDFSGR  356

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A++LT+PERV+ HNIE L+Q VRNG + +PGA Y+     
Sbjct  357   TVISPDPNLRIDEVAVPERVAKVLTYPERVTPHNIEGLKQAVRNGCDVHPGANYVTAGSS  416

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G  V+RH+ +GD VLFNRQPSLH++SIMCHRARI PWR+ 
Sbjct  417   GFKKFLKFGNRNAVADTLRVGDTVERHIINGDIVLFNRQPSLHKLSIMCHRARIRPWRSF  476

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  477   RLNECVCGPYNADFDGDEM  495



>ref|XP_003473860.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Cavia 
porcellus]
Length=1390

 Score =   419 bits (1078),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 313/516 (61%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y  D S  P+L+G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNSHAPLLHGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ +L+ ICK C  ILL  +
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGVLQMICKTCCHILLSRE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ER  FL  ++   L +L+K  L K+V  +C      RK  +C  CG  NG VKK G LKI
Sbjct  121   ERQQFLDHLKRPGLTYLQKRGLRKKVSDKC------RKKSVCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPMVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLIVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>gb|KDN61006.1| putative RNA polymerase Rpb1 [Colletotrichum sublineola]
Length=1456

 Score =   420 bits (1080),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 227/516 (44%), Positives = 313/516 (61%), Gaps = 55/516 (11%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             P++ K I+F   S  ++   A +EV   + YD  KN  P  +G LDPR+G  +KT  CAT
Sbjct  19    PKRFKGIKFGIQSNQDIANQAVLEVSDRLLYDIEKNRAPYQHGPLDPRLGTSSKTGKCAT  78

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C    + C GH+G++ L LP F++GYL  ++ IL+ ICK C ++LL E ER  FL+++R 
Sbjct  79    CQESLQNCTGHFGHVRLPLPAFHIGYLRFVMMILQDICKDCGKVLLTESERRAFLKELRR  138

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEYGSQFLDE  907
               L++L+++++ KR+ ++C      RK   C  CG V G ++K G LK+ H+    +   
Sbjct  139   PLLDNLRRSQICKRINEQC------RKVKNCMYCGSVQGTIRKVGVLKLAHDKFVTY---  189

Query  906   CHNAVSNKTKGSITVPPE-----------------------------LDSKTVHSLFKKM  814
                   NK+  +  VPPE                             ++   V +LFK +
Sbjct  190   ------NKSTSAKKVPPESKIKFDESFSEARKNNAELDKHLRKAMEDMNPLRVLNLFKMI  243

Query  813   IDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
                DCELL L     +PE  +   +P PP+ IRPSV  D    SNE+DIT +L  I+  +
Sbjct  244   SPSDCELLGLDPAEGRPEMFIWQFLPAPPVCIRPSVAQDNA--SNEDDITTKLADIVWVS  301

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +R  +   +     +  W  LQ++VA Y+NSDV GL  Q    + + GF QRLKGKQG
Sbjct  302   GMIRSALQKGSPVQTIMEQWEYLQLQVAMYVNSDVPGLQ-QPGFGKAVRGFCQRLKGKQG  360

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL I +VA+P L+A+ LT+PERVS +NI KLR+CVRN
Sbjct  361   RFRGNLSGKRVDFSGRTVISPDPNLGIDQVAVPQLVAKNLTYPERVSDYNITKLRECVRN  420

Query  282   GPNKYPGAKYIKHPD--GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GPN +PGA+ +   D  G +ISL + +R + A +LK G +V+RHLED D VLFNRQPSLH
Sbjct  421   GPNIWPGAQQVIKKDDGGYKISLKFGNRNQVAQDLKIGDVVERHLEDNDIVLFNRQPSLH  480

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H  ++ PWRT R NE VC PYNADFDGDEM
Sbjct  481   KLSIMSHLVKVRPWRTFRLNECVCGPYNADFDGDEM  516



>gb|KGO73763.1| Translation elongation/initiation factor/Ribosomal, beta-barrel 
[Penicillium italicum]
Length=2967

 Score =   427 bits (1097),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 237/515 (46%), Positives = 323/515 (63%), Gaps = 46/515 (9%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYD--ASKNPILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   +  +++  A VEV    ++D   ++  + NG LD RMG  NKT +
Sbjct  645   DSVPKVIKELKFGVLTNDDIVGQAVVEVSDRKFFDLDQTRTVVANGPLDQRMGISNKTDA  704

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             CATC  + K+C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  +LR+
Sbjct  705   CATCGNNLKDCNGHFGHVRLILPSFHVGYFKRVISILQEICKECSNILLPEAERRSYLRE  764

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             MR   L++L++ ++ KR+ +RC      RK   C+ CG +NG+VKK     LKI H+   
Sbjct  765   MRRPGLDNLRRMQIAKRINERC------RKTRECTYCGAINGVVKKTGTSALKITHDKFR  818

Query  921   QFLDECHNAVSNKTKGSIT-------------VPPELDSK-----------TVHSLFKKM  814
              F    + +VS K +  I+               PE++              V  LFKKM
Sbjct  819   AF----NVSVSVKKQAPISKDVFDNSFLEARGTNPEVEKHFKKAQDDMNPLRVLKLFKKM  874

