BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25839_g2_i3 len=1664 path=[19635:0-295 37318:296-297 31838:298-375
31916:376-420 14733:421-429 14742:430-430 14743:431-433
14746:434-486 37489:487-505 37508:506-518 14831:519-598
21786:599-721 14911:722-756 14946:757-757 14947:758-1663]

Length=1664
                                                                      Score     E

ref|XP_002272417.2|  PREDICTED: putative threonine aspartase            419   2e-138   Vitis vinifera
ref|XP_009779482.1|  PREDICTED: putative threonine aspartase isof...    410   1e-134   
ref|XP_004240111.1|  PREDICTED: putative threonine aspartase isof...    407   1e-133   
ref|XP_010321533.1|  PREDICTED: putative threonine aspartase isof...    407   3e-133   
ref|XP_006345600.1|  PREDICTED: putative threonine aspartase-like...    402   1e-131   
ref|XP_009779483.1|  PREDICTED: putative threonine aspartase isof...    400   1e-130   
ref|XP_006445098.1|  hypothetical protein CICLE_v10024326mg             398   5e-130   
ref|XP_007051873.1|  N-terminal nucleophile aminohydrolases (Ntn ...    393   5e-128   
gb|KDP28659.1|  hypothetical protein JCGZ_14430                         393   1e-127   
emb|CDP08854.1|  unnamed protein product                                389   2e-126   
ref|XP_002320114.2|  asparaginase 2 family protein                      389   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_004155816.1|  PREDICTED: probable isoaspartyl peptidase/L-...    385   5e-125   
ref|XP_004134332.1|  PREDICTED: probable isoaspartyl peptidase/L-...    384   7e-125   
gb|KGN56537.1|  hypothetical protein Csa_3G122610                       384   5e-124   
ref|XP_007218079.1|  hypothetical protein PRUPE_ppa006346mg             382   8e-124   
ref|XP_011035849.1|  PREDICTED: putative threonine aspartase            382   9e-124   
ref|XP_009347858.1|  PREDICTED: putative threonine aspartase isof...    381   1e-123   
ref|XP_011091903.1|  PREDICTED: putative threonine aspartase            381   2e-123   
ref|XP_009347857.1|  PREDICTED: putative threonine aspartase isof...    381   2e-123   
ref|XP_008232784.1|  PREDICTED: putative threonine aspartase            380   5e-123   
ref|XP_008438075.1|  PREDICTED: putative threonine aspartase isof...    378   2e-122   
ref|XP_008438074.1|  PREDICTED: putative threonine aspartase isof...    378   5e-122   
ref|XP_002511826.1|  threonine aspartase, putative                      377   9e-122   Ricinus communis
gb|KHG24615.1|  hypothetical protein F383_06242                         384   6e-121   
ref|XP_008376027.1|  PREDICTED: putative threonine aspartase isof...    374   7e-121   
ref|XP_008376028.1|  PREDICTED: putative threonine aspartase isof...    374   1e-120   
gb|KHG24614.1|  hypothetical protein F383_06242                         383   2e-120   
ref|XP_010321534.1|  PREDICTED: putative threonine aspartase isof...    372   3e-120   
gb|KHN30851.1|  Putative isoaspartyl peptidase/L-asparaginase 4         370   4e-120   
ref|XP_003521015.1|  PREDICTED: putative threonine aspartase-like...    371   6e-120   
ref|NP_191968.3|  N-terminal nucleophile aminohydrolases (Ntn hyd...    371   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004306811.1|  PREDICTED: putative threonine aspartase-like       372   2e-119   
ref|XP_002875021.1|  hypothetical protein ARALYDRAFT_490508             369   6e-119   
ref|XP_010456261.1|  PREDICTED: putative threonine aspartase isof...    368   2e-118   
ref|XP_010419609.1|  PREDICTED: putative threonine aspartase isof...    366   1e-117   
ref|XP_010263748.1|  PREDICTED: putative threonine aspartase isof...    362   3e-117   
gb|ACI95768.1|  putative L-asparaginase 1                               363   1e-116   Vigna radiata [mung bean]
ref|XP_010419610.1|  PREDICTED: putative threonine aspartase isof...    363   1e-116   
ref|XP_006396259.1|  hypothetical protein EUTSA_v10028700mg             363   2e-116   
ref|XP_010263733.1|  PREDICTED: putative threonine aspartase isof...    363   3e-116   
ref|XP_007133209.1|  hypothetical protein PHAVU_011G160800g             362   3e-116   
ref|XP_006287871.1|  hypothetical protein CARUB_v10001098mg             362   4e-116   
ref|XP_004510821.1|  PREDICTED: putative threonine aspartase-like...    361   1e-115   
ref|XP_009111470.1|  PREDICTED: putative threonine aspartase isof...    359   5e-115   
ref|XP_010053681.1|  PREDICTED: putative threonine aspartase            358   7e-115   
gb|KEH18920.1|  isoaspartyl peptidase/L-asparaginase                    355   9e-115   
emb|CDY51149.1|  BnaA09g51840D                                          358   1e-114   
gb|KEH18919.1|  isoaspartyl peptidase/L-asparaginase                    356   6e-114   
ref|XP_010523030.1|  PREDICTED: putative threonine aspartase isof...    355   1e-113   
gb|KFK30418.1|  hypothetical protein AALP_AA7G258400                    355   2e-113   
emb|CDY07207.1|  BnaCnng02220D                                          354   6e-113   
ref|XP_006491052.1|  PREDICTED: putative threonine aspartase-like...    352   3e-112   
ref|XP_010523029.1|  PREDICTED: putative threonine aspartase isof...    351   1e-111   
gb|EYU32088.1|  hypothetical protein MIMGU_mgv1a007933mg                347   1e-110   
ref|XP_010263738.1|  PREDICTED: putative threonine aspartase isof...    344   3e-109   
ref|XP_009779485.1|  PREDICTED: putative threonine aspartase isof...    339   1e-107   
ref|XP_010427239.1|  PREDICTED: LOW QUALITY PROTEIN: putative thr...    337   3e-106   
ref|XP_009620817.1|  PREDICTED: putative threonine aspartase isof...    335   6e-106   
ref|XP_010671917.1|  PREDICTED: putative threonine aspartase            336   7e-106   
ref|XP_008778598.1|  PREDICTED: putative threonine aspartase isof...    332   3e-104   
ref|XP_008778606.1|  PREDICTED: putative threonine aspartase isof...    331   5e-104   
ref|XP_009347859.1|  PREDICTED: putative threonine aspartase isof...    330   5e-104   
ref|XP_010940450.1|  PREDICTED: putative threonine aspartase isof...    328   6e-104   
ref|XP_010940443.1|  PREDICTED: putative threonine aspartase isof...    331   1e-103   
ref|XP_009787749.1|  PREDICTED: putative threonine aspartase isof...    324   1e-103   
ref|XP_010940442.1|  PREDICTED: putative threonine aspartase isof...    331   2e-103   
ref|XP_008438076.1|  PREDICTED: putative threonine aspartase isof...    327   2e-102   
ref|XP_004510822.1|  PREDICTED: putative threonine aspartase-like...    325   2e-102   
ref|XP_009620818.1|  PREDICTED: putative threonine aspartase isof...    325   4e-102   
ref|XP_004960026.1|  PREDICTED: LOW QUALITY PROTEIN: putative thr...    323   1e-100   
gb|AAC13614.1|  regions of weak similarity to l-asparaginase            321   3e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456262.1|  PREDICTED: putative threonine aspartase isof...    317   5e-99    
ref|XP_006576666.1|  PREDICTED: putative threonine aspartase-like...    315   1e-98    
ref|NP_001190644.1|  N-terminal nucleophile aminohydrolases (Ntn ...    316   1e-98    
ref|XP_006827748.1|  hypothetical protein AMTR_s00009p00262810          316   2e-98    
ref|XP_010263756.1|  PREDICTED: putative threonine aspartase isof...    316   2e-98    
ref|XP_010419611.1|  PREDICTED: putative threonine aspartase isof...    315   3e-98    
ref|XP_009398542.1|  PREDICTED: putative threonine aspartase isof...    312   2e-97    
ref|XP_008778613.1|  PREDICTED: putative threonine aspartase isof...    313   3e-97    
ref|XP_006653043.1|  PREDICTED: putative threonine aspartase-like       314   4e-97    
ref|XP_009398533.1|  PREDICTED: putative threonine aspartase isof...    312   1e-96    
ref|XP_009111471.1|  PREDICTED: putative threonine aspartase isof...    308   3e-95    
gb|EMS62373.1|  putative isoaspartyl peptidase/L-asparaginase 4         304   9e-94    
dbj|BAJ98979.1|  predicted protein                                      299   7e-92    
gb|EEC78274.1|  hypothetical protein OsI_17968                          296   3e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_003579495.1|  PREDICTED: putative threonine aspartase            296   4e-90    
gb|EEE61927.1|  hypothetical protein OsJ_16668                          296   4e-90    Oryza sativa Japonica Group [Japonica rice]
emb|CAE03435.2|  OSJNBa0032F06.18                                       293   9e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010107612.1|  putative isoaspartyl peptidase/L-asparaginase 4    289   1e-88    
ref|NP_001054297.1|  Os04g0682500                                       291   3e-88    Oryza sativa Japonica Group [Japonica rice]
gb|KEH18921.1|  isoaspartyl peptidase/L-asparaginase                    286   1e-87    
ref|NP_001140382.1|  uncharacterized protein LOC100272436               287   8e-87    Zea mays [maize]
ref|XP_010940444.1|  PREDICTED: putative threonine aspartase isof...    280   4e-85    
ref|XP_010940448.1|  PREDICTED: putative threonine aspartase isof...    278   1e-84    
gb|EPS62871.1|  hypothetical protein M569_11915                         270   4e-81    
gb|AFK34185.1|  unknown                                                 263   1e-80    
gb|EMT04749.1|  Putative isoaspartyl peptidase/L-asparaginase 4         253   2e-75    
ref|XP_007200674.1|  hypothetical protein PRUPE_ppa015895mg             248   1e-74    
ref|XP_009787750.1|  PREDICTED: putative threonine aspartase isof...    247   3e-74    
emb|CAN66192.1|  hypothetical protein VITISV_029199                     235   1e-70    Vitis vinifera
ref|XP_007133210.1|  hypothetical protein PHAVU_011G160800g             240   5e-70    
dbj|BAK06563.1|  predicted protein                                      243   2e-69    
gb|AFW59942.1|  LOW QUALITY PROTEIN: L-asparaginase family protein      235   2e-67    
ref|XP_001761847.1|  predicted protein                                  210   3e-58    
ref|XP_008339972.1|  PREDICTED: putative threonine aspartase            176   1e-48    
ref|XP_002961514.1|  hypothetical protein SELMODRAFT_75939              182   3e-48    
ref|XP_008663714.1|  PREDICTED: putative threonine aspartase            148   9e-39    
ref|XP_010457009.1|  PREDICTED: LOW QUALITY PROTEIN: putative thr...    132   5e-33    
ref|XP_002447343.1|  hypothetical protein SORBIDRAFT_06g033300          119   3e-26    Sorghum bicolor [broomcorn]
emb|CAJ86297.1|  H0124B04.14                                            118   1e-25    Oryza sativa [red rice]
gb|KFH68663.1|  hypothetical protein MVEG_05472                         112   2e-23    
ref|XP_006345601.1|  PREDICTED: putative threonine aspartase-like...    107   1e-22    
gb|KDQ27711.1|  hypothetical protein PLEOSDRAFT_1076792                 109   1e-22    
ref|XP_010217946.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...    108   4e-22    
emb|CCD77871.1|  taspase-1 (T02 family)                                 106   1e-21    
ref|XP_010704934.1|  PREDICTED: threonine aspartase 1                   107   1e-21    
ref|XP_781597.2|  PREDICTED: threonine aspartase 1-like                 106   1e-21    Strongylocentrotus purpuratus [purple urchin]
ref|NP_001012808.1|  threonine aspartase 1                              107   2e-21    Gallus gallus [bantam]
ref|XP_010175991.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...    104   7e-21    
gb|KGB37877.1|  Threonine aspartase 1                                   104   7e-21    
ref|XP_009573942.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...    103   2e-20    
gb|KHG25629.1|  hypothetical protein F383_08639                       95.9    3e-20    
gb|AAW25758.1|  SJCHGC02349 protein                                     102   3e-20    Schistosoma japonicum
gb|ERE71024.1|  threonine aspartase 1-like isoform 1                    101   3e-20    
ref|XP_004333217.1|  Tasp1 protein                                      101   5e-20    
gb|KFM57192.1|  Threonine aspartase 1                                   100   1e-19    
gb|KHG19427.1|  hypothetical protein F383_08320                       95.9    1e-19    
ref|XP_008034521.1|  N-terminal nucleophile aminohydrolase              100   1e-19    
ref|XP_006723652.1|  PREDICTED: threonine aspartase 1 isoform X1      97.8    6e-19    
dbj|BAA91018.1|  unnamed protein product                              98.6    1e-18    Homo sapiens [man]
ref|NP_060184.2|  threonine aspartase 1 precursor                     98.6    1e-18    Homo sapiens [man]
gb|KDQ21363.1|  hypothetical protein BOTBODRAFT_618295                97.1    1e-18    
ref|XP_005181785.1|  PREDICTED: threonine aspartase 1-like            97.1    1e-18    
ref|XP_009858315.1|  PREDICTED: uncharacterized protein LOC100178578  99.8    2e-18    
gb|KDQ57831.1|  hypothetical protein JAAARDRAFT_178341                97.1    2e-18    
pdb|2A8M|A  Chain A, Crystal Structure Of Human Taspase1 (T234s M...  97.1    3e-18    
ref|XP_007361954.1|  N-terminal nucleophile aminohydrolase            96.7    4e-18    
pdb|2A8L|A  Chain A, Crystal Structure Of Human Taspase1 (T234a M...  96.3    5e-18    
gb|EPS97728.1|  N-terminal nucleophile aminohydrolase                 95.9    7e-18    
dbj|GAM17346.1|  hypothetical protein SAMD00019534_005210             94.4    3e-17    
gb|EPB85673.1|  hypothetical protein HMPREF1544_07580                 92.8    3e-17    
ref|XP_007864413.1|  N-terminal nucleophile aminohydrolase            92.8    5e-17    
emb|CEG75604.1|  hypothetical protein RMATCC62417_10615               91.7    6e-17    
ref|XP_002399557.1|  asparaginase, putative                           92.0    8e-17    Ixodes scapularis [blacklegged tick]
emb|CEG75603.1|  hypothetical protein RMATCC62417_10615               91.3    1e-16    
emb|CEG75601.1|  hypothetical protein RMATCC62417_10615               91.3    1e-16    
ref|XP_006819493.1|  PREDICTED: threonine aspartase 1-like            89.4    2e-16    
dbj|GAA38679.1|  taspase threonine aspartase 1                        90.9    2e-16    
emb|CDH50762.1|  threonine aspartase 1-like                           90.1    2e-16    
ref|XP_624615.1|  PREDICTED: threonine aspartase 1-like isoform X2    90.5    2e-16    Apis mellifera [bee]
ref|XP_003696625.1|  PREDICTED: threonine aspartase 1-like            89.7    4e-16    
ref|XP_005644125.1|  N-terminal nucleophile aminohydrolase            92.0    4e-16    
ref|XP_003286025.1|  hypothetical protein DICPUDRAFT_149945           91.7    4e-16    
ref|XP_007317353.1|  hypothetical protein SERLADRAFT_465070           89.7    4e-16    
ref|XP_006618611.1|  PREDICTED: threonine aspartase 1-like isofor...  89.4    5e-16    
gb|EFN66280.1|  Threonine aspartase 1                                 89.4    6e-16    
ref|XP_010077042.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  87.0    1e-15    
ref|XP_006567758.1|  PREDICTED: threonine aspartase 1-like isofor...  88.2    1e-15    
gb|EFX79308.1|  hypothetical protein DAPPUDRAFT_304827                87.8    2e-15    
ref|XP_006618610.1|  PREDICTED: threonine aspartase 1-like isofor...  87.4    2e-15    
ref|XP_001973171.1|  GG13500                                          87.4    2e-15    Drosophila erecta
ref|XP_009917251.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  87.0    3e-15    
ref|XP_010303339.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  88.2    3e-15    
ref|XP_010289380.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  85.9    4e-15    
emb|CDS11750.1|  hypothetical protein LRAMOSA04013                    86.7    4e-15    
ref|XP_004530807.1|  PREDICTED: threonine aspartase 1-like            86.7    4e-15    
ref|XP_001627789.1|  predicted protein                                85.1    5e-15    Nematostella vectensis
ref|XP_008942159.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  84.7    5e-15    
ref|XP_973095.1|  PREDICTED: threonine aspartase 1                    86.3    5e-15    Tribolium castaneum [rust-red flour beetle]
ref|XP_007767078.1|  N-terminal nucleophile aminohydrolase            86.7    5e-15    
ref|XP_009512283.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  85.1    6e-15    
gb|KFQ78889.1|  Threonine aspartase 1                                 84.0    7e-15    
ref|XP_001353268.1|  GA18757                                          86.3    7e-15    Drosophila pseudoobscura pseudoobscura
gb|KHG07618.1|  hypothetical protein F383_34399                       80.5    7e-15    
ref|XP_639126.1|  hypothetical protein DDB_G0283269                   87.8    7e-15    Dictyostelium discoideum AX4
gb|EFA80354.1|  putative asparaginase 2                               87.0    7e-15    Heterostelium album PN500
emb|CDX78005.1|  BnaA09g32000D                                        86.3    9e-15    
gb|AFW59943.1|  L-asparaginase family protein                         84.3    1e-14    
gb|EMD37889.1|  hypothetical protein CERSUDRAFT_50827                 85.1    1e-14    
ref|XP_002086512.1|  GE22812                                          84.0    2e-14    Drosophila yakuba
gb|KFU99535.1|  Threonine aspartase 1                                 82.8    2e-14    
ref|XP_004475331.1|  PREDICTED: threonine aspartase 1 isoform 1       85.1    3e-14    
ref|XP_004610973.1|  PREDICTED: threonine aspartase 1                 85.1    3e-14    
ref|XP_003134306.3|  PREDICTED: threonine aspartase 1 isoform X1      85.1    3e-14    
ref|XP_009231585.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  82.8    3e-14    
ref|XP_003493403.1|  PREDICTED: threonine aspartase 1-like            84.0    3e-14    
gb|KDR17252.1|  hypothetical protein L798_08817                       83.6    3e-14    
ref|XP_005019859.1|  PREDICTED: threonine aspartase 1 isoform X3      83.6    3e-14    
ref|XP_008541037.1|  PREDICTED: threonine aspartase 1-like            82.8    3e-14    
ref|XP_010189511.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  81.6    4e-14    
gb|EZA61590.1|  Threonine aspartase                                   83.6    4e-14    
gb|EUB63732.1|  Threonine aspartase                                   84.0    4e-14    
ref|XP_006189337.1|  PREDICTED: threonine aspartase 1                 83.2    5e-14    
ref|XP_002095245.1|  GE19799                                          83.6    5e-14    Drosophila yakuba
ref|XP_004412922.1|  PREDICTED: threonine aspartase 1                 83.2    5e-14    
emb|CDJ03419.1|  threonine aspartase 1                                83.6    5e-14    
ref|XP_009554791.1|  PREDICTED: threonine aspartase 1                 84.3    5e-14    
ref|XP_010130662.1|  PREDICTED: threonine aspartase 1                 81.3    5e-14    
ref|XP_005445653.1|  PREDICTED: threonine aspartase 1 isoform X1      84.3    5e-14    
gb|ELR51831.1|  Threonine aspartase 1                                 82.8    6e-14    
ref|XP_008961164.1|  PREDICTED: threonine aspartase 1 isoform X2      83.2    6e-14    
ref|XP_004687218.1|  PREDICTED: threonine aspartase 1                 84.0    6e-14    
ref|XP_003788055.1|  PREDICTED: threonine aspartase 1                 84.0    6e-14    
emb|CDH50763.1|  threonine aspartase 1-like                           82.0    6e-14    
ref|XP_004661510.1|  PREDICTED: threonine aspartase 1                 83.6    6e-14    
ref|XP_009435095.1|  PREDICTED: threonine aspartase 1 isoform X3      83.2    6e-14    
ref|XP_007525860.1|  PREDICTED: threonine aspartase 1                 84.0    7e-14    
ref|XP_009491932.1|  PREDICTED: threonine aspartase 1                 83.6    7e-14    
ref|XP_005902094.1|  PREDICTED: threonine aspartase 1                 82.8    8e-14    
ref|XP_006638785.1|  PREDICTED: threonine aspartase 1-like            83.6    8e-14    
ref|XP_005019858.1|  PREDICTED: threonine aspartase 1 isoform X2      83.2    8e-14    
ref|XP_002711012.1|  PREDICTED: threonine aspartase 1                 83.6    8e-14    Oryctolagus cuniculus [domestic rabbit]
ref|XP_004593419.1|  PREDICTED: threonine aspartase 1 isoform X1      83.6    8e-14    
ref|XP_009969086.1|  PREDICTED: threonine aspartase 1                 83.2    9e-14    
ref|XP_005604530.1|  PREDICTED: threonine aspartase 1 isoform X2      83.2    9e-14    
ref|XP_009956965.1|  PREDICTED: threonine aspartase 1                 83.2    9e-14    
ref|XP_002007671.1|  GI12255                                          82.8    9e-14    Drosophila mojavensis
ref|XP_001985065.1|  GH14708                                          82.8    1e-13    Drosophila grimshawi
ref|XP_006894812.1|  PREDICTED: threonine aspartase 1-like            83.2    1e-13    
ref|XP_007476741.1|  PREDICTED: threonine aspartase 1 isoform X10     82.4    1e-13    
ref|XP_001957938.1|  GF10660                                          83.6    1e-13    Drosophila ananassae
ref|XP_002048180.1|  GJ11486                                          82.4    1e-13    Drosophila virilis
ref|XP_002030680.1|  GM24449                                          82.4    1e-13    Drosophila sechellia
ref|XP_002069110.1|  GK23937                                          82.8    1e-13    Drosophila willistoni
ref|XP_004698216.1|  PREDICTED: threonine aspartase 1                 83.2    1e-13    
ref|XP_010781835.1|  PREDICTED: threonine aspartase 1                 83.2    1e-13    
ref|XP_006758165.1|  PREDICTED: threonine aspartase 1 isoform X2      82.8    1e-13    
ref|XP_010589830.1|  PREDICTED: threonine aspartase 1 isoform X2      82.0    1e-13    
ref|XP_010971185.1|  PREDICTED: threonine aspartase 1 isoform X2      82.4    1e-13    
ref|XP_009893731.1|  PREDICTED: threonine aspartase 1                 83.2    1e-13    
ref|XP_009169156.1|  hypothetical protein T265_05798                  84.7    1e-13    
ref|XP_010809336.1|  PREDICTED: threonine aspartase 1 isoform X4      82.4    1e-13    
ref|NP_648832.1|  taspase 1, isoform A                                82.4    1e-13    Drosophila melanogaster
ref|XP_004276525.1|  PREDICTED: threonine aspartase 1                 82.8    1e-13    
ref|XP_008499120.1|  PREDICTED: threonine aspartase 1                 82.8    1e-13    
ref|XP_010342054.1|  PREDICTED: threonine aspartase 1                 81.6    1e-13    
ref|XP_005428102.1|  PREDICTED: threonine aspartase 1 isoform X3      82.8    1e-13    
ref|XP_010146303.1|  PREDICTED: threonine aspartase 1                 82.8    1e-13    
ref|XP_010573098.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    1e-13    
ref|XP_006260897.1|  PREDICTED: threonine aspartase 1                 82.8    1e-13    
ref|XP_005510752.1|  PREDICTED: threonine aspartase 1                 82.8    1e-13    
ref|XP_007165329.1|  PREDICTED: threonine aspartase 1 isoform X4      82.8    1e-13    
ref|XP_005634835.1|  PREDICTED: threonine aspartase 1 isoform X5      82.8    1e-13    
ref|XP_010573100.1|  PREDICTED: threonine aspartase 1 isoform X2      82.8    1e-13    
ref|XP_006500409.1|  PREDICTED: threonine aspartase 1 isoform X2      82.0    2e-13    
ref|XP_005525487.1|  PREDICTED: threonine aspartase 1 isoform X2      82.8    2e-13    
ref|XP_005019857.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    2e-13    
ref|XP_010200002.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009932518.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_008931235.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009672286.1|  PREDICTED: threonine aspartase 1 isoform X2      82.8    2e-13    
ref|XP_008825400.1|  PREDICTED: threonine aspartase 1                 81.6    2e-13    
ref|XP_009317835.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_010632398.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_005238659.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_006921645.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_005428101.1|  PREDICTED: threonine aspartase 1 isoform X2      82.8    2e-13    
ref|XP_006030095.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009807235.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009998480.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009672285.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    2e-13    
ref|XP_004754265.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    2e-13    
ref|XP_008994019.1|  PREDICTED: threonine aspartase 1 isoform X2      81.6    2e-13    
ref|XP_005525486.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    2e-13    
ref|XP_005042789.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_009985075.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_008701581.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_005147520.1|  PREDICTED: threonine aspartase 1                 82.8    2e-13    
ref|XP_001492291.1|  PREDICTED: threonine aspartase 1 isoform X1      82.8    2e-13    Equus caballus [domestic horse]
ref|XP_006758164.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
pdb|2A8I|A  Chain A, Crystal Structure Of Human Taspase1              82.4    2e-13    
ref|XP_849259.1|  PREDICTED: threonine aspartase 1 isoformX2          82.4    2e-13    Canis lupus familiaris [dogs]
ref|XP_008139322.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_005860633.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_004376517.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_003983837.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_007944570.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_004876893.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_009435093.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_002918527.1|  PREDICTED: threonine aspartase 1-like            82.4    2e-13    
ref|XP_003411505.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_010971184.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_008058341.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_004014210.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_007165326.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_003252096.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_001135721.1|  PREDICTED: threonine aspartase 1 isoform X2      82.4    2e-13    
ref|XP_001083347.1|  PREDICTED: threonine aspartase 1 isoform 2       82.4    2e-13    
ref|XP_005974697.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_005634834.1|  PREDICTED: threonine aspartase 1 isoform X4      82.4    2e-13    
ref|XP_006206254.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|NP_001029749.2|  threonine aspartase 1                            82.4    2e-13    
ref|XP_004634365.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_008994018.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_005380942.1|  PREDICTED: threonine aspartase 1                 82.0    2e-13    
ref|XP_006983739.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_006865683.1|  PREDICTED: threonine aspartase 1-like            82.4    2e-13    
ref|XP_004433803.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_006143719.1|  PREDICTED: threonine aspartase 1                 82.4    2e-13    
ref|XP_005604531.1|  PREDICTED: threonine aspartase 1 isoform X3      82.0    2e-13    
ref|XP_005488562.1|  PREDICTED: threonine aspartase 1 isoform X2      82.0    2e-13    
ref|XP_005488561.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|XP_007476732.1|  PREDICTED: threonine aspartase 1 isoform X1      82.4    2e-13    
ref|NP_001120568.1|  taspase, threonine aspartase, 1                  82.4    2e-13    
ref|XP_007476734.1|  PREDICTED: threonine aspartase 1 isoform X3      82.4    2e-13    
ref|NP_001270940.1|  taspase, threonine aspartase, 1                  82.4    2e-13    
emb|CAG09520.1|  unnamed protein product                              82.0    2e-13    
ref|XP_007476740.1|  PREDICTED: threonine aspartase 1 isoform X9      82.0    2e-13    
ref|XP_005095410.1|  PREDICTED: threonine aspartase 1-like isofor...  82.4    2e-13    
gb|EGV99992.1|  Threonine aspartase 1                                 82.0    2e-13    
ref|XP_003476590.1|  PREDICTED: threonine aspartase 1 isoform 1       82.0    2e-13    
ref|XP_005068754.1|  PREDICTED: threonine aspartase 1 isoform X1      82.0    2e-13    
ref|XP_005320525.1|  PREDICTED: threonine aspartase 1 isoform X1      82.0    2e-13    
ref|XP_007643066.1|  PREDICTED: threonine aspartase 1 isoform X1      82.0    2e-13    
ref|XP_007476739.1|  PREDICTED: threonine aspartase 1 isoform X8      82.0    2e-13    
ref|XP_007476735.1|  PREDICTED: threonine aspartase 1 isoform X4      82.4    3e-13    
ref|NP_001089254.1|  taspase, threonine aspartase, 1                  82.0    3e-13    
ref|XP_005428100.1|  PREDICTED: threonine aspartase 1 isoform X1      82.0    3e-13    
ref|NP_001037708.1|  threonine aspartase 1                            82.0    3e-13    
ref|XP_005365586.1|  PREDICTED: threonine aspartase 1 isoform X1      82.0    3e-13    
ref|XP_005095409.1|  PREDICTED: threonine aspartase 1-like isofor...  82.4    3e-13    
ref|XP_010809337.1|  PREDICTED: threonine aspartase 1 isoform X5      81.3    3e-13    
ref|XP_007476736.1|  PREDICTED: threonine aspartase 1 isoform X5      82.0    3e-13    
ref|XP_010809333.1|  PREDICTED: threonine aspartase 1 isoform X2      82.0    3e-13    
ref|XP_003758228.1|  PREDICTED: threonine aspartase 1 isoform 1       81.6    3e-13    
ref|XP_006114759.1|  PREDICTED: threonine aspartase 1 isoform X3      80.9    3e-13    
ref|XP_009905196.1|  PREDICTED: threonine aspartase 1                 81.6    3e-13    
ref|XP_007476738.1|  PREDICTED: threonine aspartase 1 isoform X7      81.6    3e-13    
ref|XP_006114757.1|  PREDICTED: threonine aspartase 1 isoform X1      81.6    3e-13    
ref|XP_006500410.1|  PREDICTED: threonine aspartase 1 isoform X3      80.1    4e-13    
ref|XP_007064220.1|  PREDICTED: threonine aspartase 1                 81.6    4e-13    
ref|XP_007476737.1|  PREDICTED: threonine aspartase 1 isoform X6      81.6    4e-13    
ref|XP_011062414.1|  PREDICTED: threonine aspartase 1                 80.9    4e-13    
ref|XP_008114001.1|  PREDICTED: threonine aspartase 1                 81.3    4e-13    
gb|ELU03771.1|  hypothetical protein CAPTEDRAFT_221081                80.9    4e-13    
emb|CEI93971.1|  hypothetical protein RMCBS344292_08195               79.3    5e-13    
ref|XP_007423979.1|  PREDICTED: threonine aspartase 1                 81.3    5e-13    
ref|XP_001515116.2|  PREDICTED: threonine aspartase 1                 81.6    6e-13    
ref|XP_005995097.1|  PREDICTED: threonine aspartase 1                 80.1    6e-13    
gb|EDL28405.1|  taspase, threonine aspartase 1, isoform CRA_a         80.9    7e-13    
ref|XP_006500408.1|  PREDICTED: threonine aspartase 1 isoform X1      80.5    7e-13    
ref|NP_780434.1|  threonine aspartase 1 isoform a                     80.9    7e-13    
ref|XP_002605074.1|  hypothetical protein BRAFLDRAFT_85220            81.3    7e-13    
ref|XP_008470207.1|  PREDICTED: threonine aspartase 1                 80.9    8e-13    
ref|XP_007546377.1|  PREDICTED: threonine aspartase 1-like            80.1    9e-13    
ref|XP_007872652.1|  hypothetical protein PNEG_00751                  79.3    9e-13    
ref|XP_007397184.1|  hypothetical protein PHACADRAFT_96391            79.7    9e-13    
ref|XP_009831423.1|  hypothetical protein H257_07556                  79.7    1e-12    
ref|XP_007546373.1|  PREDICTED: threonine aspartase 1-like            80.1    1e-12    
ref|XP_005795268.1|  PREDICTED: threonine aspartase 1-like            79.7    1e-12    
gb|KDN46218.1|  hypothetical protein RSAG8_04445                      79.7    1e-12    
ref|XP_009280807.1|  PREDICTED: threonine aspartase 1                 79.3    2e-12    
ref|XP_009632957.1|  PREDICTED: threonine aspartase 1                 79.0    2e-12    
ref|XP_007890495.1|  PREDICTED: threonine aspartase 1                 79.0    3e-12    
ref|XP_001868805.1|  threonine aspartase                              77.8    3e-12    
ref|XP_008428424.1|  PREDICTED: threonine aspartase 1                 78.6    3e-12    
gb|KDD75181.1|  hypothetical protein H632_c823p1                      76.6    5e-12    
ref|XP_008304452.1|  PREDICTED: threonine aspartase 1                 78.2    5e-12    
ref|XP_312407.2|  AGAP002531-PA                                       77.4    5e-12    
emb|CDS33408.1|  threonine aspartase 1                                77.4    5e-12    
ref|XP_009831424.1|  hypothetical protein, variant 1                  76.6    8e-12    
emb|CCJ31074.1|  unnamed protein product                              77.0    8e-12    
gb|KDR75208.1|  hypothetical protein GALMADRAFT_98482                 76.6    9e-12    
gb|ETN58996.1|  threonine aspartase                                   75.9    1e-11    
emb|CEG75602.1|  hypothetical protein RMATCC62417_10615               75.5    2e-11    
ref|XP_010865154.1|  PREDICTED: threonine aspartase 1                 76.6    2e-11    
gb|KFB42806.1|  AGAP002531-PA-like protein                            75.5    2e-11    
emb|CCJ30522.1|  unnamed protein product                              74.3    2e-11    
ref|XP_010728191.1|  PREDICTED: threonine aspartase 1 isoform X1      76.3    2e-11    
gb|EIE77388.1|  hypothetical protein RO3G_02092                       73.2    2e-11    
ref|XP_001653128.1|  threonine aspartase                              75.1    2e-11    
ref|XP_008320155.1|  PREDICTED: threonine aspartase 1 isoform X2      75.9    3e-11    
ref|XP_009831425.1|  hypothetical protein, variant 2                  74.7    3e-11    
ref|XP_004559828.1|  PREDICTED: threonine aspartase 1-like isofor...  75.5    3e-11    
ref|XP_005936384.1|  PREDICTED: threonine aspartase 1-like isofor...  75.1    3e-11    
ref|XP_008320154.1|  PREDICTED: threonine aspartase 1 isoform X1      75.5    4e-11    
ref|XP_005936383.1|  PREDICTED: threonine aspartase 1-like isofor...  75.1    4e-11    
ref|XP_006807003.1|  PREDICTED: threonine aspartase 1-like            75.1    4e-11    
ref|XP_005936382.1|  PREDICTED: threonine aspartase 1-like isofor...  75.1    4e-11    
ref|XP_001830047.2|  asparaginase                                     75.1    4e-11    
ref|XP_003964290.1|  PREDICTED: threonine aspartase 1-like            75.1    5e-11    
gb|EHJ76722.1|  threonine aspartase                                   74.7    5e-11    
ref|XP_005474019.1|  PREDICTED: threonine aspartase 1                 75.1    5e-11    
ref|XP_011124212.1|  hypothetical protein AOL_s00097g77               75.1    5e-11    
ref|XP_005936381.1|  PREDICTED: threonine aspartase 1-like isofor...  75.1    5e-11    
ref|XP_002428277.1|  threonine aspartase, putative                    73.6    8e-11    
ref|XP_004077598.1|  PREDICTED: threonine aspartase 1-like            73.9    1e-10    
ref|XP_009831426.1|  hypothetical protein, variant 3                  72.0    2e-10    
ref|XP_004932657.1|  PREDICTED: threonine aspartase 1-like            72.8    2e-10    
emb|CDM30775.1|  Peptidase T2, asparaginase 2                         73.2    2e-10    
ref|NP_001094423.1|  threonine aspartase 1                            72.8    2e-10    
ref|XP_005848973.1|  hypothetical protein CHLNCDRAFT_144502           73.2    3e-10    
gb|EKV10444.1|  Asparaginase family protein                           72.4    3e-10    
ref|XP_002840395.1|  hypothetical protein                             72.4    3e-10    
gb|ELU42509.1|  asparaginase domain-containing protein                71.6    3e-10    
ref|XP_002957149.1|  hypothetical protein VOLCADRAFT_98191            72.8    3e-10    
gb|KGO77589.1|  Peptidase T2, asparaginase 2                          72.8    3e-10    
ref|XP_005157025.1|  PREDICTED: threonine aspartase 1 isoform X1      72.4    3e-10    
ref|XP_009019825.1|  hypothetical protein HELRODRAFT_188697           72.8    3e-10    
ref|XP_001877420.1|  asparaginase                                     71.6    5e-10    
gb|EPY52416.1|  L-asparaginase                                        70.9    6e-10    
gb|EWC47884.1|  hypothetical protein DRE_02766                        71.2    1e-09    
ref|XP_003699558.1|  PREDICTED: threonine aspartase 1-like            70.5    1e-09    
gb|KGL80756.1|  Threonine aspartase 1                                 70.1    1e-09    
ref|XP_002164491.1|  PREDICTED: threonine aspartase 1-like            70.1    1e-09    
gb|EFZ15552.1|  hypothetical protein SINV_00912                       69.7    1e-09    
gb|KFW89094.1|  Threonine aspartase 1                                 70.1    2e-09    
gb|AFW59944.1|  L-asparaginase family protein                         66.6    2e-09    
ref|XP_004354908.1|  putative asparaginase 2                          69.7    2e-09    
ref|XP_003401959.1|  PREDICTED: threonine aspartase 1-like            69.3    2e-09    
gb|KFW01800.1|  Threonine aspartase 1                                 69.7    2e-09    
gb|KFO65434.1|  Threonine aspartase 1                                 69.7    2e-09    
ref|XP_007687029.1|  hypothetical protein COCMIDRAFT_25554            70.1    2e-09    
ref|XP_009693263.1|  PREDICTED: LOW QUALITY PROTEIN: threonine as...  66.6    3e-09    
gb|KFX52464.1|  Threonine aspartase 1                                 68.2    3e-09    
ref|XP_003386014.1|  PREDICTED: threonine aspartase 1-like            68.9    3e-09    
ref|XP_007844048.1|  threonine aspartase                              68.6    3e-09    
gb|EPS32579.1|  hypothetical protein PDE_07539                        69.3    4e-09    
ref|XP_002567689.1|  Pc21g06440                                       69.3    4e-09    
ref|XP_007702840.1|  hypothetical protein COCSADRAFT_96850            69.3    4e-09    
gb|KFX52466.1|  Threonine aspartase 1                                 68.6    5e-09    
ref|XP_007159145.1|  hypothetical protein PHAVU_002G212600g           68.9    5e-09    
gb|KFX52463.1|  Threonine aspartase 1                                 68.6    5e-09    
gb|KFV72396.1|  Threonine aspartase 1                                 68.6    5e-09    
gb|KGO35917.1|  Peptidase T2, asparaginase 2                          68.9    5e-09    
ref|XP_007339565.1|  N-terminal nucleophile aminohydrolase            67.4    6e-09    
ref|XP_003297321.1|  hypothetical protein PTT_07682                   68.9    6e-09    
ref|XP_006677552.1|  hypothetical protein BATDEDRAFT_87272            68.2    8e-09    
ref|XP_002144940.1|  asparaginase family protein                      68.2    8e-09    
gb|KFX52465.1|  Threonine aspartase 1                                 68.2    1e-08    
gb|KFW81718.1|  Threonine aspartase 1                                 66.2    1e-08    
ref|XP_007712290.1|  hypothetical protein COCCADRAFT_36772            67.8    1e-08    
gb|EUN29779.1|  hypothetical protein COCVIDRAFT_35407                 67.8    1e-08    
gb|EPX72998.1|  L-asparaginase                                        66.6    2e-08    
ref|XP_002117196.1|  hypothetical protein TRIADDRAFT_61236            65.9    2e-08    
ref|XP_009547572.1|  threonine protease                               66.6    2e-08    
ref|XP_004324115.1|  PREDICTED: threonine aspartase 1-like            64.7    2e-08    
gb|ELQ39699.1|  asparaginase family protein                           67.4    2e-08    
ref|XP_008185903.1|  PREDICTED: threonine aspartase 1 isoform X2      65.9    2e-08    
ref|XP_003720001.1|  asparaginase                                     67.0    2e-08    
gb|KFQ33053.1|  Threonine aspartase 1                                 65.1    2e-08    
ref|XP_008086946.1|  N-terminal nucleophile aminohydrolases (Ntn ...  67.0    3e-08    
ref|XP_001601325.2|  PREDICTED: threonine aspartase 1                 66.2    3e-08    
gb|ETE63455.1|  Threonine aspartase 1                                 64.7    3e-08    
ref|XP_007205201.1|  hypothetical protein PRUPE_ppa005809mg           66.2    3e-08    
gb|EHA18976.1|  asparginase                                           66.2    3e-08    
ref|XP_008236115.1|  PREDICTED: guanosine nucleotide diphosphate ...  66.2    3e-08    
ref|XP_001274453.1|  asparaginase family protein                      66.6    3e-08    
ref|XP_002533685.1|  protein with unknown function                    66.2    4e-08    
gb|KHG03270.1|  Rab GDP dissociation inhibitor alpha                  64.7    4e-08    
ref|XP_001947449.1|  PREDICTED: threonine aspartase 1 isoform X1      65.5    4e-08    
gb|EMD91619.1|  hypothetical protein COCHEDRAFT_1136345               66.2    4e-08    
ref|XP_003529259.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.9    4e-08    
gb|KFQ92363.1|  Threonine aspartase 1                                 65.9    4e-08    
gb|KFR10373.1|  Threonine aspartase 1                                 65.9    4e-08    
ref|XP_001805158.1|  hypothetical protein SNOG_14993                  66.2    4e-08    
ref|XP_009790990.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.9    4e-08    
ref|XP_009593951.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.9    4e-08    
ref|XP_008030416.1|  hypothetical protein SETTUDRAFT_97211            66.2    4e-08    
ref|XP_007042842.1|  GDP dissociation inhibitor family protein / ...  65.9    4e-08    
ref|XP_007042843.1|  GDP dissociation inhibitor family protein / ...  65.9    4e-08    
ref|XP_010030006.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.9    5e-08    
gb|KFO72942.1|  Threonine aspartase 1                                 65.5    5e-08    
ref|WP_038615622.1|  asparaginase                                     65.1    5e-08    
gb|KFM28833.1|  Putative threonine aspartase                          65.1    5e-08    
ref|XP_010030005.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.5    5e-08    
gb|KCW56943.1|  hypothetical protein EUGRSUZ_I02620                   65.5    5e-08    
ref|XP_004230543.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.5    5e-08    
ref|XP_006351732.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.5    5e-08    
emb|CAB94202.1|  GDP dissociation inhibitor                           65.5    5e-08    
ref|XP_003608428.1|  Rab-GDP dissociation inhibitor                   65.5    6e-08    
ref|XP_003386439.1|  PREDICTED: threonine aspartase 1-like            65.1    6e-08    
ref|XP_003531017.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    6e-08    
ref|XP_004155432.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    7e-08    
ref|XP_006584964.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    7e-08    
ref|XP_008455143.1|  PREDICTED: guanosine nucleotide diphosphate ...  65.1    7e-08    
ref|XP_008324830.1|  PREDICTED: N(4)-(beta-N-acetylglucosaminyl)-...  63.9    7e-08    
gb|KFP92585.1|  Threonine aspartase 1                                 64.3    7e-08    
ref|XP_006584965.1|  PREDICTED: rab GDP dissociation inhibitor al...  64.7    7e-08    
ref|XP_004504841.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    7e-08    
ref|XP_006584963.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    7e-08    
ref|XP_009220510.1|  asparaginase                                     65.5    8e-08    
ref|NP_593836.3|  threonine aspartase (predicted)                     64.7    8e-08    
ref|WP_012479233.1|  asparaginase                                     64.3    8e-08    
ref|WP_036110932.1|  asparaginase                                     64.3    8e-08    
ref|WP_021204466.1|  asparaginase                                     64.3    8e-08    
ref|XP_004137066.1|  PREDICTED: rab GDP dissociation inhibitor al...  65.1    8e-08    
ref|XP_003758229.1|  PREDICTED: threonine aspartase 1 isoform 2       64.7    8e-08    
gb|KFO12121.1|  Threonine aspartase 1                                 63.9    9e-08    
ref|WP_033833048.1|  asparaginase                                     64.3    9e-08    
ref|WP_005412336.1|  Isoaspartyl aminopeptidase                       64.3    9e-08    
ref|WP_005408201.1|  asparaginase                                     64.3    9e-08    
ref|XP_011023058.1|  PREDICTED: guanosine nucleotide diphosphate ...  64.7    9e-08    
ref|WP_024957319.1|  asparaginase                                     64.3    9e-08    
ref|WP_012510153.1|  asparaginase                                     64.3    9e-08    
gb|KFQ56865.1|  Threonine aspartase 1                                 63.9    9e-08    
ref|XP_005320526.1|  PREDICTED: threonine aspartase 1 isoform X2      64.7    9e-08    
ref|XP_002310487.1|  hypothetical protein POPTR_0007s03250g           64.7    9e-08    
ref|WP_008266554.1|  asparaginase                                     64.3    9e-08    
ref|XP_002197539.2|  PREDICTED: threonine aspartase 1                 64.3    9e-08    



