BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25831_g3_i3 len=1156 path=[13631:0-533 10224:534-538 8312:539-614
14241:615-676 9861:677-692 14318:693-693 14319:694-764 19316:765-786
23479:787-795 19346:796-865 10732:866-882 23546:883-890 9985:891-906
8698:907-952 23687:953-957 6144:958-1155]

Length=1156
                                                                      Score     E

ref|XP_009762701.1|  PREDICTED: putative late blight resistance p...  96.7    3e-23   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  95.5    6e-22   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    100   9e-22   
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  94.4    1e-21   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  94.4    1e-21   
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  94.4    1e-21   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...    106   2e-21   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...  90.5    2e-20   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501  90.5    3e-20   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  94.4    4e-20   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  94.4    4e-20   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...  90.9    4e-20   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...    102   5e-20   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...    101   6e-20   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...    100   1e-19   
ref|XP_009763644.1|  PREDICTED: putative late blight resistance p...  97.8    2e-19   
gb|AEW48187.1|  disease resistance protein RGH5                       99.8    3e-19   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...  96.3    3e-19   
gb|AEW48188.1|  disease resistance protein RGH7                       99.8    3e-19   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...  88.6    3e-19   
gb|AEW48197.1|  disease resistance protein RGH3                       99.0    5e-19   
gb|ABY61746.1|  resistance protein PSH-RGH7                           98.6    7e-19   Solanum tuberosum [potatoes]
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8              78.6    9e-19   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2             97.8    1e-18   Solanum tuberosum [potatoes]
gb|AEW48206.1|  disease resistance protein RGH4                       97.8    1e-18   
emb|CAB50786.1|  Rx protein                                           97.8    1e-18   Solanum tuberosum [potatoes]
emb|CAB56299.1|  NBS-LRR protein                                      97.4    1e-18   Solanum acaule
gb|AEW48207.1|  disease resistance protein RGH5                       97.4    2e-18   
gb|AEW48195.1|  disease resistance protein RGH6                       97.1    2e-18   
gb|AFB17980.1|  Rx-like protein                                       94.7    2e-18   
gb|AFB17979.1|  Rx-like protein                                       94.7    2e-18   
gb|AEW48202.1|  disease resistance protein RGH4                       97.1    2e-18   
gb|AEW48205.1|  disease resistance protein RGH2                       96.7    3e-18   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...  88.6    3e-18   
gb|AEW48189.1|  disease resistance protein RGH9                       96.3    3e-18   
gb|AEW48186.1|  disease resistance protein RGH2                       96.3    4e-18   
gb|ACE79449.1|  NBS-coding resistance gene analog                     92.8    4e-18   Nicotiana tabacum [American tobacco]
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...  88.6    4e-18   
gb|AEW48216.1|  disease resistance protein RX3                        96.3    4e-18   
gb|AEW48193.1|  disease resistance protein RGH4                       96.3    4e-18   
gb|AEW48196.1|  disease resistance protein RGH7                       95.9    5e-18   
gb|AFB17983.1|  Rx-like protein                                       93.6    5e-18   
gb|AEW48212.1|  disease resistance protein RGH1                       95.9    5e-18   
gb|AEW48192.1|  disease resistance protein RGH3                       95.9    5e-18   
gb|AEW48190.1|  disease resistance protein RX4                        95.5    6e-18   
gb|AEW48198.1|  disease resistance protein RGH4                       95.5    7e-18   
gb|AAF76163.1|AF266747_1  RGC1                                        95.5    7e-18   Solanum tuberosum [potatoes]
gb|AEW48209.1|  disease resistance protein RGH5                       95.5    7e-18   
gb|AFB17978.1|  Rx-like protein                                       93.2    7e-18   
gb|AEW48210.1|  disease resistance protein RGH5                       95.5    7e-18   
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...  94.7    7e-18   
gb|AFB17976.1|  Rx-like protein                                       93.2    7e-18   
gb|AFB17982.1|  Rx-like protein                                       92.8    7e-18   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  95.1    9e-18   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  95.1    9e-18   
ref|XP_009760414.1|  PREDICTED: disease susceptibility protein LO...  87.4    9e-18   
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...  94.7    1e-17   
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8              78.2    1e-17   
gb|AEW48191.1|  disease resistance protein RGH2                       94.7    1e-17   
gb|AEW48218.1|  disease resistance protein RX6                        94.7    1e-17   
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...  94.7    1e-17   
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...  78.2    1e-17   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...  94.4    1e-17   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...  94.4    1e-17   
gb|AEW48194.1|  disease resistance protein RGH5                       94.4    1e-17   
ref|XP_010327575.1|  PREDICTED: putative late blight resistance p...  80.1    2e-17   
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...  94.4    2e-17   
gb|ACE79429.1|  NBS-coding resistance gene analog                     90.5    2e-17   Nicotiana tabacum [American tobacco]
gb|ACE79448.1|  NBS-coding resistance gene analog                     90.5    2e-17   Nicotiana tabacum [American tobacco]
gb|AEW48214.1|  disease resistance protein RGH4                       94.0    2e-17   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...  94.0    2e-17   
gb|AEW48199.1|  disease resistance protein RGH6                       93.6    3e-17   
gb|AEW48208.1|  disease resistance protein RGH4                       92.8    5e-17   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  92.8    5e-17   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg              92.0    9e-17   
gb|ABY61745.1|  resistance protein PSH-RGH6                           92.0    1e-16   Solanum tuberosum [potatoes]
gb|AEW48204.1|  disease resistance protein RGH1                       91.7    1e-16   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  91.7    1e-16   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  91.7    1e-16   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...  91.7    1e-16   
gb|AAV88068.1|  NBS-LRR protein                                       63.9    1e-16   Ipomoea batatas [batate]
gb|ACF22006.1|  NBS-coding resistance gene protein                    86.7    1e-16   Nicotiana tabacum [American tobacco]
gb|AEW48217.1|  disease resistance protein RX5                        90.9    2e-16   
gb|ACE79400.1|  NBS-coding resistance gene analog                     87.4    2e-16   Nicotiana tabacum [American tobacco]
ref|XP_011072647.1|  PREDICTED: putative late blight resistance p...  90.5    2e-16   
gb|AEW48211.1|  disease resistance protein RGH1                       90.9    2e-16   
gb|AEW48201.1|  disease resistance protein RGH9                       90.5    3e-16   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...  70.1    3e-16   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              90.5    3e-16   
gb|EYU24356.1|  hypothetical protein MIMGU_mgv1a022056mg              90.1    3e-16   
gb|ACF22012.1|  NBS-coding resistance gene protein                    87.0    4e-16   Nicotiana tabacum [American tobacco]