Query  813   IDEDCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
              D DCEL+ ++ K   PE  L   IP PP+ IRPSV  DG   S E+D+T +L  I+Q+N
Sbjct  875   SDSDCELIGMNPKEARPEMFLWQFIPAPPVCIRPSVGQDGA--STEDDLTAKLGDIVQSN  932

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
              +L+  +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQG
Sbjct  933   INLKNALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQG  991

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q + N
Sbjct  992   RFRGNLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRICN  1051

Query  282   GPNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHR  106
             G NK+PGA  I K   G    L YS+ +R AD L+ G +V+RHLEDGD VLFNRQPSLH+
Sbjct  1052  GSNKWPGANLIVKKGTGFRQMLKYSNTQRMADALQEGDLVERHLEDGDIVLFNRQPSLHK  1111

Query  105   MSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             +SI+ H A+I P RT R NE VCNPYNADFDGDEM
Sbjct  1112  LSILSHFAKIRPHRTFRLNECVCNPYNADFDGDEM  1146



>ref|XP_005389956.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Chinchilla 
lanigera]
Length=1390

 Score =   419 bits (1077),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 311/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHILLSKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ER  FL  ++   L +L+K  L K+V  RC      RK  +C  CG  NG VKK G LKI
Sbjct  121   ERQQFLDHLKRPGLTYLQKRGLRKKVSDRC------RKKSVCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPAVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG  V+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDTVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_001824913.1| DNA-directed RNA polymerase III subunit RPO31 [Aspergillus oryzae 
RIB40]
 dbj|BAE63780.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EIT76474.1| RNA polymerase III, large subunit [Aspergillus oryzae 3.042]
 gb|KDE85401.1| RNA polymerase III, large subunit [Aspergillus oryzae 100-8]
Length=1447

 Score =   419 bits (1078),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 229/511 (45%), Positives = 313/511 (61%), Gaps = 38/511 (7%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   S  +++    VEV    ++D  ++   + +G LD RMG  +KT S
Sbjct  18    DRAPKVIKELKFGVLSNDDIVSQGVVEVSDRKFFDLDRDRSVVAHGPLDSRMGVSSKTAS  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  FLR+
Sbjct  78    CQTCGGALQVCNGHFGHVKLVLPSFHVGYFKRVITILQEICKECSHILLPEGERRAFLRE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGS  922
             MR   L++L++ ++ KR+ +RC      RK   C RCG  NG+VKK     LKI H+   
Sbjct  138   MRRPGLDNLRRLQIAKRINERC------RKTRNCDRCGATNGVVKKAGTSALKITHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E  +      K       ++++  V +LFK++ D D
Sbjct  192   AFNASTSMKKIPPPSKIVFDRSFEEARSHNPEVEKHHKKAQDDMNALRVLNLFKRISDTD  251

Query  801   CELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L  K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLGLDPKEARPEMFLWQYIPAPPVCIRPSVGQDAS--STEDDLTAKLGDIVQSNINLK  309

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
               +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRG
Sbjct  310   NALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRG  368

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K
Sbjct  369   NLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKK  428

Query  270   YPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             +PGA Y +K     +  L Y S    AD+L+ G +V+RH+EDGD VLFNRQPSLH++SI+
Sbjct  429   WPGANYLVKKGSTFKTFLKYGSLNMIADQLQEGDVVERHIEDGDIVLFNRQPSLHKLSIL  488

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              H A++ P RT R NE VCNPYNADFDGDEM
Sbjct  489   SHFAKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_006837499.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Chrysochloris 
asiatica]
Length=1390

 Score =   419 bits (1076),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 234/516 (45%), Positives = 311/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGIKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   I+ IL+ ICK C  ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYVDLELPCFHVGYFRAIIGILQMICKTCCHILLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             ER  FL  ++   L +L+K  L K++  +C      RK  IC  CG  NG  KK G LKI
Sbjct  121   ERKQFLDYLKRPGLTYLQKRGLKKKISDKC------RKKTICHHCGAYNGTAKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKTVDPVVSHFLQSFETAIEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDIPLLLMNPEAGKPSNLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANISFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TKMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_007778546.1| DNA-directed RNA polymerase III subunit C1 [Coniosporium apollinis 
CBS 100218]
 gb|EON63229.1| DNA-directed RNA polymerase III subunit C1 [Coniosporium apollinis 
CBS 100218]
Length=1475

 Score =   420 bits (1079),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 232/520 (45%), Positives = 313/520 (60%), Gaps = 45/520 (9%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYYDASKNP----ILNGLLDPRMGPP  1288
             + D  P++IK +QF   S  +++  A +E+  R VY   S  P      +G +D RMG  
Sbjct  13    VVDSVPKRIKELQFGILSNQDIVNQAVLEISDRNVYESISSGPNRAVTRHGPMDGRMGTS  72

Query  1287  NKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERL  1108
             +K+  C TC    KEC GH+GY+ LALP F++GY   I++IL CICKGCSR+LL E  R 
Sbjct  73    SKSGLCDTCGEGLKECNGHFGYVRLALPAFHIGYFRAIIEILHCICKGCSRVLLEESSRR  132