>ref|XP_002272417.2| PREDICTED: putative threonine aspartase [Vitis vinifera]
 emb|CBI40309.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   419 bits (1078),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/359 (63%), Positives = 264/359 (74%), Gaps = 47/359 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQ+ GS+LLGR+PP+FLVGEGAR WAKSKG+ LP TI EADE  
Sbjct  100   VPGVRNAIQIATLLAKEQMLGSSLLGRVPPIFLVGEGARIWAKSKGIDLPATIKEADE--  157

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE+ R  W+KYK MLD A
Sbjct  158   ---------------------------------------WLVTEKARLQWQKYKAMLDDA  178

Query  788   KAVNDVSSTTA--NSVKTCAVSE--AQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
              A   +SS     +  +T  +SE  AQ  D SNG+ +G QSS  +AL+++ I DT+GVIC
Sbjct  179   MAKKKISSVEPFCSPQETAVLSELDAQPSDSSNGN-EGGQSSVLSALEDDYIMDTVGVIC  237

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCC +GAGE LM
Sbjct  238   VDTEGHIASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCATGAGESLM  297

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             RGFAARECCVS S+SQA PASAC+KVLRSV Q SS++GT+KSAGIL+VQA+AP + A  N
Sbjct  298   RGFAARECCVSSSLSQAGPASACTKVLRSVVQNSSQHGTDKSAGILLVQADAP-ITAPQN  356

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*K  1492
             SP L+A+EIAA++SSLSFGIGYFGSSME+PKVSILRST +QS+TG+D F ARI + A K
Sbjct  357   SPKLKAIEIAASYSSLSFGIGYFGSSMERPKVSILRSTKQQSRTGMDHFEARIDVSAGK  415



>ref|XP_009779482.1| PREDICTED: putative threonine aspartase isoform X1 [Nicotiana 
sylvestris]
Length=425

 Score =   410 bits (1054),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 219/359 (61%), Positives = 258/359 (72%), Gaps = 42/359 (12%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN+IQIAALL KEQ+ GS LLGRI PMFLVGEGAR WA S+G+  P T++EA+E  
Sbjct  104   VPGVRNSIQIAALLVKEQMSGSPLLGRISPMFLVGEGARTWAMSRGIVSPSTVSEAEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                              L+L RQWLVTER R  WK+YKGMLD A
Sbjct  162   ---------------------------------LVLWRQWLVTERARTQWKRYKGMLDDA  188

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCD---KSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K VND S+T  A+  ++  VS+    D   + NG R+    S   ALDE+ ISDT+GVIC
Sbjct  189   KDVNDASATKMAHPKESGTVSDTPEVDNQSRGNGGRN--HISMLGALDEDFISDTVGVIC  246

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+ACG+SSGGIALKV GRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSG+GE+LM
Sbjct  247   VDTEGHIACGSSSGGIALKVGGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGSGEHLM  306

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             RGFAARECCVS ++SQA P+SAC KVL SV QE+S+ GTE  AGIL+VQAE+PRM A G 
Sbjct  307   RGFAARECCVSSALSQAGPSSACKKVLHSVVQENSQCGTESCAGILLVQAESPRMIAGGL  366

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*K  1492
             +  + AVEIAA +SS SFGIGYFGSSME+PKVS+LRS  K  +T + EFAAR+ L A K
Sbjct  367   A-RMDAVEIAAVYSSSSFGIGYFGSSMERPKVSVLRSIKKHGETAIGEFAARVSLSAKK  424



>ref|XP_004240111.1| PREDICTED: putative threonine aspartase isoform X2 [Solanum lycopersicum]
Length=420

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 257/354 (73%), Gaps = 44/354 (12%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IA LLAKEQI GS+LLGRI PMFLVGEGARAWAKSKGV LP T+ EADE L
Sbjct  107   VPGVRNAIEIATLLAKEQISGSSLLGRISPMFLVGEGARAWAKSKGVVLPSTLTEADESL  166

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                      VTE+ R  WK+YK MLD A
Sbjct  167   -----------------------------------------VTEKARTQWKRYKAMLDDA  185

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             KAVND  +    N+ +T   SE+Q  D+  G   GDQ S  +ALDE+ ISDT+GVIC+DS
Sbjct  186   KAVNDSPNIKMTNAKETNTTSESQPSDQFRGDGVGDQISLLDALDEDLISDTVGVICLDS  245

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             +GHMACG+SSGGIALK+SGRVGLAAMYGSGCWASS+GPFGAPF+VGCCVSGAGEYLM+GF
Sbjct  246   KGHMACGSSSGGIALKISGRVGLAAMYGSGCWASSRGPFGAPFMVGCCVSGAGEYLMKGF  305

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AARECC+S S+SQA P+SAC KVL+++ +E+S+   ++SAG L+VQAE PR+   G+   
Sbjct  306   AARECCISSSLSQAGPSSACKKVLQTI-KENSQCSVDRSAGFLLVQAEPPRL-VGGSLAR  363

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             L+AVE+AA +SS SFGIGYFGSSM+ PKVS+LRS  +Q+K G+DEFAARI LV+
Sbjct  364   LEAVEVAAVYSSSSFGIGYFGSSMDIPKVSVLRSKKQQNKAGIDEFAARINLVS  417



>ref|XP_010321533.1| PREDICTED: putative threonine aspartase isoform X1 [Solanum lycopersicum]
Length=421

 Score =   407 bits (1045),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 214/356 (60%), Positives = 257/356 (72%), Gaps = 47/356 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IA LLAKEQI GS+LLGRI PMFLVGEGARAWAKSKGV LP T+ EADE L
Sbjct  107   VPGVRNAIEIATLLAKEQISGSSLLGRISPMFLVGEGARAWAKSKGVVLPSTLTEADESL  166

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                      VTE+ R  WK+YK MLD A
Sbjct  167   -----------------------------------------VTEKARTQWKRYKAMLDDA  185

Query  788   KAVND---VSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             KAVND   +  T A    T +V E+Q  D+  G   GDQ S  +ALDE+ ISDT+GVIC+
Sbjct  186   KAVNDSPNIKMTNAKETNTTSV-ESQPSDQFRGDGVGDQISLLDALDEDLISDTVGVICL  244

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             DS+GHMACG+SSGGIALK+SGRVGLAAMYGSGCWASS+GPFGAPF+VGCCVSGAGEYLM+
Sbjct  245   DSKGHMACGSSSGGIALKISGRVGLAAMYGSGCWASSRGPFGAPFMVGCCVSGAGEYLMK  304

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFAARECC+S S+SQA P+SAC KVL+++ +E+S+   ++SAG L+VQAE PR+   G+ 
Sbjct  305   GFAARECCISSSLSQAGPSSACKKVLQTI-KENSQCSVDRSAGFLLVQAEPPRL-VGGSL  362

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
               L+AVE+AA +SS SFGIGYFGSSM+ PKVS+LRS  +Q+K G+DEFAARI LV+
Sbjct  363   ARLEAVEVAAVYSSSSFGIGYFGSSMDIPKVSVLRSKKQQNKAGIDEFAARINLVS  418



>ref|XP_006345600.1| PREDICTED: putative threonine aspartase-like isoform X1 [Solanum 
tuberosum]
Length=422

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 214/356 (60%), Positives = 254/356 (71%), Gaps = 46/356 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALLAKEQ+ GS+LLGRI PMFLVGEGA AWAKSKGV LP TI  ADE L
Sbjct  107   VPGVRNAIEIAALLAKEQLSGSSLLGRISPMFLVGEGACAWAKSKGVVLPSTITAADESL  166

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                      VTE+ R  WK+YK MLD A
Sbjct  167   -----------------------------------------VTEKARTQWKRYKAMLDDA  185

Query  788   KAV---NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             KAV    D+  T A      +  E+Q  D+  G   GDQ S  +ALDE+ ISDT+GVIC+
Sbjct  186   KAVIDAPDIKLTNAKETNAISEVESQSSDQLRGDGVGDQISLLDALDEDLISDTVGVICL  245

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             DS+GHMACG+SSGGIALKVSGRVGLAAMYGSGCWASS+GPFGAPFIVGCCVSGAGEYLM+
Sbjct  246   DSKGHMACGSSSGGIALKVSGRVGLAAMYGSGCWASSRGPFGAPFIVGCCVSGAGEYLMK  305

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFAARECC+S S+SQA P+SAC KVL+++ QE+S+ G ++SAG L+VQAE PR+   G+ 
Sbjct  306   GFAARECCISSSLSQAGPSSACKKVLQTI-QENSQCGVDQSAGFLLVQAEPPRL-VGGSL  363

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
               L+AVEIAA +SS SFGIGYFGSSM+ PKVS+LRS  +Q+K G+DEFAAR+ LV+
Sbjct  364   ARLEAVEIAAVYSSSSFGIGYFGSSMDTPKVSVLRSKKQQNKAGIDEFAARVNLVS  419



>ref|XP_009779483.1| PREDICTED: putative threonine aspartase isoform X2 [Nicotiana 
sylvestris]
Length=419

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 253/359 (70%), Gaps = 48/359 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN+IQIAALL KEQ+ GS LLGRI PMFLVGEGAR WA S+G+  P T++EA+E  
Sbjct  104   VPGVRNSIQIAALLVKEQMSGSPLLGRISPMFLVGEGARTWAMSRGIVSPSTVSEAEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER R  WK+YKGMLD A
Sbjct  162   ---------------------------------------WLVTERARTQWKRYKGMLDDA  182

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCD---KSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K VND S+T  A+  ++  VS+    D   + NG R+    S   ALDE+ ISDT+GVIC
Sbjct  183   KDVNDASATKMAHPKESGTVSDTPEVDNQSRGNGGRN--HISMLGALDEDFISDTVGVIC  240

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+ACG+SSGGIALKV GRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSG+GE+LM
Sbjct  241   VDTEGHIACGSSSGGIALKVGGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGSGEHLM  300

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             RGFAARECCVS ++SQA P+SAC KVL SV QE+S+ GTE  AGIL+VQAE+PRM A G 
Sbjct  301   RGFAARECCVSSALSQAGPSSACKKVLHSVVQENSQCGTESCAGILLVQAESPRMIAGGL  360

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*K  1492
             +  + AVEIAA +SS SFGIGYFGSSME+PKVS+LRS  K  +T + EFAAR+ L A K
Sbjct  361   A-RMDAVEIAAVYSSSSFGIGYFGSSMERPKVSVLRSIKKHGETAIGEFAARVSLSAKK  418



>ref|XP_006445098.1| hypothetical protein CICLE_v10024326mg [Citrus clementina]
 ref|XP_006491051.1| PREDICTED: putative threonine aspartase-like isoform X1 [Citrus 
sinensis]
 gb|ESR58338.1| hypothetical protein CICLE_v10024326mg [Citrus clementina]
Length=419

 Score =   398 bits (1023),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 211/352 (60%), Positives = 251/352 (71%), Gaps = 43/352 (12%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV NAIQIAA LAKEQ+ G +LLGRIPPMFLVGEGAR WAKSKG+ALP TIAEADE  
Sbjct  104   VPGVWNAIQIAAFLAKEQMMGPSLLGRIPPMFLVGEGARVWAKSKGIALPATIAEADE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    W+VTER R  W+KYK +L  A
Sbjct  162   ---------------------------------------WMVTERARAQWRKYKSILADA  182

Query  788   KAVNDVSSTTANSV-KTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             +A  + S+   +SV +  A +  + C+    +  G  S  Q   +++ I DT+GVICVDS
Sbjct  183   EAKTNTSAEGHSSVAEETAFTSGRSCEPLKWNGSGQLSIPQVLEEDSNIMDTVGVICVDS  242

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EGH+A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVG CVSG GEYLM+GF
Sbjct  243   EGHLASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGSCVSGGGEYLMKGF  302

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AARECCVSLS+SQA PASAC  VL  + QESS+ GT+KSAGIL+VQA+AP M  +GN P 
Sbjct  303   AARECCVSLSLSQAGPASACMTVLCPIVQESSQNGTDKSAGILMVQADAPVM-VSGNPPE  361

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             L+++EIAAA+SSLSFG+GYFGSSME+PKVS+LRST +Q++TG+D F ARI L
Sbjct  362   LKSIEIAAAYSSLSFGVGYFGSSMERPKVSVLRSTRQQNQTGIDRFEARIDL  413



>ref|XP_007051873.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
 gb|EOX96030.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Theobroma cacao]
Length=425

 Score =   393 bits (1010),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/355 (59%), Positives = 251/355 (71%), Gaps = 47/355 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV NAIQIAALL KEQ+ GS+LLGR+ PM LVGEGAR WAKSKG+ LPETI +AD   
Sbjct  108   VPGVPNAIQIAALLVKEQMKGSSLLGRLAPMLLVGEGARMWAKSKGIPLPETIGKAD---  164

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVT + +  WK YK ML GA
Sbjct  165   --------------------------------------QWLVTPKAKAQWKHYKAMLVGA  186

Query  788   KAVNDVSS--TTANSVKTCAV--SEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             KA  D+SS   + N+ +T ++  S+AQ CD    +R G QS + N  +E+ I DT+GVIC
Sbjct  187   KAEIDISSEKNSCNAQQTASIQDSQAQTCDTLEENRAG-QSCTLNTTEEDSIMDTVGVIC  245

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+A GASSGGIALKVSGRVGLA+MYGSGCWAS KGPFGAPFIVG C +GAGEYLM
Sbjct  246   VDTEGHIASGASSGGIALKVSGRVGLASMYGSGCWASFKGPFGAPFIVGSCATGAGEYLM  305

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             +GFAARECCVS S+SQA PASAC KV+RSV  ESS+  T++SAGIL+VQA+AP +   GN
Sbjct  306   KGFAARECCVSSSLSQAGPASACVKVIRSVVHESSQNDTDRSAGILLVQADAP-ITVPGN  364

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              P L+A+EI AA+SSLSFGIG+ GSSME+PKVSILR T +Q++TG+D F ARI L
Sbjct  365   PPKLKAIEIGAAYSSLSFGIGFLGSSMERPKVSILRRTKQQNRTGIDHFEARIDL  419



>gb|KDP28659.1| hypothetical protein JCGZ_14430 [Jatropha curcas]
Length=435

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 253/372 (68%), Gaps = 63/372 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             L GVRNAIQIAALLAKEQ+ GS+LLGRIPPMFLV EGAR WAKSKG  LP TI EAD   
Sbjct  104   LRGVRNAIQIAALLAKEQMTGSSLLGRIPPMFLVSEGARIWAKSKGFDLPATIEEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVTER R  WKKYK ML  A
Sbjct  161   --------------------------------------KWLVTERARGQWKKYKAMLLNA  182

Query  788   KAVNDVSS--TTANSVKTCAVSEAQLCD-KSNGSRDGDQSSSQNALDENCISDTIGVICV  958
              A  DVS    + NS +T  + E ++    S+    G QSS   AL+E+ I DT+GVICV
Sbjct  183   TADIDVSDGRFSCNSQETTKIPELEVHSGNSSKGNTGSQSSMSCALEEDNIMDTVGVICV  242

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             DSEGH+A G+SSGGIALKVSGRVGLAAMYGSGCWASS+G FGAPFIVGCCVSGAGEYLM+
Sbjct  243   DSEGHIASGSSSGGIALKVSGRVGLAAMYGSGCWASSRGLFGAPFIVGCCVSGAGEYLMK  302

Query  1139  GFAARECCVSLSIS------------------QAAPASACSKVLRSVNQESSKYGTEKSA  1264
             GFAARECCVSLS+                   QA PASA  KVLRSV  ++S+   +KSA
Sbjct  303   GFAARECCVSLSMYDWLFKTCLGIKNSRPHHFQAGPASASMKVLRSVVMDNSQNINDKSA  362

Query  1265  GILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSK  1444
             GIL+VQA+AP+  A GNSP L+AVEIAAAF+SLSFGIGYFGSSME+PKVS+LRST +QS+
Sbjct  363   GILLVQADAPQ-SAPGNSPKLKAVEIAAAFTSLSFGIGYFGSSMERPKVSVLRSTKQQSQ  421

Query  1445  TGVDEFAARIKL  1480
             TG+D F ARI L
Sbjct  422   TGIDHFEARIDL  433



>emb|CDP08854.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/351 (58%), Positives = 251/351 (72%), Gaps = 44/351 (13%)
 Frame = +2

Query  434   GVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             GVRNAIQIAALLAKEQ  GS+LLGRI PMFLVGEGAR WAKSKG+ LP T+ EA+E    
Sbjct  106   GVRNAIQIAALLAKEQTSGSSLLGRINPMFLVGEGARTWAKSKGIVLP-TVTEAEE----  160

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                  WL+TER +  W++++ ML  A A
Sbjct  161   -------------------------------------WLITERAKLQWEEFRRMLYEANA  183

Query  794   VNDVSST-TANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEG  970
               D S   T  S +T  +SE Q CD  NG     QSS  NAL+E  + DT+GVICVDSEG
Sbjct  184   TEDASRKLTGISKETAVISEPQSCDHLNGEEVDAQSSKHNALEEGSVMDTVGVICVDSEG  243

Query  971   HMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAA  1150
             H+A G+SSGGIALKVSGR+GLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE+LM+GFAA
Sbjct  244   HIASGSSSGGIALKVSGRIGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEHLMKGFAA  303

Query  1151  RECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQ  1330
             RECC+S S+S+A PASAC+KVL  + QE S+  T+ SAGIL+V+A+AP++ A G SP L+
Sbjct  304   RECCISSSLSRAGPASACTKVLHGIIQEKSQRMTDISAGILLVEADAPKL-APGGSPQLK  362

Query  1331  AVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLV  1483
             AVE+ AA++SLSFGIGYFG+++++PKVSILR+  ++++  +D+FAAR+ LV
Sbjct  363   AVEMVAAYTSLSFGIGYFGNNLQRPKVSILRNMRQKNEAKIDQFAARVNLV  413



>ref|XP_002320114.2| asparaginase 2 family protein [Populus trichocarpa]
 gb|EEE98429.2| asparaginase 2 family protein [Populus trichocarpa]
Length=419

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 247/356 (69%), Gaps = 47/356 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI IAALLAKEQ+ GS+LLGRIPPMFLVGEGAR W KSKG+ LPE IAEA+   
Sbjct  104   VPGVRNAIHIAALLAKEQMMGSSLLGRIPPMFLVGEGARVWGKSKGIDLPE-IAEAE---  159

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVT R +  W KYK ML  A
Sbjct  160   --------------------------------------KWLVTARAKEQWTKYKTMLANA  181

Query  788   KA---VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
              A    +D    +A      +  E Q  + S G+ DG QSS  + ++E+CI DT+GVICV
Sbjct  182   NAKIYSDDRLCCSAQETSKISELEFQSHEPSEGN-DGGQSSMPSTMEEDCIMDTVGVICV  240

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D+EGH+A GASSGGIA+K+ GRVGLAAM+G GCWASS+GPFG PFIVGCC SGAGEYLM+
Sbjct  241   DTEGHIASGASSGGIAMKIGGRVGLAAMHGCGCWASSRGPFGVPFIVGCCASGAGEYLMK  300

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFAARECCVS SISQA PASA  KVLRSV  + ++  TEKSAGIL+VQA+AP M A GNS
Sbjct  301   GFAARECCVSASISQAGPASASMKVLRSVILDDNRNTTEKSAGILLVQADAPMM-APGNS  359

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             P L+A+EIAAAFSSLSFGIGY GSSM++PKVS+LRST +Q KTG+D F AR+ L A
Sbjct  360   PSLKAIEIAAAFSSLSFGIGYHGSSMKRPKVSVLRSTKQQRKTGIDHFEARVDLSA  415



>ref|XP_004155816.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 4-like 
[Cucumis sativus]
Length=418

 Score =   385 bits (989),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 250/355 (70%), Gaps = 50/355 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQI GS+LLG IPP+FLVGEGA  WAK+KG+ LPETIAEA+E  
Sbjct  104   VPGVRNAIQIATLLAKEQILGSSLLGLIPPIFLVGEGACTWAKTKGICLPETIAEANE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WK+YK M++ A
Sbjct  162   ---------------------------------------WLVTERAKAQWKRYKSMVERA  182

Query  788   K----AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K      N V S++        +SE Q  +   G+    QSS+++  +E+C  DT+GVIC
Sbjct  183   KKEKGTTNVVHSSSPQD--NARISELQSHNPPEGTTC--QSSTRSNEEEDCTMDTVGVIC  238

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VDSEGH+A GASSGGIA+KVSGRVGLAAMYGSGCWASSKGPFGAPF+VG CVSG GEYLM
Sbjct  239   VDSEGHVASGASSGGIAMKVSGRVGLAAMYGSGCWASSKGPFGAPFMVGGCVSGGGEYLM  298

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             +GFAARECCVSLS+SQA PASAC KVLR+  QESS++  +KSAGIL+VQA+A ++ A GN
Sbjct  299   KGFAARECCVSLSLSQAGPASACMKVLRNFVQESSQHNADKSAGILLVQADASKL-APGN  357

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
                L+AVEIAAA+SSLSFG+GYF SSM++PKVSILRST + +K G+D F ARI L
Sbjct  358   QQKLKAVEIAAAYSSLSFGMGYFASSMDRPKVSILRSTKQNNKLGIDHFEARIDL  412



>ref|XP_004134332.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 4-like 
[Cucumis sativus]
Length=395

 Score =   384 bits (986),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 208/355 (59%), Positives = 250/355 (70%), Gaps = 50/355 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQI GS+LLG IPP+FLVGEGA  WAK+KG+ LPETIAEA+E  
Sbjct  81    VPGVRNAIQIATLLAKEQILGSSLLGLIPPIFLVGEGACTWAKTKGICLPETIAEANE--  138

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WK+YK M++ A
Sbjct  139   ---------------------------------------WLVTERAKAQWKRYKSMVERA  159

Query  788   K----AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K      N V S++        +SE Q  +   G+    QSS+++  +E+C  DT+GVIC
Sbjct  160   KKEKGTTNVVHSSSPQD--NARISELQSHNPPEGTTC--QSSTRSNEEEDCTMDTVGVIC  215

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VDSEGH+A GASSGGIA+KVSGRVGLAAMYGSGCWASSKGPFGAPF+VG CVSG GEYLM
Sbjct  216   VDSEGHVASGASSGGIAMKVSGRVGLAAMYGSGCWASSKGPFGAPFMVGGCVSGGGEYLM  275

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             +GFAARECCVSLS+SQA PASAC KVLR+  QESS++  +KSAGIL+VQA+A ++ A GN
Sbjct  276   KGFAARECCVSLSLSQAGPASACMKVLRNFVQESSQHNADKSAGILLVQADASKL-APGN  334

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
                L+AVEIAAA+SSLSFG+GYF SSM++PKVSILRST + +K G+D F ARI L
Sbjct  335   QQKLKAVEIAAAYSSLSFGMGYFASSMDRPKVSILRSTKQNNKLGIDHFEARIDL  389



>gb|KGN56537.1| hypothetical protein Csa_3G122610 [Cucumis sativus]
Length=471

 Score =   384 bits (987),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 206/353 (58%), Positives = 249/353 (71%), Gaps = 46/353 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQI GS+LLG IPP+FLVGEGA  WAK+KG+ LPETIAEA+E  
Sbjct  157   VPGVRNAIQIATLLAKEQILGSSLLGLIPPIFLVGEGACTWAKTKGICLPETIAEANE--  214

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WK+YK M++ A
Sbjct  215   ---------------------------------------WLVTERAKAQWKRYKSMVERA  235

Query  788   KAVNDVSSTTANS--VKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVD  961
             K     ++   +S       +SE Q  +   G+    QSS+++  +E+C  DT+GVICVD
Sbjct  236   KKEKGTTNVVHSSSPQDNARISELQSHNPPEGTTC--QSSTRSNEEEDCTMDTVGVICVD  293

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             SEGH+A GASSGGIA+KVSGRVGLAAMYGSGCWASSKGPFGAPF+VG CVSG GEYLM+G
Sbjct  294   SEGHVASGASSGGIAMKVSGRVGLAAMYGSGCWASSKGPFGAPFMVGGCVSGGGEYLMKG  353

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSP  1321
             FAARECCVSLS+SQA PASAC KVLR+  QESS++  +KSAGIL+VQA+A ++ A GN  
Sbjct  354   FAARECCVSLSLSQAGPASACMKVLRNFVQESSQHNADKSAGILLVQADASKL-APGNQQ  412

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L+AVEIAAA+SSLSFG+GYF SSM++PKVSILRST + +K G+D F ARI L
Sbjct  413   KLKAVEIAAAYSSLSFGMGYFASSMDRPKVSILRSTKQNNKLGIDHFEARIDL  465



>ref|XP_007218079.1| hypothetical protein PRUPE_ppa006346mg [Prunus persica]
 gb|EMJ19278.1| hypothetical protein PRUPE_ppa006346mg [Prunus persica]
Length=416

 Score =   382 bits (981),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 214/358 (60%), Positives = 246/358 (69%), Gaps = 60/358 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN IQ+AALLAKEQ+ GS+LLGRIPP+FLVGEGAR WAKSKG+AL  +   ADE  
Sbjct  108   IPGVRNPIQVAALLAKEQMMGSSLLGRIPPIFLVGEGARIWAKSKGIALTSSTPAADE--  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WKKYK M+D A
Sbjct  166   ---------------------------------------WLVTERAKAQWKKYKAMVDDA  186

Query  788   KAVNDVSS--TTANSVKTCAVSE--AQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             K   + S+   +    +T  +SE  AQ CD  KSNG+ D            +C+ DT+GV
Sbjct  187   KGKTENSAFGLSCCPQETAGMSELEAQPCDSLKSNGAED------------DCVMDTVGV  234

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             ICVD+EG +A GASSGGIALKV GRVGLAAM+GSGCWASSKG FGAP IVGCCVSGAGEY
Sbjct  235   ICVDAEGQIASGASSGGIALKVGGRVGLAAMHGSGCWASSKGLFGAPCIVGCCVSGAGEY  294

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARECCVSLS+SQA PASAC KVLRSV QES+   T++SAGIL+VQA+ P    +
Sbjct  295   LMKGFAARECCVSLSLSQAGPASACMKVLRSVVQESTHNCTDRSAGILLVQADDPTT-VS  353

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLV  1483
              NS  L+AVEIAAA+SSLSFGIGYFGSSME+PKVSILRST  QSKTGVD F ARI L 
Sbjct  354   SNSSKLKAVEIAAAYSSLSFGIGYFGSSMERPKVSILRSTKLQSKTGVDHFEARIDLT  411



>ref|XP_011035849.1| PREDICTED: putative threonine aspartase [Populus euphratica]
Length=419

 Score =   382 bits (981),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 205/356 (58%), Positives = 245/356 (69%), Gaps = 47/356 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI IAALLAKEQ+ GS+LLGRIPPMFLVGEGAR W KSKG+ LPE I EA+   
Sbjct  104   VPGVRNAIHIAALLAKEQMMGSSLLGRIPPMFLVGEGARVWGKSKGIDLPE-IVEAE---  159

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVT R +  W KYK ML  A
Sbjct  160   --------------------------------------KWLVTARAKAQWTKYKRMLANA  181

Query  788   KA---VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
              A    +D    +A      +  E Q  + S G+ DG QSS  + ++E+C+ DT+GVICV
Sbjct  182   NARIYSDDRLCCSAQETSKISELEFQSYEPSEGN-DGGQSSMPSTMEEDCVMDTVGVICV  240

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D+EGH+A GASSGGIA+K+ GRVGLAAM+G GCWASS+GPFG PFI+GCC SGAGEYLM+
Sbjct  241   DTEGHIASGASSGGIAMKIGGRVGLAAMHGCGCWASSRGPFGVPFIIGCCASGAGEYLMK  300

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFAARECCVS SIS A PASA  KVLRSV  + ++  TEKSAGIL+VQA+AP M A+GN 
Sbjct  301   GFAARECCVSASISHAGPASASMKVLRSVILDDNRNATEKSAGILLVQADAPMM-ASGNL  359

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             P L+A+EIAAAFSSLSFGIGY GSSM++PKVS+LRST +Q KTG+D F AR+ L A
Sbjct  360   PKLKAIEIAAAFSSLSFGIGYHGSSMKRPKVSVLRSTKQQRKTGIDHFEARVDLSA  415



>ref|XP_009347858.1| PREDICTED: putative threonine aspartase isoform X2 [Pyrus x bretschneideri]
Length=399

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 211/357 (59%), Positives = 247/357 (69%), Gaps = 60/357 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN IQ+AALLAKEQ+ GS LLGRIPP+FLVGEGARAWAKSKG+AL  +    DE  
Sbjct  91    IPGVRNPIQVAALLAKEQMMGSPLLGRIPPIFLVGEGARAWAKSKGLALAPSTTADDE--  148

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W+KYK M+D A
Sbjct  149   ---------------------------------------WLVTERAKAQWRKYKAMVDDA  169

Query  788   KAVNDVS----STTANSVKTCAVSEAQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             +A  + S    S +       + SEAQ CD  K NG+            +E+CI DT+GV
Sbjct  170   RAKTENSDSRLSCSPQETAGMSESEAQPCDYLKHNGA------------EEDCIMDTVGV  217

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             IC+D+EG +A GASSGGIALKV GRVGLAAM+G+GCWASSKG FGAP IVGCCVSGAGEY
Sbjct  218   ICMDAEGQIASGASSGGIALKVGGRVGLAAMHGAGCWASSKGVFGAPCIVGCCVSGAGEY  277

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARE CVSLS+SQA PASAC KVLRSV Q+S+   T++SAGIL+VQA+AP M A 
Sbjct  278   LMKGFAARESCVSLSVSQAGPASACMKVLRSVIQDSNNNCTDRSAGILLVQADAPIMVA-  336

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             G+SP L+AVEIAAA++SLSFGIGYFGS+ME+PKVSILRST  QSKTGVD F ARI L
Sbjct  337   GSSPKLKAVEIAAAYTSLSFGIGYFGSAMERPKVSILRSTKLQSKTGVDHFEARIDL  393



>ref|XP_011091903.1| PREDICTED: putative threonine aspartase [Sesamum indicum]
Length=405

 Score =   381 bits (978),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 204/356 (57%), Positives = 246/356 (69%), Gaps = 54/356 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQ+ GS+LLGRI PMFL GEGAR W KSKG+A  ETI EADE  
Sbjct  104   VPGVRNAIQIAVLLAKEQMLGSSLLGRIAPMFLAGEGARLWGKSKGIASDETIVEADE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER RN WK+YK MLD A
Sbjct  162   ---------------------------------------WLVTERARNQWKRYKLMLDDA  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             K++ D +S  A S           CD +     G QSS  + ++E+ I DT+GVICVDS+
Sbjct  183   KSMTDTASAGAQS-----------CDLTKVKEGGTQSSPLDTVEEDSIMDTVGVICVDSQ  231

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+A GASSGGIALKV+GRVGLAA YGSGCWASS+GPFGAPFIVGCCVSGAGEYLM+GFA
Sbjct  232   GHIASGASSGGIALKVNGRVGLAAAYGSGCWASSRGPFGAPFIVGCCVSGAGEYLMKGFA  291

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECCVS ++SQA P SAC+KVLRSV+ E+ + G +KSAG+L+VQAE   M  +G S  L
Sbjct  292   ARECCVSSALSQAGPVSACTKVLRSVH-EADQSGNDKSAGVLLVQAETSAM-GSGASLKL  349

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*KC  1495
             +A EIAAA++S SFG+GYFGSSM++PKVSILRS+  Q+++ V++FA RI L +  C
Sbjct  350   KAAEIAAAYTSASFGVGYFGSSMKQPKVSILRSSRLQTQSKVNQFATRINLASENC  405



>ref|XP_009347857.1| PREDICTED: putative threonine aspartase isoform X1 [Pyrus x bretschneideri]
Length=416

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 211/357 (59%), Positives = 247/357 (69%), Gaps = 60/357 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN IQ+AALLAKEQ+ GS LLGRIPP+FLVGEGARAWAKSKG+AL  +    DE  
Sbjct  108   IPGVRNPIQVAALLAKEQMMGSPLLGRIPPIFLVGEGARAWAKSKGLALAPSTTADDE--  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W+KYK M+D A
Sbjct  166   ---------------------------------------WLVTERAKAQWRKYKAMVDDA  186

Query  788   KAVNDVS----STTANSVKTCAVSEAQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             +A  + S    S +       + SEAQ CD  K NG+            +E+CI DT+GV
Sbjct  187   RAKTENSDSRLSCSPQETAGMSESEAQPCDYLKHNGA------------EEDCIMDTVGV  234

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             IC+D+EG +A GASSGGIALKV GRVGLAAM+G+GCWASSKG FGAP IVGCCVSGAGEY
Sbjct  235   ICMDAEGQIASGASSGGIALKVGGRVGLAAMHGAGCWASSKGVFGAPCIVGCCVSGAGEY  294

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARE CVSLS+SQA PASAC KVLRSV Q+S+   T++SAGIL+VQA+AP M A 
Sbjct  295   LMKGFAARESCVSLSVSQAGPASACMKVLRSVIQDSNNNCTDRSAGILLVQADAPIMVA-  353

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             G+SP L+AVEIAAA++SLSFGIGYFGS+ME+PKVSILRST  QSKTGVD F ARI L
Sbjct  354   GSSPKLKAVEIAAAYTSLSFGIGYFGSAMERPKVSILRSTKLQSKTGVDHFEARIDL  410



>ref|XP_008232784.1| PREDICTED: putative threonine aspartase [Prunus mume]
Length=416

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 247/358 (69%), Gaps = 60/358 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN IQ+AALLAKEQ+ GS+LLGRIPP+FLVGEGAR WAKSKG+AL  + + ADE  
Sbjct  108   IPGVRNPIQVAALLAKEQMMGSSLLGRIPPIFLVGEGARIWAKSKGIALTSSTSAADE--  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WKKYK M+D A
Sbjct  166   ---------------------------------------WLVTERAKAQWKKYKAMVDDA  186

Query  788   KAVNDVSS--TTANSVKTCAVSE--AQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             K   + S+   +    +T  +SE   Q CD  KSNG+ D            +C+ DT+GV
Sbjct  187   KGKTEKSAFGLSCCPQETAGMSELEGQPCDSLKSNGAED------------DCVMDTVGV  234

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             ICVD+EG +A GASSGGIALKV GRVGLAAM+GSGCWASSKG FGAP +VGCCVSGAGEY
Sbjct  235   ICVDAEGQIASGASSGGIALKVGGRVGLAAMHGSGCWASSKGFFGAPCVVGCCVSGAGEY  294

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARECCVSLS+SQA PASAC KVLRSV QES+   T++SAGIL+VQA+ P    +
Sbjct  295   LMKGFAARECCVSLSLSQAGPASACMKVLRSVVQESTHNCTDRSAGILLVQADDPTT-VS  353

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLV  1483
             G+S  L+AVEIAAA+SSLSFGIGYFGSSME+PKVSILRST  QSKTGVD F ARI L 
Sbjct  354   GSSSKLKAVEIAAAYSSLSFGIGYFGSSMERPKVSILRSTKLQSKTGVDHFEARIDLT  411



>ref|XP_008438075.1| PREDICTED: putative threonine aspartase isoform X2 [Cucumis melo]
Length=404

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 207/358 (58%), Positives = 247/358 (69%), Gaps = 53/358 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQI GS+LLG IPP+FLVGEGAR WAK+KG+ LPETIAEA+E  
Sbjct  87    VPGVRNAIQIAALLAKEQILGSSLLGLIPPIFLVGEGARTWAKTKGICLPETIAEANE--  144

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WK+YK M++ A
Sbjct  145   ---------------------------------------WLVTERAKVQWKRYKSMVERA  165

Query  788   KAVNDVSSTTANSVKTCA------VSEAQLCDKSNGSR-DGDQSSSQNALDENCISDTIG  946
             K        T+N   +C       +SE Q  +   G+       S++   +E+C  DT+G
Sbjct  166   KK----EKGTSNVAHSCCPQDNARISEVQSHNPPEGTTCQSSTRSNEEEEEEDCTMDTVG  221

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
             VICVDSEGH+A GASSGGIA+KVSGRVGLAAMYGSGCWASSKGPFGAPF+VG CVSG GE
Sbjct  222   VICVDSEGHVASGASSGGIAMKVSGRVGLAAMYGSGCWASSKGPFGAPFMVGGCVSGGGE  281

Query  1127  YLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
             YLM+GFAARECCVSLS+SQA P SAC KVLR+  QESS++  +KSAGIL+VQA+A +  A
Sbjct  282   YLMKGFAARECCVSLSLSQAGPGSACMKVLRNFVQESSQHNADKSAGILLVQADASK-SA  340

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              GN   L+AVEIAAA+SSLSFG+GYF SSM++PKVSILRST + +K G+D F ARI L
Sbjct  341   PGNPQKLKAVEIAAAYSSLSFGMGYFASSMDRPKVSILRSTKQNNKMGIDHFEARIDL  398



>ref|XP_008438074.1| PREDICTED: putative threonine aspartase isoform X1 [Cucumis melo]
Length=421

 Score =   378 bits (970),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 207/356 (58%), Positives = 246/356 (69%), Gaps = 53/356 (15%)
 Frame = +2

Query  434   GVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             GVRNAIQIAALLAKEQI GS+LLG IPP+FLVGEGAR WAK+KG+ LPETIAEA+E    
Sbjct  106   GVRNAIQIAALLAKEQILGSSLLGLIPPIFLVGEGARTWAKTKGICLPETIAEANE----  161

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                  WLVTER +  WK+YK M++ AK 
Sbjct  162   -------------------------------------WLVTERAKVQWKRYKSMVERAKK  184

Query  794   VNDVSSTTANSVKTCA------VSEAQLCDKSNGSR-DGDQSSSQNALDENCISDTIGVI  952
                    T+N   +C       +SE Q  +   G+       S++   +E+C  DT+GVI
Sbjct  185   ----EKGTSNVAHSCCPQDNARISEVQSHNPPEGTTCQSSTRSNEEEEEEDCTMDTVGVI  240

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVDSEGH+A GASSGGIA+KVSGRVGLAAMYGSGCWASSKGPFGAPF+VG CVSG GEYL
Sbjct  241   CVDSEGHVASGASSGGIAMKVSGRVGLAAMYGSGCWASSKGPFGAPFMVGGCVSGGGEYL  300

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             M+GFAARECCVSLS+SQA P SAC KVLR+  QESS++  +KSAGIL+VQA+A +  A G
Sbjct  301   MKGFAARECCVSLSLSQAGPGSACMKVLRNFVQESSQHNADKSAGILLVQADASK-SAPG  359

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             N   L+AVEIAAA+SSLSFG+GYF SSM++PKVSILRST + +K G+D F ARI L
Sbjct  360   NPQKLKAVEIAAAYSSLSFGMGYFASSMDRPKVSILRSTKQNNKMGIDHFEARIDL  415



>ref|XP_002511826.1| threonine aspartase, putative [Ricinus communis]
 gb|EEF50495.1| threonine aspartase, putative [Ricinus communis]
Length=419

 Score =   377 bits (968),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 211/355 (59%), Positives = 249/355 (70%), Gaps = 49/355 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+ GS+LLGRI PMFLVGEGAR WAKSKG+ LPETI EA+   
Sbjct  104   VPGVRNAIQIAALLAKEQMMGSSLLGRISPMFLVGEGARVWAKSKGIDLPETIEEAN---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVTER +  WK++K ML  A
Sbjct  161   --------------------------------------KWLVTERAKAQWKRFKEMLMNA  182

Query  788   KAVNDVSST--TANSVKTCAVSE--AQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
                ND+ +   + NS +T  V E  AQL + S G+  G  + S    +ENCI DT+GVIC
Sbjct  183   TTENDIPNERLSCNSQETSKVLELEAQLGNPSEGNGGGQCTPS--TFEENCIRDTVGVIC  240

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VDSEG +A G+SSGGIALKVSGRVGLAAMYGSGCWASSKG FGAP IVGCCVSGAGE L+
Sbjct  241   VDSEGQIASGSSSGGIALKVSGRVGLAAMYGSGCWASSKGLFGAPLIVGCCVSGAGESLI  300

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             +GF+ARECCVS SISQA PASA  KVL SV  + S+   +KSAGILVVQA+AP + A GN
Sbjct  301   KGFSARECCVSSSISQAGPASASMKVLSSV-LDGSQNINDKSAGILVVQADAP-VKAPGN  358