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  90.1    4e-16   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg              89.7    5e-16   
gb|ACE79442.1|  NBS-coding resistance gene analog                     86.7    5e-16   Nicotiana tabacum [American tobacco]
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  89.7    5e-16   
gb|ACE79425.1|  NBS-coding resistance gene analog                     86.7    6e-16   Nicotiana tabacum [American tobacco]
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  89.4    6e-16   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...  89.4    6e-16   
gb|ACE79412.1|  NBS-coding resistance gene analog                     86.3    6e-16   Nicotiana tabacum [American tobacco]
gb|AEW48200.1|  disease resistance protein RGH7                       89.0    8e-16   
gb|ACE79489.1|  NBS-coding resistance gene analog                     85.9    8e-16   Nicotiana tabacum [American tobacco]
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  83.6    9e-16   
gb|ACE79488.1|  NBS-coding resistance gene analog                     85.9    9e-16   Nicotiana tabacum [American tobacco]
gb|ACE79487.1|  NBS-coding resistance gene analog                     85.9    9e-16   Nicotiana tabacum [American tobacco]
gb|ACE79491.1|  NBS-coding resistance gene analog                     85.5    9e-16   Nicotiana tabacum [American tobacco]
gb|ACE79495.1|  NBS-coding resistance gene analog                     85.5    9e-16   Nicotiana sylvestris
gb|ACE79492.1|  NBS-coding resistance gene analog                     85.5    9e-16   Nicotiana tabacum [American tobacco]
gb|ACE79493.1|  NBS-coding resistance gene analog                     85.5    9e-16   Nicotiana tabacum [American tobacco]
gb|ACE79490.1|  NBS-coding resistance gene analog                     85.9    1e-15   Nicotiana tabacum [American tobacco]
gb|ACE79413.1|  NBS-coding resistance gene analog                     85.9    1e-15   Nicotiana tabacum [American tobacco]
gb|EYU40390.1|  hypothetical protein MIMGU_mgv1a018316mg              88.6    1e-15   
ref|XP_009794810.1|  PREDICTED: putative late blight resistance p...  86.7    1e-15   
gb|EYU21177.1|  hypothetical protein MIMGU_mgv1a018978mg              88.2    1e-15   
gb|ACE79438.1|  NBS-coding resistance gene analog                     85.1    2e-15   Nicotiana tabacum [American tobacco]
ref|XP_011072191.1|  PREDICTED: putative late blight resistance p...  70.5    2e-15   
gb|EYU24175.1|  hypothetical protein MIMGU_mgv1a026011mg              88.2    2e-15   
gb|ACF22011.1|  NBS-coding resistance gene protein                    84.7    2e-15   Nicotiana tabacum [American tobacco]
gb|ACF22014.1|  NBS-coding resistance gene protein                    84.7    2e-15   Nicotiana tabacum [American tobacco]
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              87.4    3e-15   
ref|XP_009796570.1|  PREDICTED: putative late blight resistance p...  87.0    3e-15   
gb|ACE79451.1|  NBS-coding resistance gene analog                     84.3    3e-15   Nicotiana tabacum [American tobacco]
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg              87.0    3e-15   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              87.4    3e-15   
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8              75.1    4e-15   
gb|ACE79424.1|  NBS-coding resistance gene analog                     84.0    5e-15   Nicotiana tabacum [American tobacco]
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  81.3    5e-15   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...  86.7    6e-15   
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...  86.3    7e-15   
gb|AEW48215.1|  disease resistance protein RGH7                       86.3    7e-15   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...  85.9    7e-15   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...  85.5    8e-15   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  86.3    8e-15   
gb|ACE79512.1|  NBS-coding resistance gene analog                     82.8    1e-14   Nicotiana tabacum [American tobacco]
gb|ACE79511.1|  NBS-coding resistance gene analog                     82.4    1e-14   Nicotiana tabacum [American tobacco]
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  85.9    1e-14   
gb|ACE79510.1|  NBS-coding resistance gene analog                     82.4    1e-14   Nicotiana tabacum [American tobacco]
gb|ACF22008.1|  NBS-coding resistance gene protein                    82.8    1e-14   Nicotiana tabacum [American tobacco]
gb|ACE79513.1|  NBS-coding resistance gene analog                     82.4    1e-14   Nicotiana tabacum [American tobacco]
gb|EYU31287.1|  hypothetical protein MIMGU_mgv1a022746mg              85.1    1e-14   
gb|ACE79508.1|  NBS-coding resistance gene analog                     82.8    1e-14   Nicotiana tabacum [American tobacco]
gb|ACE79441.1|  NBS-coding resistance gene analog                     82.8    1e-14   Nicotiana tabacum [American tobacco]
gb|ACE79509.1|  NBS-coding resistance gene analog                     82.4    1e-14   Nicotiana tabacum [American tobacco]
dbj|BAD18094.1|  NBS-LRR protein                                      82.4    1e-14   Ipomoea batatas [batate]
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...  85.1    1e-14   
ref|XP_009600479.1|  PREDICTED: putative late blight resistance p...  85.1    2e-14   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  85.1    2e-14   
emb|CDP05538.1|  unnamed protein product                              85.1    2e-14   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  79.0    2e-14   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  79.0    3e-14   
gb|AAF09256.1|AF202179_1  disease resistance protein BS2              84.3    3e-14   Capsicum chacoense
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              84.3    3e-14   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...  84.3    3e-14   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...  84.3    4e-14   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...  84.3    4e-14   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...  84.3    4e-14   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...  84.3    4e-14   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_006356562.1|  PREDICTED: putative late blight resistance p...  81.3    4e-14   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  76.3    4e-14   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  84.0    4e-14   
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  84.0    5e-14   
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...  83.6    5e-14   
ref|XP_006356519.1|  PREDICTED: putative late blight resistance p...  83.6    6e-14   
ref|XP_006355088.1|  PREDICTED: putative late blight resistance p...  83.6    6e-14   
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...  82.4    6e-14   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              83.2    6e-14   
ref|XP_006361240.1|  PREDICTED: putative late blight resistance p...  77.8    7e-14   
gb|ACE79401.1|  NBS-coding resistance gene analog                     80.5    7e-14   Nicotiana tabacum [American tobacco]
gb|ACE79434.1|  NBS-coding resistance gene analog                     80.5    8e-14   Nicotiana tabacum [American tobacco]
gb|ACE79422.1|  NBS-coding resistance gene analog                     80.5    8e-14   Nicotiana tabacum [American tobacco]
ref|XP_011072135.1|  PREDICTED: putative late blight resistance p...  82.8    8e-14   
ref|XP_009766122.1|  PREDICTED: putative late blight resistance p...  82.4    9e-14   
ref|XP_009793286.1|  PREDICTED: putative late blight resistance p...  82.4    9e-14   
gb|EYU24178.1|  hypothetical protein MIMGU_mgv1a024402mg              82.8    1e-13   
ref|XP_006355091.1|  PREDICTED: putative late blight resistance p...  82.8    1e-13   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...  82.4    1e-13   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...  82.4    1e-13   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...  82.0    2e-13   
gb|EYU24152.1|  hypothetical protein MIMGU_mgv1a018081mg              82.0    2e-13   
ref|XP_006365692.1|  PREDICTED: putative late blight resistance p...  81.6    2e-13   