Query  1107  DFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKII  937
              +LR++R   L++L++  + K V          +K  +C  CG +NG V+K    PLKI+
Sbjct  133   AYLRRLRMPHLDNLRRTGICKAVA------AEAKKCKVCPYCGVINGPVRKVANHPLKIV  186

Query  936   HEYGSQFLDE---------CHNAVSNKTKGSITVPPELDS---KTVH--------SLFKK  817
             H     FL           C        + +    PEL+    K V         +LF++
Sbjct  187   HNKYDSFLRSTAKSKVAPACKVEFDKTFETAKADNPELEKHLRKAVDDMNPLRALNLFRR  246

Query  816   MIDEDCELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQA  646
             + D DCELL +  K   PE  +   +P PP+ IRPSV  +    + E+DIT +L  IIQ 
Sbjct  247   ISDTDCELLGMDPKEGRPEMFIWQYVPAPPVPIRPSVQQEAA--TTEDDITNKLGDIIQI  304

Query  645   NSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQ  466
             +S +R  +         +  W  LQ+++A YINSD+ GL  Q    + + GF QRLKGKQ
Sbjct  305   SSLIRAGLEKGQPVQVLMEQWEFLQLQIAMYINSDLPGLQ-QQNVGKHMRGFCQRLKGKQ  363

Query  465   GRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVR  286
             GRFRGNLSGKRV+++GRTVI PDPNL I EVA+P  +A  LT+PERVSR+NIEKLR C+R
Sbjct  364   GRFRGNLSGKRVDFSGRTVIGPDPNLGIDEVAVPERVAVNLTYPERVSRYNIEKLRDCIR  423

Query  285   NGPNKYPGAKYI-KHPDGTEISLMYSSRKRHAD----ELKYGYIVDRHLEDGDAVLFNRQ  121
              GP K+PGA YI +   G + +L   +R+   D    +L+ G +V+RHLEDGD VLFNRQ
Sbjct  424   RGPKKHPGANYIVEKATGDKKALAVHARRGTLDVPARQLQIGDLVERHLEDGDIVLFNRQ  483

Query  120   PSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             PSLH++SI+ H+A+I PWRT R NE VCNPYNADFDGDEM
Sbjct  484   PSLHKLSILSHKAKIRPWRTFRLNECVCNPYNADFDGDEM  523



>ref|XP_002383676.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
flavus NRRL3357]
 gb|EED46140.1| DNA-directed RNA polymerase III largest subunit, putative [Aspergillus 
flavus NRRL3357]
Length=1436

 Score =   419 bits (1077),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 229/511 (45%), Positives = 313/511 (61%), Gaps = 38/511 (7%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKS  1273
             D  P+ IK ++F   S  +++    VEV    ++D  ++   + +G LD RMG  +KT S
Sbjct  18    DRAPKVIKELKFGVLSNDDIVSQGVVEVSDRKFFDLDRDRSVVAHGPLDSRMGVSSKTAS  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC G  + C GH+G++ L LP F+VGY   ++ IL+ ICK CS ILL E ER  FLR+
Sbjct  78    CQTCGGALQVCNGHFGHVKLVLPSFHVGYFKRVITILQEICKECSHILLPEGERRAFLRE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKKG---PLKIIHEYGS  922
             MR   L++L++ ++ KR+ +RC      RK   C RCG  NG+VKK     LKI H+   
Sbjct  138   MRRPGLDNLRRLQIAKRINERC------RKTRNCDRCGATNGVVKKAGTSALKITHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E  +      K       ++++  V +LFK++ D D
Sbjct  192   AFNASTSMKKIPPPSKIVFDRSFEEARSHNPEVEKHHKKAQDDMNALRVLNLFKRISDTD  251

Query  801   CELLYLSDK---PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L  K   PE  L   IP PP+ IRPSV  D    S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLGLDPKEARPEMFLWQYIPAPPVCIRPSVGQDAS--STEDDLTAKLGDIVQSNINLK  309

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
               +         +  W  +Q+++A YINSDV GL  +    +P+ GFVQRLKGKQGRFRG
Sbjct  310   NALLKGAPVQTIMECWDYMQLQIAVYINSDVPGLN-KADLGKPIRGFVQRLKGKQGRFRG  368

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL++ EVA+P L+A+ +T+PE V+R+N EKL+Q VRNG  K
Sbjct  369   NLSGKRVDFSGRTVISPDPNLRVDEVAVPELVAKNMTYPEVVTRYNKEKLQQRVRNGTKK  428

Query  270   YPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIM  94
             +PGA Y +K     +  L Y S    AD+L+ G +V+RH+EDGD VLFNRQPSLH++SI+
Sbjct  429   WPGANYLVKKGSTFKTFLKYGSLNMIADQLQEGDVVERHIEDGDIVLFNRQPSLHKLSIL  488

Query  93    CHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
              H A++ P RT R NE VCNPYNADFDGDEM
Sbjct  489   SHFAKVRPHRTFRLNECVCNPYNADFDGDEM  519



>gb|KID97644.1| DNA-directed RNA polymerase III largest subunit, partial [Metarhizium 
majus ARSEF 297]
Length=1458

 Score =   419 bits (1078),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 229/521 (44%), Positives = 316/521 (61%), Gaps = 37/521 (7%)
 Frame = -3