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +P L+A+EIAA ++SLSFGIGYFGSSM++PKVS+LRST +QSKT +D F ARI L
Sbjct  359   APKLKAIEIAATYTSLSFGIGYFGSSMKRPKVSVLRSTKQQSKTRIDHFEARIDL  413



>gb|KHG24615.1| hypothetical protein F383_06242 [Gossypium arboreum]
Length=686

 Score =   384 bits (986),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 245/351 (70%), Gaps = 49/351 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV NAIQIAALL KEQ  GS+LLGRIPPMFLVGEGAR WAKS G+ALP ++ +AD   
Sbjct  383   VPGVPNAIQIAALLVKEQTKGSSLLGRIPPMFLVGEGARLWAKSNGIALPASMVKAD---  439

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVT + +  WK YK ML  A
Sbjct  440   --------------------------------------QWLVTPKAKAQWKHYKAMLLDA  461

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             KA  D+SS       +C  S AQ CD       G QS   +   E+ I DT+GVICVD+E
Sbjct  462   KAEIDISSEG----NSC--SHAQTCDTLE-DNSGGQSCMLSPSAEDNIMDTVGVICVDTE  514

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A GASSGGIALKVSGRVGLAAMYG+GCWASSKGPFGAPFIVGCCVSGAGE+LM+GFA
Sbjct  515   GNIASGASSGGIALKVSGRVGLAAMYGAGCWASSKGPFGAPFIVGCCVSGAGEHLMKGFA  574

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECCVS S+SQA PASAC KVLRSV Q+S++  T+KSAGI++VQA+AP +   GN P L
Sbjct  575   ARECCVSSSLSQAGPASACMKVLRSVAQDSNQADTDKSAGIVIVQADAP-IRVPGNPPKL  633

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +A+EIAAA+SSLSFGIGYFGS ME+PKVSILR + +Q+++G+D F AR+ +
Sbjct  634   KAIEIAAAYSSLSFGIGYFGSGMERPKVSILRRSKQQNRSGIDHFEARVDV  684



>ref|XP_008376027.1| PREDICTED: putative threonine aspartase isoform X1 [Malus domestica]
Length=399

 Score =   374 bits (960),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 210/357 (59%), Positives = 244/357 (68%), Gaps = 60/357 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN  Q+AALLAKEQ+ GS LLGRIPP FLVGEGAR WAKSKG+ L  +    DE  
Sbjct  91    IPGVRNPXQVAALLAKEQMMGSPLLGRIPPTFLVGEGARXWAKSKGLVLAASTXADDE--  148

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W+KYK M+D A
Sbjct  149   ---------------------------------------WLVTERAKXQWRKYKAMVDDA  169

Query  788   KA--VNDVSSTTANSVKTCAVSE--AQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             KA   N  S  + +  +T  +SE  AQ CD  K NG+            +E+CI DT+GV
Sbjct  170   KAKTENSDSRLSCSPQETAGMSEXEAQPCDYLKHNGA------------EEDCIMDTVGV  217

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             ICVD+EG +A GASSGGIALKV GRVGLAAM+G+GCWASSKG FGAP IVGCCVSGAGEY
Sbjct  218   ICVDAEGQIASGASSGGIALKVGGRVGLAAMHGAGCWASSKGVFGAPCIVGCCVSGAGEY  277

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARE CVSLS+SQA PASAC KVLRSV QES+   T++SAGIL+VQA+AP + A 
Sbjct  278   LMKGFAARESCVSLSVSQAGPASACMKVLRSVVQESNNNCTDRSAGILLVQADAPILVA-  336

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             G+SP L+AVEIAAA++SLSFGIGYFGS+M +PKVSILRST  QSKTGVD F ARI L
Sbjct  337   GSSPKLKAVEIAAAYTSLSFGIGYFGSAMXRPKVSILRSTKLQSKTGVDHFEARIDL  393



>ref|XP_008376028.1| PREDICTED: putative threonine aspartase isoform X2 [Malus domestica]
Length=416

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 210/357 (59%), Positives = 244/357 (68%), Gaps = 60/357 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN  Q+AALLAKEQ+ GS LLGRIPP FLVGEGAR WAKSKG+ L  +    DE  
Sbjct  108   IPGVRNPXQVAALLAKEQMMGSPLLGRIPPTFLVGEGARXWAKSKGLVLAASTXADDE--  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W+KYK M+D A
Sbjct  166   ---------------------------------------WLVTERAKXQWRKYKAMVDDA  186

Query  788   KA--VNDVSSTTANSVKTCAVSE--AQLCD--KSNGSRDGDQSSSQNALDENCISDTIGV  949
             KA   N  S  + +  +T  +SE  AQ CD  K NG+            +E+CI DT+GV
Sbjct  187   KAKTENSDSRLSCSPQETAGMSEXEAQPCDYLKHNGA------------EEDCIMDTVGV  234

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             ICVD+EG +A GASSGGIALKV GRVGLAAM+G+GCWASSKG FGAP IVGCCVSGAGEY
Sbjct  235   ICVDAEGQIASGASSGGIALKVGGRVGLAAMHGAGCWASSKGVFGAPCIVGCCVSGAGEY  294

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             LM+GFAARE CVSLS+SQA PASAC KVLRSV QES+   T++SAGIL+VQA+AP + A 
Sbjct  295   LMKGFAARESCVSLSVSQAGPASACMKVLRSVVQESNNNCTDRSAGILLVQADAPILVA-  353

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             G+SP L+AVEIAAA++SLSFGIGYFGS+M +PKVSILRST  QSKTGVD F ARI L
Sbjct  354   GSSPKLKAVEIAAAYTSLSFGIGYFGSAMXRPKVSILRSTKLQSKTGVDHFEARIDL  410



>gb|KHG24614.1| hypothetical protein F383_06242 [Gossypium arboreum]
Length=713

 Score =   383 bits (984),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 205/351 (58%), Positives = 245/351 (70%), Gaps = 49/351 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV NAIQIAALL KEQ  GS+LLGRIPPMFLVGEGAR WAKS G+ALP ++ +AD   
Sbjct  410   VPGVPNAIQIAALLVKEQTKGSSLLGRIPPMFLVGEGARLWAKSNGIALPASMVKAD---  466

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVT + +  WK YK ML  A
Sbjct  467   --------------------------------------QWLVTPKAKAQWKHYKAMLLDA  488

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             KA  D+SS       +C  S AQ CD       G QS   +   E+ I DT+GVICVD+E
Sbjct  489   KAEIDISSEG----NSC--SHAQTCDTLE-DNSGGQSCMLSPSAEDNIMDTVGVICVDTE  541

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A GASSGGIALKVSGRVGLAAMYG+GCWASSKGPFGAPFIVGCCVSGAGE+LM+GFA
Sbjct  542   GNIASGASSGGIALKVSGRVGLAAMYGAGCWASSKGPFGAPFIVGCCVSGAGEHLMKGFA  601

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECCVS S+SQA PASAC KVLRSV Q+S++  T+KSAGI++VQA+AP +   GN P L
Sbjct  602   ARECCVSSSLSQAGPASACMKVLRSVAQDSNQADTDKSAGIVIVQADAP-IRVPGNPPKL  660

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +A+EIAAA+SSLSFGIGYFGS ME+PKVSILR + +Q+++G+D F AR+ +
Sbjct  661   KAIEIAAAYSSLSFGIGYFGSGMERPKVSILRRSKQQNRSGIDHFEARVDV  711



>ref|XP_010321534.1| PREDICTED: putative threonine aspartase isoform X3 [Solanum lycopersicum]
Length=398

 Score =   372 bits (955),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 198/332 (60%), Positives = 237/332 (71%), Gaps = 47/332 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IA LLAKEQI GS+LLGRI PMFLVGEGARAWAKSKGV LP T+ EADE L
Sbjct  107   VPGVRNAIEIATLLAKEQISGSSLLGRISPMFLVGEGARAWAKSKGVVLPSTLTEADESL  166

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                      VTE+ R  WK+YK MLD A
Sbjct  167   -----------------------------------------VTEKARTQWKRYKAMLDDA  185

Query  788   KAVND---VSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             KAVND   +  T A    T +V E+Q  D+  G   GDQ S  +ALDE+ ISDT+GVIC+
Sbjct  186   KAVNDSPNIKMTNAKETNTTSV-ESQPSDQFRGDGVGDQISLLDALDEDLISDTVGVICL  244

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             DS+GHMACG+SSGGIALK+SGRVGLAAMYGSGCWASS+GPFGAPF+VGCCVSGAGEYLM+
Sbjct  245   DSKGHMACGSSSGGIALKISGRVGLAAMYGSGCWASSRGPFGAPFMVGCCVSGAGEYLMK  304

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFAARECC+S S+SQA P+SAC KVL+++ +E+S+   ++SAG L+VQAE PR+   G+ 
Sbjct  305   GFAARECCISSSLSQAGPSSACKKVLQTI-KENSQCSVDRSAGFLLVQAEPPRL-VGGSL  362

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVS  1414
               L+AVE+AA +SS SFGIGYFGSSM+ PK+S
Sbjct  363   ARLEAVEVAAVYSSSSFGIGYFGSSMDIPKIS  394



>gb|KHN30851.1| Putative isoaspartyl peptidase/L-asparaginase 4 [Glycine soja]
Length=362

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 242/356 (68%), Gaps = 71/356 (20%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             ++GVRNAIQIAALLAKEQ+ GS LLGRIPP+FLVGEGA  WAKSK +ALP +I EA+E  
Sbjct  70    VAGVRNAIQIAALLAKEQMMGSPLLGRIPPIFLVGEGACKWAKSKDIALPPSIEEANE--  127

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK M++ A
Sbjct  128   ---------------------------------------WLVTERAKAQWIKYKSMVESA  148

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENC-----ISDTIGVI  952
             ++                        K+  + +GD S  QNA   +C     + DT+GVI
Sbjct  149   RS------------------------KTENTPEGDSSVYQNATVPDCALEDRVMDTVGVI  184

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             C+D+EGH+A GASSGGIALKVSGR+GLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE+L
Sbjct  185   CIDNEGHVASGASSGGIALKVSGRIGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGEHL  244

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             M+GFAARECCVSLS+SQ+  ASAC+K+LRSV ++  + GT+ SAGILVVQ++A   D  G
Sbjct  245   MKGFAARECCVSLSLSQSGAASACTKILRSVVEDGRQCGTDSSAGILVVQSDASLTD-QG  303

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              S  L+AVEIAAA++SLSFG+GYFGSSME+PKVSILRST +QSKT +D+F ARI L
Sbjct  304   KSSRLKAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQQSKTAIDQFGARIDL  359



>ref|XP_003521015.1| PREDICTED: putative threonine aspartase-like isoform X1 [Glycine 
max]
Length=390

 Score =   371 bits (953),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 242/356 (68%), Gaps = 71/356 (20%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             ++GVRNAIQIAALLAKEQ+ GS LLGRIPP+FLVGEGA  WAKSK +ALP +I EA+E  
Sbjct  98    VAGVRNAIQIAALLAKEQMMGSPLLGRIPPIFLVGEGACKWAKSKDIALPPSIEEANE--  155

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK M++ A
Sbjct  156   ---------------------------------------WLVTERAKAQWIKYKSMVESA  176

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENC-----ISDTIGVI  952
             ++                        K+  + +GD S  QNA   +C     + DT+GVI
Sbjct  177   RS------------------------KTENTPEGDSSVYQNATVPDCALEDRVMDTVGVI  212

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             C+D+EGH+A GASSGGIALKVSGR+GLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE+L
Sbjct  213   CIDNEGHVASGASSGGIALKVSGRIGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGEHL  272

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             M+GFAARECCVSLS+SQ+  ASAC+K+LRSV ++  + GT+ SAGILVVQ++A   D  G
Sbjct  273   MKGFAARECCVSLSLSQSGAASACTKILRSVVEDGRQCGTDSSAGILVVQSDASLTD-QG  331

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              S  L+AVEIAAA++SLSFG+GYFGSSME+PKVSILRST +QSKT +D+F ARI L
Sbjct  332   KSSRLKAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQQSKTAIDQFGARIDL  387



>ref|NP_191968.3| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 sp|O65268.3|TASP1_ARATH RecName: Full=Putative threonine aspartase; Short=Taspase-1; 
Contains: RecName: Full=Putative threonine aspartase subunit 
alpha; Contains: RecName: Full=Putative threonine aspartase 
subunit beta; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE81906.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
Length=408

 Score =   371 bits (952),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 206/358 (58%), Positives = 244/358 (68%), Gaps = 66/358 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQI GSTLLGRIPPM LVGEGAR W KSK V +P T+ EAD   
Sbjct  105   VPGVRNAIKIAALLVKEQITGSTLLGRIPPMLLVGEGARRWGKSKSVLIPGTVTEAD---  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLD--  781
                                                   QWLVTER RN W+++K ML   
Sbjct  162   --------------------------------------QWLVTERARNQWRRFKAMLSEV  183

Query  782   GAKAV---NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVI  952
             GAK++    +    T N+ +TC                 +  SS  A DE+ I DT+GVI
Sbjct  184   GAKSILSAEEHPRGTENN-ETCE----------------ENVSSCAAADEDKIMDTVGVI  226

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVD+EGH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFGAPF+VGCCVSGAGEYL
Sbjct  227   CVDNEGHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGAPFLVGCCVSGAGEYL  286

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSV-NQESSKYGT-EKSAGILVVQAEAPRMDA  1306
             MRGFAARECC SL++SQA PASA  KVLRSV +QESSK GT +K+AGILVVQA+A  +  
Sbjct  287   MRGFAARECCTSLALSQAGPASAAMKVLRSVMHQESSKIGTADKTAGILVVQADASVV-V  345

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              G+ P L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + S+ GVD F ARI L
Sbjct  346   PGSKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQMSEAGVDHFEARIDL  403



>ref|XP_004306811.1| PREDICTED: putative threonine aspartase-like [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   372 bits (955),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 242/357 (68%), Gaps = 57/357 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             L GV+N I++AALLAKEQ+ GS+LLGRIPP+FLVGEGAR WAKSKG+AL  + + ADE  
Sbjct  141   LPGVKNPIKVAALLAKEQMMGSSLLGRIPPIFLVGEGARIWAKSKGIALSVSTSAADE--  198

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WKKYK M+D A
Sbjct  199   ---------------------------------------WLVTERAKAHWKKYKAMVDDA  219

Query  788   KAVNDVSST----TANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
                 + SS     +A         EAQ CD  N          +   +E+CI DT+GVIC
Sbjct  220   NKKTETSSVGLSFSAQDGSRIPELEAQPCDSLN----------KYGAEEDCIMDTVGVIC  269

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD++G +A GASSGGIALKV GRVGLAAM+GSGCWASSKG FGAP IVGCC SGAGEYLM
Sbjct  270   VDADGQIASGASSGGIALKVGGRVGLAAMHGSGCWASSKGLFGAPCIVGCCASGAGEYLM  329

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             +GFAARECCVSLS+SQA PASAC KVL SV QES++  T++SAG LVVQA+AP +  +G+
Sbjct  330   KGFAARECCVSLSLSQAGPASACMKVLHSVVQESNQNCTDRSAGFLVVQADAPMV--SGS  387

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             SP L+A+EIAAA+S+LSFGIGYFGSSM++PK SILR T  QS+TGVD F ARI L A
Sbjct  388   SPKLKAIEIAAAYSTLSFGIGYFGSSMKRPKASILRRTKLQSETGVDHFEARIDLSA  444



>ref|XP_002875021.1| hypothetical protein ARALYDRAFT_490508 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51280.1| hypothetical protein ARALYDRAFT_490508 [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   369 bits (948),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 202/353 (57%), Positives = 237/353 (67%), Gaps = 56/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI++AALL KEQI GSTLLGRIPPM LVGEGAR W KSKGV LPET+ EAD   
Sbjct  104   VPGVRNAIKVAALLVKEQISGSTLLGRIPPMLLVGEGARRWGKSKGVLLPETVTEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWL T+R RN W+K+K ML   
Sbjct  161   --------------------------------------QWLTTQRARNQWRKFKTMLSEV  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A + +S+            E       N     ++ S   A+DE+ I DT+GVICVDS+
Sbjct  183   EAKSTLSA------------EEHPRGTENNDTCEEKPSPCVAVDEDKIMDTVGVICVDSQ  230

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH  CG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFGAPF VGCCVSGAGEYLMRGFA
Sbjct  231   GHTVCGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGAPFRVGCCVSGAGEYLMRGFA  290

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYGT-EKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA  KVLRSV +QESSK GT +K+AGILVVQA+A  +   G  P
Sbjct  291   ARECCTSLSLSQAGPASAAMKVLRSVMHQESSKSGTADKTAGILVVQADA-SVAVPGVKP  349

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAA +SSLSFG+GY+G+S+EKPK+SILR+  + S+ GVD F ARI L
Sbjct  350   ELNAVEIAAGYSSLSFGVGYYGNSIEKPKISILRTRRQMSEAGVDHFEARIDL  402



>ref|XP_010456261.1| PREDICTED: putative threonine aspartase isoform X1 [Camelina 
sativa]
Length=404

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 239/353 (68%), Gaps = 59/353 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G RNAI+IAALL KEQ  GSTLLGRIPPM LVGEGAR WA+SKGV LPET+ EAD   
Sbjct  104   VPGARNAIKIAALLLKEQTSGSTLLGRIPPMLLVGEGARRWAESKGVLLPETVTEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+++K ML   
Sbjct  161   --------------------------------------QWLVTERARNQWRRFKTMLSEL  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A      +T  + +     EA  C+        D+ S+  A DE+ I DT+GVICVDS+
Sbjct  183   EA-----KSTLPAERETMKDEA--CE--------DKPSACAAGDEDKIMDTVGVICVDSQ  227

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFG PF+VGCCVSGAGEYLMRGFA
Sbjct  228   GHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGVPFLVGCCVSGAGEYLMRGFA  287

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             AR+CC SLS+SQA PASA  KVLRSV  QE SK G  +K+AGILVVQ +A  +   GN P
Sbjct  288   ARDCCTSLSLSQAGPASAAMKVLRSVMQQEGSKSGIADKTAGILVVQVDAS-VAVPGNKP  346

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + SK GVD F ARI L
Sbjct  347   ELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRKQTSKAGVDHFEARIDL  399



>ref|XP_010419609.1| PREDICTED: putative threonine aspartase isoform X1 [Camelina 
sativa]
Length=404

 Score =   366 bits (939),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 204/353 (58%), Positives = 237/353 (67%), Gaps = 59/353 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G RNAI+IAALL KEQ  GSTLLGRIPPM LVGEGAR WA+SKGV LPET+ EAD   
Sbjct  104   VPGARNAIKIAALLLKEQTSGSTLLGRIPPMLLVGEGARRWAESKGVLLPETVTEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+++K ML   
Sbjct  161   --------------------------------------QWLVTERARNQWRRFKTMLSEL  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A      +T  + +     EA  C+        D+ S   A DE+ I DT+GVICVDS+
Sbjct  183   EA-----KSTLPAERETMKDEA--CE--------DKPSPCAAGDEDKIMDTVGVICVDSQ  227

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFG PF+VGCCVSGAGEYLMR FA
Sbjct  228   GHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGVPFLVGCCVSGAGEYLMREFA  287

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLSISQA PASA  KVLRSV  QE SK G  +K+AGILVVQ +A  +   GN P
Sbjct  288   ARECCTSLSISQAGPASAAMKVLRSVMQQEGSKGGIADKTAGILVVQVDA-SVAVPGNKP  346

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + SK GVD F ARI L
Sbjct  347   ELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQTSKAGVDHFEARIDL  399



>ref|XP_010263748.1| PREDICTED: putative threonine aspartase isoform X3 [Nelumbo nucifera]
Length=332

 Score =   362 bits (929),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 240/358 (67%), Gaps = 51/358 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA  LAKEQ+ G +LLGR+PPMFLVGEGAR WAKSKG+ LPETIAEAD   
Sbjct  14    VPGVRNAIQIATCLAKEQMMGPSLLGRLPPMFLVGEGAREWAKSKGIILPETIAEAD---  70

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE+ +  W KYK MLD A
Sbjct  71    --------------------------------------VWLVTEKAKAQWLKYKAMLDCA  92

Query  788   KA-------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIG  946
             +A           SS   +  K      AQ  D   G+    + S  N   E+CI DT+G
Sbjct  93    EAGSKSSSVELSSSSHETDVSKPITKKGAQPFDPVRGTDS--EPSLFNTSKEDCIMDTVG  150

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
             VICVD+EGH+A GASSGGI LKVSGRVGLAA YGSGCWASSKGPFGAPF+VGCCVSGAGE
Sbjct  151   VICVDNEGHIASGASSGGILLKVSGRVGLAATYGSGCWASSKGPFGAPFVVGCCVSGAGE  210

Query  1127  YLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
             YLM+GFAARECC+S S+SQ+ PASAC KV+ SV Q+ +    +KS GIL+VQA+AP+M  
Sbjct  211   YLMKGFAARECCISSSLSQSGPASACKKVIHSVVQDDNPKCPDKSVGILLVQADAPKM-V  269

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              GNS  L+A+EIAAA+SSLSFGIGYFGSSM++PKVSILR+T +Q+ T +D F ARI L
Sbjct  270   PGNSSKLKAIEIAAAYSSLSFGIGYFGSSMDRPKVSILRTTKRQTTTRIDHFEARIDL  327



>gb|ACI95768.1| putative L-asparaginase 1 [Vigna radiata]
Length=390

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 242/351 (69%), Gaps = 61/351 (17%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+  S LLGRIPP+FLVGEGAR WAKS+ +ALP +I EA+E  
Sbjct  98    VPGVRNAIQIAALLAKEQLMRSPLLGRIPPIFLVGEGARKWAKSRDIALPTSIEEANE--  155

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W K+K M++ A
Sbjct  156   ---------------------------------------WLVTERAKAQWIKFKSMVETA  176

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             K+  D      +SV          C +S    DG       AL+++ + DT+GVIC+D+E
Sbjct  177   KSKEDNPPEVDSSV----------C-QSTTMPDG-------ALEDH-VMDTVGVICIDNE  217

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+A GASSGGIALKVSGRVGLAAMYG+GCWASSKGPFG+PF+ GCCVSGAGEYLM+GFA
Sbjct  218   GHVATGASSGGIALKVSGRVGLAAMYGAGCWASSKGPFGSPFMAGCCVSGAGEYLMKGFA  277

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECCVSLS+SQ+ PASAC+KVLRSV ++  +  T+ SAGILVVQ++A   D  G S  L
Sbjct  278   ARECCVSLSLSQSGPASACTKVLRSVVEDGRQCVTDSSAGILVVQSDASLTD-QGKSSRL  336

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +AVEIAAA++SLSFG+GYFGSSME+PKVSILRST +QS+  +D+F ARI L
Sbjct  337   KAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQQSRIAIDQFGARIDL  387



>ref|XP_010419610.1| PREDICTED: putative threonine aspartase isoform X2 [Camelina 
sativa]
Length=398

 Score =   363 bits (931),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/353 (58%), Positives = 234/353 (66%), Gaps = 65/353 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G RNAI+IAALL KEQ  GSTLLGRIPPM LVGEGAR WA+SKGV LPET+ EAD   
Sbjct  104   VPGARNAIKIAALLLKEQTSGSTLLGRIPPMLLVGEGARRWAESKGVLLPETVTEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+++K ML   
Sbjct  161   --------------------------------------QWLVTERARNQWRRFKTMLSEL  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A      +T  + +     EA  C+        D+ S   A DE+ I DT+GVICVDS+
Sbjct  183   EA-----KSTLPAERETMKDEA--CE--------DKPSPCAAGDEDKIMDTVGVICVDSQ  227

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFG PF+VGCCVSGAGEYLMR FA
Sbjct  228   GHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGVPFLVGCCVSGAGEYLMREFA  287

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLSISQA PASA  KVLRSV  QE SK G  +K+AGILVVQ         GN P
Sbjct  288   ARECCTSLSISQAGPASAAMKVLRSVMQQEGSKGGIADKTAGILVVQ-------VPGNKP  340

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + SK GVD F ARI L
Sbjct  341   ELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQTSKAGVDHFEARIDL  393



>ref|XP_006396259.1| hypothetical protein EUTSA_v10028700mg [Eutrema salsugineum]
 gb|ESQ37712.1| hypothetical protein EUTSA_v10028700mg [Eutrema salsugineum]
Length=408

 Score =   363 bits (931),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 243/353 (69%), Gaps = 55/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GS LLGRIPPM LVGEGAR WAKSK V LPE++ EAD   
Sbjct  104   VPGVRNAIKIAALLLKEQMSGSALLGRIPPMMLVGEGARRWAKSKDVLLPESVPEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+K+K ML   
Sbjct  161   --------------------------------------QWLVTERARNQWRKFKTMLSEV  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A N++SS+     +   + + + C+       G Q     A+DE+ I DT+GVICVDSE
Sbjct  183   EAENNLSSSEEQPRE---IDKDETCE-------GKQLPCA-AVDEDKIMDTVGVICVDSE  231

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFG PF+VGCCVSGAGEYLMRGFA
Sbjct  232   GHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGTPFLVGCCVSGAGEYLMRGFA  291

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA  KVLRSV  QE S+ G T+K+AGILVVQA+A  +   G+ P
Sbjct  292   ARECCTSLSLSQAGPASAAMKVLRSVMQQEGSECGITDKTAGILVVQADA-SVAVPGSKP  350

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L A+E+AAA+SSLSFGIGY+G+S++KPK+SILR   ++++ G+D F A I L
Sbjct  351   ELNAIEMAAAYSSLSFGIGYYGNSIKKPKISILRKKGEKNEAGIDYFEAGIDL  403



>ref|XP_010263733.1| PREDICTED: putative threonine aspartase isoform X1 [Nelumbo nucifera]
Length=421

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 204/358 (57%), Positives = 240/358 (67%), Gaps = 51/358 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA  LAKEQ+ G +LLGR+PPMFLVGEGAR WAKSKG+ LPETIAEAD   
Sbjct  103   VPGVRNAIQIATCLAKEQMMGPSLLGRLPPMFLVGEGAREWAKSKGIILPETIAEAD---  159

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE+ +  W KYK MLD A
Sbjct  160   --------------------------------------VWLVTEKAKAQWLKYKAMLDCA  181

Query  788   KA-------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIG  946
             +A           SS   +  K      AQ  D   G+    + S  N   E+CI DT+G
Sbjct  182   EAGSKSSSVELSSSSHETDVSKPITKKGAQPFDPVRGTDS--EPSLFNTSKEDCIMDTVG  239

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
             VICVD+EGH+A GASSGGI LKVSGRVGLAA YGSGCWASSKGPFGAPF+VGCCVSGAGE
Sbjct  240   VICVDNEGHIASGASSGGILLKVSGRVGLAATYGSGCWASSKGPFGAPFVVGCCVSGAGE  299

Query  1127  YLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
             YLM+GFAARECC+S S+SQ+ PASAC KV+ SV Q+ +    +KS GIL+VQA+AP+M  
Sbjct  300   YLMKGFAARECCISSSLSQSGPASACKKVIHSVVQDDNPKCPDKSVGILLVQADAPKM-V  358

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              GNS  L+A+EIAAA+SSLSFGIGYFGSSM++PKVSILR+T +Q+ T +D F ARI L
Sbjct  359   PGNSSKLKAIEIAAAYSSLSFGIGYFGSSMDRPKVSILRTTKRQTTTRIDHFEARIDL  416



>ref|XP_007133209.1| hypothetical protein PHAVU_011G160800g [Phaseolus vulgaris]
 gb|ESW05203.1| hypothetical protein PHAVU_011G160800g [Phaseolus vulgaris]
Length=390

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 240/352 (68%), Gaps = 63/352 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+  S LLGRIPP+FLVGEGAR WAKSK + LP +I EA+E  
Sbjct  98    VPGVRNAIQIAALLAKEQMMRSPLLGRIPPIFLVGEGARKWAKSKDITLPTSIEEANE--  155

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK M++ A
Sbjct  156   ---------------------------------------WLVTERAKAQWMKYKSMVETA  176

Query  788   KAVNDVSSTTANSV-KTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             ++  D +    +SV ++  + ++ L D+                    + DT+GVIC+D+
Sbjct  177   RSKADNTPEVDSSVCQSTTIPDSALEDR--------------------VMDTVGVICIDN  216

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EGH+A GASSGGIALKVSGRVGLAA+YG+GCWASSKGPFG+PF+ GCCVSGAGEYLM+GF
Sbjct  217   EGHVASGASSGGIALKVSGRVGLAAVYGAGCWASSKGPFGSPFMAGCCVSGAGEYLMKGF  276

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AARECCVSLS+SQ+  ASAC+K+LRSV ++  ++ T+ SAGIL+VQ++A   D  G S  
Sbjct  277   AARECCVSLSLSQSGAASACTKILRSVVEDGRQHATDSSAGILIVQSDASLTD-QGKSSR  335

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             L+AVEIAAA++SLSFG+GYFGSSME+PKVSILRST +QS+  +D+F ARI L
Sbjct  336   LKAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQQSRMAIDQFGARIDL  387



>ref|XP_006287871.1| hypothetical protein CARUB_v10001098mg [Capsella rubella]
 gb|EOA20769.1| hypothetical protein CARUB_v10001098mg [Capsella rubella]
Length=407

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 236/353 (67%), Gaps = 56/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI IAALL KEQ+ GS+LLGRIPPM LVGEGAR WA+SKGV L ET+ EAD   
Sbjct  104   VPGVRNAINIAALLLKEQMNGSSLLGRIPPMMLVGEGARRWAESKGVLLSETVTEAD---  160

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+++K ML   
Sbjct  161   --------------------------------------QWLVTERARNQWRRFKTMLSEV  182

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A            K+    E Q  +        ++ S   A DE+ I DT+GVICVDS+
Sbjct  183   EA------------KSILSGEEQPRETMKDETCEEKKSPCAAGDEDKIMDTVGVICVDSQ  230

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +ACG+SSGGIA+K+SGRVGLAA YGSGCWASS+GPFG PF+VGCCVSGAGEYLMRGFA
Sbjct  231   GRIACGSSSGGIAMKISGRVGLAATYGSGCWASSEGPFGVPFLVGCCVSGAGEYLMRGFA  290

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYGT-EKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA  KVLRSV +QE SK GT +K+AGILVVQ +A  +   GN P
Sbjct  291   ARECCTSLSLSQAGPASAAMKVLRSVMHQEGSKSGTADKTAGILVVQVDAS-VAVPGNKP  349

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + SK GVD F AR+ L
Sbjct  350   ELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQMSKAGVDHFEARVDL  402



>ref|XP_004510821.1| PREDICTED: putative threonine aspartase-like isoform X1 [Cicer 
arietinum]
Length=405

 Score =   361 bits (926),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 197/356 (55%), Positives = 241/356 (68%), Gaps = 71/356 (20%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+ G  LLGRIPP+FLVG+GAR WAKSK +ALP + AEA+E  
Sbjct  113   VPGVRNAIQIAALLAKEQMMGPPLLGRIPPIFLVGDGAREWAKSKDIALPLSTAEANE--  170

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVT++ ++ W KYK M + A
Sbjct  171   ---------------------------------------WLVTDKAKSQWIKYKSMFEAA  191

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNA-----LDENCISDTIGVI  952
             +      S T NS+                  DG+ S  QN        E+ + DT+GVI
Sbjct  192   R------SKTTNSLP-----------------DGNSSPCQNTEMPDYASEDHVMDTVGVI  228

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVD+EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE+L
Sbjct  229   CVDNEGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGEHL  288

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             M+GFAAREC VS+S+SQ+  ASAC+K+LRSV ++ SK GT+ SAGILVVQ++A  +D  G
Sbjct  289   MKGFAARECVVSMSLSQSGAASACTKILRSVAEDGSKCGTDNSAGILVVQSDASPVD-QG  347

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              S  L+AVEIAAA++SLSFG+GYFGSSME+PKVSILRST + S+T +D+F ARI L
Sbjct  348   KS-RLKAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQHSRTAIDQFGARIDL  402



>ref|XP_009111470.1| PREDICTED: putative threonine aspartase isoform X1 [Brassica 
rapa]
Length=409

 Score =   359 bits (922),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 235/353 (67%), Gaps = 55/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GSTLLGRIPPM LVGEGAR WA+SK   LPET+ EA+   
Sbjct  105   VPGVRNAIKIAALLVKEQMSGSTLLGRIPPMMLVGEGARRWAQSKDAILPETVTEAE---  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+K+K ML   
Sbjct  162   --------------------------------------QWLVTERARNQWRKFKSMLSAV  183

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A N++SS            E Q   + NG+ D        A+DE+ I DT+GVICVDSE
Sbjct  184   EAKNNISS-----------EERQRETEKNGTFDERPLPCAAAVDEDKIMDTVGVICVDSE  232

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +ACG+SSGGIA+K+SGRVGLAA YGSGCWAS KG FG P IVGCCVSGAGEYLMRGFA
Sbjct  233   GRIACGSSSGGIAMKISGRVGLAATYGSGCWASFKGLFGDPCIVGCCVSGAGEYLMRGFA  292

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA  KVLRSV  QESS+ G T+K+ GILVVQA+A  +   G+ P
Sbjct  293   ARECCTSLSLSQAGPASAAMKVLRSVMQQESSERGDTDKTGGILVVQADAS-VSVPGDRP  351

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFGIGY+G+S+ KPK+SILR    +++ G+D F A I L
Sbjct  352   ELNAVEIAAAYSSLSFGIGYYGNSIAKPKISILRKKRGENEAGIDHFEAGIDL  404



>ref|XP_010053681.1| PREDICTED: putative threonine aspartase [Eucalyptus grandis]
 gb|KCW78043.1| hypothetical protein EUGRSUZ_D02267 [Eucalyptus grandis]
Length=398

 Score =   358 bits (920),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 230/351 (66%), Gaps = 66/351 (19%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVR+AIQIA LLAK Q+  S+LLGR+ PMFLVGEGAR WAK+KGVALP TI EA+E  
Sbjct  108   VPGVRSAIQIATLLAKGQMLESSLLGRLHPMFLVGEGARKWAKAKGVALPVTIDEAEE--  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W+KYK M+  A
Sbjct  166   ---------------------------------------WLVTERAKTQWEKYKEMVSDA  186

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A    +       K   VS+                        + I DT+GVIC+D+E
Sbjct  187   RAEKKTTIEQPMLRKPVEVSD------------------------DIIMDTVGVICIDNE  222

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+A GASSGGIALK+SGRVGLAAMYG+GCWASSKGPFGAPFI G CVSGAGEYLM+GFA
Sbjct  223   GHIASGASSGGIALKISGRVGLAAMYGAGCWASSKGPFGAPFITGSCVSGAGEYLMKGFA  282

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECCVS SISQA PASAC KVLRS+ QESS++G + +AGIL VQA+   +   G+SP L
Sbjct  283   ARECCVSSSISQAGPASACMKVLRSILQESSQHGIDGTAGILSVQADT-SVPVPGSSPKL  341

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +AVEIAAA+SS SFGIGYFGSSME+PKVSILRST +Q  T +D F ARI L
Sbjct  342   KAVEIAAAYSSSSFGIGYFGSSMERPKVSILRSTKQQKTTKIDHFEARIDL  392



>gb|KEH18920.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=306

 Score =   355 bits (910),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 240/352 (68%), Gaps = 63/352 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ  GS LLGRIPP+FLVGEGAR WAKSK + LP +IAEA+E  
Sbjct  14    VPGVRNAIQIAALLAKEQTMGSPLLGRIPPIFLVGEGAREWAKSKDIGLPPSIAEANE--  71

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WL+TER +  W KYK M + A
Sbjct  72    ---------------------------------------WLITERAKTQWIKYKSMFEAA  92

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQ-NALDENCISDTIGVICVDS  964
             +      S T NS+             SNG+    QS+   +   E+ + DT+GVICVD+
Sbjct  93    R------SKTVNSL-------------SNGNSSPCQSTEMPDYALEDQVMDTVGVICVDN  133

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE LM+GF
Sbjct  134   EGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGENLMKGF  193

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AAREC VS+S+SQ+  ASAC+KVLRSV+++SS+ GT+ SAGILVVQ++   +   G S  
Sbjct  194   AARECIVSISLSQSGAASACTKVLRSVSEDSSRCGTDSSAGILVVQSDT-SIVGQGKS-R  251

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             L AVEIAAA++SLSFG+GY+GSSME+PKV ILRST +QS+T +D+F ARI L
Sbjct  252   LTAVEIAAAYTSLSFGVGYYGSSMERPKVLILRSTKQQSRTAIDQFGARIDL  303



>emb|CDY51149.1| BnaA09g51840D [Brassica napus]
Length=409

 Score =   358 bits (919),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 235/353 (67%), Gaps = 55/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GS+LLGRIPPM LVGEGAR WA+SK   LPET+ EA+   
Sbjct  105   VPGVRNAIKIAALLVKEQMSGSSLLGRIPPMMLVGEGARRWAQSKDAILPETVTEAE---  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+K+K ML   
Sbjct  162   --------------------------------------QWLVTERARNQWRKFKSMLSAV  183

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A N++SS            E Q   + NG+ D        A+DE+ I DT+GVICVDSE
Sbjct  184   EAKNNISS-----------EERQRETEKNGTFDERPLPCAAAVDEDKIMDTVGVICVDSE  232

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +ACG+SSGGIA+K+SGRVGLAA YGSGCWASSK  FG P IVGCCVSGAGEYLMRGFA
Sbjct  233   GRIACGSSSGGIAMKISGRVGLAATYGSGCWASSKRLFGDPCIVGCCVSGAGEYLMRGFA  292

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA   VLRSV  QE S+ G T+K+ GILVVQA+A  +  TG+ P
Sbjct  293   ARECCTSLSLSQAGPASAAMNVLRSVMQQEGSERGVTDKTGGILVVQADAS-VSVTGDKP  351

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFGIGY+G+SM KPK+SILR+   +++ G+D F A I L
Sbjct  352   ELNAVEIAAAYSSLSFGIGYYGNSMVKPKISILRTKRGENEAGIDHFEAGIDL  404



>gb|KEH18919.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=405

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 198/352 (56%), Positives = 240/352 (68%), Gaps = 63/352 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ  GS LLGRIPP+FLVGEGAR WAKSK + LP +IAEA+E  
Sbjct  113   VPGVRNAIQIAALLAKEQTMGSPLLGRIPPIFLVGEGAREWAKSKDIGLPPSIAEANE--  170

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WL+TER +  W KYK M + A
Sbjct  171   ---------------------------------------WLITERAKTQWIKYKSMFEAA  191

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQ-NALDENCISDTIGVICVDS  964
             +      S T NS+             SNG+    QS+   +   E+ + DT+GVICVD+
Sbjct  192   R------SKTVNSL-------------SNGNSSPCQSTEMPDYALEDQVMDTVGVICVDN  232

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE LM+GF
Sbjct  233   EGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGENLMKGF  292

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AAREC VS+S+SQ+  ASAC+KVLRSV+++SS+ GT+ SAGILVVQ++   +   G S  
Sbjct  293   AARECIVSISLSQSGAASACTKVLRSVSEDSSRCGTDSSAGILVVQSDT-SIVGQGKS-R  350

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             L AVEIAAA++SLSFG+GY+GSSME+PKV ILRST +QS+T +D+F ARI L
Sbjct  351   LTAVEIAAAYTSLSFGVGYYGSSMERPKVLILRSTKQQSRTAIDQFGARIDL  402



>ref|XP_010523030.1| PREDICTED: putative threonine aspartase isoform X2 [Tarenaya 
hassleriana]
Length=409

 Score =   355 bits (912),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 198/357 (55%), Positives = 241/357 (68%), Gaps = 56/357 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GS LLGRIPPMFLVGEGAR WA SKGVA  +T++EAD   
Sbjct  108   VPGVRNAIKIAALLVKEQMMGSLLLGRIPPMFLVGEGARLWAMSKGVASSDTVSEAD---  164

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWL+TER R  W++++ ML  A
Sbjct  165   --------------------------------------QWLLTERARTQWQRFRTMLADA  186

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +   ++S+    S KT    +  +CD         Q+S    +DE+ I DT+GVICVDSE
Sbjct  187   ETERNLSAGGQPS-KTV---DDGVCD---------QTSICCTVDEDKIMDTVGVICVDSE  233

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG SSGGIA+KVSGRVGLAA YGSGCWASSKGPFGAPFIVGCCVSG+GEYLMRGFA
Sbjct  234   GHIACGCSSGGIAMKVSGRVGLAATYGSGCWASSKGPFGAPFIVGCCVSGSGEYLMRGFA  293

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             ARECC SLS+SQA PASA  KVLRSV  Q+S   G  ++AG LVVQA+AP + A GN   
Sbjct  294   ARECCTSLSLSQAGPASAAMKVLRSVMQQDSEDGGVNRTAGFLVVQADAP-VAALGNVSE  352

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*KC  1495
             L++VEIAAA+SS SFG+GY+GSS+EKPKVSILR   ++ +  ++ F ARI L + +C
Sbjct  353   LRSVEIAAAYSSPSFGVGYYGSSIEKPKVSILRKKREKGEAMIEHFEARIDLCSNQC  409



>gb|KFK30418.1| hypothetical protein AALP_AA7G258400 [Arabis alpina]
Length=386

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 229/351 (65%), Gaps = 74/351 (21%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GSTLLGRIPPM LVGEGAR WAKSKGV LPE++ EAD   
Sbjct  105   VPGVRNAIKIAALLVKEQMSGSTLLGRIPPMLLVGEGARRWAKSKGVVLPESVEEAD---  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+++K ML   
Sbjct  162   --------------------------------------QWLVTERARNQWRRFKTMLSAE  183

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + +    S T     +C                           E+ I DT+GVICVDSE
Sbjct  184   EQL----SETEKEETSC---------------------------EDKIMDTVGVICVDSE  212

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+ACG+SSGGIA+K+SGR+GLAAMYGSGCWASSKGPF +PF VGCCVSGAGEYLMRGFA
Sbjct  213   GHIACGSSSGGIAMKISGRLGLAAMYGSGCWASSKGPFSSPFRVGCCVSGAGEYLMRGFA  272

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             ARECC SLS+SQA PASA  KVLRSV Q+ S    +K+AGILVVQA+   +   GN+P L
Sbjct  273   ARECCTSLSLSQAGPASAAMKVLRSVMQQESGV-ADKTAGILVVQADV-SVAVPGNTPEL  330

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              AVEIAAA+SSLSFG+GY+GSS+ KPK+SI+R   ++S+ G++ F ARI L
Sbjct  331   NAVEIAAAYSSLSFGVGYYGSSILKPKISIMRKKVQKSEAGIEHFEARIDL  381



>emb|CDY07207.1| BnaCnng02220D [Brassica napus]
Length=408

 Score =   354 bits (908),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 197/353 (56%), Positives = 239/353 (68%), Gaps = 56/353 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GS+LLGRIPPM LVGEGAR WA+SK V LPET+AEAD   
Sbjct  105   VPGVRNAIKIAALLVKEQMSGSSLLGRIPPMMLVGEGARRWAQSKHVILPETVAEAD---  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER RN W+K+K ML   
Sbjct  162   --------------------------------------QWLVTERARNQWRKFKSMLSAV  183