emb|CDP05594.1|  unnamed protein product                              82.0    2e-13   
gb|EYU23504.1|  hypothetical protein MIMGU_mgv1a021434mg              81.6    2e-13   
ref|XP_011072133.1|  PREDICTED: putative late blight resistance p...  81.6    2e-13   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...  81.6    2e-13   
ref|XP_009765789.1|  PREDICTED: putative late blight resistance p...  81.6    2e-13   
ref|XP_006355089.1|  PREDICTED: putative late blight resistance p...  81.6    3e-13   
ref|XP_011072136.1|  PREDICTED: putative late blight resistance p...  81.3    3e-13   
ref|XP_010312507.1|  PREDICTED: putative late blight resistance p...  80.9    4e-13   
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...  80.5    5e-13   
ref|XP_006366309.1|  PREDICTED: putative late blight resistance p...  80.5    5e-13   
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...  80.5    5e-13   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg              80.5    5e-13   
ref|XP_009802397.1|  PREDICTED: putative late blight resistance p...  67.4    5e-13   
ref|XP_009772626.1|  PREDICTED: putative late blight resistance p...  80.5    6e-13   
emb|CDP00736.1|  unnamed protein product                              80.5    6e-13   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...  80.5    6e-13   
emb|CDP00737.1|  unnamed protein product                              80.5    6e-13   
gb|ACF21987.1|  NBS-coding resistance gene protein                    77.8    7e-13   Nicotiana tabacum [American tobacco]
gb|EYU28611.1|  hypothetical protein MIMGU_mgv1a025283mg              80.1    7e-13   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...  80.1    7e-13   
ref|XP_004242250.1|  PREDICTED: putative late blight resistance p...  80.1    7e-13   
gb|ACE79399.1|  NBS-coding resistance gene analog                     77.4    7e-13   Nicotiana tabacum [American tobacco]
ref|XP_009765788.1|  PREDICTED: putative late blight resistance p...  79.0    7e-13   
ref|XP_009603167.1|  PREDICTED: putative late blight resistance p...  80.1    7e-13   
gb|ACE79431.1|  NBS-coding resistance gene analog                     77.8    7e-13   Nicotiana tabacum [American tobacco]
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg              80.1    7e-13   
gb|ACF21990.1|  NBS-coding resistance gene protein                    77.8    7e-13   Nicotiana tabacum [American tobacco]
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg              80.1    8e-13   
ref|XP_006345616.1|  PREDICTED: putative late blight resistance p...  79.7    8e-13   
gb|EYU24172.1|  hypothetical protein MIMGU_mgv1a025900mg              80.1    8e-13   
ref|XP_009603166.1|  PREDICTED: putative late blight resistance p...  80.1    8e-13   
gb|EYU24185.1|  hypothetical protein MIMGU_mgv1a024774mg              80.1    8e-13   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              79.7    9e-13   
gb|EYU25639.1|  hypothetical protein MIMGU_mgv1a022176mg              79.3    9e-13   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg              79.7    9e-13   
emb|CDP12799.1|  unnamed protein product                              79.7    1e-12   
ref|XP_006356564.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
gb|ACQ42905.1|  tomato spotted wilt virus susceptible protein         76.3    1e-12   Solanum lycopersicum
ref|XP_009625970.1|  PREDICTED: putative late blight resistance p...  75.5    1e-12   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
ref|XP_009604598.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
gb|AAU93590.2|  Late blight resistance protein, putative              79.7    1e-12   Solanum demissum
ref|XP_006356563.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
gb|ABO93001.1|  putative disease resistance protein                   79.7    1e-12   Solanum tuberosum [potatoes]
ref|XP_009604596.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
ref|XP_009758242.1|  PREDICTED: putative late blight resistance p...  79.7    1e-12   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  79.3    1e-12   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              79.3    1e-12   
ref|XP_010322784.1|  PREDICTED: putative late blight resistance p...  79.3    1e-12   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...  79.3    1e-12   
ref|XP_004242254.2|  PREDICTED: putative late blight resistance p...  79.3    1e-12   
ref|XP_009769811.1|  PREDICTED: putative late blight resistance p...  74.3    2e-12   
gb|EYU33966.1|  hypothetical protein MIMGU_mgv1a001110mg              79.0    2e-12   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...  79.0    2e-12   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  79.0    2e-12   
ref|XP_006357007.1|  PREDICTED: putative late blight resistance p...  79.0    2e-12   
ref|XP_006363255.1|  PREDICTED: putative late blight resistance p...  79.0    2e-12   
gb|ACF21988.1|  NBS-coding resistance gene protein                    76.3    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   
ref|XP_009787579.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   
gb|ACE79443.1|  NBS-coding resistance gene analog                     76.3    2e-12   Nicotiana tabacum [American tobacco]
ref|XP_009787580.1|  PREDICTED: putative late blight resistance p...  78.6    2e-12   
gb|ACE79440.1|  NBS-coding resistance gene analog                     76.3    2e-12   Nicotiana tabacum [American tobacco]
gb|ABC71051.1|  putative disease resistance protein                   74.3    2e-12   Ipomoea batatas [batate]
ref|XP_009765786.1|  PREDICTED: putative late blight resistance p...  78.2    3e-12   
gb|ACE79419.1|  NBS-coding resistance gene analog                     75.9    3e-12   Nicotiana tabacum [American tobacco]
gb|ACE79452.1|  NBS-coding resistance gene analog                     75.9    3e-12   Nicotiana tabacum [American tobacco]
ref|XP_011071935.1|  PREDICTED: putative late blight resistance p...  78.6    3e-12   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              78.6    3e-12   
ref|XP_010323848.1|  PREDICTED: putative late blight resistance p...  78.2    3e-12   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...  78.2    3e-12   
gb|EYU25697.1|  hypothetical protein MIMGU_mgv1a026211mg              77.8    3e-12   
ref|XP_004236921.1|  PREDICTED: putative late blight resistance p...  78.6    3e-12   
gb|ACE79436.1|  NBS-coding resistance gene analog                     75.9    3e-12   Nicotiana tabacum [American tobacco]
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              78.2    3e-12   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg              78.2    4e-12   
ref|XP_009777473.1|  PREDICTED: putative late blight resistance p...  78.2    4e-12   
ref|XP_006361239.1|  PREDICTED: putative late blight resistance p...  78.2    4e-12   
ref|XP_010320570.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  78.2    4e-12   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  77.8    4e-12   
gb|EYU24351.1|  hypothetical protein MIMGU_mgv1a025953mg              77.4    4e-12   
ref|XP_009596966.1|  PREDICTED: putative late blight resistance p...  73.6    4e-12   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...  77.8    4e-12   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  77.8    4e-12   
ref|XP_009761395.1|  PREDICTED: putative late blight resistance p...  76.6    5e-12   
gb|EYU24159.1|  hypothetical protein MIMGU_mgv1a020220mg              77.8    5e-12   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  77.4    5e-12   
ref|XP_009796562.1|  PREDICTED: putative late blight resistance p...  77.8    5e-12   
ref|XP_011084812.1|  PREDICTED: disease resistance RPP13-like pro...  75.9    5e-12   
ref|XP_009758240.1|  PREDICTED: putative late blight resistance p...  77.4    6e-12   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              77.4    6e-12   
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg              77.4    6e-12   
ref|XP_004242252.1|  PREDICTED: putative late blight resistance p...  77.4    6e-12   
gb|KDP26027.1|  hypothetical protein JCGZ_21060                       77.0    6e-12   