Query  1479  EMQFTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDA--SKNPILNGLLD  1306
             E     +  + D  P++ KSI+F   S  ++   A VEV   + YD   S+ P  +G LD
Sbjct  4     ETDILAKQQLVDEAPKRFKSIKFGIQSNQDLTNQAVVEVSDRLLYDIENSRAPYAHGPLD  63

Query  1305  PRMGPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILL  1126
             PR+G  +K   C+TC+   + C GH+GY++L LP F++GYL  IV IL+ ICK CSR+LL
Sbjct  64    PRLGTSSKFGRCSTCHESLQNCNGHFGYVSLPLPAFHIGYLRFIVTILQNICKTCSRVLL  123

Query  1125  GEKERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GP  949
              + +R  FL+++R   L++L+++++ KR+ ++C      RK   C  C  +NG V+K G 
Sbjct  124   QDNDRQTFLKELRRPHLDNLRRSQICKRINEQC------RKVKSCPHCTSINGQVRKIGV  177

Query  948   LKIIHEYGSQF----------------LDECHNAVSNK----TKGSITVPPELDSKTVHS  829
             LK+ H+  S +                 DE      N      K       +L+   V  
Sbjct  178   LKLTHDKFSSYSKSTSAKKVPPAAKTQFDESFATARNDNPELAKHLHKAVEDLNPLRVLG  237

Query  828   LFKKMIDEDCELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKR  658
             LF+ +   DCELL L+    +PE  +   +P PP+ IRPS+  D    SNE+D+T +L  
Sbjct  238   LFQHIGPVDCELLGLNPLEGRPEMFIWQYLPAPPVCIRPSISQDNA--SNEDDLTTKLAD  295

Query  657   IIQANSSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRL  478
             I+  +  +R  +   +     +  W  LQ +VA YINSDV GL  Q    + + G  QRL
Sbjct  296   IVWVSGMIRSALQKGSPIQTIMEQWEYLQTQVAIYINSDVPGLQ-QPGFGKSIRGICQRL  354

Query  477   KGKQGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLR  298
             KGKQGRFRGNLSGKRV+++GRTVISPDPNL I EVA+P L+A+ LT+PERV R NIEKLR
Sbjct  355   KGKQGRFRGNLSGKRVDFSGRTVISPDPNLGIDEVAVPQLVAKNLTYPERVQRQNIEKLR  414

Query  297   QCVRNGPNKYPGAKYI--KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNR  124
             +C+RNGPN +PGA+Y+      G +ISL  +  K  A++L  G +V+RH+EDGD VLFNR
Sbjct  415   RCIRNGPNVWPGAQYVLKMREGGYKISLKIADTKLVANKLCIGDVVERHIEDGDIVLFNR  474

Query  123   QPSLHRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             QPSLH++SIM H  ++ PWRT R NE VCNPYNADFDGDEM
Sbjct  475   QPSLHKLSIMSHFVKVRPWRTFRLNECVCNPYNADFDGDEM  515



>ref|XP_502142.1| YALI0C22550p [Yarrowia lipolytica]
 emb|CAG82462.1| YALI0C22550p [Yarrowia lipolytica CLIB122]
Length=1483

 Score =   420 bits (1079),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 226/500 (45%), Positives = 310/500 (62%), Gaps = 30/500 (6%)
 Frame = -3

Query  1437  PRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKTKSCAT  1264
             PR I  I+F   S  E++K +EVEV     YD  K   P+  G LDPRMG  +    C T
Sbjct  18    PRVIGGIEFGALSPQEILKLSEVEVATRDLYDLQKGRAPMEYGALDPRMGVSSNMSKCKT  77

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C      CPGH+G++ LALP F++GY    + IL+ +CK C+RILL +++R  FL ++R 
Sbjct  78    CAEPLATCPGHFGHVKLALPCFHIGYFKATISILQNVCKDCARILLSDEDRRKFLTELRR  137

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE----YGSQ  919
               +++L++ ++ K+V ++C      +K   C  C  +NG+VKK GPLKIIH+     G +
Sbjct  138   PGIDNLRRMQILKKVNEQC------KKQRRCVHCNSINGVVKKAGPLKIIHDKFRHVGKK  191

Query  918   FLDEC--HNAVSNKTKGSITVPPELDSKT--------VHSLFKKMIDEDCELLYLS---D  778
               +E    +   N  K SI     L  K         V +LF++++  DCELL +     
Sbjct  192   IPEEKTEFDNSFNTAKESIPDVERLQKKAMDDLNPLKVFNLFREILPMDCELLGMDPGKG  251

Query  777   KPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPAR  598
             +PE  +   +P PP+ IRPSV  D    SNE+D+T +L  I+  ++ +   +      A 
Sbjct  252   RPETYIWRYMPAPPVCIRPSVMQDSA--SNEDDLTVKLTEIVWTSAIIEAGLKQGMAVAS  309

Query  597   SLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTG  418
              +  W  LQ+ VA YINSD    P Q  AS+P+    QRLKGKQGRFRGNLSGKRV+++G
Sbjct  310   LMEQWELLQLAVAVYINSDTPQGPGQ-SASKPIRALTQRLKGKQGRFRGNLSGKRVDFSG  368