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +A N++SS            E Q   + NG+ + ++ S   A+DE+ I DT+GVICVDS 
Sbjct  184   EAKNNLSS-----------EERQRETEKNGTCE-ERPSLCAAVDEDKIMDTVGVICVDSA  231

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +ACG+SSGGIA+K+SGRVGLAA YGSGCWA+SKG FG P IVGCCVSGAGEYLM+GFA
Sbjct  232   GRIACGSSSGGIAMKISGRVGLAATYGSGCWAASKGLFGDPCIVGCCVSGAGEYLMKGFA  291

Query  1148  ARECCVSLSISQAAPASACSKVLRSV-NQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             ARECC SLS+SQA PASA  KVLRSV  QE S+ G T+K+ GILVVQA+A  +   G+ P
Sbjct  292   ARECCTSLSLSQAGPASAAMKVLRSVIQQEGSERGDTDKTGGILVVQADAS-VSVPGDRP  350

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L AVEIAAA+SSLSFGIGY+G+S+ KPK++ILR   +++  G+D F A I L
Sbjct  351   ELNAVEIAAAYSSLSFGIGYYGNSIAKPKITILRKKREENGAGIDHFEAGIDL  403



>ref|XP_006491052.1| PREDICTED: putative threonine aspartase-like isoform X2 [Citrus 
sinensis]
Length=404

 Score =   352 bits (903),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 228/323 (71%), Gaps = 47/323 (15%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
             FLVGEGAR WAKSKG+ALP TIAEADE                                 
Sbjct  120   FLVGEGARVWAKSKGIALPATIAEADE---------------------------------  146

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSV-KTCAVSEAQLCD--KS  871
                     W+VTER R  W+KYK +L  A+A  + S+   +SV +  A +  + C+  K 
Sbjct  147   --------WMVTERARAQWRKYKSILADAEAKTNTSAEGHSSVAEETAFTSGRSCEPLKW  198

Query  872   NGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGS  1051
             NGS  G  S  Q   +++ I DT+GVICVDSEGH+A GASSGGIALKVSGRVGLAAMYGS
Sbjct  199   NGS--GQLSIPQVLEEDSNIMDTVGVICVDSEGHLASGASSGGIALKVSGRVGLAAMYGS  256

Query  1052  GCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQ  1231
             GCWASSKGPFGAPFIVG CVSG GEYLM+GFAARECCVSLS+SQA PASAC  VL  + Q
Sbjct  257   GCWASSKGPFGAPFIVGSCVSGGGEYLMKGFAARECCVSLSLSQAGPASACMTVLCPIVQ  316

Query  1232  ESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             ESS+ GT+KSAGIL+VQA+AP M  +GN P L+++EIAAA+SSLSFG+GYFGSSME+PKV
Sbjct  317   ESSQNGTDKSAGILMVQADAPVM-VSGNPPELKSIEIAAAYSSLSFGVGYFGSSMERPKV  375

Query  1412  SILRSTSKQSKTGVDEFAARIKL  1480
             S+LRST +Q++TG+D F ARI L
Sbjct  376   SVLRSTRQQNQTGIDRFEARIDL  398



>ref|XP_010523029.1| PREDICTED: putative threonine aspartase isoform X1 [Tarenaya 
hassleriana]
Length=410

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 198/358 (55%), Positives = 241/358 (67%), Gaps = 57/358 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI+IAALL KEQ+ GS LLGRIPPMFLVGEGAR WA SKGVA  +T++EAD   
Sbjct  108   VPGVRNAIKIAALLVKEQMMGSLLLGRIPPMFLVGEGARLWAMSKGVASSDTVSEAD---  164

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWL+TER R  W++++ ML  A
Sbjct  165   --------------------------------------QWLLTERARTQWQRFRTMLADA  186

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             +   ++S+    S KT    +  +CD         Q+S    +DE+ I DT+GVICVDSE
Sbjct  187   ETERNLSAGGQPS-KTV---DDGVCD---------QTSICCTVDEDKIMDTVGVICVDSE  233

Query  968   GHMACGASSGGIALKV-SGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             GH+ACG SSGGIA+KV SGRVGLAA YGSGCWASSKGPFGAPFIVGCCVSG+GEYLMRGF
Sbjct  234   GHIACGCSSGGIAMKVVSGRVGLAATYGSGCWASSKGPFGAPFIVGCCVSGSGEYLMRGF  293

Query  1145  AARECCVSLSISQAAPASACSKVLRSV-NQESSKYGTEKSAGILVVQAEAPRMDATGNSP  1321
             AARECC SLS+SQA PASA  KVLRSV  Q+S   G  ++AG LVVQA+AP + A GN  
Sbjct  294   AARECCTSLSLSQAGPASAAMKVLRSVMQQDSEDGGVNRTAGFLVVQADAP-VAALGNVS  352

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*KC  1495
              L++VEIAAA+SS SFG+GY+GSS+EKPKVSILR   ++ +  ++ F ARI L + +C
Sbjct  353   ELRSVEIAAAYSSPSFGVGYYGSSIEKPKVSILRKKREKGEAMIEHFEARIDLCSNQC  410



>gb|EYU32088.1| hypothetical protein MIMGU_mgv1a007933mg [Erythranthe guttata]
Length=390

 Score =   347 bits (891),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 194/353 (55%), Positives = 231/353 (65%), Gaps = 65/353 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA LLAKEQI GS+LLGRI PMFLVGEGAR WAKSKGVA  + +  ADE  
Sbjct  101   VQGVRNAIQIAVLLAKEQISGSSLLGRISPMFLVGEGARMWAKSKGVASDDIVEGADE--  158

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER RN W++Y+ MLD A
Sbjct  159   ---------------------------------------WLVTERARNQWRRYRTMLDDA  179

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             KA+ + ++           SE Q  D    +  G Q      L+EN I+DT+GVICVDS+
Sbjct  180   KAITNSTA-----------SETQSRDLPKLNEGGTQPYPPKTLEENGIADTVGVICVDSK  228

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+A GASSGGIALKVSGRVGLAAMYG GCWASS+ P G PF VGCCVSGAGEYLM+GFA
Sbjct  229   GHIASGASSGGIALKVSGRVGLAAMYGCGCWASSRTPSGDPFNVGCCVSGAGEYLMKGFA  288

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN--SP  1321
             ARECCVS ++S   P +AC +VL+SVN        E+SAG L+V+A+A    ATG   S 
Sbjct  289   ARECCVSSALSDDGPVNACLRVLQSVN--------ERSAGFLLVEADA---SATGVSISE  337

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              L+AVE+ AA++S SFG+GYFGSSME+PKVSILRST  Q++ GVD+FAARI  
Sbjct  338   KLKAVEVVAAYTSSSFGVGYFGSSMERPKVSILRSTRPQNQNGVDQFAARINF  390



>ref|XP_010263738.1| PREDICTED: putative threonine aspartase isoform X2 [Nelumbo nucifera]
Length=412

 Score =   344 bits (883),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 191/337 (57%), Positives = 223/337 (66%), Gaps = 51/337 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA  LAKEQ+ G +LLGR+PPMFLVGEGAR WAKSKG+ LPETIAEAD   
Sbjct  103   VPGVRNAIQIATCLAKEQMMGPSLLGRLPPMFLVGEGAREWAKSKGIILPETIAEAD---  159

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE+ +  W KYK MLD A
Sbjct  160   --------------------------------------VWLVTEKAKAQWLKYKAMLDCA  181

Query  788   KA-------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIG  946
             +A           SS   +  K      AQ  D   G+    + S  N   E+CI DT+G
Sbjct  182   EAGSKSSSVELSSSSHETDVSKPITKKGAQPFDPVRGTDS--EPSLFNTSKEDCIMDTVG  239

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
             VICVD+EGH+A GASSGGI LKVSGRVGLAA YGSGCWASSKGPFGAPF+VGCCVSGAGE
Sbjct  240   VICVDNEGHIASGASSGGILLKVSGRVGLAATYGSGCWASSKGPFGAPFVVGCCVSGAGE  299

Query  1127  YLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
             YLM+GFAARECC+S S+SQ+ PASAC KV+ SV Q+ +    +KS GIL+VQA+AP+M  
Sbjct  300   YLMKGFAARECCISSSLSQSGPASACKKVIHSVVQDDNPKCPDKSVGILLVQADAPKM-V  358

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSI  1417
              GNS  L+A+EIAAA+SSLSFGIGYFGSSM++PK  I
Sbjct  359   PGNSSKLKAIEIAAAYSSLSFGIGYFGSSMDRPKRGI  395



>ref|XP_009779485.1| PREDICTED: putative threonine aspartase isoform X3 [Nicotiana 
sylvestris]
Length=378

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 211/295 (72%), Gaps = 41/295 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN+IQIAALL KEQ+ GS LLGRI PMFLVGEGAR WA S+G+  P T++EA+E  
Sbjct  104   VPGVRNSIQIAALLVKEQMSGSPLLGRISPMFLVGEGARTWAMSRGIVSPSTVSEAEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                              L+L RQWLVTER R  WK+YKGMLD A
Sbjct  162   ---------------------------------LVLWRQWLVTERARTQWKRYKGMLDDA  188

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCD---KSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K VND S+T  A+  ++  VS+    D   + NG R+    S   ALDE+ ISDT+GVIC
Sbjct  189   KDVNDASATKMAHPKESGTVSDTPEVDNQSRGNGGRN--HISMLGALDEDFISDTVGVIC  246

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+ACG+SSGGIALKV GRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSG+GE+LM
Sbjct  247   VDTEGHIACGSSSGGIALKVGGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGSGEHLM  306

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRM  1300
             RGFAARECCVS ++SQA P+SAC KVL SV QE+S+ GTE  AGIL+VQAE+PRM
Sbjct  307   RGFAARECCVSSALSQAGPSSACKKVLHSVVQENSQCGTESCAGILLVQAESPRM  361



>ref|XP_010427239.1| PREDICTED: LOW QUALITY PROTEIN: putative threonine aspartase 
[Camelina sativa]
Length=408

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 194/357 (54%), Positives = 229/357 (64%), Gaps = 63/357 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPM----FLVGEGARAWAKSKGVALPETIAEA  595
             + G RNAI+IAALL KEQ  GSTLLGRIPPM           +   + +GV LPET+ EA
Sbjct  104   VPGARNAIKIAALLLKEQTSGSTLLGRIPPMXXITLFFSSVYQLNFECEGVLLPETVTEA  163

Query  596   DEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGM  775
             DE                                         WLVTER RN W+++K M
Sbjct  164   DE-----------------------------------------WLVTERARNQWRRFKTM  182

Query  776   LDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             L   +A      +T  + +     EA  C+        D+ S   A DE+ I DT+GVIC
Sbjct  183   LSELEA-----KSTLPAERETMKDEA--CE--------DKPSPCAAGDEDKIMDTVGVIC  227

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VDS+GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFG PF+VGCCVSGAGEYLM
Sbjct  228   VDSQGHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGVPFLVGCCVSGAGEYLM  287

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSV-NQESSKYGT-EKSAGILVVQAEAPRMDAT  1309
             RGFAARECC SLS+SQA PASA  KVLRSV  QE SK G  EK+AGILVVQ +A  +   
Sbjct  288   RGFAARECCTSLSLSQAGPASAAMKVLRSVMQQEGSKSGVAEKTAGILVVQVDA-SVAVP  346

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             GN P L AVEIAAA+SSLSFG+GY+G+S+EKPK+SILR+  + SK GVD F ARI L
Sbjct  347   GNKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKISILRTRRQMSKAGVDHFEARIDL  403



>ref|XP_009620817.1| PREDICTED: putative threonine aspartase isoform X1 [Nicotiana 
tomentosiformis]
Length=393

 Score =   335 bits (860),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 178/294 (61%), Positives = 210/294 (71%), Gaps = 41/294 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN+IQIAALL KEQ+ GS LLGRI PMFLVGEGAR WA S+G+  P T++EA+E  
Sbjct  122   VPGVRNSIQIAALLVKEQMSGSPLLGRISPMFLVGEGARTWAMSRGIVSPSTVSEAEE--  179

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                              L+L RQWLVTER R  W++YKGMLD A
Sbjct  180   ---------------------------------LVLWRQWLVTERARTQWERYKGMLDDA  206

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCD---KSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K VNDVS+   A+   +  VS+    D   + NG+R+    S   ALDE+ ISDT+GVIC
Sbjct  207   KDVNDVSAAKMAHPKDSGTVSDTPEVDNQSRGNGARN--PISMLGALDEDFISDTVGVIC  264

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+ACG+SSGGIALKV GRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSG+GE+LM
Sbjct  265   VDTEGHIACGSSSGGIALKVGGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGSGEHLM  324

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPR  1297
             RGFAARECCVS ++SQA P+SAC KVL SV QE+S+ GTE SAG L+VQAE+PR
Sbjct  325   RGFAARECCVSSALSQAGPSSACKKVLHSVVQENSQCGTESSAGFLLVQAESPR  378



>ref|XP_010671917.1| PREDICTED: putative threonine aspartase [Beta vulgaris subsp. 
vulgaris]
Length=421

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 187/356 (53%), Positives = 230/356 (65%), Gaps = 48/356 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI++AA L KEQ  G +LLGR PP FLVGEGA  WAKSKG++   TI EA+   
Sbjct  106   VPGVRNAIKVAASLIKEQKMGPSLLGRTPPTFLVGEGALKWAKSKGISCAGTIEEAE---  162

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVTE+T++ W KYK MLD A
Sbjct  163   --------------------------------------KWLVTEKTKSQWCKYKAMLDAA  184

Query  788   KA---VNDVSSTTANSVKTCAV--SEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVI  952
             K      D+  +++   K   +   EA   D S G  D  +SS+   ++E+CI DT+GVI
Sbjct  185   KTKVRAFDMQPSSSRPHKKGLLFDVEAYSSDASKGIGD-VKSSTLGVMEEDCIMDTVGVI  243

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             C+D  GH+A GASSGGIA+KVSGRVGLA MYGSGCWASS GPF APF VGCC +GAGEYL
Sbjct  244   CIDRAGHVASGASSGGIAMKVSGRVGLAGMYGSGCWASSNGPFEAPFRVGCCTTGAGEYL  303

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             MR FAA+ECC+SLS SQA PASAC ++LR V Q   + G + SAGIL+VQA+AP +    
Sbjct  304   MRAFAAKECCMSLSSSQAGPASACIEILRLVIQACRQQGADGSAGILLVQADAPLVGPE-  362

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             N P L+ VEIAA +SS SFGIGY+GSSME+PKVS+LR+   +S TG+D F ARI L
Sbjct  363   NMPKLKMVEIAAGYSSQSFGIGYYGSSMERPKVSVLRNNKLKSTTGIDHFEARINL  418



>ref|XP_008778598.1| PREDICTED: putative threonine aspartase isoform X1 [Phoenix dactylifera]
Length=422

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 230/357 (64%), Gaps = 50/357 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ LP T++E +E  
Sbjct  104   VRGVRNAIQIAAYLAKEQITGSSLLGRIPPLFLVGEGAREWGKSKGIILPATVSEMEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK ML  A
Sbjct  162   ---------------------------------------WLVTERAKTQWVKYKAMLAYA  182

Query  788   KAVNDVSSTT------ANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGV  949
             K  ++ S+        +++V         L D +       QSS+++ + E+CI DT+GV
Sbjct  183   KGQSESSTALSTSASGSSAVPMVKPEGQSLIDGNKNKASSGQSSAKDNIKEDCIMDTVGV  242

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             IC+DS GH+A GASSGGIALKV GRVGLAAMYGSGCWASS+ PFGAPF+VGCC +GAGEY
Sbjct  243   ICIDSSGHVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPFGAPFVVGCCATGAGEY  302

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             L++ FAARECCVS S+SQ+ PASAC+K+L SV Q  ++   +  AG+L+VQA+   + AT
Sbjct  303   LIKEFAARECCVSSSLSQSGPASACTKILHSVVQNGNQKSRDTGAGVLLVQADT--LKAT  360

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              + P L+AVE+ AA+ S SFGIG FG+SM+ PKVSILR+   ++   ++ F A + L
Sbjct  361   QSCP-LEAVELVAAYCSSSFGIGLFGNSMDCPKVSILRAAEHRNSNDINHFGAHVVL  416



>ref|XP_008778606.1| PREDICTED: putative threonine aspartase isoform X2 [Phoenix dactylifera]
Length=421

 Score =   331 bits (849),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 230/356 (65%), Gaps = 49/356 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ LP T++E +E  
Sbjct  104   VRGVRNAIQIAAYLAKEQITGSSLLGRIPPLFLVGEGAREWGKSKGIILPATVSEMEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK ML  A
Sbjct  162   ---------------------------------------WLVTERAKTQWVKYKAMLAYA  182

Query  788   KAVNDVSSTTA----NSVKTCAVSEAQ-LCDKSNGSRDGDQSSSQNALDENCISDTIGVI  952
             K  ++ S+  +     S     V   Q L D +       QSS+++ + E+CI DT+GVI
Sbjct  183   KGQSESSTALSTSASGSSAVPMVKPGQSLIDGNKNKASSGQSSAKDNIKEDCIMDTVGVI  242

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             C+DS GH+A GASSGGIALKV GRVGLAAMYGSGCWASS+ PFGAPF+VGCC +GAGEYL
Sbjct  243   CIDSSGHVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPFGAPFVVGCCATGAGEYL  302

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             ++ FAARECCVS S+SQ+ PASAC+K+L SV Q  ++   +  AG+L+VQA+   + AT 
Sbjct  303   IKEFAARECCVSSSLSQSGPASACTKILHSVVQNGNQKSRDTGAGVLLVQADT--LKATQ  360

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             + P L+AVE+ AA+ S SFGIG FG+SM+ PKVSILR+   ++   ++ F A + L
Sbjct  361   SCP-LEAVELVAAYCSSSFGIGLFGNSMDCPKVSILRAAEHRNSNDINHFGAHVVL  415



>ref|XP_009347859.1| PREDICTED: putative threonine aspartase isoform X3 [Pyrus x bretschneideri]
Length=401

 Score =   330 bits (847),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 187/326 (57%), Positives = 219/326 (67%), Gaps = 60/326 (18%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
              LVGEGARAWAKSKG+AL  +    DE                                 
Sbjct  124   LLVGEGARAWAKSKGLALAPSTTADDE---------------------------------  150

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVS----STTANSVKTCAVSEAQLCD-  865
                     WLVTER +  W+KYK M+D A+A  + S    S +       + SEAQ CD 
Sbjct  151   --------WLVTERAKAQWRKYKAMVDDARAKTENSDSRLSCSPQETAGMSESEAQPCDY  202

Query  866   -KSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAM  1042
              K NG+            +E+CI DT+GVIC+D+EG +A GASSGGIALKV GRVGLAAM
Sbjct  203   LKHNGA------------EEDCIMDTVGVICMDAEGQIASGASSGGIALKVGGRVGLAAM  250

Query  1043  YGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRS  1222
             +G+GCWASSKG FGAP IVGCCVSGAGEYLM+GFAARE CVSLS+SQA PASAC KVLRS
Sbjct  251   HGAGCWASSKGVFGAPCIVGCCVSGAGEYLMKGFAARESCVSLSVSQAGPASACMKVLRS  310

Query  1223  VNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEK  1402
             V Q+S+   T++SAGIL+VQA+AP M A G+SP L+AVEIAAA++SLSFGIGYFGS+ME+
Sbjct  311   VIQDSNNNCTDRSAGILLVQADAPIMVA-GSSPKLKAVEIAAAYTSLSFGIGYFGSAMER  369

Query  1403  PKVSILRSTSKQSKTGVDEFAARIKL  1480
             PKVSILRST  QSKTGVD F ARI L
Sbjct  370   PKVSILRSTKLQSKTGVDHFEARIDL  395



>ref|XP_010940450.1| PREDICTED: putative threonine aspartase isoform X5 [Elaeis guineensis]
Length=341

 Score =   328 bits (842),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 230/357 (64%), Gaps = 52/357 (15%)
 Frame = +2

Query  434   GVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ +P T++E +E    
Sbjct  23    GVRNAIQIAAHLAKEQIAGSSLLGRIPPLFLVGEGAREWGKSKGIIMPATVSEIEE----  78

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                  WLVTER +  W KYK ML  AK 
Sbjct  79    -------------------------------------WLVTERAKTQWMKYKAMLADAKG  101

Query  794   --------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGV  949
                         S ++A S++  A+   +L           Q S+++ + E+CI DT+GV
Sbjct  102   WSESSTAQTTSTSGSSAVSLEKPAIEAQRLIGGKKNKASHGQPSAKDDIKEDCIMDTVGV  161

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             IC+DS G +A GASSGGIALKV GRVGLAAMYGSGCWASS+ P+GAPFIVGCC +GAGEY
Sbjct  162   ICIDSSGRVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPYGAPFIVGCCATGAGEY  221

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             L++GFAARECCVS S+SQ+ PASAC+K+LRSV Q S++   +  AG+L+VQA+   +  T
Sbjct  222   LIKGFAARECCVSSSLSQSGPASACTKLLRSVVQNSNQKSHDTGAGVLLVQADT--LKVT  279

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              +SP  +AVE+ AA+ S SFGIGYFG+SM+ PKVSILR    ++   ++ F AR+ L
Sbjct  280   QSSP-PEAVELVAAYCSSSFGIGYFGNSMDCPKVSILRGAGYRNSNDINHFGARVVL  335



>ref|XP_010940443.1| PREDICTED: putative threonine aspartase isoform X2 [Elaeis guineensis]
Length=435

 Score =   331 bits (848),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 231/359 (64%), Gaps = 52/359 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ +P T++E +E  
Sbjct  115   VRGVRNAIQIAAHLAKEQIAGSSLLGRIPPLFLVGEGAREWGKSKGIIMPATVSEIEE--  172

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK ML  A
Sbjct  173   ---------------------------------------WLVTERAKTQWMKYKAMLADA  193

Query  788   KA--------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTI  943
             K             S ++A S++  A+   +L           Q S+++ + E+CI DT+
Sbjct  194   KGWSESSTAQTTSTSGSSAVSLEKPAIEAQRLIGGKKNKASHGQPSAKDDIKEDCIMDTV  253

Query  944   GVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAG  1123
             GVIC+DS G +A GASSGGIALKV GRVGLAAMYGSGCWASS+ P+GAPFIVGCC +GAG
Sbjct  254   GVICIDSSGRVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPYGAPFIVGCCATGAG  313

Query  1124  EYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMD  1303
             EYL++GFAARECCVS S+SQ+ PASAC+K+LRSV Q S++   +  AG+L+VQA+   + 
Sbjct  314   EYLIKGFAARECCVSSSLSQSGPASACTKLLRSVVQNSNQKSHDTGAGVLLVQADT--LK  371

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              T +SP  +AVE+ AA+ S SFGIGYFG+SM+ PKVSILR    ++   ++ F AR+ L
Sbjct  372   VTQSSP-PEAVELVAAYCSSSFGIGYFGNSMDCPKVSILRGAGYRNSNDINHFGARVVL  429



>ref|XP_009787749.1| PREDICTED: putative threonine aspartase isoform X1 [Nicotiana 
sylvestris]
Length=253

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 201/261 (77%), Gaps = 9/261 (3%)
 Frame = +2

Query  713   LVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVK-TCAVSEAQLCDKSNGSRDG  889
             ++  WLVT +    WK+YK ML  AK  ND        +K T A+SE Q CD+  G+  G
Sbjct  1     MLDDWLVTGKASTQWKRYKAMLHDAKVGNDALDLKMTHLKETNAISEGQPCDQLWGNGVG  60

Query  890   DQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASS  1069
             D      ALDE+ ISDT+GVIC+DSEGH+ACGASSGGIALKVSGRVGLAAMYGSGCWASS
Sbjct  61    D------ALDEDLISDTVGVICLDSEGHIACGASSGGIALKVSGRVGLAAMYGSGCWASS  114

Query  1070  KGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYG  1249
              GPFGAPFIVGCCVSGAGE+LM+GFAARECC+S S+SQA P+SAC KVLR+V QE+S+ G
Sbjct  115   IGPFGAPFIVGCCVSGAGEHLMKGFAARECCISSSLSQAGPSSACKKVLRTV-QENSQCG  173

Query  1250  TEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRST  1429
              E SAG L+VQAE  R+ A G    L+ VEIAA +SS SFGIGYFGSSM++PKVS+LRS 
Sbjct  174   AESSAGFLLVQAEPSRLVA-GTLAKLETVEIAAVYSSSSFGIGYFGSSMDRPKVSVLRSK  232

Query  1430  SKQSKTGVDEFAARIKLVA*K  1492
              +QSKTG++EFAAR+ LV  K
Sbjct  233   KQQSKTGINEFAARVNLVTKK  253



>ref|XP_010940442.1| PREDICTED: putative threonine aspartase isoform X1 [Elaeis guineensis]
Length=452

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/359 (50%), Positives = 231/359 (64%), Gaps = 52/359 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ +P T++E +E  
Sbjct  132   VRGVRNAIQIAAHLAKEQIAGSSLLGRIPPLFLVGEGAREWGKSKGIIMPATVSEIEE--  189

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK ML  A
Sbjct  190   ---------------------------------------WLVTERAKTQWMKYKAMLADA  210

Query  788   KA--------VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTI  943
             K             S ++A S++  A+   +L           Q S+++ + E+CI DT+
Sbjct  211   KGWSESSTAQTTSTSGSSAVSLEKPAIEAQRLIGGKKNKASHGQPSAKDDIKEDCIMDTV  270

Query  944   GVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAG  1123
             GVIC+DS G +A GASSGGIALKV GRVGLAAMYGSGCWASS+ P+GAPFIVGCC +GAG
Sbjct  271   GVICIDSSGRVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPYGAPFIVGCCATGAG  330

Query  1124  EYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMD  1303
             EYL++GFAARECCVS S+SQ+ PASAC+K+LRSV Q S++   +  AG+L+VQA+   + 
Sbjct  331   EYLIKGFAARECCVSSSLSQSGPASACTKLLRSVVQNSNQKSHDTGAGVLLVQADT--LK  388

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              T +SP  +AVE+ AA+ S SFGIGYFG+SM+ PKVSILR    ++   ++ F AR+ L
Sbjct  389   VTQSSP-PEAVELVAAYCSSSFGIGYFGNSMDCPKVSILRGAGYRNSNDINHFGARVVL  446



>ref|XP_008438076.1| PREDICTED: putative threonine aspartase isoform X3 [Cucumis melo]
Length=406

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 218/327 (67%), Gaps = 53/327 (16%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
              LVGEGAR WAK+KG+ LPETIAEA+E                                 
Sbjct  120   LLVGEGARTWAKTKGICLPETIAEANE---------------------------------  146

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVKTCA------VSEAQLC  862
                     WLVTER +  WK+YK M++ AK        T+N   +C       +SE Q  
Sbjct  147   --------WLVTERAKVQWKRYKSMVERAKK----EKGTSNVAHSCCPQDNARISEVQSH  194

Query  863   DKSNGSR-DGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAA  1039
             +   G+       S++   +E+C  DT+GVICVDSEGH+A GASSGGIA+KVSGRVGLAA
Sbjct  195   NPPEGTTCQSSTRSNEEEEEEDCTMDTVGVICVDSEGHVASGASSGGIAMKVSGRVGLAA  254

Query  1040  MYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLR  1219
             MYGSGCWASSKGPFGAPF+VG CVSG GEYLM+GFAARECCVSLS+SQA P SAC KVLR
Sbjct  255   MYGSGCWASSKGPFGAPFMVGGCVSGGGEYLMKGFAARECCVSLSLSQAGPGSACMKVLR  314

Query  1220  SVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSME  1399
             +  QESS++  +KSAGIL+VQA+A +  A GN   L+AVEIAAA+SSLSFG+GYF SSM+
Sbjct  315   NFVQESSQHNADKSAGILLVQADASK-SAPGNPQKLKAVEIAAAYSSLSFGMGYFASSMD  373

Query  1400  KPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +PKVSILRST + +K G+D F ARI L
Sbjct  374   RPKVSILRSTKQNNKMGIDHFEARIDL  400



>ref|XP_004510822.1| PREDICTED: putative threonine aspartase-like isoform X2 [Cicer 
arietinum]
Length=384

 Score =   325 bits (834),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/356 (52%), Positives = 224/356 (63%), Gaps = 92/356 (26%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+ G  LLGRIPP+FLVG+GAR WAKSK +ALP + AEA+E  
Sbjct  113   VPGVRNAIQIAALLAKEQMMGPPLLGRIPPIFLVGDGAREWAKSKDIALPLSTAEANE--  170

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVT++ ++ W KYK M + A
Sbjct  171   ---------------------------------------WLVTDKAKSQWIKYKSMFEAA  191

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNA-----LDENCISDTIGVI  952
             +      S T NS+                  DG+ S  QN        E+ + DT+GVI
Sbjct  192   R------SKTTNSLP-----------------DGNSSPCQNTEMPDYASEDHVMDTVGVI  228

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVD+EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE+L
Sbjct  229   CVDNEGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGEHL  288

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             M+GFAAREC VS+S+                     K GT+ SAGILVVQ++A  +D  G
Sbjct  289   MKGFAARECVVSMSL---------------------KCGTDNSAGILVVQSDASPVD-QG  326

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              S  L+AVEIAAA++SLSFG+GYFGSSME+PKVSILRST + S+T +D+F ARI L
Sbjct  327   KS-RLKAVEIAAAYTSLSFGVGYFGSSMERPKVSILRSTKQHSRTAIDQFGARIDL  381



>ref|XP_009620818.1| PREDICTED: putative threonine aspartase isoform X2 [Nicotiana 
tomentosiformis]
Length=387

 Score =   325 bits (833),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/294 (59%), Positives = 205/294 (70%), Gaps = 47/294 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRN+IQIAALL KEQ+ GS LLGRI PMFLVGEGAR WA S+G+  P T++EA+E  
Sbjct  122   VPGVRNSIQIAALLVKEQMSGSPLLGRISPMFLVGEGARTWAMSRGIVSPSTVSEAEE--  179

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER R  W++YKGMLD A
Sbjct  180   ---------------------------------------WLVTERARTQWERYKGMLDDA  200

Query  788   KAVNDVSST-TANSVKTCAVSEAQLCD---KSNGSRDGDQSSSQNALDENCISDTIGVIC  955
             K VNDVS+   A+   +  VS+    D   + NG+R+    S   ALDE+ ISDT+GVIC
Sbjct  201   KDVNDVSAAKMAHPKDSGTVSDTPEVDNQSRGNGARN--PISMLGALDEDFISDTVGVIC  258

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD+EGH+ACG+SSGGIALKV GRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSG+GE+LM
Sbjct  259   VDTEGHIACGSSSGGIALKVGGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGSGEHLM  318

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPR  1297
             RGFAARECCVS ++SQA P+SAC KVL SV QE+S+ GTE SAG L+VQAE+PR
Sbjct  319   RGFAARECCVSSALSQAGPSSACKKVLHSVVQENSQCGTESSAGFLLVQAESPR  372



>ref|XP_004960026.1| PREDICTED: LOW QUALITY PROTEIN: putative threonine aspartase-like 
[Setaria italica]
Length=434

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 231/358 (65%), Gaps = 54/358 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQ+A  LAKEQI GS+LLGRIPPMFLVGEGA  WAKSKG+ L E+ +EA+   
Sbjct  122   IQGVKNPIQVALHLAKEQIAGSSLLGRIPPMFLVGEGAYKWAKSKGMDLLESTSEAN---  178

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  R  W KY  +L  +
Sbjct  179   --------------------------------------SWLVTENARAQWVKYTALLVNS  200

Query  788   KAV---NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDEN--CISDTIGVI  952
             K +   N  S +  +SV+     EA   D  N + DG +  +Q+ +++N  C+ DT+GVI
Sbjct  201   KKLLEHNTGSGSEHDSVQL----EAPGTDSEN-TADGKKMFTQSPMEDNQDCVMDTVGVI  255

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVDS G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PF+V CC +GAGE+L
Sbjct  256   CVDSYGNVASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFMVACCATGAGEHL  315

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATG  1312
             +RGFAARECC+S S+SQ+ PASAC+KVLR+V Q SSK   +  AG+L+VQ +A +    G
Sbjct  316   IRGFAARECCISSSLSQSGPASACTKVLRTVVQSSSKMSHDTGAGLLLVQVDAQKXG--G  373

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             +   L+A E+ AA+SS SFG+GYFGS+M  PKVS+LR++   S   ++ FA RIK+ A
Sbjct  374   DLSELEAAELVAAYSSPSFGVGYFGSNMNNPKVSMLRASEGASGI-INHFATRIKIDA  430



>gb|AAC13614.1| regions of weak similarity to l-asparaginase [Arabidopsis thaliana]
 emb|CAB80868.1| putative glycosylasparaginase [Arabidopsis thaliana]
Length=402

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 189/353 (54%), Positives = 222/353 (63%), Gaps = 79/353 (22%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPM-----------FLVGEGARAWAKSKGVAL  574
             + GVRNAI+IAALL KEQI GSTLLGRIPP+            LVGEGAR W KSK V +
Sbjct  104   VPGVRNAIKIAALLVKEQITGSTLLGRIPPIVGLNFLICLPRLLVGEGARRWGKSKSVLI  163

Query  575   PETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNL  754
             P T+ EAD                                         QWLVTER RN 
Sbjct  164   PGTVTEAD-----------------------------------------QWLVTERARNQ  182

Query  755   WKKYKGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCIS  934
             W+++K ML         S   A S+ +   +E       N     +  SS  A DE+ I 
Sbjct  183   WRRFKAML---------SEVGAKSILS---AEEHPRGTENNETCEENVSSCAAADEDKIM  230

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+GVICVD+EGH+ACG+SSGGIA+K+SGRVGLAA YGSGCWASSKGPFGAPF+VGCCVS
Sbjct  231   DTVGVICVDNEGHIACGSSSGGIAMKISGRVGLAATYGSGCWASSKGPFGAPFLVGCCVS  290

Query  1115  GAGEYLMRGFAARECCVSLSIS------------QAAPASACSKVLRSV-NQESSKYGT-  1252
             GAGEYLMRGFAARECC SL++              A PASA  KVLRSV +QESSK GT 
Sbjct  291   GAGEYLMRGFAARECCTSLALYISLIFLSFYAFLGAGPASAAMKVLRSVMHQESSKIGTA  350

Query  1253  EKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             +K+AGILVVQA+A  +   G+ P L AVEIAAA+SSLSFG+GY+G+S+EKPKV
Sbjct  351   DKTAGILVVQADASVV-VPGSKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKV  402



>ref|XP_010456262.1| PREDICTED: putative threonine aspartase isoform X2 [Camelina 
sativa]
Length=389

 Score =   317 bits (813),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 212/320 (66%), Gaps = 59/320 (18%)
 Frame = +2

Query  527   VGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIF  706
             VGEGAR WA+SKGV LPET+ EAD                                    
Sbjct  122   VGEGARRWAESKGVLLPETVTEAD------------------------------------  145

Query  707   LLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRD  886
                  QWLVTER RN W+++K ML   +A      +T  + +     EA  C+       
Sbjct  146   -----QWLVTERARNQWRRFKTMLSELEA-----KSTLPAERETMKDEA--CE-------  186

Query  887   GDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWAS  1066
              D+ S+  A DE+ I DT+GVICVDS+GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWAS
Sbjct  187   -DKPSACAAGDEDKIMDTVGVICVDSQGHIACGSSSGGIAMKISGRVGLAATYGSGCWAS  245

Query  1067  SKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSV-NQESSK  1243
             SKGPFG PF+VGCCVSGAGEYLMRGFAAR+CC SLS+SQA PASA  KVLRSV  QE SK
Sbjct  246   SKGPFGVPFLVGCCVSGAGEYLMRGFAARDCCTSLSLSQAGPASAAMKVLRSVMQQEGSK  305

Query  1244  YG-TEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSIL  1420
              G  +K+AGILVVQ +A  +   GN P L AVEIAAA+SSLSFG+GY+G+S+EKPK+SIL
Sbjct  306   SGIADKTAGILVVQVDAS-VAVPGNKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKISIL  364

Query  1421  RSTSKQSKTGVDEFAARIKL  1480
             R+  + SK GVD F ARI L
Sbjct  365   RTRKQTSKAGVDHFEARIDL  384



>ref|XP_006576666.1| PREDICTED: putative threonine aspartase-like isoform X2 [Glycine 
max]
Length=375

 Score =   315 bits (808),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 211/323 (65%), Gaps = 71/323 (22%)
 Frame = +2

Query  527   VGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIF  706
             VGEGA  WAKSK +ALP +I EA+E                                   
Sbjct  116   VGEGACKWAKSKDIALPPSIEEANE-----------------------------------  140

Query  707   LLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRD  886
                   WLVTER +  W KYK M++ A++                        K+  + +
Sbjct  141   ------WLVTERAKAQWIKYKSMVESARS------------------------KTENTPE  170

Query  887   GDQSSSQNALDENC-----ISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGS  1051
             GD S  QNA   +C     + DT+GVIC+D+EGH+A GASSGGIALKVSGR+GLAAMYGS
Sbjct  171   GDSSVYQNATVPDCALEDRVMDTVGVICIDNEGHVASGASSGGIALKVSGRIGLAAMYGS  230

Query  1052  GCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQ  1231
             GCWASSKGPFGAPF+ GCCVSGAGE+LM+GFAARECCVSLS+SQ+  ASAC+K+LRSV +
Sbjct  231   GCWASSKGPFGAPFMAGCCVSGAGEHLMKGFAARECCVSLSLSQSGAASACTKILRSVVE  290

Query  1232  ESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             +  + GT+ SAGILVVQ++A   D  G S  L+AVEIAAA++SLSFG+GYFGSSME+PKV
Sbjct  291   DGRQCGTDSSAGILVVQSDASLTD-QGKSSRLKAVEIAAAYTSLSFGVGYFGSSMERPKV  349

Query  1412  SILRSTSKQSKTGVDEFAARIKL  1480
             SILRST +QSKT +D+F ARI L
Sbjct  350   SILRSTKQQSKTAIDQFGARIDL  372



>ref|NP_001190644.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
 gb|AEE81907.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein [Arabidopsis thaliana]
Length=393

 Score =   316 bits (810),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 215/325 (66%), Gaps = 66/325 (20%)
 Frame = +2

Query  527   VGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIF  706
             VGEGAR W KSK V +P T+ EAD                                    
Sbjct  123   VGEGARRWGKSKSVLIPGTVTEAD------------------------------------  146

Query  707   LLLVRQWLVTERTRNLWKKYKGMLD--GAKAV---NDVSSTTANSVKTCAVSEAQLCDKS  871
                  QWLVTER RN W+++K ML   GAK++    +    T N+ +TC           
Sbjct  147   -----QWLVTERARNQWRRFKAMLSEVGAKSILSAEEHPRGTENN-ETCE----------  190

Query  872   NGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGS  1051
                   +  SS  A DE+ I DT+GVICVD+EGH+ACG+SSGGIA+K+SGRVGLAA YGS
Sbjct  191   ------ENVSSCAAADEDKIMDTVGVICVDNEGHIACGSSSGGIAMKISGRVGLAATYGS  244

Query  1052  GCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSV-N  1228
             GCWASSKGPFGAPF+VGCCVSGAGEYLMRGFAARECC SL++SQA PASA  KVLRSV +
Sbjct  245   GCWASSKGPFGAPFLVGCCVSGAGEYLMRGFAARECCTSLALSQAGPASAAMKVLRSVMH  304

Query  1229  QESSKYGT-EKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
             QESSK GT +K+AGILVVQA+A  +   G+ P L AVEIAAA+SSLSFG+GY+G+S+EKP
Sbjct  305   QESSKIGTADKTAGILVVQADASVV-VPGSKPELNAVEIAAAYSSLSFGVGYYGNSIEKP  363

Query  1406  KVSILRSTSKQSKTGVDEFAARIKL  1480
             K+SILR+  + S+ GVD F ARI L
Sbjct  364   KISILRTRRQMSEAGVDHFEARIDL  388



>ref|XP_006827748.1| hypothetical protein AMTR_s00009p00262810 [Amborella trichopoda]
 gb|ERM95164.1| hypothetical protein AMTR_s00009p00262810 [Amborella trichopoda]
Length=387

 Score =   316 bits (809),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 228/358 (64%), Gaps = 51/358 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G+RNAI+IAA LAKE + G  LLGRIPP+FLVGEGAR WA SKG+   E+ AE D   
Sbjct  70    VPGLRNAIEIAAHLAKEHLEGPQLLGRIPPIFLVGEGAREWALSKGIISQESSAEVD---  126

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   +WLVTER +  W  YK MLD A
Sbjct  127   --------------------------------------KWLVTERAKEQWFIYKAMLDDA  148

Query  788   K-----AVNDVSSTTANSVKTCAVS-EAQLC-DKSNGSRDGDQSSSQNALDENCISDTIG  946
             K     + +++ S      ++ A S EAQL  +K NG  +G     +  ++++ I DT+G
Sbjct  149   KRGGGSSTDELPSCPGTMHQSLASSGEAQLFPEKGNG--NGSMEILEVEVNKDAIMDTVG  206

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
              ICVDS GH+A GASSGGIALKV GRVGLAAMYG GCWA SKGPFGAPF VGCCVSGAGE
Sbjct  207   AICVDSLGHVASGASSGGIALKVKGRVGLAAMYGCGCWADSKGPFGAPFPVGCCVSGAGE  266

Query  1127  YLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
              LMRGFAARECC+S S+SQA P SAC+K+L+++ ++ ++   ++ +G+L+VQA+  + + 
Sbjct  267   NLMRGFAARECCLSSSLSQAGPTSACTKILKAILKDRAQEFEDRGSGVLLVQADIHK-EH  325

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             + NS  L AVE+ AA+SS SFGIGY+GSSM +PKVSIL S+   +   VD F AR  L
Sbjct  326   SSNSERLSAVELVAAYSSSSFGIGYYGSSMNRPKVSILSSSRATNSKEVDHFGARFDL  383



>ref|XP_010263756.1| PREDICTED: putative threonine aspartase isoform X4 [Nelumbo nucifera]
Length=406

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 182/327 (56%), Positives = 214/327 (65%), Gaps = 51/327 (16%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
             FLVGEGAR WAKSKG+ LPETIAEAD                                  
Sbjct  119   FLVGEGAREWAKSKGIILPETIAEAD----------------------------------  144

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKA-------VNDVSSTTANSVKTCAVSEAQL  859
                     WLVTE+ +  W KYK MLD A+A           SS   +  K      AQ 
Sbjct  145   -------VWLVTEKAKAQWLKYKAMLDCAEAGSKSSSVELSSSSHETDVSKPITKKGAQP  197