ref|XP_006355090.1|  PREDICTED: putative late blight resistance p...  77.4    6e-12   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...  77.4    7e-12   
ref|XP_009758239.1|  PREDICTED: putative late blight resistance p...  77.4    7e-12   
emb|CDP20176.1|  unnamed protein product                              77.4    7e-12   
ref|XP_004242251.1|  PREDICTED: putative late blight resistance p...  77.0    7e-12   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  77.0    7e-12   
emb|CDP00758.1|  unnamed protein product                              77.4    7e-12   
gb|EYU33968.1|  hypothetical protein MIMGU_mgv1a026820mg              77.0    7e-12   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...  77.0    7e-12   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...  77.0    7e-12   
ref|XP_009596953.1|  PREDICTED: putative late blight resistance p...  77.0    8e-12   
ref|XP_006346790.1|  PREDICTED: putative late blight resistance p...  77.0    8e-12   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  77.0    8e-12   
ref|XP_009624532.1|  PREDICTED: putative late blight resistance p...  77.0    8e-12   
emb|CDP11823.1|  unnamed protein product                              76.6    8e-12   
gb|ACF22032.1|  NBS-coding resistance gene protein                    74.7    8e-12   
ref|XP_006363500.1|  PREDICTED: putative late blight resistance p...  76.6    9e-12   
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...  76.6    9e-12   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...  77.0    9e-12   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  77.0    9e-12   
gb|EYU24166.1|  hypothetical protein MIMGU_mgv1a000858mg              77.0    9e-12   
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...  76.6    1e-11   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              76.6    1e-11   
emb|CDP19424.1|  unnamed protein product                              75.1    1e-11   
ref|NP_001234836.1|  hero resistance protein 1 homologue              76.6    1e-11   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  76.6    1e-11   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg              76.6    1e-11   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  76.6    1e-11   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...  76.6    1e-11   
ref|XP_009588716.1|  PREDICTED: putative late blight resistance p...  76.6    1e-11   
ref|XP_006367893.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...  75.9    1e-11   
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...  76.3    1e-11   
ref|XP_011086979.1|  PREDICTED: putative late blight resistance p...  76.3    2e-11   
ref|XP_011072174.1|  PREDICTED: disease resistance RPP8-like prot...  75.1    2e-11   
gb|ABS29403.1|  NBS-LRR type disease resistance protein               72.0    2e-11   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg              75.9    2e-11   
ref|XP_004248043.1|  PREDICTED: putative late blight resistance p...  76.3    2e-11   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  75.9    2e-11   
emb|CDP05557.1|  unnamed protein product                              75.1    2e-11   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...  75.9    2e-11   
ref|XP_009786137.1|  PREDICTED: putative late blight resistance p...  75.9    2e-11   
ref|XP_009786145.1|  PREDICTED: putative late blight resistance p...  75.9    2e-11   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              75.9    2e-11   
gb|AAV88065.1|  leucine-rich repeat protein                           75.1    2e-11   
ref|XP_009622003.1|  PREDICTED: putative late blight resistance p...  75.5    2e-11   
ref|XP_009782023.1|  PREDICTED: putative late blight resistance p...  75.5    3e-11   
ref|XP_004240304.1|  PREDICTED: putative late blight resistance p...  75.5    3e-11   
gb|ACE79459.1|  NBS-coding resistance gene analog                     73.9    3e-11   
gb|AGW28126.1|  NBS-LRR class resistance protein Fy12-Ry12            75.1    3e-11   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              75.5    3e-11   
gb|ACF22034.1|  NBS-coding resistance gene protein                    73.2    3e-11   
gb|ACE79420.1|  NBS-coding resistance gene analog                     73.9    3e-11   
gb|ACE79417.1|  NBS-coding resistance gene analog                     73.6    3e-11   
ref|XP_010319557.1|  PREDICTED: putative late blight resistance p...  75.1    3e-11   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  75.1    3e-11   
gb|AGX27505.1|  NBS-LRR class resistance protein Fy12-Ry1             74.7    3e-11   
ref|XP_009780398.1|  PREDICTED: putative late blight resistance p...  71.6    3e-11   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              75.1    3e-11   
ref|XP_004238960.1|  PREDICTED: putative late blight resistance p...  75.1    3e-11   
emb|CDP00688.1|  unnamed protein product                              74.7    3e-11   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  75.1    3e-11   
ref|XP_009799411.1|  PREDICTED: putative late blight resistance p...  74.3    3e-11   
gb|ACE79428.1|  NBS-coding resistance gene analog                     73.6    3e-11   
gb|ACE79439.1|  NBS-coding resistance gene analog                     73.6    4e-11   
ref|XP_010320780.1|  PREDICTED: putative late blight resistance p...  74.7    4e-11   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...  75.1    4e-11   
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...  75.1    4e-11   
gb|AAG31017.1|  tospovirus resistance protein E                       75.1    4e-11   
gb|EYU23523.1|  hypothetical protein MIMGU_mgv1a025044mg              74.7    4e-11   
ref|XP_009799410.1|  PREDICTED: putative late blight resistance p...  73.9    4e-11   
gb|ACE79453.1|  NBS-coding resistance gene analog                     73.2    4e-11   
gb|AAV88066.1|  NBS-LRR protein                                       74.7    4e-11   
gb|AGX27506.1|  NBS-LRR class resistance protein Fy12-Ry1             74.7    4e-11   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...  74.7    4e-11   
emb|CDP04885.1|  unnamed protein product                              74.7    4e-11   
ref|XP_009799408.1|  PREDICTED: putative late blight resistance p...  73.9    4e-11   
emb|CDP11642.1|  unnamed protein product                              75.1    4e-11   
emb|CAD29726.1|  hero resistance protein 2 homologue                  74.7    4e-11   
emb|CDP00690.1|  unnamed protein product                              74.3    4e-11   
ref|XP_009600432.1|  PREDICTED: putative late blight resistance p...  74.7    4e-11   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              74.7    5e-11   
ref|XP_010326937.1|  PREDICTED: putative late blight resistance p...  74.7    5e-11   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  74.3    5e-11   
ref|XP_009799409.1|  PREDICTED: putative late blight resistance p...  73.9    5e-11   
ref|XP_009799407.1|  PREDICTED: putative late blight resistance p...  73.9    5e-11   
ref|XP_004237188.1|  PREDICTED: putative late blight resistance p...  74.7    5e-11   
gb|ACE79456.1|  NBS-coding resistance gene analog                     73.2    5e-11   
ref|XP_009606269.1|  PREDICTED: putative late blight resistance p...  72.8    5e-11   
gb|ACE79426.1|  NBS-coding resistance gene analog                     72.8    5e-11   
gb|ACE79455.1|  NBS-coding resistance gene analog                     73.2    5e-11   
ref|XP_006365693.1|  PREDICTED: putative late blight resistance p...  74.7    5e-11   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  74.3    5e-11   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...  74.3    5e-11   
ref|XP_009769771.1|  PREDICTED: late blight resistance protein R1...  74.3    5e-11   
emb|CDP05558.1|  unnamed protein product                              74.3    5e-11   
gb|EYU24151.1|  hypothetical protein MIMGU_mgv1a019744mg              74.3    6e-11   
gb|ACE79435.1|  NBS-coding resistance gene analog                     72.8    6e-11   
gb|ACE79462.1|  NBS-coding resistance gene analog                     72.8    6e-11   
emb|CAD29729.1|  hero resistance protein                              74.3    6e-11   