Query  417   RTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI-KHP  241
             RTVISPDPNL+I +VA+P  +A+ILT+PERV+ HNIEKLR  V  GP+++PGA Y+ K  
Sbjct  369   RTVISPDPNLRIDQVAVPDRVAKILTYPERVTSHNIEKLRNLVITGPSQHPGANYLFKKG  428

Query  240   DGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRT  61
             +    +L +  R + A+ L+ G +V+RHLEDGD VLFNRQPSLHR+SI+ H A+I PWRT
Sbjct  429   ESLRRNLRFGDRAKIAERLEIGDVVERHLEDGDVVLFNRQPSLHRLSILAHFAQIRPWRT  488

Query  60    LRFNESVCNPYNADFDGDEM  1
              R NE VC PYNADFDGDEM
Sbjct  489   FRLNECVCTPYNADFDGDEM  508



>ref|XP_003022324.1| hypothetical protein TRV_03535 [Trichophyton verrucosum HKI 0517]
 gb|EFE41706.1| hypothetical protein TRV_03535 [Trichophyton verrucosum HKI 0517]
Length=1444

 Score =   419 bits (1077),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 318/512 (62%), Gaps = 40/512 (8%)
 Frame = -3

Query  1446  DVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKNPIL--NGLLDPRMGPPNKTKS  1273
             D  P+ IK I F   S  +++  A VE+     +D   N  +  NG +DPR+G  NK+ +
Sbjct  18    DRVPKVIKEINFGVLSNQDIISQAHVEISDRKLFDLDNNRAVARNGPMDPRLGISNKSDT  77

Query  1272  CATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRK  1093
             C TC GD +EC GH+GY+ L LP F+VGY    ++IL+ ICK CS+ILL E ER  +L++
Sbjct  78    CETCGGDLQECNGHFGYVRLVLPAFHVGYFKRTIEILQDICKDCSKILLPEDERRSYLKE  137

Query  1092  MRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK---GPLKIIHEYGS  922
             +R   L++L++ ++ KR+  RC      RK  +C  C  +NG VKK   G LKI+H+   
Sbjct  138   LRRPGLDNLRRMQINKRINVRC------RKTPVCYYCNAINGTVKKASTGALKIVHDKFR  191

Query  921   QF--------------------LDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
              F                     +E   +  +  K    V  +L+   V  LF+++ +ED
Sbjct  192   AFNASLSAKKIPPPSKLAFDRSFEEAKKSNPDIEKHYRRVFDDLNPLRVLKLFRRISNED  251

Query  801   CELLYLS---DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
             CELL L+    +PE  L   IP PP+ IRPSV  +G   S E+D+T +L  I+Q+N +L+
Sbjct  252   CELLSLNVDGARPEYFLWQFIPAPPVPIRPSVGQEG--PSTEDDLTAKLGDIVQSNLNLK  309

Query  630   QEISDTTLPARSLAS-WVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFR  454
               + D   P +++   W  +Q+++A YINSD+ GL     + + + G  QRLKGKQGRFR
Sbjct  310   MAL-DKGAPVQTIIECWDYMQLQIAVYINSDIPGLQ-NTDSKKTIRGLCQRLKGKQGRFR  367

Query  453   GNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPN  274
             GNLSGKRV+++GRTVISPDPNL+I EVA+P L+A  +T+PERV+R+N EKLRQ +RNG  
Sbjct  368   GNLSGKRVDFSGRTVISPDPNLRIDEVAVPQLVAMNMTYPERVTRYNKEKLRQRIRNGTK  427

Query  273   KYPGAKY-IKHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
              +PGA Y IK  +   + L Y +    A++L+ G IV+RHLE+GD VLFNRQPSLH++SI
Sbjct  428   TWPGANYLIKEGNSFRLFLKYGNLNMIANQLREGDIVERHLENGDIVLFNRQPSLHKLSI  487

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             + H  ++ P RT R NE VCNPYNADFDGDEM
Sbjct  488   LSHFVKVRPHRTFRLNECVCNPYNADFDGDEM  519



>ref|XP_010606158.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 isoform 
X3 [Fukomys damarensis]
Length=1346

 Score =   417 bits (1073),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHILLSKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K+V  +C      RK  +C  CG  NG VKK G LKI
Sbjct  121   EKQQFLDHLKRPGLTYLQKRGLRKKVSDKC------RKKSLCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPMVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLIVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_007882529.1| hypothetical protein PFL1_06792 [Pseudozyma flocculosa PF-1]
 gb|EPQ25655.1| hypothetical protein PFL1_06792 [Pseudozyma flocculosa PF-1]
Length=1400

 Score =   418 bits (1074),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 237/505 (47%), Positives = 319/505 (63%), Gaps = 34/505 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEVY-RGVYY--DASKNPILNGLLDPRMGPPNKTKSC  1270
              P+KIK IQF   S  +++  +E+E+  R +Y   +A + P+ NG+LD R+G  +K   C
Sbjct  9     APKKIKHIQFGVLSQQDIVNMSEIEITTRDLYTIGEAERKPVANGVLDRRLGISDKNSLC  68