Query  860   CDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAA  1039
              D   G+    + S  N   E+CI DT+GVICVD+EGH+A GASSGGI LKVSGRVGLAA
Sbjct  198   FDPVRGTDS--EPSLFNTSKEDCIMDTVGVICVDNEGHIASGASSGGILLKVSGRVGLAA  255

Query  1040  MYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLR  1219
              YGSGCWASSKGPFGAPF+VGCCVSGAGEYLM+GFAARECC+S S+SQ+ PASAC KV+ 
Sbjct  256   TYGSGCWASSKGPFGAPFVVGCCVSGAGEYLMKGFAARECCISSSLSQSGPASACKKVIH  315

Query  1220  SVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSME  1399
             SV Q+ +    +KS GIL+VQA+AP+M   GNS  L+A+EIAAA+SSLSFGIGYFGSSM+
Sbjct  316   SVVQDDNPKCPDKSVGILLVQADAPKM-VPGNSSKLKAIEIAAAYSSLSFGIGYFGSSMD  374

Query  1400  KPKVSILRSTSKQSKTGVDEFAARIKL  1480
             +PKVSILR+T +Q+ T +D F ARI L
Sbjct  375   RPKVSILRTTKRQTTTRIDHFEARIDL  401



>ref|XP_010419611.1| PREDICTED: putative threonine aspartase isoform X3 [Camelina 
sativa]
Length=389

 Score =   315 bits (807),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 179/320 (56%), Positives = 210/320 (66%), Gaps = 59/320 (18%)
 Frame = +2

Query  527   VGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIF  706
             VGEGAR WA+SKGV LPET+ EAD                                    
Sbjct  122   VGEGARRWAESKGVLLPETVTEAD------------------------------------  145

Query  707   LLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRD  886
                  QWLVTER RN W+++K ML   +A      +T  + +     EA  C+       
Sbjct  146   -----QWLVTERARNQWRRFKTMLSELEA-----KSTLPAERETMKDEA--CE-------  186

Query  887   GDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWAS  1066
              D+ S   A DE+ I DT+GVICVDS+GH+ACG+SSGGIA+K+SGRVGLAA YGSGCWAS
Sbjct  187   -DKPSPCAAGDEDKIMDTVGVICVDSQGHIACGSSSGGIAMKISGRVGLAATYGSGCWAS  245

Query  1067  SKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSV-NQESSK  1243
             SKGPFG PF+VGCCVSGAGEYLMR FAARECC SLSISQA PASA  KVLRSV  QE SK
Sbjct  246   SKGPFGVPFLVGCCVSGAGEYLMREFAARECCTSLSISQAGPASAAMKVLRSVMQQEGSK  305

Query  1244  YG-TEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSIL  1420
              G  +K+AGILVVQ +A  +   GN P L AVEIAAA+SSLSFG+GY+G+S+EKPK+SIL
Sbjct  306   GGIADKTAGILVVQVDA-SVAVPGNKPELNAVEIAAAYSSLSFGVGYYGNSIEKPKISIL  364

Query  1421  RSTSKQSKTGVDEFAARIKL  1480
             R+  + SK GVD F ARI L
Sbjct  365   RTRRQTSKAGVDHFEARIDL  384



>ref|XP_009398542.1| PREDICTED: putative threonine aspartase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=361

 Score =   312 bits (799),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 220/359 (61%), Gaps = 52/359 (14%)
 Frame = +2

Query  434   GVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             GVRNAIQIA  LAKEQ  GS+LLGRIPPMFLVGEGAR W KSKG+ +P +I E D     
Sbjct  46    GVRNAIQIATCLAKEQTTGSSLLGRIPPMFLVGEGAREWGKSKGLTIPTSILEED-----  100

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                  WLVTE+ ++ W KYK ML  AK 
Sbjct  101   ------------------------------------SWLVTEKAKSQWMKYKAMLADAKK  124

Query  794   VNDVSSTTAN-SVKTCAVSEAQLCDKS-------NGSRDGDQSSSQNALDENCISDTIGV  949
              ++ S      + +T ++      D+S       N   DG  S  +N   E+ + DT+G 
Sbjct  125   KSECSLEVPTLACRTASLPTDTEVDESQSSIVGQNKELDG-HSFMKNNDKEDFVMDTVGA  183

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             +C+DS GH+A GASSGGIALKV GRVGLAAMYGSGCWAS K PFG+PF+VGCC +G GE 
Sbjct  184   VCIDSNGHVASGASSGGIALKVDGRVGLAAMYGSGCWASVKDPFGSPFVVGCCATGVGEC  243

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             L++GFAARECCVS S+SQ+ P SAC K+LRS+   SS+   +   G+L++QA+  ++   
Sbjct  244   LIKGFAARECCVSSSLSQSGPVSACMKILRSLIHSSSQKSHDTGGGVLLLQADTVKI--A  301

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
              N   L+AVE+ AA+SS SFG+GYFGS M++PKVS+LR+   +  + V +FA RI   A
Sbjct  302   ENLSSLKAVEVVAAYSSSSFGVGYFGSFMDRPKVSVLRAAEPRDSSKVSQFATRINFDA  360



>ref|XP_008778613.1| PREDICTED: putative threonine aspartase isoform X3 [Phoenix dactylifera]
Length=412

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 171/333 (51%), Positives = 216/333 (65%), Gaps = 50/333 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAA LAKEQI GS+LLGRIPP+FLVGEGAR W KSKG+ LP T++E +E  
Sbjct  104   VRGVRNAIQIAAYLAKEQITGSSLLGRIPPLFLVGEGAREWGKSKGIILPATVSEMEE--  161

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK ML  A
Sbjct  162   ---------------------------------------WLVTERAKTQWVKYKAMLAYA  182

Query  788   KAVNDVSSTT------ANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGV  949
             K  ++ S+        +++V         L D +       QSS+++ + E+CI DT+GV
Sbjct  183   KGQSESSTALSTSASGSSAVPMVKPEGQSLIDGNKNKASSGQSSAKDNIKEDCIMDTVGV  242

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             IC+DS GH+A GASSGGIALKV GRVGLAAMYGSGCWASS+ PFGAPF+VGCC +GAGEY
Sbjct  243   ICIDSSGHVASGASSGGIALKVDGRVGLAAMYGSGCWASSRDPFGAPFVVGCCATGAGEY  302

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             L++ FAARECCVS S+SQ+ PASAC+K+L SV Q  ++   +  AG+L+VQA+   + AT
Sbjct  303   LIKEFAARECCVSSSLSQSGPASACTKILHSVVQNGNQKSRDTGAGVLLVQADT--LKAT  360

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
              + P L+AVE+ AA+ S SFGIG FG+SM+ PK
Sbjct  361   QSCP-LEAVELVAAYCSSSFGIGLFGNSMDCPK  392



>ref|XP_006653043.1| PREDICTED: putative threonine aspartase-like [Oryza brachyantha]
Length=446

 Score =   314 bits (805),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 171/359 (48%), Positives = 225/359 (63%), Gaps = 54/359 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQIA  LA+EQ+ GS+LLGRIPPMFLVGEGA  WAK+KG+ LPET +E +   
Sbjct  132   VQGVKNPIQIALHLAREQMIGSSLLGRIPPMFLVGEGAFQWAKAKGLNLPETTSEGN---  188

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  + LW KY+ +L  A
Sbjct  189   --------------------------------------SWLVTENAKALWTKYRSLLSSA  210

Query  788   KAVNDVSSTTANSVKTCAV------SEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGV  949
             K +   +++T +  ++C+V      SEA+        +   QS  ++  D++C+ DT+G 
Sbjct  211   KEL--ANNSTGSGSESCSVQLEASGSEAEDITGVKKMKMITQSIMED--DQDCVMDTVGA  266

Query  950   ICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEY  1129
             ICVDS G++A GASSGGIALKV GRVGLAAMYGSGCWA+SKGPFG PFIVGCC +GAGE+
Sbjct  267   ICVDSHGNIASGASSGGIALKVDGRVGLAAMYGSGCWAASKGPFGTPFIVGCCATGAGEH  326

Query  1130  LMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDAT  1309
             L+RGFAARECC+S S+ Q+ PASAC+KVLR V + SS+   +  AG+L+VQA+  +    
Sbjct  327   LIRGFAARECCISSSLIQSGPASACTKVLRQVVKSSSEMSHDTGAGLLLVQADVLK---R  383

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
             G  P L A E+ AA SS SFG+GY GS+M  PKV++LRS+       ++ FA R+   A
Sbjct  384   GKLPALGAAELVAAHSSPSFGVGYLGSNMNAPKVAMLRSSKTVPSGTINHFATRVNFDA  442



>ref|XP_009398533.1| PREDICTED: putative threonine aspartase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   312 bits (800),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/361 (47%), Positives = 221/361 (61%), Gaps = 52/361 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIA  LAKEQ  GS+LLGRIPPMFLVGEGAR W KSKG+ +P +I E D   
Sbjct  103   VRGVRNAIQIATCLAKEQTTGSSLLGRIPPMFLVGEGAREWGKSKGLTIPTSILEED---  159

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE+ ++ W KYK ML  A
Sbjct  160   --------------------------------------SWLVTEKAKSQWMKYKAMLADA  181

Query  788   KAVNDVSSTTAN-SVKTCAVSEAQLCDKS-------NGSRDGDQSSSQNALDENCISDTI  943
             K  ++ S      + +T ++      D+S       N   DG  S  +N   E+ + DT+
Sbjct  182   KKKSECSLEVPTLACRTASLPTDTEVDESQSSIVGQNKELDG-HSFMKNNDKEDFVMDTV  240

Query  944   GVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAG  1123
             G +C+DS GH+A GASSGGIALKV GRVGLAAMYGSGCWAS K PFG+PF+VGCC +G G
Sbjct  241   GAVCIDSNGHVASGASSGGIALKVDGRVGLAAMYGSGCWASVKDPFGSPFVVGCCATGVG  300

Query  1124  EYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMD  1303
             E L++GFAARECCVS S+SQ+ P SAC K+LRS+   SS+   +   G+L++QA+  ++ 
Sbjct  301   ECLIKGFAARECCVSSSLSQSGPVSACMKILRSLIHSSSQKSHDTGGGVLLLQADTVKI-  359

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLV  1483
                N   L+AVE+ AA+SS SFG+GYFGS M++PKVS+LR+   +  + V +FA RI   
Sbjct  360   -AENLSSLKAVEVVAAYSSSSFGVGYFGSFMDRPKVSVLRAAEPRDSSKVSQFATRINFD  418

Query  1484  A  1486
             A
Sbjct  419   A  419



>ref|XP_009111471.1| PREDICTED: putative threonine aspartase isoform X2 [Brassica 
rapa]
Length=394

 Score =   308 bits (788),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 207/322 (64%), Gaps = 55/322 (17%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
              LVGEGAR WA+SK   LPET+ EA+                                  
Sbjct  121   MLVGEGARRWAQSKDAILPETVTEAE----------------------------------  146

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGS  880
                    QWLVTER RN W+K+K ML   +A N++SS            E Q   + NG+
Sbjct  147   -------QWLVTERARNQWRKFKSMLSAVEAKNNISS-----------EERQRETEKNGT  188

Query  881   RDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCW  1060
              D        A+DE+ I DT+GVICVDSEG +ACG+SSGGIA+K+SGRVGLAA YGSGCW
Sbjct  189   FDERPLPCAAAVDEDKIMDTVGVICVDSEGRIACGSSSGGIAMKISGRVGLAATYGSGCW  248

Query  1061  ASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSV-NQES  1237
             AS KG FG P IVGCCVSGAGEYLMRGFAARECC SLS+SQA PASA  KVLRSV  QES
Sbjct  249   ASFKGLFGDPCIVGCCVSGAGEYLMRGFAARECCTSLSLSQAGPASAAMKVLRSVMQQES  308

Query  1238  SKYG-TEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVS  1414
             S+ G T+K+ GILVVQA+A  +   G+ P L AVEIAAA+SSLSFGIGY+G+S+ KPK+S
Sbjct  309   SERGDTDKTGGILVVQADAS-VSVPGDRPELNAVEIAAAYSSLSFGIGYYGNSIAKPKIS  367

Query  1415  ILRSTSKQSKTGVDEFAARIKL  1480
             ILR    +++ G+D F A I L
Sbjct  368   ILRKKRGENEAGIDHFEAGIDL  389



>gb|EMS62373.1| putative isoaspartyl peptidase/L-asparaginase 4 [Triticum urartu]
Length=394

 Score =   304 bits (778),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 162/354 (46%), Positives = 220/354 (62%), Gaps = 48/354 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQ+A  L KEQ+ G +LLGRIPPMFLVGEGA  WAK KG+ + +  +E +   
Sbjct  79    VQGVKNPIQVALHLTKEQMSGPSLLGRIPPMFLVGEGACQWAKCKGIDIIDATSEDN---  135

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY  +L  A
Sbjct  136   --------------------------------------NWLVTENAKAQWVKYSALLASA  157

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNAL--DENCISDTIGVICV  958
             K +VN  +++ + S+           +  N ++   +  S++ +  D++C+ DT+G +CV
Sbjct  158   KESVNRSTASASESISIQLDPSGAQAENLNNAKKIKKEFSRSIMEDDQDCVMDTVGAVCV  217

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D  G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PF++GCC +GAGE+L+R
Sbjct  218   DGYGNVASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFVIGCCATGAGEHLIR  277

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFA+RECC+S S+SQ+ PAS+C+KVLRSV Q SS+   +  AG+L+VQ++   +   G  
Sbjct  278   GFASRECCISASLSQSGPASSCTKVLRSVVQSSSEMSHDTGAGLLLVQSD---LTKRGEL  334

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             P L+AVE+ AA+SS SFGIGYFGS+M  PKVS+LR +   S + V  FA R+  
Sbjct  335   PLLEAVELVAAYSSPSFGIGYFGSNMNSPKVSMLRDSRAPSGS-VQHFATRVNF  387



>dbj|BAJ98979.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   299 bits (765),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 163/354 (46%), Positives = 220/354 (62%), Gaps = 48/354 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQ+A  LAKEQ+ GS+LLGRIPPMFLVGEGA  WAK KG+ + E  +E +   
Sbjct  75    VQGVKNPIQVALHLAKEQMSGSSLLGRIPPMFLVGEGACQWAKCKGIDIIEATSEDN---  131

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY  +L  A
Sbjct  132   --------------------------------------NWLVTENAKAQWVKYSALLASA  153

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNAL--DENCISDTIGVICV  958
             K +VN  +++ + S            +  N ++   +  S++ +  D++C+ DT+G +CV
Sbjct  154   KQSVNSSTASGSESSSIQLDPSGAQAENLNSAKKIKKEFSRSIMEDDQDCVMDTVGAVCV  213

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D  G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PF++GCC +GAGE+L+R
Sbjct  214   DEYGNVASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFVIGCCATGAGEHLIR  273

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNS  1318
             GFA+RECC+S S+SQ+ PAS+C+KVLRSV Q SS+   +  AG+L+VQ++  +    G S
Sbjct  274   GFASRECCISASLSQSGPASSCTKVLRSVVQSSSEMSHDTGAGLLLVQSDVTK---RGES  330

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
               L+A E+ AA+SS SFGIGYFGS+M  PKVS+LR +   S + +  FA R+  
Sbjct  331   TVLEAAELVAAYSSPSFGIGYFGSNMSSPKVSMLRDSRAPSGS-IQHFATRVNF  383



>gb|EEC78274.1| hypothetical protein OsI_17968 [Oryza sativa Indica Group]
Length=445

 Score =   296 bits (758),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 216/355 (61%), Gaps = 47/355 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQIA  LA+EQ+ G +LLGRIPPMFLVGEGA  WAKSKG+ LPE  +E +   
Sbjct  132   VQGVKNPIQIALHLAREQMVGPSLLGRIPPMFLVGEGACQWAKSKGLNLPEATSEGN---  188

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY+ +L  A
Sbjct  189   --------------------------------------SWLVTESAKAQWGKYRSLLASA  210

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQ-SSSQNALDENCISDTIGVICVD  961
             K +VN  + + + S      +     +   G +     + S    D++C+ DT+G +CVD
Sbjct  211   KESVNHSTGSGSESSSVQLEAPGAEAEDITGVKKMKMITQSIMEDDQDCVMDTVGAVCVD  270

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             + G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PFIVGCC +GAGE+L+RG
Sbjct  271   AYGNIASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFIVGCCATGAGEHLIRG  330

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSP  1321
             FAARECC+S S+ Q+ PASAC+KVLR   Q SS+   +  AG+L++QA+  +    G   
Sbjct  331   FAARECCISSSLIQSGPASACTKVLRQAVQSSSEMSHDTGAGLLLIQADVLK---RGEVS  387

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
              L A E+ AA+SS SFG+GY GS+M  PKV++LRS SK +   ++ FA R+   A
Sbjct  388   ALGAAELVAAYSSPSFGVGYLGSNMNSPKVAMLRS-SKAAPNTINHFATRVNFDA  441



>ref|XP_003579495.1| PREDICTED: putative threonine aspartase [Brachypodium distachyon]
Length=442

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 221/355 (62%), Gaps = 50/355 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N I +A  LAKEQ+ GS+LLGRIPPMFLVGEGA  WAKSKG+ +    +E +   
Sbjct  127   VQGVKNPIDVALHLAKEQMIGSSLLGRIPPMFLVGEGACQWAKSKGINVLGATSEEN---  183

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WL+TE ++  W KY  +L  A
Sbjct  184   --------------------------------------NWLMTENSKAQWVKYSSLLASA  205

Query  788   KAV--NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNAL--DENCISDTIGVIC  955
             K +  +   S + +S     VS  Q  +  N  +   ++ +++ +  D++C+ DT+G +C
Sbjct  206   KELVNHPTGSASESSSVQLEVSGTQPENLDN-VKKMKKTFTRSIMEDDQDCVMDTVGAVC  264

Query  956   VDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLM  1135
             VD  G++A GASSGGIALKV GRVGL+AMYGSGCWASSKGPFG PFI+GCC +GAGE+L+
Sbjct  265   VDDLGNVASGASSGGIALKVDGRVGLSAMYGSGCWASSKGPFGTPFIIGCCATGAGEHLI  324

Query  1136  RGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGN  1315
             RGFA+RECC+S S+SQ+ PAS+C+KVLRS  Q SS+   +  AG+L+VQA+  +    G+
Sbjct  325   RGFASRECCISASLSQSGPASSCTKVLRSAVQSSSEMSHDTGAGLLLVQADVLK---RGD  381

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
              P L + E+ AA+SS SFGIGYFGS+M  PKVS+LR  S+ S + +  FA R+  
Sbjct  382   LPVLDSAELIAAYSSQSFGIGYFGSNMNNPKVSMLRD-SRTSSSSIQHFATRVNF  435



>gb|EEE61927.1| hypothetical protein OsJ_16668 [Oryza sativa Japonica Group]
Length=445

 Score =   296 bits (757),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 165/355 (46%), Positives = 216/355 (61%), Gaps = 47/355 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQIA  LA+EQ+ G +LLGRIPPMFLVGEGA  WAKSKG+ LPE  +E +   
Sbjct  132   VQGVKNPIQIALHLAREQMVGPSLLGRIPPMFLVGEGACQWAKSKGLNLPEATSEGN---  188

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY+ +L  A
Sbjct  189   --------------------------------------SWLVTESAKAQWGKYRSLLASA  210

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQ-SSSQNALDENCISDTIGVICVD  961
             K +VN  + + + S      +     +   G +     + S    D++C+ DT+G +CVD
Sbjct  211   KESVNHSTGSGSESSSVQLEAPGAEAEDITGVKKMKMITRSIMEDDQDCVMDTVGAVCVD  270

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             + G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PFIVGCC +GAGE+L+RG
Sbjct  271   AYGNIASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFIVGCCATGAGEHLIRG  330

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSP  1321
             FAARECC+S S+ Q+ PASAC+KVLR   Q SS+   +  AG+L++QA+  +    G   
Sbjct  331   FAARECCISSSLIQSGPASACTKVLRQAVQSSSEMSHDTGAGLLLIQADVLK---RGEVS  387

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
              L A E+ AA+SS SFG+GY GS+M  PKV++LRS SK +   ++ FA R+   A
Sbjct  388   ALGAAELVAAYSSPSFGVGYLGSNMNSPKVAMLRS-SKAAPNTINHFATRVNFDA  441



>emb|CAE03435.2| OSJNBa0032F06.18 [Oryza sativa Japonica Group]
Length=446

 Score =   293 bits (749),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 215/355 (61%), Gaps = 46/355 (13%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQIA  LA+EQ+ G +LLGRIPP+FLVGEGA  WAKSKG+ LPE  +E +   
Sbjct  132   VQGVKNPIQIALHLAREQMVGPSLLGRIPPIFLVGEGACQWAKSKGLNLPEATSEGN---  188

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY+ +L  A
Sbjct  189   --------------------------------------SWLVTESAKAQWGKYRSLLASA  210

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQ-SSSQNALDENCISDTIGVICVD  961
             K +VN  + + + S      +     +   G +     + S    D++C+ DT+G +CVD
Sbjct  211   KESVNHSTGSGSESSSVQLEAPGAEAEDITGVKKMKMITRSIMEDDQDCVMDTVGAVCVD  270

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             + G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PFIVGCC +GAGE+L+RG
Sbjct  271   AYGNIASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFIVGCCATGAGEHLIRG  330

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSP  1321
             FAARECC+S S+ Q+ PASAC+KVLR   Q SS+   +  AG+L++QA+   ++      
Sbjct  331   FAARECCISSSLIQSGPASACTKVLRQAVQSSSEMSHDTGAGLLLIQADV--LNVRREVS  388

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
              L A E+ AA+SS SFG+GY GS M  PKV++LRS SK +   ++ FA R+   A
Sbjct  389   ALGAAELVAAYSSPSFGVGYLGSYMNSPKVAMLRS-SKAAPNTINHFATRVNFDA  442



>ref|XP_010107612.1| putative isoaspartyl peptidase/L-asparaginase 4 [Morus notabilis]
 gb|EXC16351.1| putative isoaspartyl peptidase/L-asparaginase 4 [Morus notabilis]
Length=354

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 159/291 (55%), Positives = 189/291 (65%), Gaps = 51/291 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+NAIQIAALL KEQ+ GS+LLG IPPMFLVGEGA  WAKSKG+++  T  EA+E  
Sbjct  105   VPGVKNAIQIAALLVKEQMMGSSLLGLIPPMFLVGEGACEWAKSKGISVLATAKEANE--  162

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  WKKYK M+  A
Sbjct  163   ---------------------------------------WLVTERAKAQWKKYKAMVSDA  183

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQ--SSSQNALDENCISDTIGVICVD  961
             KA  + SS           ++ +        ++G     S ++  +E+ I DT+GVICVD
Sbjct  184   KAKMENSSIEHQCSPQGTAAKLE--------KEGQPFYPSKRDVPEEDSIMDTVGVICVD  235

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             +EGH+A GASSGGIALKV GRVGLAA YGSGCWASSKGPFGAPF+VGCCVSGAGEYLM+G
Sbjct  236   TEGHIASGASSGGIALKVRGRVGLAATYGSGCWASSKGPFGAPFVVGCCVSGAGEYLMKG  295

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAP  1294
             FAARECCVS SISQ  PASAC+KVLRS  Q+S   GT+KSAGIL+VQA+ P
Sbjct  296   FAARECCVSSSISQVGPASACNKVLRSFVQDSDHNGTDKSAGILLVQADTP  346



>ref|NP_001054297.1| Os04g0682500 [Oryza sativa Japonica Group]
 dbj|BAF16211.1| Os04g0682500 [Oryza sativa Japonica Group]
Length=445

 Score =   291 bits (745),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 216/356 (61%), Gaps = 49/356 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQIA  LA+EQ+ G +LLGRIPP+FLVGEGA  WAKSKG+ LPE  +E +   
Sbjct  132   VQGVKNPIQIALHLAREQMVGPSLLGRIPPIFLVGEGACQWAKSKGLNLPEATSEGN---  188

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY+ +L  A
Sbjct  189   --------------------------------------SWLVTESAKAQWGKYRSLLASA  210

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQ-SSSQNALDENCISDTIGVICVD  961
             K +VN  + + + S      +     +   G +     + S    D++C+ DT+G +CVD
Sbjct  211   KESVNHSTGSGSESSSVQLEAPGAEAEDITGVKKMKMITRSIMEDDQDCVMDTVGAVCVD  270

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             + G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PFIVGCC +GAGE+L+RG
Sbjct  271   AYGNIASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFIVGCCATGAGEHLIRG  330

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEA-PRMDATGNS  1318
             FAARECC+S S+ Q+ PASAC+KVLR   Q SS+   +  AG+L++QA+   R + +   
Sbjct  331   FAARECCISSSLIQSGPASACTKVLRQAVQSSSEMSHDTGAGLLLIQADVLNRREVSA--  388

Query  1319  PFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA  1486
               L A E+ AA+SS SFG+GY GS M  PKV++LRS SK +   ++ FA R+   A
Sbjct  389   --LGAAELVAAYSSPSFGVGYLGSYMNSPKVAMLRS-SKAAPNTINHFATRVNFDA  441



>gb|KEH18921.1| isoaspartyl peptidase/L-asparaginase [Medicago truncatula]
Length=353

 Score =   286 bits (733),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 159/288 (55%), Positives = 191/288 (66%), Gaps = 61/288 (21%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ  GS LLGRIPP+FLVGEGAR WAKSK + LP +IAEA+E  
Sbjct  113   VPGVRNAIQIAALLAKEQTMGSPLLGRIPPIFLVGEGAREWAKSKDIGLPPSIAEANE--  170

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WL+TER +  W KYK M + A
Sbjct  171   ---------------------------------------WLITERAKTQWIKYKSMFEAA  191

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQ-NALDENCISDTIGVICVDS  964
             +      S T NS+             SNG+    QS+   +   E+ + DT+GVICVD+
Sbjct  192   R------SKTVNSL-------------SNGNSSPCQSTEMPDYALEDQVMDTVGVICVDN  232

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ GCCVSGAGE LM+GF
Sbjct  233   EGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFMAGCCVSGAGENLMKGF  292

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAE  1288
             AAREC VS+S+SQ+  ASAC+KVLRSV+++SS+ GT+ SAGILVVQ++
Sbjct  293   AARECIVSISLSQSGAASACTKVLRSVSEDSSRCGTDSSAGILVVQSD  340



>ref|NP_001140382.1| uncharacterized protein LOC100272436 [Zea mays]
 gb|ACF83709.1| unknown [Zea mays]
Length=434

 Score =   287 bits (734),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 218/350 (62%), Gaps = 48/350 (14%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFPF  616
             V+N IQ+A  LAKEQ+ G +LLGRIPPMFLVGEGA  WAKSKG+ L E+ +EA+      
Sbjct  124   VKNPIQVALHLAKEQMAGPSLLGRIPPMFLVGEGAYQWAKSKGMDLVESTSEAN------  177

Query  617   PVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKAV  796
                                                 WLVTE  R  W KY  +L   K  
Sbjct  178   -----------------------------------SWLVTENARAQWVKYTSLLVNTKK-  201

Query  797   NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENC--ISDTIGVICVDSEG  970
             +   ST + S       EAQ  +  N + D     +++ + +N   I+DT+GVICVDS G
Sbjct  202   SLYHSTGSGSEHHSVQLEAQGTESENIA-DAKNIFTESFMGDNTDHITDTVGVICVDSYG  260

Query  971   HMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAA  1150
             ++A GASSGGIALKV GRVGLAAM+GSGCWASSKGPFG PF+V CC +GAGE+L+RGFAA
Sbjct  261   NVASGASSGGIALKVDGRVGLAAMFGSGCWASSKGPFGTPFVVACCATGAGEHLIRGFAA  320

Query  1151  RECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQ  1330
             RE C+S S+SQ+ PASAC+KVLRSV Q SSK   +  AG+L+VQA+  +    G+   L+
Sbjct  321   RESCISSSLSQSGPASACTKVLRSVVQSSSKMSHDTGAGLLLVQADVVK---GGDLSELE  377

Query  1331  AVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             A E+ AA+SS SFG+GYFGS+M  PKV +L++     KT V++FA  +K 
Sbjct  378   AAELVAAYSSPSFGVGYFGSNMNNPKVVVLKAPEGPCKTTVNQFATCVKF  427



>ref|XP_010940444.1| PREDICTED: putative threonine aspartase isoform X3 [Elaeis guineensis]
 ref|XP_010940446.1| PREDICTED: putative threonine aspartase isoform X3 [Elaeis guineensis]
 ref|XP_010940447.1| PREDICTED: putative threonine aspartase isoform X3 [Elaeis guineensis]
Length=350

 Score =   280 bits (716),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 203/328 (62%), Gaps = 52/328 (16%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
             FLVGEGAR W KSKG+ +P T++E +E                                 
Sbjct  61    FLVGEGAREWGKSKGIIMPATVSEIEE---------------------------------  87

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKA--------VNDVSSTTANSVKTCAVSEAQ  856
                     WLVTER +  W KYK ML  AK             S ++A S++  A+   +
Sbjct  88    --------WLVTERAKTQWMKYKAMLADAKGWSESSTAQTTSTSGSSAVSLEKPAIEAQR  139

Query  857   LCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLA  1036
             L           Q S+++ + E+CI DT+GVIC+DS G +A GASSGGIALKV GRVGLA
Sbjct  140   LIGGKKNKASHGQPSAKDDIKEDCIMDTVGVICIDSSGRVASGASSGGIALKVDGRVGLA  199

Query  1037  AMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVL  1216
             AMYGSGCWASS+ P+GAPFIVGCC +GAGEYL++GFAARECCVS S+SQ+ PASAC+K+L
Sbjct  200   AMYGSGCWASSRDPYGAPFIVGCCATGAGEYLIKGFAARECCVSSSLSQSGPASACTKLL  259

Query  1217  RSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSM  1396
             RSV Q S++   +  AG+L+VQA+   +  T +SP  +AVE+ AA+ S SFGIGYFG+SM
Sbjct  260   RSVVQNSNQKSHDTGAGVLLVQADT--LKVTQSSP-PEAVELVAAYCSSSFGIGYFGNSM  316

Query  1397  EKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             + PKVSILR    ++   ++ F AR+ L
Sbjct  317   DCPKVSILRGAGYRNSNDINHFGARVVL  344



>ref|XP_010940448.1| PREDICTED: putative threonine aspartase isoform X4 [Elaeis guineensis]
 ref|XP_010940449.1| PREDICTED: putative threonine aspartase isoform X4 [Elaeis guineensis]
Length=346

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 203/328 (62%), Gaps = 52/328 (16%)
 Frame = +2

Query  521   FLVGEGARAWAKSKGVALPETIAEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKI  700
             FLVGEGAR W KSKG+ +P T++E +E                                 
Sbjct  57    FLVGEGAREWGKSKGIIMPATVSEIEE---------------------------------  83

Query  701   IFLLLVRQWLVTERTRNLWKKYKGMLDGAKA--------VNDVSSTTANSVKTCAVSEAQ  856
                     WLVTER +  W KYK ML  AK             S ++A S++  A+   +
Sbjct  84    --------WLVTERAKTQWMKYKAMLADAKGWSESSTAQTTSTSGSSAVSLEKPAIEAQR  135

Query  857   LCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLA  1036
             L           Q S+++ + E+CI DT+GVIC+DS G +A GASSGGIALKV GRVGLA
Sbjct  136   LIGGKKNKASHGQPSAKDDIKEDCIMDTVGVICIDSSGRVASGASSGGIALKVDGRVGLA  195

Query  1037  AMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVL  1216
             AMYGSGCWASS+ P+GAPFIVGCC +GAGEYL++GFAARECCVS S+SQ+ PASAC+K+L
Sbjct  196   AMYGSGCWASSRDPYGAPFIVGCCATGAGEYLIKGFAARECCVSSSLSQSGPASACTKLL  255

Query  1217  RSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSM  1396
             RSV Q S++   +  AG+L+VQA+   +  T +SP  +AVE+ AA+ S SFGIGYFG+SM
Sbjct  256   RSVVQNSNQKSHDTGAGVLLVQADT--LKVTQSSP-PEAVELVAAYCSSSFGIGYFGNSM  312

Query  1397  EKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             + PKVSILR    ++   ++ F AR+ L
Sbjct  313   DCPKVSILRGAGYRNSNDINHFGARVVL  340



>gb|EPS62871.1| hypothetical protein M569_11915, partial [Genlisea aurea]
Length=380

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/356 (45%), Positives = 207/356 (58%), Gaps = 81/356 (23%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G+RN I+IA  L KEQ+  S+LLGRI PMFLVGEGA  WA SKG+             
Sbjct  101   VPGIRNPIRIAVSLVKEQMLSSSLLGRIKPMFLVGEGAHHWAMSKGIG------------  148

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QWLVTER ++ W++YK ML+ A
Sbjct  149   --------------------------------------QWLVTERAKHQWERYKTMLEYA  170

Query  788   KAVNDVSSTTANSV-KTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             + + D +        +   V+E +             SS    ++++ + DT+GVIC+DS
Sbjct  171   EGITDGAEAEEKRFNEVVPVAEVE-------------SSFSEMVEDDSVMDTVGVICIDS  217

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EGH+A GASSGGIA KVSGRVGLAAMYGSGCWAS+KG      IVGCCVSGAGEYLM+GF
Sbjct  218   EGHIASGASSGGIAFKVSGRVGLAAMYGSGCWASTKGR-----IVGCCVSGAGEYLMKGF  272

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPF  1324
             AARECC+   +S++ P SACS+VLR+   +  + G EKS G+L+V+AE      T  +  
Sbjct  273   AARECCL---LSRSDPVSACSEVLRNF-LDDEEGGAEKSGGVLMVEAETD----TPEAKL  324

Query  1325  LQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR----STSKQSKTGVDEFAARIKL  1480
             + AVE+AAA++S SFGIG+FG  M++PKVSILR     +S    T V EFA R+  
Sbjct  325   MNAVEVAAAYTSSSFGIGFFGRGMDRPKVSILRKKKNQSSSSKDTTVREFATRVSF  380



>gb|AFK34185.1| unknown [Medicago truncatula]
Length=219

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  920   ENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIV  1099
             E+ + DT+GVICVD+EG++A GASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPF+ 
Sbjct  32    EDQVMDTVGVICVDNEGNVASGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFVA  91

Query  1100  GCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVV  1279
             GCCVSGAGE LM+GFAAREC VS+S+SQ+  ASAC+KVLRSV+++SS+ GT+ SAGILVV
Sbjct  92    GCCVSGAGENLMKGFAARECIVSISLSQSGAASACTKVLRSVSEDSSRCGTDSSAGILVV  151

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDE  1459
             Q++   +   G S  L AVEI AA++SLSFG+GY+GSSME+PKV ILRST +QS+T +D+
Sbjct  152   QSDTS-IVGQGKSR-LTAVEIVAAYTSLSFGVGYYGSSMERPKVLILRSTKQQSRTAIDQ  209

Query  1460  FAARIKL  1480
             F ARI L
Sbjct  210   FGARIDL  216



>gb|EMT04749.1| Putative isoaspartyl peptidase/L-asparaginase 4 [Aegilops tauschii]
Length=316

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 176/256 (69%), Gaps = 7/256 (3%)
 Frame = +2

Query  722   QWLVTERTRNLWKKYKGMLDGAKA-VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQS  898
              WLVTE  +  W KY  +L  AK  VN  +++ + S            D  N ++   + 
Sbjct  58    HWLVTENAKAQWVKYSALLASAKELVNRSTASASESSSLQLDPSGAQADNLNNAKKIKKE  117

Query  899   SSQNAL--DENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK  1072
              S++ +  D++C+ DT+G +CVD  G++A GASSGGIALKV GRVGLAAMYGSGCWASSK
Sbjct  118   FSRSIMEDDQDCVMDTVGAVCVDEYGNVASGASSGGIALKVDGRVGLAAMYGSGCWASSK  177

Query  1073  GPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGT  1252
             GPFG PF++GCC +GAGE+L+RGFA+RECC+S S+SQ+ PAS+C+KVLRSV Q SS+   
Sbjct  178   GPFGTPFVIGCCATGAGEHLIRGFASRECCISASLSQSGPASSCTKVLRSVVQSSSEMSH  237

Query  1253  EKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTS  1432
             +  AG+L+VQ++   +   G SP L+AVE+ AA+SS SFGIGY GS+M  PKVS+LR + 
Sbjct  238   DTGAGLLLVQSD---LTKRGESPLLEAVELVAAYSSPSFGIGYLGSNMNSPKVSMLRDSR  294

Query  1433  KQSKTGVDEFAARIKL  1480
               S + V  FA R+  
Sbjct  295   APSGS-VQHFATRVNF  309



>ref|XP_007200674.1| hypothetical protein PRUPE_ppa015895mg [Prunus persica]
 gb|EMJ01873.1| hypothetical protein PRUPE_ppa015895mg [Prunus persica]
Length=219

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = +2

Query  920   ENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIV  1099
             E+CI DT+GVICVD+EG +  GA SGGIALKVSGRVGLAAM+GSGCWASSKG F AP IV
Sbjct  55    EDCIMDTVGVICVDTEGQIPSGALSGGIALKVSGRVGLAAMHGSGCWASSKGFFVAPCIV  114

Query  1100  GCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVV  1279
             GCCVSGAGEYLM+GFAARECCVSLS+SQA PASAC KVLRSV QES+   T++SAGIL+V
Sbjct  115   GCCVSGAGEYLMKGFAARECCVSLSLSQAGPASACMKVLRSVVQESNHNCTDRSAGILLV  174

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSI  1417
             QA+ P    +G+SP L+A+EIAAAFSSLSFG+GYFGSSME+PKV I
Sbjct  175   QADDP-TTVSGSSPKLKAIEIAAAFSSLSFGVGYFGSSMERPKVII  219



>ref|XP_009787750.1| PREDICTED: putative threonine aspartase isoform X2 [Nicotiana 
sylvestris]
Length=220

 Score =   247 bits (630),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 149/193 (77%), Gaps = 8/193 (4%)
 Frame = +2

Query  725   WLVTERTRNLWKKYKGMLDGAKAVNDVSSTTANSVK-TCAVSEAQLCDKSNGSRDGDQSS  901
             WLVT +    WK+YK ML  AK  ND        +K T A+SE Q CD+  G+  GD   
Sbjct  18    WLVTGKASTQWKRYKAMLHDAKVGNDALDLKMTHLKETNAISEGQPCDQLWGNGVGD---  74

Query  902   SQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPF  1081
                ALDE+ ISDT+GVIC+DSEGH+ACGASSGGIALKVSGRVGLAAMYGSGCWASS GPF
Sbjct  75    ---ALDEDLISDTVGVICLDSEGHIACGASSGGIALKVSGRVGLAAMYGSGCWASSIGPF  131

Query  1082  GAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS  1261
             GAPFIVGCCVSGAGE+LM+GFAARECC+S S+SQA P+SAC KVLR+V QE+S+ G E S
Sbjct  132   GAPFIVGCCVSGAGEHLMKGFAARECCISSSLSQAGPSSACKKVLRTV-QENSQCGAESS  190

Query  1262  AGILVVQAEAPRM  1300
             AG L+VQAE  R+
Sbjct  191   AGFLLVQAEPSRL  203



>emb|CAN66192.1| hypothetical protein VITISV_029199 [Vitis vinifera]
Length=152

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +2

Query  1040  MYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLR  1219
             MYGSGCWASSKGPFGAPFIVGCC +GAGE LMRGFAARECCVS S+SQA PASAC+KVLR
Sbjct  1     MYGSGCWASSKGPFGAPFIVGCCATGAGESLMRGFAARECCVSSSLSQAGPASACTKVLR  60

Query  1220  SVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSME  1399
             SV Q SS++GT+KSAGIL+VQA+AP + A  NSP L+A+EIAA++SSLSFGIGYFGSSME
Sbjct  61    SVVQNSSQHGTDKSAGILLVQADAP-ITAPQNSPKLKAIEIAASYSSLSFGIGYFGSSME  119

Query  1400  KPKVSILRSTSKQSKTGVDEFAARIKLVA*K  1492
             +PKVSILRST +QS+TG+D F ARI + A K
Sbjct  120   RPKVSILRSTKQQSRTGMDHFEARIDVSAXK  150



>ref|XP_007133210.1| hypothetical protein PHAVU_011G160800g [Phaseolus vulgaris]
 gb|ESW05204.1| hypothetical protein PHAVU_011G160800g [Phaseolus vulgaris]
Length=337

 Score =   240 bits (612),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 159/251 (63%), Gaps = 62/251 (25%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAIQIAALLAKEQ+  S LLGRIPP+FLVGEGAR WAKSK + LP +I EA+E  
Sbjct  98    VPGVRNAIQIAALLAKEQMMRSPLLGRIPPIFLVGEGARKWAKSKDITLPTSIEEANE--  155

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTER +  W KYK M++ A
Sbjct  156   ---------------------------------------WLVTERAKAQWMKYKSMVETA  176

Query  788   KAVNDVSSTTANSV-KTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             ++  D +    +SV ++  + ++ L D+                    + DT+GVIC+D+
Sbjct  177   RSKADNTPEVDSSVCQSTTIPDSALEDR--------------------VMDTVGVICIDN  216

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EGH+A GASSGGIALKVSGRVGLAA+YG+GCWASSKGPFG+PF+ GCCVSGAGEYLM+GF
Sbjct  217   EGHVASGASSGGIALKVSGRVGLAAVYGAGCWASSKGPFGSPFMAGCCVSGAGEYLMKGF  276

Query  1145  AARECCVSLSI  1177
             AARECCVSLS+
Sbjct  277   AARECCVSLSL  287



>dbj|BAK06563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   243 bits (619),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 132/294 (45%), Positives = 181/294 (62%), Gaps = 44/294 (15%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N IQ+A  LAKEQ+ GS+LLGRIPPMFLVGEGA  WAK KG+ + E  +E +   
Sbjct  114   VQGVKNPIQVALHLAKEQMSGSSLLGRIPPMFLVGEGACQWAKCKGIDIIEATSEDN---  170

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                    WLVTE  +  W KY  +L  A
Sbjct  171   --------------------------------------NWLVTENAKAQWVKYSALLASA  192

Query  788   K-AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNAL--DENCISDTIGVICV  958
             K +VN  +++ + S            +  N ++   +  S++ +  D++C+ DT+G +CV
Sbjct  193   KQSVNSSTASGSESSSIQLDPSGAQAENLNSAKKIKKEFSRSIMEDDQDCVMDTVGAVCV  252

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D  G++A GASSGGIALKV GRVGLAAMYGSGCWASSKGPFG PF++GCC +GAG +L+R
Sbjct  253   DEYGNVASGASSGGIALKVDGRVGLAAMYGSGCWASSKGPFGTPFVIGCCATGAGGHLIR  312