ref|XP_004505810.1|  PREDICTED: probable disease resistance RPP8-...  74.7    6e-11   
ref|NP_001233995.1|  hero resistance protein                          74.3    6e-11   
gb|AHB79188.1|  CC-NBS-LRR disease resistance protein                 74.3    6e-11   
gb|ACE79427.1|  NBS-coding resistance gene analog                     72.4    6e-11   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...  74.3    6e-11   
ref|XP_006358839.1|  PREDICTED: late blight resistance protein R1...  74.3    6e-11   
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...  73.9    6e-11   
ref|XP_009588710.1|  PREDICTED: putative late blight resistance p...  74.3    6e-11   
gb|AET22504.1|  hypothetical protein                                  74.3    6e-11   
ref|XP_009588709.1|  PREDICTED: putative late blight resistance p...  74.3    6e-11   
ref|XP_009588708.1|  PREDICTED: putative late blight resistance p...  74.3    6e-11   
ref|XP_010319246.1|  PREDICTED: putative late blight resistance p...  74.3    7e-11   
ref|XP_009592156.1|  PREDICTED: late blight resistance protein R1...  73.9    7e-11   
gb|EYU24355.1|  hypothetical protein MIMGU_mgv1a024375mg              73.9    7e-11   
ref|XP_009761661.1|  PREDICTED: late blight resistance protein R1...  73.9    7e-11   
gb|ACE79446.1|  NBS-coding resistance gene analog                     72.4    7e-11   
ref|XP_011071868.1|  PREDICTED: putative late blight resistance p...  73.9    7e-11   
ref|XP_009779957.1|  PREDICTED: LOW QUALITY PROTEIN: late blight ...  73.9    7e-11   
ref|XP_011072142.1|  PREDICTED: putative late blight resistance p...  73.9    7e-11   
ref|XP_009596957.1|  PREDICTED: putative late blight resistance p...  73.9    7e-11   
ref|XP_009765183.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  73.9    8e-11   
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  73.9    8e-11   
ref|XP_006340022.1|  PREDICTED: putative late blight resistance p...  73.9    8e-11   
gb|AAG31016.1|  tospovirus resistance protein D                       73.9    8e-11   
ref|XP_009800164.1|  PREDICTED: putative late blight resistance p...  73.6    9e-11   
gb|AAG31014.1|  tospovirus resistance protein B                       73.9    9e-11   
gb|ABC71047.1|  putative disease resistance protein                   70.1    9e-11   
ref|XP_009799404.1|  PREDICTED: putative late blight resistance p...  73.6    9e-11   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
emb|CBI24945.3|  unnamed protein product                              73.6    1e-10   
ref|XP_009612837.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_009803439.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_009598609.1|  PREDICTED: putative late blight resistance p...  73.2    1e-10   
ref|XP_009803436.1|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_010661781.1|  PREDICTED: putative disease resistance prote...  73.2    1e-10   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg              73.2    1e-10   
ref|NP_001289831.1|  putative late blight resistance protein homo...  73.6    1e-10   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  73.2    1e-10   
ref|XP_004248007.2|  PREDICTED: putative late blight resistance p...  73.6    1e-10   
ref|XP_011072173.1|  PREDICTED: putative late blight resistance p...  73.2    1e-10   
ref|XP_011097122.1|  PREDICTED: late blight resistance protein R1...  73.2    1e-10   
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg             73.2    1e-10   
gb|EYU23530.1|  hypothetical protein MIMGU_mgv1a018743mg              72.8    1e-10   
ref|XP_011090484.1|  PREDICTED: putative late blight resistance p...  73.2    1e-10   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  73.2    2e-10   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  72.8    2e-10   
gb|ACE79423.1|  NBS-coding resistance gene analog                     71.2    2e-10   
ref|XP_010045756.1|  PREDICTED: putative disease resistance prote...  72.8    2e-10   
ref|XP_009760599.1|  PREDICTED: late blight resistance protein R1...  73.2    2e-10   
gb|AGX27499.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
gb|ACF22033.1|  NBS-coding resistance gene protein                    70.9    2e-10   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              72.8    2e-10   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  72.8    2e-10   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  72.8    2e-10   
ref|XP_009760596.1|  PREDICTED: late blight resistance protein R1...  72.8    2e-10   
ref|XP_009760595.1|  PREDICTED: late blight resistance protein R1...  72.8    2e-10   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...  72.8    2e-10   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
ref|XP_009760597.1|  PREDICTED: late blight resistance protein R1...  72.8    2e-10   
ref|XP_009760600.1|  PREDICTED: late blight resistance protein R1...  72.8    2e-10   
ref|XP_009590018.1|  PREDICTED: putative late blight resistance p...  72.0    2e-10   
gb|ACE79507.1|  NBS-coding resistance gene analog                     70.9    2e-10   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
emb|CDP08423.1|  unnamed protein product                              72.8    2e-10   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
gb|AAM47597.1|AF513548_1  NBS/LRR resistance protein-like protein     68.9    2e-10   
ref|XP_004136127.1|  PREDICTED: putative disease resistance prote...  72.8    2e-10   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1              72.4    2e-10   
gb|AAG31015.1|  tospovirus resistance protein C                       72.4    2e-10   
gb|ACF22063.1|  NBS-coding resistance gene protein                    70.1    3e-10   
ref|XP_006362989.1|  PREDICTED: disease resistance protein RPP13-...  72.0    3e-10   
emb|CDP16976.1|  unnamed protein product                              72.4    3e-10   
emb|CDP11620.1|  unnamed protein product                              72.0    3e-10   
ref|XP_010693575.1|  PREDICTED: putative disease resistance prote...  72.0    3e-10   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...  72.0    3e-10   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...  72.0    3e-10   
gb|AFN86170.1|  reistance protein F variant 1.1                       72.4    3e-10   
emb|CBI24947.3|  unnamed protein product                              72.0    3e-10   
gb|ABR37219.1|  NBS-LRR type disease resistance protein               68.6    3e-10   
emb|CDP21622.1|  unnamed protein product                              72.0    3e-10   
gb|ACF22072.1|  NBS-coding resistance gene protein                    70.1    3e-10   
ref|XP_010646020.1|  PREDICTED: disease resistance protein RGA2-like  71.2    3e-10   
gb|ACF22068.1|  NBS-coding resistance gene protein                    69.7    3e-10   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  72.0    3e-10   
gb|EYU40389.1|  hypothetical protein MIMGU_mgv1a001268mg              72.0    3e-10   
gb|ACF22074.1|  NBS-coding resistance gene protein                    69.7    3e-10   
gb|ACQ42907.1|  tomato spotted wilt virus resistance protein          68.9    3e-10   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363  72.0    4e-10   
emb|CDP20159.1|  unnamed protein product                              72.0    4e-10   
gb|AFN86171.1|  reistance protein F variant 1.2                       72.0    4e-10   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              71.6    4e-10   
emb|CDP19794.1|  unnamed protein product                              72.0    4e-10   
emb|CDP17263.1|  unnamed protein product                              72.0    4e-10   
ref|XP_004306372.1|  PREDICTED: disease resistance protein RGA2-like  71.6    4e-10   
emb|CDY05425.1|  BnaA02g32660D                                        71.2    4e-10   
ref|XP_010321401.1|  PREDICTED: putative late blight resistance p...  71.6    4e-10   
ref|XP_010321399.1|  PREDICTED: putative late blight resistance p...  71.6    4e-10   
ref|XP_010321400.1|  PREDICTED: putative late blight resistance p...  71.6    4e-10   
ref|XP_004240205.1|  PREDICTED: putative late blight resistance p...  71.6    4e-10   
ref|XP_002519373.1|  leucine-rich repeat containing protein, puta...  71.6    4e-10   