Query  1269  ATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKM  1090
              TC+    +C GHYGY+ L LPVF+VG+    V IL+ ICK C+ +LL E +R  +LR+ 
Sbjct  69    ETCHLKMADCVGHYGYIKLVLPVFHVGFFKHTVSILQSICKNCAHVLLEEPDRRKYLRRF  128

Query  1089  RNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHEY-----  928
             R   LE+L++   FK V  R       RK + C +CG  NG VKK G LKI+HE      
Sbjct  129   RRPNLENLQRTRTFKEVNTRA------RKVLYCPKCGYTNGTVKKQGQLKIVHEKFRAKK  182

Query  927   GSQFLDECHNAVSNKTK---GSIT-----VPPELDSKTVHSLFKKMIDEDCELLYLS---  781
              +  L+E  +  +   +   G IT        +L+   V  LFK++ DEDCELL L    
Sbjct  183   TAAELEEFRSTFTTNVRMGNGDITPHLSKAQEDLNPLKVLDLFKRISDEDCELLGLRPEF  242

Query  780   DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEI---SDTT  610
              +PE+ +   + VPP+ IRPSV  DG   +NE+D+T +L  II  NS L+  +      T
Sbjct  243   GRPEEYIWQYVCVPPVCIRPSVAQDGA--TNEDDVTIKLTEIIFTNSLLKIGLVKGGKGT  300

Query  609   LPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRV  430
               ++ +  W  LQ+ VA YINS++ G+P Q    +P  GF QRLKGKQGRFRGNLSGKRV
Sbjct  301   TTSQLVQQWDFLQLTVALYINSELPGVPSQ-PGQKPSRGFCQRLKGKQGRFRGNLSGKRV  359

Query  429   EYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYI  250
             +++GRTVI PDPNLKI EVA+P  +A+ILT+PERV  HNIE++RQ VRNG + +PGA Y+
Sbjct  360   DFSGRTVIGPDPNLKIDEVAVPERVAKILTYPERVFVHNIERMRQAVRNGTDVHPGANYL  419

Query  249   KH-PDGTEISLMY-SSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARI  76
             +    G +  L +   R+  A +L+ G IV+RHL DGD VLFNRQPSLH++SIM HRA++
Sbjct  420   QDGKTGFKRFLKFPGMREELAQKLRVGDIVERHLRDGDIVLFNRQPSLHKLSIMSHRAKV  479

Query  75    MPWRTLRFNESVCNPYNADFDGDEM  1
              PWRT R NE  CNPYNADFDGDEM
Sbjct  480   RPWRTFRLNECACNPYNADFDGDEM  504



>ref|XP_010189951.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1, partial 
[Mesitornis unicolor]
Length=786

 Score =   404 bits (1039),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 310/512 (61%), Gaps = 29/512 (6%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYY--DASKNPILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y  D   +P+  G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNHHSPLQYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L  +
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFKAVIGILQMICKTCCCIMLSVE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K+V ++C      RK   C  CG  NG VKK G LKI
Sbjct  121   EKKQFLDYLKRPGLTYLQKRGLKKKVSEKC------RKKNTCPYCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITV---PPELDSKTVHSLFKKMIDED  802
             IHE             S F      A+ +  +    +      L+   V +LFK++  ED
Sbjct  175   IHEKYKTNKKVVDPVVSTFFQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAED  234

Query  801   CELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLR  631
               LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N  ++
Sbjct  235   IPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIK  294

Query  630   QEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRG  451
             +           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQGRFRG
Sbjct  295   KHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG  354

Query  450   NLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNK  271
             NLSGKRV+++GRTVISPDPNL+I EVA+PI +A+ILTFPE+V++ NI  +R+ VRNGP+ 
Sbjct  355   NLSGKRVDFSGRTVISPDPNLRIDEVAVPIHVAKILTFPEKVNKANINFMRKLVRNGPDV  414

Query  270   YPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSI  97
             +PGA +I+    T++   L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH++SI
Sbjct  415   HPGANFIQQRH-TQMKRFLKYGNREKMAQELKFGDIVERHLIDGDIVLFNRQPSLHKLSI  473

Query  96    MCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             M H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  474   MAHIARVKPHRTFRFNECVCTPYNADFDGDEM  505



>emb|CDO78062.1| hypothetical protein BN946_scf184826.g7 [Trametes cinnabarina]
Length=1396

 Score =   418 bits (1074),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 227/499 (45%), Positives = 318/499 (64%), Gaps = 35/499 (7%)
 Frame = -3

Query  1440  GPRKIKSIQFSTFSGSEVMKSAEVEV-YRGVYYDASKNPILNGLLDPRMGPPNKTKSCAT  1264
              P+ IK +QFS  +  + +K AE EV +R +Y    + P+ NG+LD R+G  +K+  C T
Sbjct  9     APKVIKKLQFSLLNNQDTVKLAEFEVTHRDLYTPIDRLPVKNGVLDRRLGTTDKSAFCET  68

Query  1263  CNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFLRKMRN  1084
             C  +  +C GHY Y+ L +PVF++GY    + IL+CICK C+R+LL E +R  +L++ R 
Sbjct  69    CGLNSVDCVGHYAYIKLVVPVFHIGYFKHTIGILQCICKTCARVLLEEPDRRAYLKRFRR  128