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRM  1300
             GFA+RECC+S S+SQ+ PAS+C+KVLRSV Q SS+   +  AG+L+ Q++  ++
Sbjct  313   GFASRECCISASLSQSGPASSCTKVLRSVVQSSSEMSHDTGAGLLLAQSDVTKV  366



>gb|AFW59942.1| LOW QUALITY PROTEIN: L-asparaginase family protein, partial [Zea 
mays]
Length=396

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/282 (50%), Positives = 174/282 (62%), Gaps = 45/282 (16%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFPF  616
             V+N IQ+A  LAKEQ+ G +LLGRIPPMFLVGEGA  WAKSKG+ L E+ +EA+      
Sbjct  150   VKNPIQVALHLAKEQMAGPSLLGRIPPMFLVGEGAYQWAKSKGMDLVESTSEAN------  203

Query  617   PVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKAV  796
                                                 WLVTE  R  W KY  +L   K  
Sbjct  204   -----------------------------------SWLVTENARAQWVKYTSLLVNTKK-  227

Query  797   NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENC--ISDTIGVICVDSEG  970
             +   ST + S       EAQ  +  N + D     +++ + +N   I+DT+GVICVDS G
Sbjct  228   SLYHSTGSGSEHHSVQLEAQGTESENIA-DAKNIFTESFMGDNTDHITDTVGVICVDSYG  286

Query  971   HMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAA  1150
             ++A GASSGGIALKV GRVGLAAM+GSGCWASSKGPFG PF+V CC +GAGE+L+RGFAA
Sbjct  287   NVASGASSGGIALKVDGRVGLAAMFGSGCWASSKGPFGTPFVVACCATGAGEHLIRGFAA  346

Query  1151  RECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILV  1276
             RE C+S S+SQ+ PASAC+KVLRSV Q SSK   +  AG+LV
Sbjct  347   RESCISSSLSQSGPASACTKVLRSVVQSSSKMSHDTGAGLLV  388



>ref|XP_001761847.1| predicted protein [Physcomitrella patens]
 gb|EDQ73288.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 167/328 (51%), Gaps = 73/328 (22%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GVRNAI +A  LAKE   G+  LGR PP+FLVG+GAR WA   G+A      E     
Sbjct  109   VPGVRNAIDVAMQLAKESRKGTLPLGRTPPVFLVGDGAREWAIRHGLADESVSGE-----  163

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                 +  WL+T++    WKKYK  L   
Sbjct  164   ------------------------------------IENWLITKKAHEQWKKYKQCL---  184

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                    + T  + +  ++S+A L          D+ S      E+ + DT+G +CVD E
Sbjct  185   -------AMTIPTAERDSMSDAHLIGVE------DEKSR-----EDVVLDTVGAVCVDRE  226

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A GASSGGIA+KV GRVGLAA YGSGCWA+ K  FG    VGC VSGAGE LMRG A
Sbjct  227   GNIAAGASSGGIAMKVKGRVGLAATYGSGCWATPKEIFGTS--VGCTVSGAGEQLMRGLA  284

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             A  C    +  Q  P  AC   LRSV ++   +G +  AG+L +Q+         N    
Sbjct  285   AYRCSALATTLQEGPGHACETTLRSVIEKGHAFGGKDDAGVLFLQS---------NCDST  335

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             Q VE+ A FSS SFGIGY+GSSM KPKV
Sbjct  336   QTVELVAVFSSSSFGIGYYGSSMNKPKV  363



>ref|XP_008339972.1| PREDICTED: putative threonine aspartase [Malus domestica]
Length=147

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +2

Query  1040  MYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLR  1219
             M+G+GCW SSKG FGAP IVGCC SGAGE+LM+GFAARE CVSLS+SQ  PASAC+KVL 
Sbjct  1     MHGAGCWGSSKGLFGAPCIVGCCASGAGEHLMKGFAAREPCVSLSLSQEGPASACTKVLC  60

Query  1220  SVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSME  1399
             SV QES+   T++SAGIL+VQA+AP M  TG SP L+AVEI AA++SLSFGIGYFGSSME
Sbjct  61    SVVQESNHDCTDRSAGILLVQADAPIM-VTGRSPKLKAVEIGAAYTSLSFGIGYFGSSME  119

Query  1400  KPKV  1411
             +PKV
Sbjct  120   RPKV  123



>ref|XP_002961514.1| hypothetical protein SELMODRAFT_75939, partial [Selaginella moellendorffii]
 gb|EFJ36774.1| hypothetical protein SELMODRAFT_75939, partial [Selaginella moellendorffii]
Length=365

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 126/336 (38%), Positives = 166/336 (49%), Gaps = 82/336 (24%)
 Frame = +2

Query  431   SGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLF  610
             SGV N I++AALLAKE   GS+ LG IPP+F+VG+GAR WAK  G+   E+   A     
Sbjct  103   SGVSNPIEVAALLAKESTHGSSSLGLIPPIFIVGDGARQWAKEHGIETMESPEHA-----  157

Query  611   PFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAK  790
                                                    LVT R++  W KYK M+    
Sbjct  158   ---------------------------------------LVTNRSKEQWLKYKNMM----  174

Query  791   AVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEG  970
                 + S+  N        E      SN SR            E+ I DT+G +CVD +G
Sbjct  175   --TSMDSSFPNFFSYLEQPE------SNLSR------------EDVIQDTVGAVCVDDKG  214

Query  971   HMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAA  1150
             +++ G SSGGIA+K  GRVGLAA+YG GCWA+S         VGC  SGAGE L++   A
Sbjct  215   NISAGVSSGGIAMKAKGRVGLAAVYGCGCWATSN----LSSSVGCSTSGAGERLIKSLLA  270

Query  1151  RECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQA-EAPRMDATGNSPF-  1324
             RECC S+  S A P S CS +L  +NQ       ++ AGIL++Q+ ++   D  G     
Sbjct  271   RECCHSVWESDAGPVSVCSDILLKLNQ-GHLASQKQDAGILLLQSFKSFVSDICGLKSIM  329

Query  1325  -------LQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
                    L+ VE  AA ++ SFGIGYF + ME+PKV
Sbjct  330   IVFQPNRLEGVEFLAAHTAPSFGIGYFANFMERPKV  365



>ref|XP_008663714.1| PREDICTED: putative threonine aspartase [Zea mays]
Length=118

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = +2

Query  929   ISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCC  1108
             I+DT+GVICVDS G++A GASSGGIALKV GRVGLAAM+GSGCWASSKGPFG PF+V CC
Sbjct  8     ITDTVGVICVDSYGNVASGASSGGIALKVDGRVGLAAMFGSGCWASSKGPFGTPFVVACC  67

Query  1109  VSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSK  1243
              +GAGE+L+RGFAARE C+S S+SQ+ PASAC+KVL SV Q SS 
Sbjct  68    ATGAGEHLIRGFAARESCISSSLSQSGPASACTKVLCSVVQSSSN  112



>ref|XP_010457009.1| PREDICTED: LOW QUALITY PROTEIN: putative threonine aspartase, 
partial [Camelina sativa]
Length=127

 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = +2

Query  1004  ALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQ  1183
             A ++ G V LAA YGS CWASSKGPFG PF VGC   GA EYLMR FAARECC SL+ SQ
Sbjct  3     AFQICGHVSLAATYGSACWASSKGPFGVPFRVGC-XCGAEEYLMRXFAARECCTSLARSQ  61

Query  1184  AAPASACSKVLRSV-NQESSKYGT-EKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFS  1357
             A PASA  KVLRSV  QE +K GT +K+AG LV+QA+A  +   G+ P L AVEI AA+S
Sbjct  62    AGPASAAVKVLRSVMQQEGTKSGTADKTAGSLVLQADA-SVAVPGDRPELNAVEIGAAYS  120

Query  1358  SL  1363
             S+
Sbjct  121   SV  122



>ref|XP_002447343.1| hypothetical protein SORBIDRAFT_06g033300 [Sorghum bicolor]
 gb|EES11671.1| hypothetical protein SORBIDRAFT_06g033300 [Sorghum bicolor]
Length=355

 Score =   119 bits (299),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 80/202 (40%), Positives = 107/202 (53%), Gaps = 50/202 (25%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFPF  616
             V+N I++A  LAKEQ+ GS+LLGRIPPMFLVGEGA  WAKSKG+ L E+   A+      
Sbjct  124   VKNPIKVALHLAKEQMAGSSLLGRIPPMFLVGEGAYQWAKSKGMDLVESAPGAN------  177

Query  617   PVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKAV  796
                                                 WLVTE  R  W KY  +L   K +
Sbjct  178   -----------------------------------NWLVTENARAQWVKYTSLLVNTKKL  202

Query  797   --NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDEN--CISDTIGVICVDS  964
               +D  S + +SV+     EA   +  N S D  +  +++ +++N  C+ DT+GVICVDS
Sbjct  203   LEHDTGSASEHSVQL----EAPGTESENIS-DVKKILTESFMEDNTDCVMDTVGVICVDS  257

Query  965   EGHMACGASSGGIALKVSGRVG  1030
              G++A GASSGGIALK+S   G
Sbjct  258   YGNVASGASSGGIALKMSHDTG  279


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 4/80 (5%)
 Frame = +2

Query  1241  KYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSIL  1420
             K   +  AG+L+VQA+  +    G+   L+A E+ AA+SS SFG+GYFGS+M  PKV +L
Sbjct  273   KMSHDTGAGLLLVQADVRK---GGDLSELEAAELVAAYSSPSFGVGYFGSNMNNPKVLML  329

Query  1421  RSTSKQSKTGVDEFAARIKL  1480
             ++    SKT V++FA  +K 
Sbjct  330   KTPEGPSKT-VNQFATCVKF  348



>emb|CAJ86297.1| H0124B04.14 [Oryza sativa Indica Group]
Length=355

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 127/266 (48%), Gaps = 59/266 (22%)
 Frame = +2

Query  701   IFLLLVRQ--WLVTERTRNLWKKYKGMLDGAK-AVNDVSSTTANSVKTCAVSEAQLCDKS  871
             I L L R+  WLVTE  +  W KY+ +L  AK +VN  + + + S      +     +  
Sbjct  141   IALHLAREQMWLVTESAKAQWGKYRSLLASAKESVNHSTGSGSESSSVQLEAPGAEAEDI  200

Query  872   NGSRDGDQ-SSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
              G +     + S    D++C+ DT+G +CVD+ G++A GASSGGIALKV           
Sbjct  201   TGVKKMKMITQSIMEDDQDCVMDTVGAVCVDAYGNIASGASSGGIALKVQ----------  250

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVN  1228
                W                                        Q+ PASAC+KVLR   
Sbjct  251   ---WI---------------------------------------QSGPASACTKVLRQAV  268

Query  1229  QESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
             Q SS+   +  AG+L++QA+   +   G    L A E+ AA+SS SFG+GY GS+M  PK
Sbjct  269   QSSSEMSHDTGAGLLLIQADV--LKVRGEVSALGAAELVAAYSSPSFGVGYLGSNMNSPK  326

Query  1409  VSILRSTSKQSKTGVDEFAARIKLVA  1486
             V++LRS SK +   ++ FA R+   A
Sbjct  327   VAMLRS-SKAAPNTINHFATRVNFDA  351



>gb|KFH68663.1| hypothetical protein MVEG_05472 [Mortierella verticillata NRRL 
6337]
Length=436

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 102/344 (30%), Positives = 150/344 (44%), Gaps = 49/344 (14%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +S  +N IQ+AA + +E   G   LGRIPP+ LVG G   W  + G  L       +   
Sbjct  129   VSDFKNPIQVAAKVLQESDQGPLSLGRIPPLMLVGPGVAQWVDTMGYQLDRVETNPN---  185

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                               LT +L+    V      LV +  + +        Y G+L  +
Sbjct  186   ------------------LTKILNYNPTVDAPGASLVSKTALEQHIH-----YNGLLQQS  222

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
               + + SS     + T  + ++     ++GS  GD            ++DT+G ICVD  
Sbjct  223   SPM-EASSFAKRKMDTTEM-DSNKRHANSGSPQGD-----------MLNDTVGAICVDHL  269

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +A G SSGGIALK  GRV  AA++G+GCWA       A F   C V+GAGE + +   
Sbjct  270   GRVAAGVSSGGIALKFPGRVSEAALFGAGCWAQDPTHEAAGF--ACSVTGAGEQITKTLL  327

Query  1148  ARECCVSLSISQAAPASACSKVL-RSVNQESSKYGTEKSAGILVVQ---AEAPRMDATGN  1315
             AR C   L I      SA  KVL + +     +  TE+ AG + ++   AE    +A  +
Sbjct  328   ARTCMDQL-IDDDDTTSAAQKVLDKFIVSPLLRSYTERHAGFVAIKIDPAEVSLSEAAQH  386

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKT  1447
                    E     ++ + GIGY      KPKV ++    + SKT
Sbjct  387   RTIRG--EFVYGHTTPTMGIGYMSVQDSKPKV-VMSQRKEGSKT  427



>ref|XP_006345601.1| PREDICTED: putative threonine aspartase-like isoform X2 [Solanum 
tuberosum]
Length=270

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 78/148 (53%), Gaps = 42/148 (28%)
 Frame = +2

Query  434  GVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
            GVRNAI+IAALLAKEQ+ GS+LLGRI PMFLVGEGA AWAKSKGV LP TI  ADE    
Sbjct  109  GVRNAIEIAALLAKEQLSGSSLLGRISPMFLVGEGACAWAKSKGVVLPSTITAADES---  165

Query  614  FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                  LVTE+ R  WK+YK MLD AKA
Sbjct  166  --------------------------------------LVTEKARTQWKRYKAMLDDAKA  187

Query  794  VNDVSSTT-ANSVKTCAVSEAQLCDKSN  874
            V D       N+ +T A+S    C  S+
Sbjct  188  VIDAPDIKLTNAKETNAISGKWACGSSS  215


 Score = 76.6 bits (187),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = +1

Query  1012  GQWTCRFSSNVWFWLLGILKGTVWSSFYSWLLC*RCWRVLNERICCSGML  1161
             G+W C  SSNVWF LLGI+KGT WSS YS +LC  CWRV NERICCSGML
Sbjct  207   GKWACGSSSNVWFRLLGIVKGTFWSSIYSGMLCQWCWRVPNERICCSGML  256



>gb|KDQ27711.1| hypothetical protein PLEOSDRAFT_1076792 [Pleurotus ostreatus 
PC15]
Length=389

 Score =   109 bits (272),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 153/362 (42%), Gaps = 112/362 (31%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SG+ N I++A A+L   +I     LGR+PPM LV EGA ++A S               
Sbjct  99    VSGISNPIRLARAVLDHARIPDP--LGRVPPMMLVSEGATSFASS---------------  141

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
               P P ++I  + S                           L+T R R  W K+K  LD 
Sbjct  142   -VPQPPIAIVPVDS---------------------------LITLRARQQWSKWKARLDQ  173

Query  785   AKA--VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             A+A  V+    TTA                                 E+ + DT+G +  
Sbjct  174   AEAGPVDSTCPTTA---------------------------------EDQMQDTVGAVTC  200

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWAS---------SKGPFGAPFIV----  1099
             D  G MA G SSGG+ LK  GR+G AAMYG+GCWAS         + G     F +    
Sbjct  201   DRAGRMAAGVSSGGLLLKHPGRIGEAAMYGAGCWASQTNRQPHTEASGDSSNNFTISGRS  260

Query  1100  -GCCVSGAGEYLMRGFAARECCVSLSISQAAPAS-------ACSKVLRSVNQESSKYGTE  1255
               C VSG GE ++R   AR    +L+  QA   S       A S+V  ++    S    E
Sbjct  261   MACSVSGTGEDIVRAMLARSIARALAYDQAETFSGEVDVHEALSEVFVNLFLRPSMARGE  320

Query  1256  --KSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRST  1429
                SAG++++     R DA  +SP  ++V +  AF++ S  I Y  S    PKV ILR  
Sbjct  321   LNPSAGVILLD----RGDA--DSP--RSVRLWCAFTTPSMSIAYASSRHPSPKVKILRRP  372

Query  1430  SK  1435
             ++
Sbjct  373   TR  374



>ref|XP_010217946.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1 [Tinamus 
guttatus]
Length=419

 Score =   108 bits (270),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 100/338 (30%), Positives = 147/338 (43%), Gaps = 60/338 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPACP---------  183

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                            P + L     N  +++          L  +   +L +  K     
Sbjct  184   ---------------PGFSLAAFKRNKRKLE----------LAEKVETDLIQLKKRRQSN  218

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
              K    + ST     KT            +G + GDQ    +  +++   DT+G + VD 
Sbjct  219   EKGSRVMCSTCGRLPKT-----------KDGGKGGDQIDLCSPENDSGTLDTVGAVVVDQ  267

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R  
Sbjct  268   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTI  326

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQE---SSKYGTEKS--AGILVVQA--EAPRMD  1303
              AREC  +L    A  A     +L ++  +   S     E     G++V+++   A   D
Sbjct  327   LARECSCALQTEDAHQA-----LLETMQNKFIGSPFLANEDGVLGGVIVLRSCRCAAEAD  381

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSI  1417
             ++   P L  VE   + ++ S  +GY  +   K KVS+
Sbjct  382   SSQEKPTL-LVEFLWSHTTESMCVGYMSAQDGKAKVSL  418



>emb|CCD77871.1| taspase-1 (T02 family) [Schistosoma mansoni]
Length=368

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 99/343 (29%), Positives = 144/343 (42%), Gaps = 101/343 (29%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGST-LLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             ++N +++A LL + QI      LGR+PP  LVG+GA  WA SKG ++  +          
Sbjct  97    MKNPVKVARLLLQSQIDHPVGELGRVPPSVLVGDGAHVWAASKGYSVDNSD---------  147

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                   LVT+ +R  W+KYK  L     
Sbjct  148   --------------------------------------LVTKHSRVSWEKYKSWLFNG--  167

Query  794   VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNA--LDENCIS--DTIGVICVD  961
              N++++TT                     RD   +  +N   L  + +   DT+G +C+D
Sbjct  168   -NEMNATT---------------------RDPHFNHHENVPELKRSRVHRFDTVGAVCID  205

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
              EG +A  +SSGGIA+K  GR+G A  YG GCWA     F +   +G   SG GE L+R 
Sbjct  206   IEGKIAAASSSGGIAMKYEGRLGQACTYGCGCWAEELSSFSS---IGVVTSGTGEQLIRT  262

Query  1142  FAARECCV-----SLSISQAAPASACSKVLRSVNQESSKY---GTEKSAGILVVQAEAPR  1297
               A+         S+S+S+   +S     L      +SKY     EK AG+  V A   R
Sbjct  263   QLAQRSAERFNGDSISVSEIVHSSLTDGFL------NSKYLSCDMEKFAGVAGVYANFER  316

Query  1298  MDATGNSPFLQAVEIAAAFSSLSFGIG-YFGSSMEKPKVSILR  1423
             +D          VE+    S+ S  +G Y  S M+KP V + R
Sbjct  317   ID-------FPNVEVFFGHSTRSMSVGHYLPSIMKKPSVHVSR  352



>ref|XP_010704934.1| PREDICTED: threonine aspartase 1 [Meleagris gallopavo]
Length=406

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 83/257 (32%), Positives = 119/257 (46%), Gaps = 42/257 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  112   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAFRWAVDHGIPACP---------  162

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
               P  + +  +L++F        L    +  +I                L K+ +    G
Sbjct  163   --PGIMATRFSLAAFKRNKRKLELAEKVETDLI---------------QLKKRRQSNEKG  205

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             ++ +           +TC     +    ++GSR GDQ    +  +++   DT+G + VD 
Sbjct  206   SRVM----------CRTCG----RPSKANDGSRGGDQIELYSLENDSGTLDTVGAVVVDQ  251

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R  
Sbjct  252   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTSGCGEHLVRTI  310

Query  1145  AARECCVSLSISQAAPA  1195
              AREC  +L    A  A
Sbjct  311   LARECSCALQTEDAHQA  327



>ref|XP_781597.2| PREDICTED: threonine aspartase 1-like [Strongylocentrotus purpuratus]
Length=377

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/336 (30%), Positives = 134/336 (40%), Gaps = 83/336 (25%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             L G+RN +++A  L  EQ  G    GRIPP  LVG GA  WA   G              
Sbjct  94    LGGIRNPVKVAKALLCEQRKGLLSHGRIPPCVLVGNGALQWACDHG--------------  139

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                             F  +    L+T R  + ++K+K  L G 
Sbjct  140   --------------------------------FKEVNTSSLITPRALSAYRKHKRALTGF  167

Query  788   KAVN-DVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
               +  D   + A  +K                  GD S     +D + + DT+G +CVDS
Sbjct  168   STLPPDQQESLAKRMK------------------GDGSP---VMDGDTMQDTVGAVCVDS  206

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
              G +A   SSGGIALK  GRVG A  +G GCWA S         VGC  SG+GE LMR  
Sbjct  207   NGQIASAVSSGGIALKHPGRVGHAMCFGCGCWAQSHTKTSMSVSVGCSTSGSGEQLMRCN  266

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSA---GILVVQAEAPRMDATGN  1315
              A+ CC  L  S    +S  S   R   +  S + T+ +A   G + V+      DA   
Sbjct  267   LAQTCCEGLLQSDDPTSSLGSTFQRQYLK--SPFLTDDAARLGGAIAVRYNHKDRDA---  321

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
                    EI    S+ S  +GY  ++  K K+ I R
Sbjct  322   -------EILWTHSTDSLCVGYMDTTQTKAKMVISR  350



>ref|NP_001012808.1| threonine aspartase 1 [Gallus gallus]
 emb|CAG32757.1| hypothetical protein RCJMB04_35c14 [Gallus gallus]
 emb|CAG32785.1| hypothetical protein RCJMB04_37c14 [Gallus gallus]
Length=445

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 116/257 (45%), Gaps = 47/257 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAFRWAVDHGIPACP---------  183

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                            P + L     N  ++++   +      + +R ++  K  + M   
Sbjct  184   ---------------PGFSLAAFKRNKRKLELAEKVETDLIQLKKRRQSNEKGSRVM---  225

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                            +TC     +    ++GSR GDQ    +  +++   DT+G + VD 
Sbjct  226   --------------CRTCG----RPSKANDGSRGGDQIELYSLENDSGTLDTVGAVVVDQ  267

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R  
Sbjct  268   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAR-TPYSTAVSTSGCGEHLVRTI  326

Query  1145  AARECCVSLSISQAAPA  1195
              AREC  +L    A  A
Sbjct  327   LARECSCALQTEDAHQA  343



>ref|XP_010175991.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1, partial 
[Caprimulgus carolinensis]
Length=366

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 111/257 (43%), Gaps = 47/257 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  84    LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPACPPGF------  137

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                       +L++F        L    +  +I L   RQ                    
Sbjct  138   ----------SLAAFKRNKRKLELAEKVETDLIHLKKRRQ--------------------  167

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                     S    S   C+    +    ++G + GDQ    +  +++   DT+G + VD 
Sbjct  168   --------SNEKGSRVMCSAC-GRPPKANDGGKGGDQIELYSPENDSGTLDTVGAVVVDQ  218

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R  
Sbjct  219   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTSGCGEHLVRTI  277

Query  1145  AARECCVSLSISQAAPA  1195
              AREC  +L    A  A
Sbjct  278   LARECSCALQTEDAHQA  294



>gb|KGB37877.1| Threonine aspartase 1 [Schistosoma haematobium]
Length=368

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 99/339 (29%), Positives = 145/339 (43%), Gaps = 93/339 (27%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGST-LLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             ++N +++A LL + QI      LGR+PP  LVG+GA  WA SKG                
Sbjct  97    MKNPVKVARLLLQSQIDHPLGELGRVPPSVLVGDGAHLWAASKG----------------  140

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
             +PV +                                 LVT+ +R  W+KYK  L     
Sbjct  141   YPVDN-------------------------------SNLVTKHSRVSWEKYKSWLFNG--  167

Query  794   VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGH  973
              N++ +TT +S      +  +L           ++S  +  D      T+G +C+D EG 
Sbjct  168   -NEMDATTKDSHFNHHENVPEL-----------KTSRVHRFD------TVGAVCIDIEGK  209

Query  974   MACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAAR  1153
             +A  +SSGGIA+K  GR+G A  YG GCWA     F +   +G   SG GE L++   A+
Sbjct  210   IAAASSSGGIAMKYEGRLGQACTYGCGCWAEELSSFSS---IGVVTSGTGEQLIKTQLAQ  266

Query  1154  ECCV-----SLSISQAAPASACSKVLRSVNQESSKY---GTEKSAGILVVQAEAPRMDAT  1309
                      S+S+S+   +S     L      +SKY     EK AG+  V A   R+D  
Sbjct  267   RSAERFNGDSISVSEIVHSSLTDGFL------NSKYLSCDMEKFAGVAGVYANFERID--  318

Query  1310  GNSPFLQAVEIAAAFSSLSFGIG-YFGSSMEKPKVSILR  1423
                     VE+    S+ S  +G Y  S M+KP V + R
Sbjct  319   -----FPNVEVFFGHSTRSMSVGHYLPSVMKKPFVRVSR  352



>ref|XP_009573942.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1, partial 
[Fulmarus glacialis]
Length=415

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 80/257 (31%), Positives = 111/257 (43%), Gaps = 47/257 (18%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPACP---------  183

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                            P + L     N  +++          L  +   +L +  K     
Sbjct  184   ---------------PGFSLAAFKRNKRKLE----------LAEKVETDLIQLKKRRQSN  218

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
              K    + S      K            ++G + GDQ    +  +++   DT+G + VD 
Sbjct  219   EKGSRVMCSACGRPPKA-----------NDGGKGGDQIELCSPENDSGTLDTVGAVVVDQ  267

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R  
Sbjct  268   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTSGCGEHLVRTI  326

Query  1145  AARECCVSLSISQAAPA  1195
              AREC  +L    A  A
Sbjct  327   LARECSCALQTEDAHQA  343



>gb|KHG25629.1| hypothetical protein F383_08639 [Gossypium arboreum]
Length=74

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 47/52 (90%), Gaps = 0/52 (0%)
 Frame = +2

Query  1013  VSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVS  1168
             VSG VGL AMYG+GCWASSKGPFGAPF VGCCVS AGE+LM+ FAARECCVS
Sbjct  12    VSGHVGLVAMYGAGCWASSKGPFGAPFTVGCCVSDAGEHLMKRFAARECCVS  63



>gb|AAW25758.1| SJCHGC02349 protein [Schistosoma japonicum]
Length=368

 Score =   102 bits (253),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 97/339 (29%), Positives = 132/339 (39%), Gaps = 93/339 (27%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGST-LLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             +RN +++A LL + QI      LGR+PP  LVG+GA  WA SKG ++             
Sbjct  97    MRNPVKVARLLLQSQIDHPLGELGRVPPSLLVGDGAHLWASSKGYSIDN-----------  145

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                                                 + LVT+ +   W+KYK  L     
Sbjct  146   ------------------------------------KNLVTKDSLFSWEKYKSWLFNGNN  169

Query  794   VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGH  973
             ++     TAN+          +  +S   R                 DT+G +C+D EG 
Sbjct  170   ID----VTANNPHFTNHENCSIPKRSRTHR----------------LDTVGAVCIDLEGK  209

Query  974   MACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAAR  1153
             +A   SSGGIA+K  GR+G A  YG GCWA    PF     +G   SG GE L+R   A+
Sbjct  210   VAAAVSSGGIAMKYEGRLGQACAYGCGCWAEEINPFTR---IGVVTSGTGEQLVRTQLAQ  266

Query  1154  ECC-----VSLSISQAAPASACSKVLRSVNQESSKY---GTEKSAGILVVQAEAPRMDAT  1309
                      S+ +     AS     L      +SKY     EK AG+  V A   R    
Sbjct  267   RSAERFYGSSICVPDVIQASLIEGFL------NSKYLSCDMEKFAGVAGVYANFER----  316

Query  1310  GNSPFLQAVEIAAAFSSLSFGIG-YFGSSMEKPKVSILR  1423
                P    +E+    S+ S  IG Y  S M KP V + R
Sbjct  317   ---PNFPVIEVFFGHSTRSMSIGHYLPSVMTKPSVRVSR  352



>gb|ERE71024.1| threonine aspartase 1-like isoform 1 [Cricetulus griseus]
Length=308

 Score =   101 bits (251),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 109/263 (41%), Gaps = 70/263 (27%)
 Frame = +2

Query  407   LQIRHLLLSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETI  586
             LQ + +LL+G++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+      
Sbjct  14    LQEQQVLLTGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIP-----  68

Query  587   AEADEVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKY  766
                                S PP ++T                      T  +   +K+ 
Sbjct  69    -------------------SCPPSIMT----------------------TRFSLAAFKRN  87

Query  767   KGMLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIG  946
             K  L+ A+ V                 E          +   + +   ALD      T+G
Sbjct  88    KRKLELAERV-----------------ETDFIQLKKRRQSSAKENDSGALD------TVG  124

Query  947   VICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGE  1126
              + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE
Sbjct  125   AVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGE  183

Query  1127  YLMRGFAARECCVSLSISQAAPA  1195
             +L+R   AREC  +L    A  A
Sbjct  184   HLVRTILARECSHALQAEDAHQA  206



>ref|XP_004333217.1| Tasp1 protein [Acanthamoeba castellanii str. Neff]
 gb|ELR11204.1| Tasp1 protein [Acanthamoeba castellanii str. Neff]
Length=366

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 81/273 (30%), Positives = 111/273 (41%), Gaps = 44/273 (16%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SGVR+ I +A  +   +  G   LGR+PPMFLVGEGAR W  + GV          E +
Sbjct  20    VSGVRSPITLAHAIMTAERKGRLPLGRVPPMFLVGEGARRWGLAHGV----------EGV  69

Query  608   FPFPVMSI*TLSSFPPYML--TWLLHNMEQVKIIFLLLV-----------RQWLVTERTR  748
              P P        S P   L      H  E+ +                     +V  R R
Sbjct  70    LPLP--------SSPTSHLRRKRARHETEKRRDGGDDDDKGEVEGESGEDEDPMVAPRAR  121

Query  749   NLWKKYKGMLD---GAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALD  919
               W+KY   L      +   +     A+  +          +     R     ++  A +
Sbjct  122   AAWEKYSARLRLWAELEERKERRRCGADEAEGDDGDNDGGGEVHRAKRPKTDLAAAEA-E  180

Query  920   ENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWA---------SSK  1072
              + + DT+G IC+D+ G  A G SSGGIA+K  GRVG AA+YG GCWA         SS 
Sbjct  181   SDSLYDTVGAICIDATGKTAAGVSSGGIAMKWEGRVGEAALYGCGCWASGLDLNPSSSSA  240

Query  1073  GPFGAPFIVGCCVSGAGEYLMRGFAARECCVSL  1171
              P      V C  SG GE + +   A   C  +
Sbjct  241   TPRSPRVAVACSASGVGEQITKSLLASTACREM  273



>gb|KFM57192.1| Threonine aspartase 1, partial [Stegodyphus mimosarum]
Length=366

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 138/328 (42%), Gaps = 84/328 (26%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             L  ++N I++A  + +EQ  G    GRIPP  LVG GA  WAK  G              
Sbjct  94    LCNIKNPIKVAQNVLEEQNRGLLSHGRIPPCILVGSGALEWAKEHG--------------  139

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                             F  + ++ L TE +R ++ K K +L   
Sbjct  140   --------------------------------FCEIDQKQLSTEVSRAIYLKNKSLL---  164

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                           K    SE     KSN   D   +  Q +  E+ + DT+G +CVD+ 
Sbjct  165   --------------KKVIPSEP----KSNFISD---TLEQRSFGESTLLDTVGAVCVDAF  203

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G+++   SSGG+ LK  GR+G A++YGSGCWA +      P I  C  +G GEYL++   
Sbjct  204   GNVSSAVSSGGLLLKHCGRIGQASVYGSGCWAENSLSTEKPSI-ACSATGVGEYLIKTVF  262

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGT--EKSAGILVVQAEAPRMDATGNSP  1321
             A+ECC  L        +A   V R    +S    T  +K AG+LV+++ +          
Sbjct  263   AKECCQMLC-DNVNSLTALPDVFRKKFLDSPYIRTVGQKLAGVLVLKSYSDE--------  313

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
                  E+  A ++ +  +GY   S +KP
Sbjct  314   --GYCELGWAHTTKTMIVGYMNVSGKKP  339



>gb|KHG19427.1| hypothetical protein F383_08320 [Gossypium arboreum]
Length=127

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 91/165 (55%), Gaps = 44/165 (27%)
 Frame = +2

Query  920   ENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIV  1099
             E+ I DT+GVIC ++EG++A  ASSG          GL +     C  S+         +
Sbjct  6     EDNIMDTVGVICFNTEGNIASRASSGE---------GLRS-----CEISNN--------L  43

Query  1100  GCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVV  1279
             G  VS            R C          PASAC KVL SV Q+S++  T+K AGIL+V
Sbjct  44    GSVVS-----------HRHC----------PASACMKVLYSVAQDSNQADTDKCAGILIV  82

Query  1280  QAEAP-RMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             QA+AP R  +  +S     +EIAAA+SSLSFGIGYFGS ME+PKV
Sbjct  83    QADAPIRASSRKSSKTESYIEIAAAYSSLSFGIGYFGSGMERPKV  127



>ref|XP_008034521.1| N-terminal nucleophile aminohydrolase [Trametes versicolor FP-101664 
SS1]
 gb|EIW63309.1| N-terminal nucleophile aminohydrolase [Trametes versicolor FP-101664 
SS1]
Length=372

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 93/336 (28%), Positives = 146/336 (43%), Gaps = 94/336 (28%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVA-LPETIAEADEV  604
             +SGV+N I++A  + +       LLGRIPP+ LV  GA+ +A+++ +A +P++       
Sbjct  105   VSGVKNPIKLAHSVLQYSRT-PDLLGRIPPLLLVSAGAQEFARTRDLACIPDS-------  156

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                                                      +++ R    WK++   L+ 
Sbjct  157   -----------------------------------------MISPRAHREWKRWTDALET  175

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             A+  + + +    S                 S  G Q    + L +    DT+G I +D+
Sbjct  176   ARHAHPMDTMLETS-----------------SAVGLQHPQTDGLHDR--QDTVGAIALDA  216

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG++A G SSGG+ LK+ GRVG AAMYG+GCWA+ +        V C VSGAGE + R  
Sbjct  217   EGNLAAGVSSGGLLLKLPGRVGEAAMYGAGCWATHR--------VSCSVSGAGEDITRAS  268

Query  1145  AARECCVSLSISQAAPASACSKVLRSV-----NQESSKYG-TEKSAGILVVQAEAPRMDA  1306
              A+  C   S+  A        VL++V     ++  ++ G T   AG++++  E    D 
Sbjct  269   LAKTICS--SVEAAGEDGDIHDVLQTVIGHQFHKVCAERGETSPQAGVILLVKE---YDD  323

Query  1307  TGN-SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
              G   P L       AF++ S  IGY  S   KP V
Sbjct  324   DGQLRPRLW-----CAFTTESMAIGYASSVSSKPSV  354



>ref|XP_006723652.1| PREDICTED: threonine aspartase 1 isoform X1 [Homo sapiens]
 ref|XP_006723653.1| PREDICTED: threonine aspartase 1 isoform X2 [Homo sapiens]
 gb|EAX10317.1| taspase, threonine aspartase, 1, isoform CRA_d [Homo sapiens]
Length=318

 Score = 97.8 bits (242),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 96/339 (28%), Positives = 142/339 (42%), Gaps = 83/339 (24%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G              
Sbjct  31    LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHG--------------  76

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                       + S PP ++T                      T  +   +K+ K  L+ A
Sbjct  77    ----------IPSCPPNIMT----------------------TRFSLAAFKRNKRKLELA  104

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + V+                  QL  +   S   + S +          DT+G + VD E
Sbjct  105   ERVD--------------TDFMQLKKRRQSSEKENDSGTL---------DTVGAVVVDHE  141

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R   
Sbjct  142   GNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTIL  200

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVVQA--EAPRMDA  1306
             AREC  +L    A  A     +L ++  +  SS +   +     G++V+++   +   D+
Sbjct  201   ARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPDS  255

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             + N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  256   SQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  293



>dbj|BAA91018.1| unnamed protein product [Homo sapiens]
Length=420

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/256 (31%), Positives = 106/256 (41%), Gaps = 70/256 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G              
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHG--------------  178

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                       + S PP ++T                      T  +   +K+ K  L+ A
Sbjct  179   ----------IPSCPPNIMT----------------------TRFSLAAFKRNKRKLELA  206

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + V+                  QL  +   S   + S +          DT+G + VD E
Sbjct  207   ERVD--------------TDFMQLKKRRQSSEKENDSGTL---------DTVGAVVVDHE  243

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R   
Sbjct  244   GNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTIL  302

Query  1148  ARECCVSLSISQAAPA  1195
             AREC  +L    A  A
Sbjct  303   ARECSHALQAEDAHQA  318



>ref|NP_060184.2| threonine aspartase 1 precursor [Homo sapiens]
 sp|Q9H6P5.1|TASP1_HUMAN RecName: Full=Threonine aspartase 1; Short=Taspase-1; Contains: 
RecName: Full=Threonine aspartase subunit alpha; Contains: 
RecName: Full=Threonine aspartase subunit beta [Homo sapiens]
 pdb|2A8J|A Chain A, Crystal Structure Of Human Taspase1 (Acivated Form)
 pdb|2A8J|B Chain B, Crystal Structure Of Human Taspase1 (Acivated Form)
 dbj|BAB15209.1| unnamed protein product [Homo sapiens]
 gb|AAH25266.1| Taspase, threonine aspartase, 1 [Homo sapiens]
 gb|EAX10315.1| taspase, threonine aspartase, 1, isoform CRA_b [Homo sapiens]
Length=420

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/256 (31%), Positives = 106/256 (41%), Gaps = 70/256 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G              
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHG--------------  178

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                       + S PP ++T                      T  +   +K+ K  L+ A
Sbjct  179   ----------IPSCPPNIMT----------------------TRFSLAAFKRNKRKLELA  206

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + V+                  QL  +   S   + S +          DT+G + VD E
Sbjct  207   ERVD--------------TDFMQLKKRRQSSEKENDSGTL---------DTVGAVVVDHE  243

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R   
Sbjct  244   GNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTIL  302

Query  1148  ARECCVSLSISQAAPA  1195
             AREC  +L    A  A
Sbjct  303   ARECSHALQAEDAHQA  318



>gb|KDQ21363.1| hypothetical protein BOTBODRAFT_618295, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=345

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/345 (26%), Positives = 143/345 (41%), Gaps = 112/345 (32%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SGV+N I+IA ALL   +I G   LGR+ PM LV +GA  +A S G+   ET+      
Sbjct  91    VSGVKNPIKIARALLENAKIPGP--LGRVHPMTLVAQGAVKFAASVGI---ETV------  139

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                            PP  +                      V+   + +W+K++  L+ 
Sbjct  140   ---------------PPASM----------------------VSTEAQEIWRKWRARLEQ  162

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
             A+  ++V                                      E  + DT+G + +D 
Sbjct  163   AEGGHEVH-------------------------------------EMLLQDTVGAVALDK  185

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             + +++ G SSGGI LK  GR+G AA YG+GCWASS G       + C VSG GE + R  
Sbjct  186   QFNVSAGVSSGGILLKYPGRLGEAAAYGAGCWASSSG-------IACSVSGNGEQITRTL  238

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQES------SKYGTEKSAGILVVQAEAPRMDA  1306
              A++    + ++    A    +++R++           +   E +AG++++  E     +
Sbjct  239   LAQKIVHQVELA----ADEADEIIRTILVHDFIRPCRDRGDIEPNAGVILLVNEHTDYGS  294

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQS  1441
             T          +  AF++ S  I Y  SS  KPK  ILR    Q+
Sbjct  295   T---------RLWCAFTTSSMAIAYASSSKTKPKALILRRPQNQN  330



>ref|XP_005181785.1| PREDICTED: threonine aspartase 1-like [Musca domestica]
Length=362

 Score = 97.1 bits (240),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 98/358 (27%), Positives = 152/358 (42%), Gaps = 96/358 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLG--RIPPMFLVGEGARAWAKSKGVALPETIAEADE  601
             +S V+N IQ+A +L + Q     +L   RIPPM + G GA  +A+  G A+ +  A    
Sbjct  92    VSTVKNPIQLARMLCEGQ---ERMLSMERIPPMIMAGTGAENFAEEMGCAMIDASA----  144

Query  602   VLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGML-  778
                                                       +++ + +  +  YK  + 
Sbjct  145   ------------------------------------------MISSKAKFTYTHYKSKVG  162

Query  779   DGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             DGAK    V+ST   S                   + +QS + +A + + + DT+G +CV
Sbjct  163   DGAK----VTSTKIES-------------------NPEQSETVDAAEVSPL-DTVGAVCV  198

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             DS G+ A G SSGG+ LKV GRVG AA YG+GCWA+          V  C +G GEYLM+
Sbjct  199   DSTGNSAAGCSSGGLILKVPGRVGQAATYGAGCWATDTDDLS----VATCTTGNGEYLMK  254

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSA-GILVVQAEAPRMDATGN  1315
              F A+E C  L  S  A  ++  K  +S   ES     ++   G  +     P+ +    
Sbjct  255   TFLAKEICTDLFTSDCA-VTSLHKTFKSKFLESPFLPADQCLYGGALSLIYYPKNNCG--  311

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV--SILRSTSKQSKTGV---DEFAARI  1474
                    E+  + ++ SF +GY  +  + PK   S L + S+  K+ V     F  R+
Sbjct  312   -------EVLWSHTTKSFCVGYMSTQQKTPKFVYSPLPAYSQPGKSSVVNGHNFHLRV  362



>ref|XP_009858315.1| PREDICTED: uncharacterized protein LOC100178578 [Ciona intestinalis]
Length=1002

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/340 (27%), Positives = 137/340 (40%), Gaps = 92/340 (27%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTL-LGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             ++N +  A  LA +Q  GS L LGRIPP  L G+GA  WA++ GV +       DE    
Sbjct  408   IKNPVMAAYELANQQAKGSRLSLGRIPPCSLSGQGAEKWARAHGVEM------CDE----  457

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYK-----GML  778
                                                 + L++E     W+KY+      +L
Sbjct  458   ------------------------------------KNLISESAYKTWQKYQRRLLEHIL  481

Query  779   DGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
              G+K  N                           +  D        D     DT+G + +
Sbjct  482   RGSKTRN---------------------------KQQDNREEHEVFDAASRLDTVGAVAL  514

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D  G +A  ASSGG+ +K+SGRVG AA YG GCWA + G    P  V  C +G GE L+ 
Sbjct  515   DIHGKVASAASSGGLLMKLSGRVGQAATYGCGCWAEN-GSIAKPS-VAVCTTGCGEQLVY  572