>ref|XP_009762701.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=983

 Score = 96.7 bits (239),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 95/165 (58%), Gaps = 18/165 (11%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS-------EMVGR  453
            +L  IL Q +E  D+V +ELVK+K +  +Q        SL  S  P S       +MVG 
Sbjct  94   RLLAILHQAIEGADSVTKELVKLKENINMQAA----NRSLEGSSSPRSHVSILENDMVGY  149

Query  452  DKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQH  273
            + E E + G LI RSS QL+V+SI+GMGGIGK+T A++++ DP I S FD   W+  S+ 
Sbjct  150  NIEQECMRGQLIGRSS-QLEVISIAGMGGIGKSTFAKKMFYDPSILSFFDFRGWITVSKD  208

Query  272  QNDRQMLLGLLNSLVY------TNNSSSDEDLSAQLRKTLWGQRY  156
             + R+MLL LL   +         +  S+ DL+  L+K+L G+RY
Sbjct  209  YSLRKMLLSLLQDTIVEKEKKEKLDKKSNGDLADLLQKSLKGRRY  253


 Score = 40.4 bits (93),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 4/60 (7%)
 Frame = -1

Query  859  KHLVLSLHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEE  680
            +HL L L++K+GS++E  D +  D   E +K+L  K++DVA  VEDE+E Q+  + E +E
Sbjct  30   EHLKL-LYEKVGSMLEFLDTNSDD---EPMKDLLKKVKDVAHNVEDEVESQLRLVSEKDE  85



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 95.5 bits (236),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 9/131 (7%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGR  453
            +L +ILQ+ +E++D+VKEEL K+K D      +     SL  S  P        + MVG 
Sbjct  103  RLLMILQRAIEEVDSVKEELNKLK-DNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGH  161

Query  452  DKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQH  273
            + E E++ G L   SS QL+V+SI+GMGGIGK+T A+R++ DP I S FD+  WV  S+ 
Sbjct  162  NIEQELMRGQLTGNSS-QLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKD  220

Query  272  QNDRQMLLGLL  240
             N R+MLL LL
Sbjct  221  YNLRKMLLSLL  231


 Score = 37.0 bits (84),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 4/51 (8%)
 Frame = -1

Query  856  HLVLSLHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            HL L L+ K+GS++E  D +  D   E +++L  K++DVA +VEDE+E  I
Sbjct  32   HLKL-LYDKVGSMLEFLDTNSDD---EPMRDLLKKVKDVAHKVEDEVESHI  78



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   100 bits (249),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 86/155 (55%), Gaps = 9/155 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDY-----MLQRTLDVLPISLADSFQPASEMVGRDKEFEII  432
            L Q    ID+   + +KIK  Y      L       P S   S QP + MVG + E +++
Sbjct  85   LNQIKGHIDSTMNDWMKIKTSYENHVKALPANEGFSPDSSKLSSQPENVMVGHNNELDLM  144

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
            +  L  R SR+LKVVSI GMGGIGKTT A RIY DP+I S FD    V  SQ    R++L
Sbjct  145  LDHLT-RGSRELKVVSIVGMGGIGKTTFATRIYYDPVIVSRFDTRPMVTVSQEFYVRRLL  203

Query  251  LGLLNSLVYTNN---SSSDEDLSAQLRKTLWGQRY  156
            LGLLNS+        + SD  L+ +LRK L G+RY
Sbjct  204  LGLLNSITSIPREICNESDGQLADRLRKGLKGRRY  238


 Score = 31.6 bits (70),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 10/87 (11%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDI  785
            MA   + SLM T+           ILQQN   P     +  L++ LGSL  + ++S    
Sbjct  1    MAYAALTSLMGTVG---------KILQQNP-DPEKGEEMKFLYETLGSLRAILEDSVKRS  50

Query  784  GVEAIKELETKLRDVAFRVEDEIEFQI  704
             +E IK LE +   +A+ +ED++E  +
Sbjct  51   DLEMIKRLEAQTTQMAYALEDKVELAM  77



>ref|XP_009624584.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana tomentosiformis]
Length=723

 Score = 94.4 bits (233),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E++D+VKEEL K+K D      +     SL  S  P        + MVG + E 
Sbjct  107  ILQRAIEEVDSVKEELNKLK-DNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGHNIEQ  165

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E++ G L   SS QL+V+SI+GMGGIGK+T A+R++ DP I S FD+  WV  S+  N R
Sbjct  166  ELMRGQLTGNSS-QLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKDYNLR  224

Query  260  QMLLGLL  240
            +MLL LL
Sbjct  225  KMLLSLL  231


 Score = 37.4 bits (85),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 13/89 (15%)
 Frame = -1

Query  964  MACV--VVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRM  791
            MA V   V SLM T++L    S     LQ++      +HL L L+ K+GS++E  D +  
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH----KEHLKL-LYDKVGSMLEFLDTNSD  52

Query  790  DIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            D   E +++L  K++DVA +VEDE+E  I
Sbjct  53   D---EPMRDLLKKVKDVAHKVEDEVESHI  78



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 94.4 bits (233),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E++D+VKEEL K+K D      +     SL  S  P        + MVG + E 
Sbjct  107  ILQRAIEEVDSVKEELNKLK-DNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGHNIEQ  165

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E++ G L   SS QL+V+SI+GMGGIGK+T A+R++ DP I S FD+  WV  S+  N R
Sbjct  166  ELMRGQLTGNSS-QLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKDYNLR  224

Query  260  QMLLGLL  240
            +MLL LL
Sbjct  225  KMLLSLL  231


 Score = 37.4 bits (85),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 4/51 (8%)
 Frame = -1

Query  856  HLVLSLHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            HL L L+ K+GS++E  D +  D   E +++L  K++DVA +VEDE+E  I
Sbjct  32   HLKL-LYDKVGSMLEFLDTNSDD---EPMRDLLKKVKDVAHKVEDEVESHI  78



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 94.4 bits (233),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 78/127 (61%), Gaps = 9/127 (7%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E++D+VKEEL K+K D      +     SL  S  P        + MVG + E 
Sbjct  107  ILQRAIEEVDSVKEELNKLK-DNNNNNNMRAGNFSLGGSSSPRLHVSTLENNMVGHNIEQ  165

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E++ G L   SS QL+V+SI+GMGGIGK+T A+R++ DP I S FD+  WV  S+  N R
Sbjct  166  ELMRGQLTGNSS-QLEVISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVSKDYNLR  224

Query  260  QMLLGLL  240
            +MLL LL
Sbjct  225  KMLLSLL  231


 Score = 37.4 bits (85),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 4/51 (8%)
 Frame = -1

Query  856  HLVLSLHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            HL L L+ K+GS++E  D +  D   E +++L  K++DVA +VEDE+E  I
Sbjct  32   HLKL-LYDKVGSMLEFLDTNSDD---EPMRDLLKKVKDVAHKVEDEVESHI  78



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 99/164 (60%), Gaps = 8/164 (5%)
 Frame = -3

Query  626  SSPCFKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD----SFQPASEMV  459
            S+  +KL   L++ +E ID++ ++ + I++ Y   + L     SLA     + +P + MV
Sbjct  87   SNALWKLCCCLEKAVERIDSIMKQWMAIRDWYTNIKGLKAQKFSLASIPERAVEPENIMV  146

Query  458  GRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNAS  279
            G + EFE++   L  R S +L+VVSI+GMGGIGKTTLA ++Y DP I S FD+ A V  S
Sbjct  147  GHESEFEMMQDRL-ARGSSELEVVSITGMGGIGKTTLANKLYSDPFIMSRFDIRAKVTIS  205

Query  278  QHQNDRQMLLGLLNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            Q    R +LLGLL+ +    N   ++D   L+ QL+K L G+RY
Sbjct  206  QEYCKRNVLLGLLSPISGRTNEYFEQDDGQLADQLQKLLKGRRY  249