Query  1083  TKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKIIHE--YGSQFL  913
               LE+L++  L    VK   A+   RK V C  C   NG VKK G LKIIH+     +  
Sbjct  129   PNLENLQRMTL----VKAVNAL--ARKTVYCPYCAATNGTVKKAGALKIIHDKFRAKKTA  182

Query  912   DECHN-------AVSNKTKGSI----TVPPELDSKTVHSLFKKMIDEDCELLYLS---DK  775
             +E          AV  + + S+     +  +L+   V  LFK++ DEDCELL L     +
Sbjct  183   EEMEKWKRTFGPAVEAQKELSMYINKAIHEDLNPLKVLDLFKRISDEDCELLGLRPDYGR  242

Query  774   PEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSLRQEISDTTLPARS  595
             PE+ +   I VPP+AIRPSV  DG   SNE+D+T +L  I+ +N+ ++Q ++     A+ 
Sbjct  243   PEQYIWQYISVPPVAIRPSVAQDGA--SNEDDLTVKLTEIVFSNALIKQGLAKGAPTAQF  300

Query  594   LASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQGRFRGNLSGKRVEYTGR  415
             +  W  LQ+ VA YINS++ G+P QM   +P+ GF QRLKGKQGRFRGNLSGKRV+++GR
Sbjct  301   MEQWEFLQLSVAMYINSELPGVPSQM-GQKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGR  359

Query  414   TVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRNGPNKYPGAKYIKH-PD  238
             TVISPDPNL+I EVA+P  +A+ILT+PERV+ HNIE+L++ VRNG + +PGA Y+    +
Sbjct  360   TVISPDPNLRIDEVAVPERVAKILTYPERVTAHNIERLKKAVRNGCDVHPGANYVTAGSN  419

Query  237   GTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLHRMSIMCHRARIMPWRTL  58
             G +  L + +R   AD L+ G IV+RH+ DGD  LFNRQPSLH++       ++ PWR+ 
Sbjct  420   GFKKYLKFGNRTAIADGLRIGDIVERHVIDGDIALFNRQPSLHKI-------KVRPWRSF  472

Query  57    RFNESVCNPYNADFDGDEM  1
             R NE VC PYNADFDGDEM
Sbjct  473   RLNECVCGPYNADFDGDEM  491



>ref|XP_010606151.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 isoform 
X2 [Fukomys damarensis]
 gb|KFO37026.1| DNA-directed RNA polymerase III subunit RPC1 [Fukomys damarensis]
Length=1390

 Score =   417 bits (1073),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHILLSKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K+V  +C      RK  +C  CG  NG VKK G LKI
Sbjct  121   EKQQFLDHLKRPGLTYLQKRGLRKKVSDKC------RKKSLCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPMVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLIVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_005325893.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 [Ictidomys 
tridecemlineatus]
Length=1390

 Score =   417 bits (1073),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 232/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK  IC  CG  NG VKK G LKI
Sbjct  121   EKQQFLDYLKRPGLTYLQKRGLKKKISDKC------RKKSICHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPIVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLIVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>gb|EMG47443.1| DNA-directed RNA polymerase, partial [Candida maltosa Xu316]
Length=1447

 Score =   418 bits (1075),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 217/517 (42%), Positives = 321/517 (62%), Gaps = 41/517 (8%)
 Frame = -3

Query  1452  IEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRMGPPNKT  1279
             + D+ P+ IK ++F   S  +++  +EVE+     YD  K   P   G LD +MG  + +
Sbjct  5     VVDIAPKCIKGLEFGALSAKDIISQSEVEIQTRDLYDLEKGRVPKQYGALDTKMGISSNS  64

Query  1278  KSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEKERLDFL  1099
             + C+TC+G+   C GH+G++ LALPVF+VGY   I+ IL+C+CK C+ ILL E  +  FL
Sbjct  65    QECSTCHGNLASCHGHFGHIRLALPVFHVGYFKNIISILQCVCKNCASILLDEPSKRQFL  124

Query  1098  RKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-----GP--LKI  940
               +R   +++L++ ++ K+++++C      +K   C +C  +NG+VKK     GP  LKI
Sbjct  125   NDLRRPNIDNLRRMKILKKIIEQC------KKQRRCLKCNHINGVVKKAASGAGPAALKI  178

Query  939   IHE--------------YGSQFLDECHNAVSNKTKGSITVPPELDSKTVHSLFKKMIDED  802
             +H+                 + LD+  N      K +  +  +L+     +LFK++  ED
Sbjct  179   VHDTFRWIGKKETPEKNQWDEDLDQVFNRNPELEKFAKRIQDDLNPLKTLNLFKQITPED  238

Query  801   CELLYLS----DKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQANSSL  634
             CEL  L+     +PE  +   +P PP+ IRPSV +D   QSNE+D+T +L  I+  +S +
Sbjct  239   CELFGLNPAKGGRPEMYIWRYLPAPPVCIRPSVMMDA--QSNEDDLTVKLTEIVWTSSMI  296