Query  1139  GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGT--EKSAGILVVQAEAPRMDATG  1312
               AA++C  +L ++   P +A    L +   ++    +  EK AGIL +           
Sbjct  573   AMAAKKCADNL-MTDDQPYTAVQNTLLNDVLQTPFLNSDCEKQAGILALHE--------V  623

Query  1313  NSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTS  1432
             N     A+E+    ++ S  IG+  +  + P+V + R  S
Sbjct  624   NDGLESAIEVVWGHTTSSMIIGHMSTKDKVPEVVVSRLPS  663



>gb|KDQ57831.1| hypothetical protein JAAARDRAFT_178341 [Jaapia argillacea MUCL 
33604]
Length=394

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 95/337 (28%), Positives = 139/337 (41%), Gaps = 84/337 (25%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SGV+N I +A +++   ++     LGR+PP+ LVGEGA+A+A S G             
Sbjct  118   VSGVKNPIGVARSIIEYSKV--PDPLGRLPPLTLVGEGAKAFASSSG-------------  162

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                 PV+        PP          E++K            + R    W ++K  LD 
Sbjct  163   ---LPVI--------PP----------EELK------------SPRAIEEWVRWKTRLD-  188

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                                  E+Q    S+    G     Q         DT+G    DS
Sbjct  189   ---------------------ESQSHPLSHRDLPGGLHDRQ---------DTVGAAVWDS  218

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
              G++A G SSGG+ LK  GRVG AA++G+GCWA   G       + C VSG+GEY++R  
Sbjct  219   TGNLAAGVSSGGLLLKPPGRVGEAAIFGAGCWALRSGISSG---MACSVSGSGEYIIRTS  275

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGT-EKSAGILVVQAEAPRMDATGNSP  1321
              A+    SL            + L    +   ++G  + +AGIL++  E     A G S 
Sbjct  276   LAKSVGDSLQDPDIDTHEVLKRTLIGFCKNCERWGEHDPNAGILLLTQEVGEKGAEGQSH  335

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTS  1432
                   +  AF+S +  I +  S    PK  ILR  S
Sbjct  336   VQPVARLWCAFTSPAMAIAFASSQDPNPKAMILRRPS  372



>pdb|2A8M|A Chain A, Crystal Structure Of Human Taspase1 (T234s Mutant)
 pdb|2A8M|B Chain B, Crystal Structure Of Human Taspase1 (T234s Mutant)
Length=420

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 106/256 (41%), Gaps = 70/256 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G              
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHG--------------  178

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                       + S PP ++T                      T  +   +K+ K  L+ A
Sbjct  179   ----------IPSCPPNIMT----------------------TRFSLAAFKRNKRKLELA  206

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + V+                  QL  +   S   + S +          D++G + VD E
Sbjct  207   ERVD--------------TDFMQLKKRRQSSEKENDSGTL---------DSVGAVVVDHE  243

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R   
Sbjct  244   GNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTIL  302

Query  1148  ARECCVSLSISQAAPA  1195
             AREC  +L    A  A
Sbjct  303   ARECSHALQAEDAHQA  318



>ref|XP_007361954.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF65318.1| N-terminal nucleophile aminohydrolase [Dichomitus squalens LYAD-421 
SS1]
Length=415

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 105/376 (28%), Positives = 150/376 (40%), Gaps = 121/376 (32%)
 Frame = +2

Query  428   LSGVRNAIQIA--ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADE  601
             +SGVR  I++A   LL   +      LGR PP+ LV  GA  +A+S G+  P        
Sbjct  102   VSGVRYPIKLAHEVLLYSRK---PDPLGRTPPLLLVSSGASEFAESYGLRCPP-------  151

Query  602   VLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLD  781
                                                     Q +V+ R +  W K+K  LD
Sbjct  152   ----------------------------------------QSMVSRRAQGEWVKWKNELD  171

Query  782   GAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVD  961
              AK+   +S  +  +    A  + Q+    +G RD                DT+G +  +
Sbjct  172   AAKS--RLSEDSPATPGQDAPPQLQV----DGLRD--------------RQDTVGAVACN  211

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRG  1141
             +EGH+A G SSGG+ LK+ GRVG AA+YG+GCWA+ K          C VSGAGEY+ R 
Sbjct  212   AEGHLAAGVSSGGLLLKLPGRVGEAAIYGAGCWATHK--------TACSVSGAGEYITRM  263

Query  1142  FAARECCVSLSISQAAPASACSKVLRSVNQE------SSKYGTEKSAGI-LVVQAEAPRM  1300
               AR  C   +I  A   +   +VL+ V  E      S +      AG+ L+V+ E  R 
Sbjct  264   SLARALCE--AIEAAGDDTDTHEVLQRVLGEDFLQLCSDRGEPSPQAGVLLLVKEERSRD  321

Query  1301  DAT---------------------------GNS----PFLQAVEIAAAFSSLSFGIGYFG  1387
             D+                            GNS    P  +   +  AF++ S  IGY  
Sbjct  322   DSANVGHDSDMDSDSDGNGDDSNTDKSDRGGNSHGGRPAFKP-RLWCAFTTESMAIGYAT  380

Query  1388  SSMEKPKVSILRSTSK  1435
             +   KP   ILR   +
Sbjct  381   TLSPKPSTVILRRPPR  396



>pdb|2A8L|A Chain A, Crystal Structure Of Human Taspase1 (T234a Mutant)
 pdb|2A8L|B Chain B, Crystal Structure Of Human Taspase1 (T234a Mutant)
Length=420

 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 105/256 (41%), Gaps = 70/256 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G              
Sbjct  133   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHG--------------  178

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                       + S PP ++T                      T  +   +K+ K  L+ A
Sbjct  179   ----------IPSCPPNIMT----------------------TRFSLAAFKRNKRKLELA  206

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             + V+                  QL  +   S   + S +          D +G + VD E
Sbjct  207   ERVD--------------TDFMQLKKRRQSSEKENDSGTL---------DAVGAVVVDHE  243

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      SG GE+L+R   
Sbjct  244   GNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTSGCGEHLVRTIL  302

Query  1148  ARECCVSLSISQAAPA  1195
             AREC  +L    A  A
Sbjct  303   ARECSHALQAEDAHQA  318



>gb|EPS97728.1| N-terminal nucleophile aminohydrolase [Fomitopsis pinicola FP-58527 
SS1]
Length=412

 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 101/360 (28%), Positives = 151/360 (42%), Gaps = 79/360 (22%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SGV++ +Q+A A+L   +      LGRI P+ LV +GA  +A++KG+    T+   D  
Sbjct  100   VSGVKHPVQLARAVLEYSRRLDP--LGRIAPLMLVADGALQFAQAKGIV---TVPPGD--  152

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                                                      LV  R +  WK +K +L  
Sbjct  153   -----------------------------------------LVAPRAQEEWKHWKNVLQS  171

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                   V+    +        E+ L   S G+   D +   N      + DT+G I  D+
Sbjct  172   VSPSYRVAEGPIDCPTVVRDDESAL--SSIGT---DNAGLHN------VQDTVGAIACDA  220

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
              G  + G SSGG+ LK  GR+G AAM+G+GCWA+S    G    V C VSGAGE++ R  
Sbjct  221   SGSFSAGVSSGGLLLKHPGRIGEAAMFGAGCWATSPKDEGIGG-VACSVSGAGEHITRAA  279

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKYGTE---KSAGILVVQAEAPRMDATGN  1315
              AR    ++ +  A       ++L S     +++G E     AGIL++  E  R+    +
Sbjct  280   LARSVVEAVDVPNADTHETIRRILLS-GLRGARHGPEDGLPHAGILLLMRE--RVGEATS  336

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKLVA*KC  1495
              P L       AF++ S  I Y  S   KPK        K  K+ +DE+     L A  C
Sbjct  337   VPRLW-----CAFTTESMAIAYASSMDPKPK-------KKLGKSVIDEWPYGRSLQASAC  384



>dbj|GAM17346.1| hypothetical protein SAMD00019534_005210, partial [Acytostelium 
subglobosum LB1]
Length=434

 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 119/258 (46%), Gaps = 61/258 (24%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTL-LGRIPPMFLVGEGARAWAKSKGVALPETIAEADE  601
             ++GV N I+ A A+L K++  G    LGRI P+ LV +GA+ WA + GV   +      +
Sbjct  87    VNGVCNPIKAAGAMLRKQREKGHYKSLGRIRPLMLVADGAKEWASNHGVDTYDK-----D  141

Query  602   VLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLD  781
              +   P+++           +T++ HN        L L R      + +   ++Y    D
Sbjct  142   SMMGDPLIT-------QQSNITYMNHNSR------LELHRH--TKHQQQYTDEQYYYYDD  186

Query  782   GAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVD  961
               + V+D  S                    +G  D          DE+ + DT+G I VD
Sbjct  187   NEQQVDDQES-------------------QHGVED----------DESLMYDTVGAIVVD  217

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWA--------SSKGPFGAPFIVGCCVSG  1117
               GH+A G SSGGI+LK  GRVG AA++GSGCWA        +S G   +  +     +G
Sbjct  218   WNGHVAAGVSSGGISLKHPGRVGEAALFGSGCWAQDELVIKRTSSGDGTSTTL--SIPAG  275

Query  1118  AGEYLMRGFAARECCVSL  1171
              GE +MRG  A+ECC  +
Sbjct  276   VGEQIMRGLMAKECCARM  293



>gb|EPB85673.1| hypothetical protein HMPREF1544_07580 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=316

 Score = 92.8 bits (229),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 93/190 (49%), Gaps = 22/190 (12%)
 Frame = +2

Query  890   DQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWA-S  1066
             D+  SQ+A   +   DT+G IC+DS G +A G SSGGI+LK  GRVG AAMYGSGCWA +
Sbjct  135   DEQESQSA---DLGHDTVGAICIDSHGDIAAGVSSGGISLKSPGRVGEAAMYGSGCWAQN  191

Query  1067  SKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSL---SISQAAPASACSK-VLRSVNQE  1234
              KG       V C  +G GE +MR     +C   L      QAA  +A +K  L S   E
Sbjct  192   EKGDLPG---VACSTTGTGEQIMRTMFTYKCVDRLLREDDMQAAVVNALNKDFLESPMLE  248

Query  1235  SSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVS  1414
                   +KS G + ++++         S     VE      +   GIGY  + M+ PK  
Sbjct  249   IYD---QKSVGTIALRSQ--------KSHGKTRVEFWFGHVTEDMGIGYLSNKMKAPKAF  297

Query  1415  ILRSTSKQSK  1444
             + R  S   K
Sbjct  298   VSRKASSNDK  307



>ref|XP_007864413.1| N-terminal nucleophile aminohydrolase [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ57291.1| N-terminal nucleophile aminohydrolase [Gloeophyllum trabeum ATCC 
11539]
Length=388

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 88/332 (27%), Positives = 140/332 (42%), Gaps = 93/332 (28%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + GV+N I+ AA    +       LGRIPPM LV  GAR +A S G           EV+
Sbjct  105   VPGVKNPIR-AARAVMDYSKRPDRLGRIPPMTLVSLGARQFAGSTGC----------EVV  153

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
              P                                    + L + + +  W+++K  LD  
Sbjct  154   SP------------------------------------EILTSPKAKKEWQRWKTRLD--  175

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                ++++     S++                            D +   DT+G + +D+ 
Sbjct  176   DPADNITPMLRESIE----------------------------DIHQRQDTVGAVVLDAA  207

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             GH+A G SSGG+ LK  GR+G AA++G+GCWA +         + C +SG+GEY+++   
Sbjct  208   GHLAGGVSSGGLLLKYPGRIGEAAVFGAGCWAQNMSTDRTTNGMACSISGSGEYIIQSTM  267

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKY----GTEKSAGILVVQAEAPRMDATGN  1315
             A+      S+ +    S    V R +    +K+     TE+SAG+L++  EA   D  G 
Sbjct  268   AQ------SLWREYHKSTEGDVHRLLKDVLTKFREDRDTERSAGVLMLTLEA---DEPGI  318

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKV  1411
             SP  +   +   F++ S  I Y  S+  KPKV
Sbjct  319   SPIPR---LWCGFTADSMAIAYATSADPKPKV  347



>emb|CEG75604.1| hypothetical protein RMATCC62417_10615 [Rhizopus microsporus]
Length=316

 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 19/175 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK--GPFGAPFIVGCC  1108
             DT+G +C+D  G+ A G SSGGI+LK  GRVG AAMYG GCWA ++  G  G    V C 
Sbjct  147   DTVGAVCIDQNGNTAAGVSSGGISLKFPGRVGEAAMYGCGCWAQNERNGVSG----VACS  202

Query  1109  VSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQES---SKYGTEKSAGILVV  1279
              +G GE +MR     +C   L  ++     A +  L++   +S     Y T KS GI+++
Sbjct  203   TTGTGEQIMRTMLTYKCASRLQ-TEDDIQKAMTDCLKNDFLDSPFLDIYDT-KSVGIIML  260

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSK  1444
             + +    D        + +E     ++   G+GY  S+  KPK  I R TS + +
Sbjct  261   RVQTLEND--------KRLEFWYGHTTEDMGVGYMSSTYSKPKTFISRKTSPKER  307



>ref|XP_002399557.1| asparaginase, putative [Ixodes scapularis]
 gb|EEC02647.1| asparaginase, putative [Ixodes scapularis]
Length=377

 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 86/290 (30%), Positives = 124/290 (43%), Gaps = 77/290 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             L  V N + +A  L + Q  G   LGRIPP FLVGEGA  WA++                
Sbjct  100   LPRVENPVLVAKALCEAQARGPLSLGRIPPCFLVGEGAFRWAQTH---------------  144

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  + + T S                            LVTE+ R    K+K      
Sbjct  145   -----LQVGTGSQ---------------------------LVTEQARRCHTKHK------  166

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                           K   +SE  L D   G    D   S+++    C+ DT+G +C+D  
Sbjct  167   --------------KRMRLSENWL-DAPCGLEGKDDDCSEHS---GCLLDTVGAVCLDKS  208

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI +K SGRVG A +YG GCWA +     A   V    SG GE+L++   
Sbjct  209   GNVAAAVSSGGIWMKHSGRVGQAGVYGCGCWAENSADGSA---VAVSTSGGGEHLIKTML  265

Query  1148  ARECCVSLSISQAAPASACSKVLRS--VNQESSKYGTEKSAGILVVQAEA  1291
             AR+C  +L +S    A+A     R+  ++    +  +EK  G+L ++A+A
Sbjct  266   ARQCADTL-LSAEDGATALHGCFRAGFLDSPFLQDVSEKLGGVLTLKADA  314



>emb|CEG75603.1| hypothetical protein RMATCC62417_10615 [Rhizopus microsporus]
Length=351

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 19/175 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK--GPFGAPFIVGCC  1108
             DT+G +C+D  G+ A G SSGGI+LK  GRVG AAMYG GCWA ++  G  G    V C 
Sbjct  182   DTVGAVCIDQNGNTAAGVSSGGISLKFPGRVGEAAMYGCGCWAQNERNGVSG----VACS  237

Query  1109  VSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQES---SKYGTEKSAGILVV  1279
              +G GE +MR     +C   L  ++     A +  L++   +S     Y T KS GI+++
Sbjct  238   TTGTGEQIMRTMLTYKCASRLQ-TEDDIQKAMTDCLKNDFLDSPFLDIYDT-KSVGIIML  295

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSK  1444
             + +    D        + +E     ++   G+GY  S+  KPK  I R TS + +
Sbjct  296   RVQTLEND--------KRLEFWYGHTTEDMGVGYMSSTYSKPKTFISRKTSPKER  342



>emb|CEG75601.1| hypothetical protein RMATCC62417_10615 [Rhizopus microsporus]
Length=359

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 90/175 (51%), Gaps = 19/175 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK--GPFGAPFIVGCC  1108
             DT+G +C+D  G+ A G SSGGI+LK  GRVG AAMYG GCWA ++  G  G    V C 
Sbjct  190   DTVGAVCIDQNGNTAAGVSSGGISLKFPGRVGEAAMYGCGCWAQNERNGVSG----VACS  245

Query  1109  VSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQES---SKYGTEKSAGILVV  1279
              +G GE +MR     +C   L  ++     A +  L++   +S     Y T KS GI+++
Sbjct  246   TTGTGEQIMRTMLTYKCASRLQ-TEDDIQKAMTDCLKNDFLDSPFLDIYDT-KSVGIIML  303

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSK  1444
             + +    D        + +E     ++   G+GY  S+  KPK  I R TS + +
Sbjct  304   RVQTLEND--------KRLEFWYGHTTEDMGVGYMSSTYSKPKTFISRKTSPKER  350



>ref|XP_006819493.1| PREDICTED: threonine aspartase 1-like [Saccoglossus kowalevskii]
Length=232

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 109/268 (41%), Gaps = 77/268 (29%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             + G++N I++A  L  E+  G   LGR+PP FL G+GA  WAK  G+          E +
Sbjct  25    IKGIKNPIKVAHCLLTEENKGLLSLGRVPPCFLTGDGAYTWAKEHGI----------EEI  74

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
              P  +++   LSSF  Y                    RQ L+T   R+            
Sbjct  75    HPDKMITENALSSFKKY--------------------RQKLLTCTKRD------------  102

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                    ++T N  K                R  D     N L      DT+G I +D  
Sbjct  103   ------CASTGNVHK---------------KRKTDMVCIDNEL-----LDTVGAISIDCH  136

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G+++   SSGGI+LK  GRVG AA+YG GCWA                +G GE+L++   
Sbjct  137   GNISSAVSSGGISLKQPGRVGQAAVYGCGCWAMKLSTTSVASS----TTGCGEHLLKTML  192

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQ  1231
             AR+C     +  A  +    + +R V Q
Sbjct  193   ARKC-----VESALGSECLDQAIRKVFQ  215



>dbj|GAA38679.1| taspase threonine aspartase 1 [Clonorchis sinensis]
Length=360

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 95/354 (27%), Positives = 138/354 (39%), Gaps = 95/354 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGS-TLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SG+RN I ++ LL KEQ+  S T LGR+ P  L G GA  WA  K  AL E        
Sbjct  96    VSGIRNPILLSHLLLKEQLRNSVTRLGRVQPTLLSGSGAVQWAALKKPALVE--------  147

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                             PY L                      V+ R+R  W+KY+     
Sbjct  148   ----------------PYNL----------------------VSHRSRTEWRKYR-----  164

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
              + +++V S      K       +LC                        DT+G +C+D 
Sbjct  165   -RWLSEVES------KPTEPPPKKLCTSP--------------------LDTVGAVCIDK  197

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
              G +A   SSGGIALK  GR+G A++YG GCWA  +   G    V    SG GE L+R  
Sbjct  198   GGSVAAAISSGGIALKQEGRIGQASIYGCGCWA-EESQLGK---VAVVTSGTGEQLIRTQ  253

Query  1145  AARECCVSLSISQAAPASACSKVLRSVNQESSKY---GTEKSAGILVVQAEAPRMDATGN  1315
              A++    L     AP     + + + +   S+       K AGI  +       DA   
Sbjct  254   LAQKAAERLLEPSPAPTPETLQSVITTDFIDSRLLANEEHKFAGIAGIYCP----DADSG  309

Query  1316  SPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIK  1477
             S     +E+    ++ S  + YF        ++ +   S +    VD FA R++
Sbjct  310   S-----IEVFFGHTTRSMSVAYFVEDAMPIPMAYVSRLSPEKPLRVDAFAHRLQ  358



>emb|CDH50762.1| threonine aspartase 1-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=330

 Score = 90.1 bits (222),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 93/176 (53%), Gaps = 21/176 (12%)
 Frame = +2

Query  929   ISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCW---ASSKGPFGAPFIV  1099
             + DT+G I VDSEGH+A G SSGGI+LKV GRVG AA+YGSGCW   A+ + P      V
Sbjct  162   VHDTVGAIGVDSEGHVAAGVSSGGISLKVPGRVGEAAVYGSGCWAQDATDESPG-----V  216

Query  1100  GCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESS--KYGTEKSAGIL  1273
              C  SG GE +MR     +C   ++  +    SA +  L+    +S   +   EKS G++
Sbjct  217   ACSTSGTGEQIMRTMITTKCAQRIT-QEDNIQSAVTTCLQKDFLDSPFLRMYDEKSVGMI  275

Query  1274  VVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQS  1441
              +     R  ++G       +E   A  + S GIG   S+ +KPK  I R +S  +
Sbjct  276   TL----CRDKSSGR------IEFWYAHVTESMGIGCMSSTAKKPKTFISRKSSNDA  321



>ref|XP_624615.1| PREDICTED: threonine aspartase 1-like isoform X2 [Apis mellifera]
Length=351

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 88/326 (27%), Positives = 126/326 (39%), Gaps = 98/326 (30%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+                 
Sbjct  98    VSGIKNPVLLAKRLCEHQSV-KIAYGRIPPSFLVGNGAHVWAQE----------------  140

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  M I TLS              EQ            L++ + + ++K YK  ++ +
Sbjct  141   -----MRIQTLSP-------------EQ------------LISTKAQKMYKHYKRKIENS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A  DV   T   +                                   DT+G ICVD E
Sbjct  171   NA--DVQKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDATGNSPFL  1327
             AR    ++S S     +    +          YG E+  G ++    AP+    G   FL
Sbjct  249   ARTVAEAISHSSCPITNLYHSMKADFIDSKFLYGLEQKLGGVIAIRYAPQ---EGLGDFL  305

Query  1328  QAVEIAAAFSSLSFGIGYFGSSMEKP  1405
                    + S+ S  IGY  S+ + P
Sbjct  306   W------SHSTNSMIIGYMNSNEQTP  325



>ref|XP_003696625.1| PREDICTED: threonine aspartase 1-like [Apis florea]
Length=351

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 92/332 (28%), Positives = 136/332 (41%), Gaps = 110/332 (33%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+                 
Sbjct  98    VSGIKNPVLLAKRLCEHQSV-KIAYGRIPPSFLVGNGAHVWAQE----------------  140

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  M I TL   PP          EQ            L++ + + ++K YK  ++ +
Sbjct  141   -----MRIQTL---PP----------EQ------------LISTKAQKMYKHYKRKIENS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A  DV   T   +                                   DT+G ICVD E
Sbjct  171   NA--DVQKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLSISQAAPASAC--SKVLRSVNQE--SSKY--GTEKSAGILVVQAEAPRMDAT  1309
             AR      ++++A   S+C  + +  S+  +   SK+  G E+  G ++    AP+    
Sbjct  249   AR------TVAEAISHSSCPITNLYHSMKADFIDSKFLCGLEQKLGGVIAIRYAPQ---E  299

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
             G   FL       + S+ S  IGY  S+ + P
Sbjct  300   GLGDFLW------SHSTNSMIIGYMNSNEQTP  325



>ref|XP_005644125.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19581.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
Length=713

 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 98/244 (40%), Gaps = 70/244 (29%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SGV N +++A  LA+ Q      LGR+ PMFL G+GAR WAK +G+    +   A    
Sbjct  111   VSGVENPVRVAGELAR-QSREPMALGRVRPMFLAGDGAREWAKEQGLPAAPSAEAA----  165

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                   QW +    +  W++YK M+D A
Sbjct  166   -------------------------------------SQWHINGAAQRRWQRYKRMIDEA  188

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                 +  S  A   K                          +L    + D   ++C    
Sbjct  189   VQSREAPSNPAGIHKKLP-----------------------SLQMYLVPD---IVCTSQA  222

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G +A   SSGGIA+K  GRVG AAM+G GCWA+     G P  V C V+G GE +MR   
Sbjct  223   GRVAASVSSGGIAMKTDGRVGEAAMFGCGCWAADSHS-GRP-AVACSVTGVGEAIMRAGL  280

Query  1148  AREC  1159
             AR C
Sbjct  281   ARAC  284



>ref|XP_003286025.1| hypothetical protein DICPUDRAFT_149945 [Dictyostelium purpureum]
 gb|EGC37461.1| hypothetical protein DICPUDRAFT_149945 [Dictyostelium purpureum]
Length=563

 Score = 91.7 bits (226),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 114/253 (45%), Gaps = 55/253 (22%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTL-LGRIPPMFLVGEGARAWAKSKGVALPETIAEADE  601
             +SGV+N I++   LL K+++ GST  LGR  P+ L GEGA+ WA++  +   ET  + + 
Sbjct  211   VSGVKNPIKLTCELLRKQKLNGSTKSLGRQRPIMLSGEGAKLWAQNHNI---ETFDKNNS  267

Query  602   VLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLD  781
             +L              P                         L+T++    W KYK  L+
Sbjct  268   IL------------GDP-------------------------LITQQANINWMKYKSKLE  290

Query  782   GAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVD  961
               K          N    C  +     + +N   +      Q   D N + DT+G I VD
Sbjct  291   DYKY---------NKNNQCYNNSNNNNNNNNNYENEYYEEEQVEEDTNQLYDTVGAISVD  341

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK---GPFGAPFIVGCCVSGAGEYL  1132
               G ++ G SSGGI LK  GRVG AA+YG+GCWA ++     F  P  V    +G GE L
Sbjct  342   WNGLISSGVSSGGILLKHPGRVGEAAIYGAGCWAQNELNVNGFKLPG-VAASATGVGEQL  400

Query  1133  MRGFAARECCVSL  1171
              +   ++ECC+ +
Sbjct  401   TKALISKECCLKI  413



>ref|XP_007317353.1| hypothetical protein SERLADRAFT_465070 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN99669.1| hypothetical protein SERLA73DRAFT_179800 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO25231.1| hypothetical protein SERLADRAFT_465070 [Serpula lacrymans var. 
lacrymans S7.9]
Length=365

 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 98/351 (28%), Positives = 142/351 (40%), Gaps = 109/351 (31%)
 Frame = +2

Query  428   LSGVRNAIQIA-ALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SGV+N +++A A+L   +      LGRIPP+ LV EGAR +A  +              
Sbjct  98    VSGVKNPVKLANAVLQASR--RRDQLGRIPPLTLVSEGARLFAAKE--------------  141

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                        L   PP                      + LV+ + +  W+K+K  LD 
Sbjct  142   ----------NLEIIPP----------------------ESLVSAKAKKDWEKWKTRLDS  169

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                                              +GD+S+ +       + DT+G +  D 
Sbjct  170   ---------------------------------EGDESAKEK-FTSVALQDTVGAVAWDG  195

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
             EG+MA G SSGGI LK SGR+G AA +GSGCWA      G    + C ++G GEY++R  
Sbjct  196   EGNMAAGVSSGGILLKYSGRIGEAATFGSGCWAHQSEDGG----MACSITGTGEYIVRTM  251

Query  1145  AARECCVSLSISQAAPASA-CSKVLRSVNQE------SSKYGTEKSAGILVVQAEAPRMD  1303
              AR    SL  +   PA     +VL+ V  +        +     +AG+L++  E   +D
Sbjct  252   LAR----SLGEALRKPADVDTHEVLQQVLVDQFWVPIHERGEPTPNAGVLLLTKE---ID  304

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSM--EKPKVSILRSTSKQSKTG  1450
                  P L       AF++ +  I Y  S      PK SILR   K S  G
Sbjct  305   DGQAIPRLW-----CAFTTETMAIAYASSEPGDTSPKSSILRR-PKNSHAG  349



>ref|XP_006618611.1| PREDICTED: threonine aspartase 1-like isoform X2 [Apis dorsata]
Length=351

 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 92/332 (28%), Positives = 136/332 (41%), Gaps = 110/332 (33%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+                 
Sbjct  98    VSGIKNPVLLAKRLCEHQSV-KIAYGRIPPSFLVGNGAHVWAQE----------------  140

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  M I TL   PP          EQ            L++ + + ++K YK  ++ +
Sbjct  141   -----MRIQTL---PP----------EQ------------LISTKAQKMYKHYKRKIENS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A  DV   T   +                                   DT+G ICVD E
Sbjct  171   NA--DVQKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLSISQAAPASAC--SKVLRSVNQE--SSKY--GTEKSAGILVVQAEAPRMDAT  1309
             AR      ++++A   S+C  + +  S+  +   SK+  G E+  G ++    AP+    
Sbjct  249   AR------TVAEAISHSSCPITNLYHSMKADFIDSKFLCGLEQKLGGVIAIRYAPQ---E  299

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
             G   FL       + S+ S  IGY  S+ + P
Sbjct  300   GLGDFLW------SHSTNSMIIGYMNSNEQMP  325



>gb|EFN66280.1| Threonine aspartase 1 [Camponotus floridanus]
Length=358

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 96/354 (27%), Positives = 143/354 (40%), Gaps = 103/354 (29%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L ++Q       GRIPP FLVG GA  WA   G+             
Sbjct  98    VSGIKNPVLLAKRLCEQQSI-KFAYGRIPPSFLVGNGAHIWAHEMGI-------------  143

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                         + PP                      + L++ R + ++K YK      
Sbjct  144   -----------QTLPP----------------------EQLISMRAQKIYKHYK------  164

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                          V+ C+V EAQ C K                      DT+G ICVD +
Sbjct  165   -----------RKVEDCSV-EAQKCVKKR-------------------MDTVGAICVDVD  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A ++G G WA     +     VG   SG GE+L+R   
Sbjct  194   GNIAAACSSGGIILKYPGRVGQAGVWGCGAWACKDTSYS----VGASTSGCGEHLVRTSL  249

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSK--YGTEKSAGILVVQAEAPRMDATGNSP  1321
             AR    ++S + + P ++  + + +V+   SK  YG E+  G ++    +P+    G   
Sbjct  250   ARTVAEAIS-NTSCPTTSLHQAM-NVDFIDSKFLYGLEQKLGGVIAIRYSPQ---EGLGD  304

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPK--VSILRSTSKQSKTGVDEFAARIK  1477
             FL       + S+ S  IGY  +    P   +S L S     K  V+    +IK
Sbjct  305   FLW------SHSTNSMIIGYMNTCQRTPMSYMSALPSHEVGKKAIVEGVCFKIK  352



>ref|XP_010077042.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like, partial 
[Pterocles gutturalis]
Length=230

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +2

Query  869   SNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
             S+G + GDQ    +  +++   DT+G + +D EG++A   SSGG+ALK  GRVG AA+YG
Sbjct  51    SDGGKGGDQIELYSLENDSGTLDTVGAVVIDQEGNVAAAVSSGGLALKHPGRVGQAALYG  110

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
              GCWA + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  111   CGCWAENTG-VHTPYSTAVSTSGCGEHLVRTILARECSWALQTEDAHQA  158



>ref|XP_006567758.1| PREDICTED: threonine aspartase 1-like isoform X1 [Apis mellifera]
Length=360

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 92/336 (27%), Positives = 133/336 (40%), Gaps = 109/336 (32%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+                 
Sbjct  98    VSGIKNPVLLAKRLCEHQSV-KIAYGRIPPSFLVGNGAHVWAQE----------------  140

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  M I TLS              EQ            L++ + + ++K YK  ++ +
Sbjct  141   -----MRIQTLSP-------------EQ------------LISTKAQKMYKHYKRKIENS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A  DV   T   +                                   DT+G ICVD E
Sbjct  171   NA--DVQKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLSISQAAPASACSKVLR--------SVNQESSK--YGTEKSAGILVVQAEAPR  1297
             AR    ++S S + P +     ++        + N   SK  YG E+  G ++    AP+
Sbjct  249   ARTVAEAISHS-SCPITNLYHSMKADFIGENSNTNFLDSKFLYGLEQKLGGVIAIRYAPQ  307

Query  1298  MDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
                 G   FL       + S+ S  IGY  S+ + P
Sbjct  308   ---EGLGDFLW------SHSTNSMIIGYMNSNEQTP  334



>gb|EFX79308.1| hypothetical protein DAPPUDRAFT_304827 [Daphnia pulex]
Length=369

 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 139/351 (40%), Gaps = 108/351 (31%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGST---LLGRIPPMFLVGEGARAWAKSKGVALPETIAEAD  598
             L  ++N I    ++ KE I       LLGR PP+ LVGEGA  +AK +G+ L        
Sbjct  100   LKSIKNPI----MVVKEIILYQNEPRLLGRTPPLVLVGEGASDFAKHRGLNL--------  147

Query  599   EVLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGML  778
                                      +HN               L++++    +KKYK  L
Sbjct  148   -------------------------VHN-------------STLISDKAMRKYKKYKERL  169

Query  779   DGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICV  958
             +                                SR    S  +  +  N   DT+GVIC+
Sbjct  170   EV-------------------------------SRKAFSSGLKITVQPNPSQDTVGVICI  198

Query  959   DSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR  1138
             D+ G +A  +SSGGIA+K+ GRVG   +YG GCWA      G    V    SG GE L++
Sbjct  199   DTNGDIASASSSGGIAMKLPGRVGQVPVYGCGCWAQHSSSGG----VAVSTSGCGEQLIQ  254

Query  1139  GFAARECCVSLSISQAAPASA-----CSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMD  1303
                A++   ++ + +  PA       C++ + S       Y  ++  G+LV       +D
Sbjct  255   TTLAKKLGQTI-LERGDPAFHLKELMCNEFIHSEILSDDVY--DRMGGVLVAYYSEDSID  311

Query  1304  ATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVD  1456
                          + AF++ S  +G+  ++ EK  V + R+TS  + T  +
Sbjct  312   ------------FSMAFTTESMVVGFMSTNHEKAIVRVSRNTSLATPTNAN  350



>ref|XP_006618610.1| PREDICTED: threonine aspartase 1-like isoform X1 [Apis dorsata]
Length=360

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 90/336 (27%), Positives = 133/336 (40%), Gaps = 109/336 (32%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+                 
Sbjct  98    VSGIKNPVLLAKRLCEHQSV-KIAYGRIPPSFLVGNGAHVWAQE----------------  140

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                  M I TL   PP                      + L++ + + ++K YK  ++ +
Sbjct  141   -----MRIQTL---PP----------------------EQLISTKAQKMYKHYKRKIENS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A  DV   T   +                                   DT+G ICVD E
Sbjct  171   NA--DVQKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLSISQAAPASACSKVLR--------SVNQESSKY--GTEKSAGILVVQAEAPR  1297
             AR    ++S S + P +     ++        + N   SK+  G E+  G ++    AP+
Sbjct  249   ARTVAEAISHS-SCPITNLYHSMKADFIGENSNTNFLDSKFLCGLEQKLGGVIAIRYAPQ  307

Query  1298  MDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
                 G   FL       + S+ S  IGY  S+ + P
Sbjct  308   ---EGLGDFLW------SHSTNSMIIGYMNSNEQMP  334



>ref|XP_001973171.1| GG13500 [Drosophila erecta]
 gb|EDV52197.1| GG13500 [Drosophila erecta]
Length=364

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/329 (28%), Positives = 131/329 (40%), Gaps = 85/329 (26%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +S V+N IQ+A  +   Q     LL RIPPM L G GA  +              ADEV 
Sbjct  92    VSRVKNPIQLARRICDAQ-SSPQLLERIPPMILAGTGAEHY--------------ADEV-  135

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                        S   P +L                      ++ + +  +  YK   D  
Sbjct  136   ---------GCSMVEPGVL----------------------ISSKAKFQFNHYKSKYD--  162

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
               VN +S  T+    T  V E            G++     ALD      T+G +CVD  
Sbjct  163   LVVNRLSKATSEEPVT--VPEP-----------GNEVELAAALD------TVGAVCVDGA  203

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +G GEYLM+   
Sbjct  204   GNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTTGNGEYLMKTLL  259

Query  1148  ARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAEAPRMDATGNSP  1321
             ARE C   + S     ++  K  +    +S     ++   AG L +             P
Sbjct  260   AREICHG-AFSSDCAVTSLHKTFKQKFLDSPLLPRQQDLYAGALTLLY----------YP  308

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                + E+  + ++ SF +GY  ++   PK
Sbjct  309   GQSSGEVMWSHTTQSFCVGYMATNQRVPK  337



>ref|XP_009917251.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like, partial 
[Haliaeetus albicilla]
Length=336

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 97/217 (45%), Gaps = 41/217 (19%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEV  604
             LSG++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P         
Sbjct  148   LSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPACP---------  198

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
               P  + +  +L++F        L    +  +I L   RQ                    
Sbjct  199   --PGIMATRFSLAAFKRNKRKLELAEKVETDLIQLKKRRQ--------------------  236

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                     S    S   C+V   +    ++G + GDQ    +  +++   DT+G + VD 
Sbjct  237   --------SNEKGSRVMCSVC-GRPPKANDGGKGGDQIELYSLENDSGTLDTVGAVVVDQ  287

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKG  1075
             EG++A   SSGG+ALK  GRVG AA+YG GCWA + G
Sbjct  288   EGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTG  324



>ref|XP_010303339.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like, partial 
[Balearica regulorum gibbericeps]
Length=423

 Score = 88.2 bits (217),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +2

Query  869   SNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
             ++G + GDQ    +  +++   DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG
Sbjct  236   NDGGKGGDQIELYSPENDSGTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYG  295

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
              GCWA + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  296   CGCWAENTGAH-TPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  343



>ref|XP_010289380.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like, partial 
[Phaethon lepturus]
Length=260

 Score = 85.9 bits (211),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +2

Query  869   SNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
             ++G + GDQ       +++   DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG
Sbjct  51    NDGGKGGDQIELYLPENDSGTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYG  110

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
              GCWA + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  111   CGCWAENTGAH-TPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  158



>emb|CDS11750.1| hypothetical protein LRAMOSA04013 [Absidia idahoensis var. thermophila]
Length=330

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 88/168 (52%), Gaps = 17/168 (10%)
 Frame = +2

Query  929   ISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCC  1108
             + DT+G I VDSEGH+A G SSGGI+LK+ GRVG AA+YGSGCWA        P  V C 
Sbjct  162   VHDTVGAIGVDSEGHVAAGVSSGGISLKIPGRVGEAAVYGSGCWAQDATD-DLP-AVACS  219

Query  1109  VSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQES---SKYGTEKSAGILVV  1279
              SG GE +MR     +C   ++  +    SA +  L+    +S     Y T KS G++ +
Sbjct  220   TSGTGEQIMRTMITTKCAQRIT-QEDNIQSAVTTCLQEDFLDSPFLQMYDT-KSVGMITL  277

Query  1280  QAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
                  R  ++G       +E   A  + S GIG   S+ +KPK  I R
Sbjct  278   ----CRHKSSGR------IEFWYAHVTESMGIGCMSSTAKKPKTFISR  315



>ref|XP_004530807.1| PREDICTED: threonine aspartase 1-like [Ceratitis capitata]
Length=364

 Score = 86.7 bits (213),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 104/214 (49%), Gaps = 17/214 (8%)
 Frame = +2

Query  773   MLDGAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVI  952
             M+D +  ++  +  + N  K+   + +   +  NG+  G  +++  +  +    DT+G +
Sbjct  139   MIDASAMISSKAKFSYNHYKSKIATISSAAEGGNGTSIGMSTTAAVSTSQVSALDTVGAV  198

Query  953   CVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYL  1132
             CVDS G+ A G SSGG+ LKV GR+G AA YG+GCWA+          V  C +G GEYL
Sbjct  199   CVDSAGNTAAGCSSGGLLLKVPGRIGQAATYGAGCWATDSTEVS----VATCTTGNGEYL  254

Query  1133  MRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAEAPRMDA  1306
             M+   A+E C  L  +  A  ++  K +++   ES     ++   AG L +         
Sbjct  255   MKTLLAKEICGDLLTTDCA-VTSLHKSIKNKFLESPFLPADQDLYAGALSLIYY------  307

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                 P     E+  + ++ SF +GY  +  + PK
Sbjct  308   ----PHANTGEVLWSHTTKSFCVGYMSTQQKAPK  337



>ref|XP_001627789.1| predicted protein [Nematostella vectensis]
 gb|EDO35689.1| predicted protein [Nematostella vectensis]
Length=227

 Score = 85.1 bits (209),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/241 (27%), Positives = 100/241 (41%), Gaps = 79/241 (33%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFPF  616
             V+N  Q+A  + +++I G   LG +PP+FLVGEGA  WA+  G+                
Sbjct  65    VKNPSQVAHHILRDEIKGPKTLGLVPPVFLVGEGAECWARDYGIPG--------------  110

Query  617   PVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKAV  796
                                             +  Q L+TE++   + +YK  L      
Sbjct  111   --------------------------------VTEQSLITEKSLASYHRYKERL------  132

Query  797   NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHM  976
                     NS K   + + +            Q      + E+   DT+GV+CVD+ G +
Sbjct  133   --------NSTKPSELHQPK-----------KQKLDDMDVLEDSSLDTVGVVCVDTAGCV  173

Query  977   ACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARE  1156
             + G+SSGG+ LK  GRVG AA+YG+GC+A +             V   GE L++   A+E
Sbjct  174   SAGSSSGGLLLKKPGRVGQAAVYGAGCYARN--------TTHSSVKRCGELLIKTLLAKE  225

Query  1157  C  1159
             C
Sbjct  226   C  226



>ref|XP_008942159.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like [Merops 
nubicus]
Length=221

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +2

Query  869   SNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
             S G + GDQ   ++  + +   DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG
Sbjct  12    SGGGKGGDQIELRSPENVSGTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYG  71

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
              GCWA + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  72    CGCWAENTGAH-TPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  119



>ref|XP_973095.1| PREDICTED: threonine aspartase 1 [Tribolium castaneum]
Length=348

 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 88/175 (50%), Gaps = 16/175 (9%)
 Frame = +2

Query  905   QNALD--ENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGP  1078
             Q  LD   N + DT+G +CVD+ GH+A G SSGGI LK  GRVG AA+Y SG WA S  P
Sbjct  160   QKLLDSRNNELLDTVGAVCVDNSGHVAAGCSSGGILLKRPGRVGQAAVYASGAWADSFSP  219

Query  1079  FGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVL--RSVNQESSKYGT  1252
                   V  C SG GE+LMR   A+E    +  S A P    S+ +  + +N    K  +
Sbjct  220   -ETENSVAVCTSGCGEHLMRTQLAKEIAEDVK-SSACPTIGLSQSITDKFLNSRFLKNVS  277

Query  1253  EKSAGILVVQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSI  1417
              K  G LV+  +    + TG+S  L       A ++ S  IG+     E PK  I
Sbjct  278   TKLCGALVLHID----NKTGDSAVLW------AHTTESMSIGFMKCGDENPKALI  322



>ref|XP_007767078.1| N-terminal nucleophile aminohydrolase, partial [Coniophora puteana 
RWD-64-598 SS2]
 gb|EIW83269.1| N-terminal nucleophile aminohydrolase, partial [Coniophora puteana 
RWD-64-598 SS2]
Length=361

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 136/351 (39%), Gaps = 103/351 (29%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SGV+N I+ AA    E       LGRI PM LVG GA  +A S G+ +           
Sbjct  100   VSGVKNPIR-AARAVLEHSREPDPLGRIRPMTLVGAGAHTFAHSSGIEI-----------  147