>ref|XP_009631206.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=905

 Score = 90.5 bits (223),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/179 (35%), Positives = 101/179 (56%), Gaps = 28/179 (16%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYML--QRTLDVLPISLADSFQPASEMVGRDKEFE  438
            +L +ILQ+ ++DID+V  EL+K++ + M     +L     S +++     E+VG + E E
Sbjct  103  RLLMILQRAIKDIDSVNRELLKLRENNMRAGNCSLGASTSSQSNASTLEKEIVGYNIEQE  162

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
            +++G L   SS QL+V+SI GMGGIGK+T A+RI+ DP I S FD+ AW+  S+  + R+
Sbjct  163  LMLGQLRGHSS-QLEVISIFGMGGIGKSTFAKRIFFDPSILSFFDIRAWIVVSKDYSIRK  221

Query  257  MLLGLLNSLVYTNNSSS-------------------------DEDLSAQLRKTLWGQRY  156
            MLL LL + +  +  +                          D+ L+ +L+K+L G+RY
Sbjct  222  MLLSLLQNAIGVDEEADKKSDGEQPNRLQKSDGDLEDGLQKIDDALADRLQKSLKGRRY  280


 Score = 37.0 bits (84),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 13/89 (15%)
 Frame = -1

Query  964  MACV--VVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRM  791
            MA V   V SLM T++L    S     LQ++      +HL L L+ K+GS++E  D +  
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEDH----KEHLKL-LYDKVGSMLEFLDTNSD  52

Query  790  DIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            D   E +K+L   ++DVA +VEDE+E  I
Sbjct  53   D---EPMKDLLKNVKDVAHKVEDEVESHI  78



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score = 90.5 bits (223),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = -3

Query  611   KLGLILQQGMEDIDAVKEELVKIKNDYMLQ-RTLDVLPISLADSFQP----ASEMVGRDK  447
             KL   LQ+  +DID V+EE  KI+     Q  TL +L  + +    P    ++ MVGRDK
Sbjct  1076  KLRESLQRVAKDIDRVQEESQKIQQHKGSQASTLSLLRDTSSSEILPNLDVSNNMVGRDK  1135

Query  446   EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
             E + ++  L   S  +LKV+ I GMGGIGKTTLA++++  P I S FD+ AW   S+  N
Sbjct  1136  EKKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYN  1195

Query  266   DRQMLLGLLNSLVYTNNS--SSDED-LSAQLRKTLWGQRY  156
              +++LL LL S++  ++   S DED L+  L+K L  +RY
Sbjct  1196  VKEILLSLLQSIINIDDKVYSRDEDELADLLQKKLKCRRY  1235


 Score = 36.6 bits (83),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 46/86 (53%), Gaps = 6/86 (7%)
 Frame = -1

Query  964   MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDI  785
             MA   + SL+RT+EL  L +   P+L    L   ++  ++ LHKK+ S+      S   I
Sbjct  976   MAYASIASLIRTMEL--LLTSDSPMLS---LTFDHREEIIELHKKVSSIEAFLKNSEKQI  1030

Query  784   GVE-AIKELETKLRDVAFRVEDEIEF  710
                 A+ ELE +++  A  VED+IEF
Sbjct  1031  HNHMAMTELEARIKGFANVVEDKIEF  1056


 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 95/160 (59%), Gaps = 8/160 (5%)
 Frame = -3

Query  611   KLGLILQQGMEDIDAVKEELVKIKNDYMLQ-RTLDVLPISLADSFQP----ASEMVGRDK  447
             KL   LQ+  +DID V+EE  KI+     Q  TL +L  + +    P    ++ MVGRDK
Sbjct  1880  KLRESLQRVAKDIDRVQEESQKIQQHKGSQASTLSLLRDTSSSEILPNLDVSNNMVGRDK  1939

Query  446   EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
             E + ++  L   S  +LKV+ I GMGGIGKTTLA++++  P I S FD+ AW   S+  N
Sbjct  1940  EKKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRAWATISKEYN  1999

Query  266   DRQMLLGLLNSLVYTNNS--SSDED-LSAQLRKTLWGQRY  156
              +++LL LL S++  ++   S DED L+  L+K L  +RY
Sbjct  2000  VKEILLSLLQSIINIDDKVYSRDEDELADLLQKKLKCRRY  2039


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 88/154 (57%), Gaps = 9/154 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADS----FQPASEMVGRDKEFEIIM  429
            L+Q  E+ID V++E  KI+  Y  +++L+   +  + S        + MVGR  E E +M
Sbjct  200  LKQVAEEIDRVQKESTKIQ--YKAKQSLEEYFVQASSSAKVILNGKNNMVGRRDEREKMM  257

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L    S  LKV+ I GMGGIGKTTLA+ ++ D  I S FD+ AW   SQ  N + +L+
Sbjct  258  TELTRGFSGVLKVIPIVGMGGIGKTTLAKEVFNDAFIRSHFDVRAWATISQEHNVKDILV  317

Query  248  GLLNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
             LL+S    +++ + ED   L+  L+K+L  +RY
Sbjct  318  SLLHSTKEKDDTVNTEDESKLADMLQKSLKSRRY  351



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score = 94.4 bits (233),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 93/159 (58%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K   +  LQ        S+ DS  P        ++MVG + E 
Sbjct  101  ILQRGIENVDSLKEELIKHSPNNNLQAGNS----SIGDSSSPRLHAPTHENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L  R S +L+V+S++GMGGIGK+T A++++  P + S FD+  WV  S+  + R
Sbjct  157  ANMLSQLT-RDSPELEVISVTGMGGIGKSTFAKKLFSHPSVLSFFDIRGWVTVSEDYSYR  215

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
             MLLGLL           +  SD DL+  L+++L G+RY
Sbjct  216  NMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRY  254


 Score = 32.3 bits (72),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  841  LHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
            L++K+ SL EL D S      E  ++L  K RD+A   EDE+E Q+  + E + D
Sbjct  37   LYEKVDSLHELLDNS----DGEQTEDLHEKARDIANEAEDEVESQMKVVMEEQHD  87



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score = 94.4 bits (233),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 93/159 (58%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K   +  LQ        S+ DS  P        ++MVG + E 
Sbjct  101  ILQRGIENVDSLKEELIKHSPNNNLQAGNS----SIGDSSSPRLHAPTHENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L  R S +L+V+S++GMGGIGK+T A++++  P + S FD+  WV  S+  + R
Sbjct  157  ANMLSQLT-RDSPELEVISVTGMGGIGKSTFAKKLFSHPSVLSFFDIRGWVTVSEDYSYR  215

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
             MLLGLL           +  SD DL+  L+++L G+RY
Sbjct  216  NMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRY  254


 Score = 32.3 bits (72),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  841  LHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
            L++K+ SL EL D S      E  ++L  K RD+A   EDE+E Q+  + E + D
Sbjct  37   LYEKVDSLHELLDNS----DGEQTEDLHEKARDIANEAEDEVESQMKVVMEEQHD  87



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score = 90.9 bits (224),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 87/154 (56%), Gaps = 11/154 (7%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEF----EIIM  429
            LQQ +EDID+VKEEL+K + +  LQ        S+  S  P S +   + +     E  M
Sbjct  100  LQQVIEDIDSVKEELIKQRKNNNLQAGNH----SVGGSSSPLSHVSALENDVISIEEERM  155

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
               + R S +L+V+SI GMGGIGK+T AR++Y DP I S  D+ AW+  S+  + R MLL
Sbjct  156  RDQLTRGSSELEVISIVGMGGIGKSTFARKMYSDPSIVSFHDVRAWITVSKDYSLRNMLL  215