Query  633   RQEISDTTLPARSLASWVDLQMEVAQYINSD-----VRGLPPQMQASRPLSGFVQRLKGK  469
             +  I         +  W  +Q+ VA YINSD     +       +AS+P+  F QRLKGK
Sbjct  297   KAGILKGISINNLMEQWDYMQLSVAMYINSDSANPALSAGGGGAKASKPIRAFCQRLKGK  356

Query  468   QGRFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCV  289
             QGRFRGNLSGKRV+++GRTVISPDPNLKI EVA+P+L+A++LT+PE+ +R+N +KL+Q +
Sbjct  357   QGRFRGNLSGKRVDFSGRTVISPDPNLKIDEVAVPVLVAKVLTYPEKCTRYNRKKLQQLI  416

Query  288   RNGPNKYPGAKYI-KHPDGTEISLMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSL  112
              NGP+ +PGA Y+ K  +  + +L +  R + A  L+ G +V+RH+EDGD VLFNRQPSL
Sbjct  417   VNGPDFHPGANYVMKQGEAGKRNLRFGDRFKLAKYLQIGDVVERHIEDGDVVLFNRQPSL  476

Query  111   HRMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             HR+SI+ H A+I PWRT R NE VC PYNADFDGDEM
Sbjct  477   HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEM  513



>ref|XP_006887622.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1-like 
[Elephantulus edwardii]
Length=1231

 Score =   415 bits (1066),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 232/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  EC GHYGY++L LP F+VGY   ++ IL+ ICK C  I+L ++
Sbjct  61    GTSEKDRPCETCGKNLAECLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K++  +C      RK  IC  CG  NG VKK G LKI
Sbjct  121   EKKQFLDYLKRPSLTYLQKRGLKKKISDKC------RKKTICHHCGSFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     AV +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKMVDPIVSNFLQSFETAVEHNKE----VEPLLGRAQENLNPLVVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI+ LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANIDFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             G   +PGA +I+    T++   L Y +R++ A ELK+G IV+RHL DGD VLFNRQPSLH
Sbjct  411   GSEVHPGANFIQQRH-TQMKRFLKYGNREKIAQELKFGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



>ref|XP_010606144.1| PREDICTED: DNA-directed RNA polymerase III subunit RPC1 isoform 
X1 [Fukomys damarensis]
Length=1403

 Score =   417 bits (1073),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 233/516 (45%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = -3

Query  1470  FTKQPYIEDVGPRKIKSIQFSTFSGSEVMKSAEVEVYRGVYYDASKN--PILNGLLDPRM  1297
               K+ + E    +KI  I F   S  E+ + A ++V     Y    N  P+L G+LD RM
Sbjct  1     MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNNHAPLLYGVLDHRM  60

Query  1296  GPPNKTKSCATCNGDFKECPGHYGYLNLALPVFNVGYLPIIVDILKCICKGCSRILLGEK  1117
             G   K + C TC  +  +C GHYGY++L LP F+VGY   ++ IL+ ICK C  ILL ++
Sbjct  61    GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHILLSKE  120

Query  1116  ERLDFLRKMRNTKLEHLKKNELFKRVVKRCTAMTSGRKAVICSRCGCVNGMVKK-GPLKI  940
             E+  FL  ++   L +L+K  L K+V  +C      RK  +C  CG  NG VKK G LKI
Sbjct  121   EKQQFLDHLKRPGLTYLQKRGLRKKVSDKC------RKKSLCHHCGAFNGTVKKCGLLKI  174

Query  939   IHE-----------YGSQFLDECHNAVSNKTKGSITVPP-------ELDSKTVHSLFKKM  814
             IHE             S FL     A+ +  +    V P        L+   V +LFK++
Sbjct  175   IHEKYKTNKKVVDPMVSSFLQSFETAIEHNKE----VEPLLGRAQENLNPLIVLNLFKRI  230

Query  813   IDEDCELLYL---SDKPEKLLVTSIPVPPIAIRPSVFVDGGMQSNENDITERLKRIIQAN  643
               ED  LL +   + KP  L++T + VPP+ IRPSV  D    +NE+D+T +L  II  N
Sbjct  231   PAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLN  290

Query  642   SSLRQEISDTTLPARSLASWVDLQMEVAQYINSDVRGLPPQMQASRPLSGFVQRLKGKQG  463
               +++           +  W  LQ++ A YINS++ G+P  M   +   GFVQRLKGKQG
Sbjct  291   DVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQG  350

Query  462   RFRGNLSGKRVEYTGRTVISPDPNLKITEVAIPILMARILTFPERVSRHNIEKLRQCVRN  283
             RFRGNLSGKRV+++GRTVISPDPNL+I EVA+P+ +A+ILTFPE+V++ NI  LR+ VRN
Sbjct  351   RFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRN  410

Query  282   GPNKYPGAKYIKHPDGTEIS--LMYSSRKRHADELKYGYIVDRHLEDGDAVLFNRQPSLH  109
             GP  +PGA +I+    T++   L Y +R++ A ELKYG IV+RHL DGD VLFNRQPSLH
Sbjct  411   GPEVHPGANFIQQRH-TQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLH  469

Query  108   RMSIMCHRARIMPWRTLRFNESVCNPYNADFDGDEM  1
             ++SIM H AR+ P RT RFNE VC PYNADFDGDEM
Sbjct  470   KLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEM  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5250800251364