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                           PP                      + L++ R +  W K+   L+ +
Sbjct  148   -------------VPP----------------------ESLISSRAKADWTKWTMRLERS  172

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
             KA                               G       +L E  + DT+G + +D+ 
Sbjct  173   KA------------------------------GGPAVDDSESLPEEAMQDTVGAVVLDAR  202

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMR---  1138
             G+MA   SSGG+ LK SGRVG AA++G+GCWA      G    + C VSG GE++ R   
Sbjct  203   GNMAACVSSGGLLLKYSGRVGEAAIFGAGCWAQQSSAGG----MACSVSGGGEHIARCSL  258

Query  1139  ----GFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKSAGILVVQAEAPRMDA  1306
                 G A  + C +  + Q       S+ L++  +       +  AG+L++  EA     
Sbjct  259   ARALGEALHDPCDAHEVLQDVLTRKFSRPLQARGER------DPQAGMLLLTKEASESGD  312

Query  1307  TGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDE  1459
             T          +   F++ +  +GY       P++ +LR   + +  G DE
Sbjct  313   T-------RARLWCGFTTKTMAVGYATWPGSSPRIKVLR--RETTSAGDDE  354



>ref|XP_009512283.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1-like, partial 
[Phalacrocorax carbo]
Length=282

 Score = 85.1 bits (209),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 63/109 (58%), Gaps = 1/109 (1%)
 Frame = +2

Query  869   SNGSRDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYG  1048
             ++G + GDQ       +++   DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG
Sbjct  73    NDGGKGGDQIELYLPENDSGTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYG  132

Query  1049  SGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
              GCWA + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  133   CGCWAENTGAH-TPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  180



>gb|KFQ78889.1| Threonine aspartase 1, partial [Phaethon lepturus]
Length=200

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  43    DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  101

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  102   GCGEHLVRTILARECSCALQTEDAHQA  128



>ref|XP_001353268.1| GA18757 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002020973.1| GL25099 [Drosophila persimilis]
 gb|EAL30771.1| GA18757 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW40129.1| GL25099 [Drosophila persimilis]
Length=366

 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 80/164 (49%), Gaps = 25/164 (15%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVDS G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  195   DTVGAVCVDSSGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDDLA----IATCTT  250

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASA----CSKVLRS--VNQESSKYGTEKSAGILV  1276
             G GEYLM+   ARE C     S  A  S       K L S  + Q+   Y     AG L 
Sbjct  251   GNGEYLMKTLLAREICNGAFTSDCAVTSLHKTFTQKFLDSPLLPQQQDLY-----AGALT  305

Query  1277  VQAEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
             +             P   + E+  + ++ SF +GY  ++ + PK
Sbjct  306   LLY----------YPKQSSGEVMWSHTTQSFCVGYMATTQKVPK  339



>gb|KHG07618.1| hypothetical protein F383_34399 [Gossypium arboreum]
Length=66

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  1310  GNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTGVDEFAARIKL  1480
             GN P L+A+EIAAA+SSLSFGIG FGS ME+PKVSILR + +Q++ G+D F AR+ +
Sbjct  8     GNPPKLKAIEIAAAYSSLSFGIGCFGSGMERPKVSILRRSKQQNRNGIDHFEARVDV  64



>ref|XP_639126.1| hypothetical protein DDB_G0283269 [Dictyostelium discoideum AX4]
 gb|EAL65775.1| hypothetical protein DDB_G0283269 [Dictyostelium discoideum AX4]
Length=589

 Score = 87.8 bits (216),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 112/252 (44%), Gaps = 56/252 (22%)
 Frame = +2

Query  440   RNAIQIAALLAKEQIC-GSTL-LGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFP  613
             +N I+++A L ++Q+  G+T  LGR  PM LVGEGA+ WA + G+   ET  +++++L  
Sbjct  223   KNPIKLSAELLRKQLHKGNTKSLGRQRPMILVGEGAKEWASNHGL---ETF-DSNQLLLG  278

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
              P                                    L+T+++   W KYK  L+  K 
Sbjct  279   DP------------------------------------LITQQSNVNWLKYKSKLENFKN  302

Query  794   VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGH  973
                                    +  N + + + +          + DT+G I VD  G+
Sbjct  303   FKHYYKQQEQQQDEQQQQHYNEDENENENENDEGNGD--------LYDTVGAIVVDWNGN  354

Query  974   MACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPF---GAPFI---VGCCVSGAGEYLM  1135
             ++ G SSGGI LK SGRVG AA++G+GCWA ++        P     V    +G GE L 
Sbjct  355   ISSGVSSGGIILKHSGRVGEAAVFGAGCWAQNELTILNNNKPIKLAGVASSATGVGEQLT  414

Query  1136  RGFAARECCVSL  1171
             R   ++ECC+ +
Sbjct  415   RSLISKECCLKI  426



>gb|EFA80354.1| putative asparaginase 2 [Polysphondylium pallidum PN500]
Length=449

 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 97/218 (44%), Gaps = 57/218 (26%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFI------  1096
             DT+G I VD  GH+A G SSGGI+LK  GRVG AA++GSGCWA  +      F+      
Sbjct  237   DTVGAIVVDENGHIASGVSSGGISLKHRGRVGEAALFGSGCWAQDE-----LFLESNGKS  291

Query  1097  ---VGCCVSGAGEYLMRGFAARECCVSLSISQAAPA------------SAC--SKVLRSV  1225
                V C  +G GE++MR   +++CC+++  + A  A            S C  +   R+ 
Sbjct  292   IPGVACSSTGVGEHIMRSMTSKQCCLAMQNNYADLAIKSYFENQLLNHSDCFGNHFERTT  351

Query  1226  N-----------------------QESSKYGTEKSAGILVVQAEAPRMDATGNSPFLQAV  1336
             N                       Q  +  G E+ AG++ ++ +  R   TG       +
Sbjct  352   NIDKQDKEIEEKLEEEEEEEEYSTQSYNGSGDERLAGVIAIRKQTDR--NTGKMD----I  405

Query  1337  EIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQSKTG  1450
             E+  A S+ S GIGY  S       S+L   +  S  G
Sbjct  406   ELVWAHSTYSMGIGYISSKDNFKAHSLLSRINDDSPVG  443



>emb|CDX78005.1| BnaA09g32000D [Brassica napus]
Length=414

 Score = 86.3 bits (212),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 61/114 (54%), Gaps = 24/114 (21%)
 Frame = +2

Query  899   SSQNALDENCISDTIGVICVDSEG------------HMACGASSGG-IALK---------  1012
             ++   LD        GV+ VD +G            HM  G   G  + LK         
Sbjct  301   AANYGLDPLIFMANAGVLGVDLDGKPIALYHDHKLSHMTTGVKIGRYLYLKDTLLVGPPQ  360

Query  1013  --VSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVS  1168
               +SGRVGLA+ YG G WAS K  FGAPF+VGCCVSGAG+YL RGFAA ECC S
Sbjct  361   VVISGRVGLASTYGFGLWASFKELFGAPFLVGCCVSGAGKYLKRGFAAIECCTS  414



>gb|AFW59943.1| L-asparaginase family protein [Zea mays]
Length=283

 Score = 84.3 bits (207),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 82/174 (47%), Gaps = 45/174 (26%)
 Frame = +2

Query  437  VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVLFPF  616
            V+N IQ+A  LAKEQ+ G +LLGRIPPMFLVGEGA  WAKSKG+ L E+ +EA+      
Sbjct  150  VKNPIQVALHLAKEQMAGPSLLGRIPPMFLVGEGAYQWAKSKGMDLVESTSEAN------  203

Query  617  PVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKAV  796
                                                WLVTE  R  W KY  +L   K  
Sbjct  204  -----------------------------------SWLVTENARAQWVKYTSLLVNTKK-  227

Query  797  NDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENC--ISDTIGVI  952
            +   ST + S       EAQ  +  N + D     +++ + +N   I+DT+GVI
Sbjct  228  SLYHSTGSGSEHHSVQLEAQGTESENIA-DAKNIFTESFMGDNTDHITDTVGVI  280



>gb|EMD37889.1| hypothetical protein CERSUDRAFT_50827 [Ceriporiopsis subvermispora 
B]
Length=373

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/340 (26%), Positives = 137/340 (40%), Gaps = 80/340 (24%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             ++G++N +++A ++  E       LGRIPP+ L G GA  +A   G+   ET+    +V 
Sbjct  98    VTGIKNPVKLARVVL-EHSRRPDPLGRIPPLLLTGHGAAQFAAMSGI---ETVGSESQV-  152

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                                                         R +  W  +K +LD A
Sbjct  153   ------------------------------------------APRVQREWSHWKSILDSA  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
              A    +ST  +S  T                  +QS    A     + DT+G +  D  
Sbjct  171   TA----ASTQQDSQYT------------------NQSILDAAESLYALQDTVGAVAWDQL  208

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
               ++ G SSGG+ LK  GR+G AA YG+GCWA+          V C VSGAGEY++R   
Sbjct  209   SGLSAGVSSGGLLLKHPGRIGEAATYGAGCWANMTPDRNR--AVACSVSGAGEYIIRTLL  266

Query  1148  ARECCVSLSISQAAPAS-ACSKVLRSVNQESSKYG-TEKSAGILVVQAEAPRMDATGNSP  1321
             AR+   ++  S          ++L+  +++    G  +  AG+L++  E     A G   
Sbjct  267   ARKIAETIIFSDPNDTHDVLGRILQQFHEDCRARGEPDPHAGVLLLLRE---QSAEG---  320

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILRSTSKQS  1441
              +    +  AF++ S  I Y  S   KP+V +   T   S
Sbjct  321   -VIIPRLWCAFTTESMAIAYALSLDAKPQVRLATRTHLNS  359



>ref|XP_002086512.1| GE22812 [Drosophila yakuba]
 gb|EDW99913.1| GE22812 [Drosophila yakuba]
Length=298

 Score = 84.0 bits (206),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  127   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  182

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   ARE C     S  A  ++  K  +    +S     E+   AG L +   
Sbjct  183   GNGEYLMKTLLAREICHGAFSSDCA-VTSLHKTFKQKFLDSPLLPREQDLYAGALTLLY-  240

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P   + E+  + ++ SF +GY  ++   PK
Sbjct  241   ---------YPGQSSGEVMWSHTTQSFCVGYMATNQRVPK  271



>gb|KFU99535.1| Threonine aspartase 1, partial [Pterocles gutturalis]
Length=200

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + +D EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  43    DTVGAVVIDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTG-VHTPYSTAVSTS  101

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  102   GCGEHLVRTILARECSWALQTEDAHQA  128



>ref|XP_004475331.1| PREDICTED: threonine aspartase 1 isoform 1 [Dasypus novemcinctus]
Length=420

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 90/170 (53%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC ++L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  292   GCGEHLVRTILARECSLALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  346

Query  1280  QA-EAP-RMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++   P   DA+ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  347   RSCRCPAEPDASQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_004610973.1| PREDICTED: threonine aspartase 1 [Sorex araneus]
Length=420

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 90/172 (52%), Gaps = 18/172 (10%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGARN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  346

Query  1280  Q----AEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             +    +E P  D+T N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  347   RSCRCSEEP--DSTQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_003134306.3| PREDICTED: threonine aspartase 1 isoform X1 [Sus scrofa]
Length=420

 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 88/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKSAGIL--VVQ  1282
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +  G+L  V+ 
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASED-GVLGGVIV  345

Query  1283  AEAPRMDATGNSPFLQA---VEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
               + R  A  NSP  +    VE   + ++ S  +GY  +   K K  I R
Sbjct  346   LRSCRCSAEPNSPQNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_009231585.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1, partial 
[Pongo abelii]
Length=264

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  169   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  227

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  228   GCGEHLVRTILARECSHALQAEDAHQA  254



>ref|XP_003493403.1| PREDICTED: threonine aspartase 1-like [Bombus impatiens]
Length=351

 Score = 84.0 bits (206),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 98/249 (39%), Gaps = 89/249 (36%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L + Q       GRIPP FLVG GA  WA+  G+             
Sbjct  98    VSGIKNPVSLAKRLCEYQSI-KIAYGRIPPSFLVGNGAHVWAQEMGI-------------  143

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
                         + PP          EQ            L++ + + ++K YK  ++ +
Sbjct  144   -----------QTLPP----------EQ------------LISTKAQKMYKHYKRKIESS  170

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                 DV   T   +                                   DT+G ICVD E
Sbjct  171   DI--DVHKYTKQRM-----------------------------------DTVGAICVDKE  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A M+G G WA     +   + +G   SG GE+L+R   
Sbjct  194   GNIAGACSSGGIILKYPGRVGQAGMWGCGTWA-----YKDKYSIGTSTSGCGEHLIRTLL  248

Query  1148  ARECCVSLS  1174
             AR    ++S
Sbjct  249   ARTTAEAIS  257



>gb|KDR17252.1| hypothetical protein L798_08817, partial [Zootermopsis nevadensis]
Length=321

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 81/158 (51%), Gaps = 13/158 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD+ G +A   SSGG+ALK  GRVG AA YG GCWAS+ G    P  V  C S
Sbjct  176   DTVGAVCVDAYGDVAAACSSGGLALKHPGRVGQAATYGCGCWASN-GTSHVPS-VATCTS  233

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESS-KYGTEKSAGILVVQAEA  1291
             G GEYL+R   ARE  + +    +   +   KV+++   ES   +G E+  G L++    
Sbjct  234   GCGEYLVRTMLAREAALEVQ-KNSCSVTGLHKVMKTKFMESPFLHGVEEKIGGLILLKCF  292

Query  1292  PRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKP  1405
             P  D TG        E     SS +  + Y   +  +P
Sbjct  293   PN-DETG--------EFVWTHSSKTMCVSYMSDAERRP  321



>ref|XP_005019859.1| PREDICTED: threonine aspartase 1 isoform X3 [Anas platyrhynchos]
Length=343

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_008541037.1| PREDICTED: threonine aspartase 1-like [Equus przewalskii]
Length=280

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  112   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  170

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  171   GCGEHLVRTILARECSHALQAEDAHQA  197



>ref|XP_010189511.1| PREDICTED: LOW QUALITY PROTEIN: threonine aspartase 1, partial 
[Mesitornis unicolor]
Length=181

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 94/214 (44%), Gaps = 46/214 (21%)
 Frame = +2

Query  437   VRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGV-ALPETIAEADEVLFP  613
             ++N + +A  L  E   G    GRIPP FLVGEGA  WA   G+ A P            
Sbjct  1     IKNPVSVANRLLYEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIPACP------------  48

Query  614   FPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGAKA  793
                         P + L     N  ++++   +      + +R ++  K  + ML     
Sbjct  49    ------------PGFSLAAFKRNKRKLELAEKVETDLIQLKKRRQSNEKGSRVML-----  91

Query  794   VNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSEGH  973
                  ST     K            ++G + G+Q    +  +++   DT+G + VD EG+
Sbjct  92    -----STCGRPPKA-----------NDGGKGGEQIELHSLENDSGTLDTVGAVVVDQEGN  135

Query  974   MACGASSGGIALKVSGRVGLAAMYGSGCWASSKG  1075
             +A   SSGG+ALK  GRVG AA+YG GCWA + G
Sbjct  136   VAAAVSSGGLALKHPGRVGQAALYGCGCWAENTG  169



>gb|EZA61590.1| Threonine aspartase [Cerapachys biroi]
Length=357

 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 95/347 (27%), Positives = 141/347 (41%), Gaps = 103/347 (30%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGSTLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEVL  607
             +SG++N + +A  L ++Q       GRIPP FLVG GA  WA   G+          + L
Sbjct  98    VSGIKNPVFLAKRLCEQQSI-KFAYGRIPPSFLVGSGAHIWANEMGI----------QTL  146

Query  608   FPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDGA  787
              P  ++SI                                    R +  +K YK      
Sbjct  147   SPDQLISI------------------------------------RAQKTYKHYK------  164

Query  788   KAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDSE  967
                          V++C+V E Q C K                      DT+G ICVD +
Sbjct  165   -----------RKVESCSV-EVQKCAKRR-------------------MDTVGAICVDDD  193

Query  968   GHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFA  1147
             G++A   SSGGI LK  GRVG A ++G G WA       A + +G   SG GE+L+R   
Sbjct  194   GNIAAACSSGGIILKYPGRVGQAGVWGCGAWACKD----ASYSIGASTSGCGEHLVRTSL  249

Query  1148  ARECCVSLSISQAA-PASACSKVLRSVNQESS-KYGTEKSAGILVVQAEAPRMDATGNSP  1321
             AR   V+ +IS A+ P ++  + + +   +S   YG E+  G ++    +P+    G   
Sbjct  250   ART--VAEAISTASCPTTSLHQAMSADFIDSKFLYGLEQKLGGVIAVRYSPQ---EGLGD  304

Query  1322  FLQAVEIAAAFSSLSFGIGYFGSSMEKPK--VSILRSTSKQSKTGVD  1456
             FL       + S+ S  IGY  +    P   +S+L S     K  V+
Sbjct  305   FLW------SHSTNSMIIGYMNTCGRAPMSYMSVLPSHEAGKKAIVE  345



>gb|EUB63732.1| Threonine aspartase [Echinococcus granulosus]
 emb|CDS15890.1| threonine aspartase 1 [Echinococcus granulosus]
Length=371

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 92/358 (26%), Positives = 147/358 (41%), Gaps = 98/358 (27%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGS-TLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +S V+N IQI   L  + + G  + +GR+ P+ L G+GAR WA                 
Sbjct  96    VSCVKNPIQIPKHLILQHLTGPVSPIGRVKPLSLCGDGARRWAS----------------  139

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                                       +  ++I    L    L++   +N W++Y+G++D 
Sbjct  140   -------------------------EVAGIQI----LPDHCLISHAAKNRWRRYRGLVD-  169

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
                  +   + A+S+   +             R GD+             DT+G +C+D+
Sbjct  170   -----ERDRSVASSIDEIS--------HFKKPRHGDKL------------DTVGAVCLDT  204

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFI-VGCCVSGAGEYLMRG  1141
              G++   +SSGGI LK+ GR+G A +YG G WA        P + VGC  SG GE L++ 
Sbjct  205   SGNICAASSSGGIPLKLKGRLGQACVYGCGSWAEV-----TPAVSVGCVTSGTGEQLIKT  259

Query  1142  FAARECCVSL------SISQAAPASACSKVLRS---VNQESSKYGTEKSAGILVVQAEAP  1294
               A+     +      S+     AS     L S    N+ +SK G     GI+ +     
Sbjct  260   QLAQRVASKILKRTDGSLPNIVNASFQEDFLDSRFLSNETTSKLG-----GIVGIGNTGD  314

Query  1295  RMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSS-MEKPKVSILRSTSKQSKTGVDEFA  1465
               D   +S     VE     S+ S   G++ S+ M KP V++ R  S+   TG D +A
Sbjct  315   ARDPLSSS----VVEFFFKHSTESLAYGFYISNQMTKPLVAVSRK-SRTLPTGSDYYA  367



>ref|XP_006189337.1| PREDICTED: threonine aspartase 1, partial [Camelus ferus]
Length=328

 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_002095245.1| GE19799 [Drosophila yakuba]
 gb|EDW94957.1| GE19799 [Drosophila yakuba]
Length=365

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  194   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  249

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   ARE C   + S     ++  K  +    +S     E+   AG L +   
Sbjct  250   GNGEYLMKTLLAREICHG-AFSSDCAVTSLHKTFKQKFLDSPLLPREQDLYAGALTLLY-  307

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P   + E+  + ++ SF +GY  ++   PK
Sbjct  308   ---------YPGQSSGEVMWSHTTQSFCVGYMATNQRVPK  338



>ref|XP_004412922.1| PREDICTED: threonine aspartase 1, partial [Odobenus rosmarus 
divergens]
Length=328

 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>emb|CDJ03419.1| threonine aspartase 1 [Echinococcus multilocularis]
 emb|CDS40701.1| threonine aspartase 1 [Echinococcus multilocularis]
Length=371

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 150/359 (42%), Gaps = 100/359 (28%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGS-TLLGRIPPMFLVGEGARAWA-KSKGVALPETIAEADE  601
             +S V+N IQI   L  + + G  + +GR+ P+ L G+GAR WA +  G+ +         
Sbjct  96    VSCVKNPIQIPKHLILQHLTGPVSPIGRVKPLSLCGDGARRWASEVAGIQI---------  146

Query  602   VLFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLD  781
                             P Y L                      ++   R+ W++Y+G++D
Sbjct  147   ---------------LPDYRL----------------------ISHAARSRWRRYRGLVD  169

Query  782   GAKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVD  961
                   +   + A+S+      E     K    R GD+             DT+G +C+D
Sbjct  170   ------EHDRSVASSI-----DERSHFKKP---RQGDKL------------DTVGAVCLD  203

Query  962   SEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFI-VGCCVSGAGEYLMR  1138
             + G++   +SSGGI LK+ GR+G A +YG G WA        P + VGC  SG GE L++
Sbjct  204   TSGNICAASSSGGIPLKLKGRLGQACVYGCGSWAEV-----TPTVSVGCVTSGTGEQLIK  258

Query  1139  GFAARECCVSL------SISQAAPASACSKVLRS---VNQESSKYGTEKSAGILVVQAEA  1291
                A+     +      S+     AS     L S    N+ +SK G     GI+ + +  
Sbjct  259   TQLAQRVASKILDRTGGSLPNIVNASFQEDFLDSRFLSNETTSKLG-----GIVGIGSTG  313

Query  1292  PRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSS-MEKPKVSILRSTSKQSKTGVDEFA  1465
                D   +S     VE     S+ S   G++ S+ M KP V++ R  S+   TG D +A
Sbjct  314   DARDPLSSS----VVEFFFKHSTESLAYGFYISNQMTKPLVAVSRK-SRTLPTGSDYYA  367



>ref|XP_009554791.1| PREDICTED: threonine aspartase 1 [Cuculus canorus]
Length=420

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = +2

Query  893   QSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK  1072
             + S++  +D   + DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + 
Sbjct  220   RQSNEKVIDSGTL-DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENT  278

Query  1073  GPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
             G   +P+      SG GE+L+R   AREC  +L    A  A
Sbjct  279   GAH-SPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_010130662.1| PREDICTED: threonine aspartase 1, partial [Buceros rhinoceros 
silvestris]
Length=195

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 86/170 (51%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  8     DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  66

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKSAGIL--VVQ  1282
             G GE+L+R   AREC  +L    A  A     +L ++  +   S +   +  G+L  V+ 
Sbjct  67    GCGEHLVRTILARECSCALQTEDAHQA-----LLETMQNKFIGSPFLANED-GVLGGVIV  120

Query  1283  AEAPRMDATGNSPFLQA---VEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
               + R  A   SP  +    VE   + ++ S  +GY  +   K K  I R
Sbjct  121   LRSCRCSADPESPQEKPTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISR  170



>ref|XP_005445653.1| PREDICTED: threonine aspartase 1 isoform X1 [Falco cherrug]
Length=445

 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 61/105 (58%), Gaps = 1/105 (1%)
 Frame = +2

Query  881   RDGDQSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCW  1060
             + GDQ    +  +++   DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCW
Sbjct  240   KGGDQIELYSQENDSGTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCW  299

Query  1061  ASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
             A + G    P+      SG GE+L+R   AREC  +L    A  A
Sbjct  300   AENTGAH-TPYSTAVSTSGCGEHLVRTILARECSCALQTEDAHQA  343



>gb|ELR51831.1| Threonine aspartase 1, partial [Bos mutus]
Length=329

 Score = 82.8 bits (203),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_008961164.1| PREDICTED: threonine aspartase 1 isoform X2 [Pan paniscus]
Length=365

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  178   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  236

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  237   GCGEHLVRTILARECSHALQAEDAHQA  263



>ref|XP_004687218.1| PREDICTED: threonine aspartase 1 [Condylura cristata]
Length=420

 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA YG GCWA + G +  P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAAHYGCGCWAENTGTYN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  346

Query  1280  QA--EAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++   +   D+T N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  347   RSCRCSAEPDSTQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_003788055.1| PREDICTED: threonine aspartase 1 [Otolemur garnettii]
Length=407

 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 88/169 (52%), Gaps = 13/169 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  221   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  279

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  280   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  334

Query  1280  QA-EAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++      D++ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  335   RSCRCSEADSSQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  382



>emb|CDH50763.1| threonine aspartase 1-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=268

 Score = 82.0 bits (201),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 52/80 (65%), Gaps = 8/80 (10%)
 Frame = +2

Query  929   ISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCW---ASSKGPFGAPFIV  1099
             + DT+G I VDSEGH+A G SSGGI+LKV GRVG AA+YGSGCW   A+ + P      V
Sbjct  162   VHDTVGAIGVDSEGHVAAGVSSGGISLKVPGRVGEAAVYGSGCWAQDATDESPG-----V  216

Query  1100  GCCVSGAGEYLMRGFAAREC  1159
              C  SG GE +MR     +C
Sbjct  217   ACSTSGTGEQIMRTMITTKC  236



>ref|XP_004661510.1| PREDICTED: threonine aspartase 1 [Jaculus jaculus]
Length=380

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 90/173 (52%), Gaps = 20/173 (12%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  193   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  251

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  252   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  306

Query  1280  Q-----AEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             +     AEA   D++ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  307   RSCRCSAEA---DSSQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  355



>ref|XP_009435095.1| PREDICTED: threonine aspartase 1 isoform X3 [Pan troglodytes]
Length=372

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  178   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  236

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  237   GCGEHLVRTILARECSHALQAEDAHQA  263



>ref|XP_007525860.1| PREDICTED: threonine aspartase 1 [Erinaceus europaeus]
Length=420

 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGVHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  346

Query  1280  QAEAPRM--DATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++    M  D+T N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  347   RSCRCSMEPDSTHNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_009491932.1| PREDICTED: threonine aspartase 1 [Pelecanus crispus]
Length=419

 Score = 83.6 bits (205),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  228   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  286

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  287   GCGEHLVRTILARECSCALQTEDAHQA  313



>ref|XP_005902094.1| PREDICTED: threonine aspartase 1 [Bos mutus]
Length=351

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_006638785.1| PREDICTED: threonine aspartase 1-like [Lepisosteus oculatus]
Length=417

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 97/184 (53%), Gaps = 16/184 (9%)
 Frame = +2

Query  893   QSSSQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSK  1072
             + SS+N  D   + DT+G I VD EG++A   SSGG+A+K +GRVG AA YG GCWA + 
Sbjct  218   RQSSENENDSGSL-DTVGAIVVDHEGNVAAAVSSGGLAMKHAGRVGQAAHYGCGCWAENA  276

Query  1073  GPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKY  1246
             G     +      SG GE+L+R   AREC  ++    A  A     +L ++  +   S +
Sbjct  277   GNLNT-YSTAVSTSGCGEHLVRTMLARECSAAMQYEDAHHA-----LLETMQNKFIGSPF  330

Query  1247  GTEKS---AGILVVQAEAPRMDATGNSPFLQA--VEIAAAFSSLSFGIGYFGSSMEKPKV  1411
              + +     G++V++  + R  A  +SP +QA  VE   + ++ S  IGY  +   K K 
Sbjct  331   LSSEDCVLGGVIVLR--SCRCVAEESSPDVQALLVEFLWSHTTESMCIGYMSARDGKAKT  388

Query  1412  SILR  1423
              I R
Sbjct  389   HISR  392



>ref|XP_005019858.1| PREDICTED: threonine aspartase 1 isoform X2 [Anas platyrhynchos]
Length=374

 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_002711012.1| PREDICTED: threonine aspartase 1 [Oryctolagus cuniculus]
Length=416

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 90/173 (52%), Gaps = 20/173 (12%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  229   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  287

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  288   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  342

Query  1280  Q-----AEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             +     AEA   D++ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  343   RSCRCSAEA---DSSQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  391



>ref|XP_004593419.1| PREDICTED: threonine aspartase 1 isoform X1 [Ochotona princeps]
Length=420

 Score = 83.6 bits (205),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 91/173 (53%), Gaps = 20/173 (12%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G   +P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-SPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  346

Query  1280  Q-----AEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             +     AEA   D++ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  347   RSGRCSAEA---DSSQNKQTL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_009969086.1| PREDICTED: threonine aspartase 1, partial [Tyto alba]
Length=385

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  228   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  286

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  287   GCGEHLVRTILARECSCALQTEDAHQA  313



>ref|XP_005604530.1| PREDICTED: threonine aspartase 1 isoform X2 [Equus caballus]
Length=392

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_009956965.1| PREDICTED: threonine aspartase 1, partial [Leptosomus discolor]
Length=385

 Score = 83.2 bits (204),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  228   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  286

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  287   GCGEHLVRTILARECSCALQTEDAHQA  313



>ref|XP_002007671.1| GI12255 [Drosophila mojavensis]
 gb|EDW18147.1| GI12255 [Drosophila mojavensis]
Length=362

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  191   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  246

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   ARE C + + S     ++  K  +    +S     ++   AG L +   
Sbjct  247   GNGEYLMKTLLAREIC-NGAFSSDCAVTSLHKTFKQKFLDSPLLPQQQDLYAGALTLLY-  304

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P     E+  + ++ SF +GY  ++ + PK
Sbjct  305   ---------YPKQSCGEVMWSHTTQSFCVGYMATTQKVPK  335



>ref|XP_001985065.1| GH14708 [Drosophila grimshawi]
 gb|EDV97413.1| GH14708 [Drosophila grimshawi]
Length=365

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  194   DTVGAVCVDDAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  249

Query  1115  GAGEYLMRGFAARECC  1162
             G GEYLM+   ARE C
Sbjct  250   GNGEYLMKTLLAREIC  265



>ref|XP_006894812.1| PREDICTED: threonine aspartase 1-like [Elephantulus edwardii]
Length=418

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/183 (34%), Positives = 95/183 (52%), Gaps = 18/183 (10%)
 Frame = +2

Query  902   SQNALDENCISDTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPF  1081
             S   ++++   DT+G + VD EG++A   SSGG+ALK  GRVG AA YG GCWA + G  
Sbjct  220   SSEKVNDSSTLDTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAAHYGCGCWAENTGAH  279

Query  1082  GAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTE  1255
               P+      SG GE+L+R   AREC  +L    A  A     +L ++ ++  SS +   
Sbjct  280   N-PYSTAVSTSGCGEHLVRTILARECSHALQAEDAHQA-----LLETMQKKFISSPFLAS  333

Query  1256  KS---AGILVVQ----AEAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVS  1414
             +     G++V++    +E P  D++ +   L  VE   + ++ S  +GY  S   K K  
Sbjct  334   EDGVLGGVIVLRSCRCSEEP--DSSQSEQRL-LVEFLWSHTTESMCVGYMSSQDGKAKTH  390

Query  1415  ILR  1423
             I R
Sbjct  391   ISR  393



>ref|XP_007476741.1| PREDICTED: threonine aspartase 1 isoform X10 [Monodelphis domestica]
Length=354

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTG-VQNPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_001957938.1| GF10660 [Drosophila ananassae]
 gb|EDV40744.1| GF10660 [Drosophila ananassae]
Length=482

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  193   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  248

Query  1115  GAGEYLMRGFAARECC  1162
             G GEYLM+   ARE C
Sbjct  249   GNGEYLMKTLLAREIC  264



>ref|XP_002048180.1| GJ11486 [Drosophila virilis]
 gb|EDW70522.1| GJ11486 [Drosophila virilis]
Length=360

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  189   DTVGAVCVDGSGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  244

Query  1115  GAGEYLMRGFAARECC  1162
             G GEYLM+   ARE C
Sbjct  245   GNGEYLMKTLLAREIC  260



>ref|XP_002030680.1| GM24449 [Drosophila sechellia]
 ref|XP_002085052.1| GD12517 [Drosophila simulans]
 gb|EDW41666.1| GM24449 [Drosophila sechellia]
 gb|EDX10637.1| GD12517 [Drosophila simulans]
Length=365

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  194   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  249

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   ARE C   + S     ++  K  +    +S     ++   AG L +   
Sbjct  250   GNGEYLMKTLLAREICHG-AFSSDCAVTSLHKTFKQKFLDSPLLPRQQDLYAGALTLLY-  307

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P   + E+  + ++ SF +GY  ++   PK
Sbjct  308   ---------YPGQSSGEVMWSHTTQSFCVGYMATNQRVPK  338



>ref|XP_002069110.1| GK23937 [Drosophila willistoni]
 gb|EDW80096.1| GK23937 [Drosophila willistoni]
Length=380

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 79/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD+ G  A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  209   DTVGAVCVDASGRTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDDLS----IATCTT  264

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   A+E C     S  A  ++  K  +    +S     ++   AG L +   
Sbjct  265   GNGEYLMKTLLAKEICNGAFTSDCA-VTSLHKTFKQKFLDSPLLPQQQDLYAGALTLLY-  322

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P   + E+  + ++ SF +GY  ++ + PK
Sbjct  323   ---------YPKQGSGEVMWSHTTQSFCVGYMATTQKVPK  353



>ref|XP_004698216.1| PREDICTED: threonine aspartase 1 [Echinops telfairi]
Length=417

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 88/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  232   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  290

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE---SSKYGTEKS--AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +   S    +E     G++V+
Sbjct  291   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFIGSPFLASEDGVLGGVIVL  345

Query  1280  QA--EAPRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++   +   D+T N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  346   RSCKCSTEPDSTQNKQRL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  394



>ref|XP_010781835.1| PREDICTED: threonine aspartase 1 [Notothenia coriiceps]
Length=413

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 66/116 (57%), Gaps = 6/116 (5%)
 Frame = +2

Query  857   LCDKSNGSRDGDQSSSQNALDEN---CISDTIGVICVDSEGHMACGASSGGIALKVSGRV  1027
             L +K +   +  +   Q++  EN   C+ DT+G + VDSEG++A   SSGG+A+K  GRV
Sbjct  201   LAEKMDTGHNHAKKRRQSSETENGSGCL-DTVGAVVVDSEGNVAAAVSSGGLAMKHPGRV  259

Query  1028  GLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGFAARECCVSLSISQAAPA  1195
             G AA YG GCWA +   F  P+      SG GE+L+R   AREC  +L    A  A
Sbjct  260   GQAAHYGCGCWAENA--FNNPYSTAVSTSGCGEHLIRTMLARECSAALQSEDAHKA  313



>ref|XP_006758165.1| PREDICTED: threonine aspartase 1 isoform X2 [Myotis davidii]
Length=409

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_010589830.1| PREDICTED: threonine aspartase 1 isoform X2 [Loxodonta africana]
Length=351

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  164   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  222

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKS---AGILVV  1279
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +     G++V+
Sbjct  223   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASEDGVLGGVIVL  277

Query  1280  QA-EAP-RMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
             ++   P   D++ N   L  VE   + ++ S  +GY  +   K K  I R
Sbjct  278   RSCRCPAEPDSSQNKQRL-LVEFLWSHTTESMCVGYMSAQDGKAKTHISR  326



>ref|XP_010971185.1| PREDICTED: threonine aspartase 1 isoform X2 [Camelus bactrianus]
 ref|XP_010977430.1| PREDICTED: threonine aspartase 1 isoform X2 [Camelus dromedarius]
Length=383

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_009893731.1| PREDICTED: threonine aspartase 1 [Charadrius vociferus]
Length=424

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_009169156.1| hypothetical protein T265_05798 [Opisthorchis viverrini]
 gb|KER27106.1| hypothetical protein T265_05798 [Opisthorchis viverrini]
Length=3094

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 76/256 (30%), Positives = 102/256 (40%), Gaps = 83/256 (32%)
 Frame = +2

Query  428   LSGVRNAIQIAALLAKEQICGS-TLLGRIPPMFLVGEGARAWAKSKGVALPETIAEADEV  604
             +SG+RN I ++ LL KEQ+  S T LGR+ P  L G GA  WA  K  AL E        
Sbjct  678   VSGIRNPILLSHLLLKEQLRNSVTRLGRVQPTLLSGSGAVQWAALKKPALVE--------  729

Query  605   LFPFPVMSI*TLSSFPPYMLTWLLHNMEQVKIIFLLLVRQWLVTERTRNLWKKYKGMLDG  784
                             PY L                      V+ ++R  WKKY+     
Sbjct  730   ----------------PYNL----------------------VSHKSRTEWKKYR-----  746

Query  785   AKAVNDVSSTTANSVKTCAVSEAQLCDKSNGSRDGDQSSSQNALDENCISDTIGVICVDS  964
              + +++V S      K       +LC                        DT+G +C+D 
Sbjct  747   -RWLSEVES------KPTEPPPKRLCTSP--------------------LDTVGAVCIDK  779

Query  965   EGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVSGAGEYLMRGF  1144
              G +A   SSGGIALK  GR+G A++YG GCWA  +   G    V    SG GE L+R  
Sbjct  780   RGSVAAAISSGGIALKQEGRIGQASIYGCGCWA-EESQLGK---VAVVTSGTGEQLIRTQ  835

Query  1145  AARECCVSLSISQAAP  1192
              A++    L      P
Sbjct  836   LAQKAAERLLAPSPTP  851



>ref|XP_010809336.1| PREDICTED: threonine aspartase 1 isoform X4 [Bos taurus]
Length=383

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|NP_648832.1| taspase 1, isoform A [Drosophila melanogaster]
 ref|NP_001261920.1| taspase 1, isoform B [Drosophila melanogaster]
 gb|AAL28622.1| LD05057p [Drosophila melanogaster]
 gb|AAF49544.2| taspase 1, isoform A [Drosophila melanogaster]
 gb|ACL84176.1| Taspase1-PA, partial [synthetic construct]
 gb|ACL89265.1| Taspase1-PA [synthetic construct]
 gb|AGB94613.1| taspase 1, isoform B [Drosophila melanogaster]
Length=365

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 78/160 (49%), Gaps = 17/160 (11%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G +CVD  G+ A G SSGGI LKV GRVG AA YG+GCWA+          +  C +
Sbjct  194   DTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELA----IATCTT  249

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQESSKYGTEKS--AGILVVQAE  1288
             G GEYLM+   ARE C   + S     ++  K  +    +S     ++   AG L +   
Sbjct  250   GNGEYLMKTLLAREICHG-AFSSDCAVTSLHKTFKQKFLDSPLLPRQQDLYAGALTLLY-  307

Query  1289  APRMDATGNSPFLQAVEIAAAFSSLSFGIGYFGSSMEKPK  1408
                       P   + E+  + ++ SF +GY  ++   PK
Sbjct  308   ---------YPGQSSGEVMWSHTTQSFCVGYMATNQRVPK  338



>ref|XP_004276525.1| PREDICTED: threonine aspartase 1 [Orcinus orca]
 ref|XP_007450259.1| PREDICTED: threonine aspartase 1 [Lipotes vexillifer]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 88/170 (52%), Gaps = 14/170 (8%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPASACSKVLRSVNQE--SSKYGTEKSAGIL--VVQ  1282
             G GE+L+R   AREC  +L    A  A     +L ++  +  SS +   +  G+L  V+ 
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA-----LLETMQNKFISSPFLASED-GVLGGVIV  345

Query  1283  AEAPRMDATGN-SPFLQA--VEIAAAFSSLSFGIGYFGSSMEKPKVSILR  1423
               + R  A  N SP  Q   VE   + ++ S  +GY  +   K K  I R
Sbjct  346   LRSCRCSAEPNSSPNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISR  395



>ref|XP_008499120.1| PREDICTED: threonine aspartase 1 [Calypte anna]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_010342054.1| PREDICTED: threonine aspartase 1 [Saimiri boliviensis boliviensis]
Length=318

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  131   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  189

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  190   GCGEHLVRTILARECSHALQAEDAHQA  216



>ref|XP_005428102.1| PREDICTED: threonine aspartase 1 isoform X3 [Geospiza fortis]
 ref|XP_009091998.1| PREDICTED: threonine aspartase 1 isoform X2 [Serinus canaria]
Length=416

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  228   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  286

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  287   GCGEHLVRTILARECSCALQTEDAHQA  313



>ref|XP_010146303.1| PREDICTED: threonine aspartase 1 [Eurypyga helias]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_010573098.1| PREDICTED: threonine aspartase 1 isoform X1 [Haliaeetus leucocephalus]
Length=435

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  248   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  306

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  307   GCGEHLVRTILARECSCALQTEDAHQA  333



>ref|XP_006260897.1| PREDICTED: threonine aspartase 1 [Alligator mississippiensis]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGVLN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSRALQTEDAHQA  318



>ref|XP_005510752.1| PREDICTED: threonine aspartase 1 [Columba livia]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_007165329.1| PREDICTED: threonine aspartase 1 isoform X4 [Balaenoptera acutorostrata 
scammoni]
Length=405

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_005634835.1| PREDICTED: threonine aspartase 1 isoform X5 [Canis lupus familiaris]
Length=409

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSHALQAEDAHQA  318



>ref|XP_010573100.1| PREDICTED: threonine aspartase 1 isoform X2 [Haliaeetus leucocephalus]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_006500409.1| PREDICTED: threonine aspartase 1 isoform X2 [Mus musculus]
Length=353

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  166   DTVGAVVVDHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAQN-PYSTAVSTS  224

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  225   GCGEHLVRTILARECSHALQAEDAHQA  251



>ref|XP_005525487.1| PREDICTED: threonine aspartase 1 isoform X2 [Pseudopodoces humilis]
 ref|XP_010401362.1| PREDICTED: threonine aspartase 1 isoform X2 [Corvus cornix cornix]
 ref|XP_010401363.1| PREDICTED: threonine aspartase 1 isoform X2 [Corvus cornix cornix]
Length=416

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  228   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHN-PYSTAVSTS  286

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  287   GCGEHLVRTILARECSCALQTEDAHQA  313



>ref|XP_005019857.1| PREDICTED: threonine aspartase 1 isoform X1 [Anas platyrhynchos]
Length=420

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



>ref|XP_010200002.1| PREDICTED: threonine aspartase 1 [Colius striatus]
Length=418

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  231   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  289

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  290   GCGEHLVRTILARECSCALQTEDAHQA  316



>ref|XP_009932518.1| PREDICTED: threonine aspartase 1 [Opisthocomus hoazin]
Length=418

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  231   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  289

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  290   GCGEHLVRTILARECSCALQTEDAHQA  316



>ref|XP_008931235.1| PREDICTED: threonine aspartase 1 [Manacus vitellinus]
Length=421

 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +2

Query  935   DTIGVICVDSEGHMACGASSGGIALKVSGRVGLAAMYGSGCWASSKGPFGAPFIVGCCVS  1114
             DT+G + VD EG++A   SSGG+ALK  GRVG AA+YG GCWA + G    P+      S
Sbjct  233   DTVGAVVVDQEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAH-TPYSTAVSTS  291

Query  1115  GAGEYLMRGFAARECCVSLSISQAAPA  1195
             G GE+L+R   AREC  +L    A  A
Sbjct  292   GCGEHLVRTILARECSCALQTEDAHQA  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600