Query  248  GLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
             LL   +      +  SD +L+ +LRK L  +RY
Sbjct  216  CLLRDAIGMTKELDKRSDGELAERLRKHLMAKRY  249


 Score = 35.8 bits (81),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = -1

Query  964  MACV--VVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRM  791
            MA V   V SLM T++L    S     LQ+       +HL L L+ K+GSL EL D +  
Sbjct  1    MATVYAAVTSLMGTIQL---ISQSTSDLQEGH----REHLKL-LYDKVGSLQELLDTNSD  52

Query  790  DIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEEDFGI  668
            D   + +K+L  K+ D+    EDE+E Q+  + E +ED  I
Sbjct  53   D---KPMKDLRKKVIDLTHEAEDEVESQLRLVMEEDEDVQI  90


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = -3

Query  470  SEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAW  291
            ++MVG   E E + G L   SS QL+V+SI+GMGGIGK+T A++++ DP I   FD+  W
Sbjct  373  TDMVGYKDEQESMRGKLTGHSS-QLEVISIAGMGGIGKSTFAKKMFSDPSILEFFDVRGW  431

Query  290  VNASQHQNDRQMLLGLLN--SLVYTN-NSSSDEDLSAQLRKTLWGQRY  156
            +  S+  + R+MLL LL   + V  N ++ SD DL+  L+K L  +RY
Sbjct  432  ITVSRDYSVRKMLLSLLQDATAVKENLDNVSDGDLAGLLKKRLNSRRY  479



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score =   102 bits (253),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEM----VGRDK  447
            ++L  IL+Q  E +D+  ++ + I + Y   R  ++   SL D  Q A EM    VG + 
Sbjct  258  WELFFILEQAAECVDSTMKQWMAIWDRYNNTRDQEIQNFSLVDISQHALEMENMMVGHEN  317

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFEII    I R +R+L+VVSI GMGGIGKTTLA RIY DP I S FD+ A    SQ   
Sbjct  318  EFEIIQDQ-IARGARELEVVSIVGMGGIGKTTLANRIYCDPFIVSRFDIRAKATLSQEHC  376

Query  266  DRQMLLGLLNSLVYTNNSSSDE----DLSAQLRKTLWGQRY  156
             R +LL LL+S     +   +E     L+ +L+K L G+RY
Sbjct  377  VRNVLLRLLSSTRGKTDECYEEQDDGQLADRLQKLLKGKRY  417



>ref|XP_009777040.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=902

 Score =   101 bits (252),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 92/157 (59%), Gaps = 5/157 (3%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEI  435
            ++L  +L+Q + DID   ++ +  + +  L+    +LP +   + +P + MVG + EFE+
Sbjct  97   WRLRFLLKQAIRDIDCTAKKWIGTQTNQDLKAQNPILPSTSERALEPENMMVGHENEFEM  156

Query  434  IMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQM  255
            +   L  R + +L+VVSI GMGGIGKTTLA +I+ DP I S FD+ A V  SQ    R+ 
Sbjct  157  MQDQL-ARGASELEVVSIVGMGGIGKTTLANKIFSDPFIMSRFDIRAKVTISQEYCPRKG  215

Query  254  LLGLLNSLVYTNNSS----SDEDLSAQLRKTLWGQRY  156
            LLGLL+S+    +       D  L  +L+K L G+RY
Sbjct  216  LLGLLSSITGKTDKPYEQQDDGQLKDRLQKLLKGRRY  252



>ref|XP_006345285.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like, 
partial [Solanum tuberosum]
Length=873

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 96/167 (57%), Gaps = 12/167 (7%)
 Frame = -3

Query  635  AKSSSPCF-KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSF------Q  477
            AK+ +  F +L   L+Q +E ID++  + + I N Y   + L     SLA S       +
Sbjct  82   AKNKARAFWELCCSLEQEVERIDSLMMQWLAIWNWYSKIKDLKARKFSLAPSIPEHAVGK  141

Query  476  PASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLL  297
            P + MVG + EFE+++   +    R+L+VVSI GMGGIGKTTLA ++YRDP I S FD+L
Sbjct  142  PENIMVGHENEFEMMLNQ-VAGGERELEVVSIVGMGGIGKTTLATKLYRDPRIMSHFDIL  200

Query  296  AWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            A    SQ    R +LL LL S     +   D+ L+ QL+K L G+RY
Sbjct  201  AKATVSQEYCVRNVLLALLAS----TSEEPDDQLADQLQKRLKGKRY  243



>ref|XP_009763644.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=353

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 93/158 (59%), Gaps = 7/158 (4%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVK-IKNDYMLQRTLDVLPISLAD-SFQPASEMVGRDKEFE  438
            K    LQ+  E ID+   +L + +K++  +  +L V    L + S Q  + MVG + E E
Sbjct  110  KFCTRLQEASESIDSKCRKLTENMKSNLQVTNSL-VQSFDLPEHSPQLGNCMVGHENELE  168

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
             I   L++ SS + + ++I+GMGGIGKTT AR+IY DP I S FD+LAW  AS+    R+
Sbjct  169  DIKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWATASKEYCVRK  228

Query  257  MLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            MLL LL+ +  T      +  D +LS +L++ LW +RY
Sbjct  229  MLLQLLHCIPSTEEVRREARDDGELSGKLKQRLWKRRY  266



>gb|AEW48187.1| disease resistance protein RGH5 [Solanum albicans]
Length=931

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 95/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL S+    +  SD  L+ +L+K L G+RY
Sbjct  209  NVILGLLPSI----SDGSDNQLADRLQKHLKGRRY  239



>ref|XP_009779880.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=862

 Score = 96.3 bits (238),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYML--QRTLDVLPISLADSFQPASEMVGRDKEFEIIMG  426
            ILQ+ ++DID+V +EL+K++ + M     +L     S + +    +EMVG + E E+I+G
Sbjct  52   ILQRAIKDIDSVNKELMKLRENNMRPGNCSLGASTSSQSHASTLENEMVGYNIEQELILG  111

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L   SS QL+V+SI GMGGIGK+T A+RI+ DP I S FD+  W+  S+  N R+MLL 
Sbjct  112  QLRGHSS-QLEVISIFGMGGIGKSTFAKRIFSDPSIVSFFDVRGWIVVSKDYNIRKMLLS  170

Query  245  LLNSLVYTN--NSSSDEDLSAQLRKT  174
            LL  +      +S SD +LS  L+K+
Sbjct  171  LLKDVGMNEEADSKSDGELSNCLQKS  196


 Score = 27.3 bits (59),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -1

Query  772  IKELETKLRDVAFRVEDEIEFQI  704
            +K+L  K++DVA +VEDE+E  I
Sbjct  1    MKDLLKKVKDVAHKVEDEVESHI  23



>gb|AEW48188.1| disease resistance protein RGH7 [Solanum albicans]
Length=912

 Score = 99.8 bits (247),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 95/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL S+    +  SD  L+ +L+K L G+RY
Sbjct  209  NVILGLLPSI----SDGSDNQLADRLQKHLKGRRY  239



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score = 88.6 bits (218),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 8/155 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQ-RTLDVLPISLADSFQP----ASEMVGRDKEFEII  432
            LQ+  +DID V++E  KI++    Q  TL +L  + +    P    ++ MVGRDKE E +
Sbjct  106  LQRVAKDIDCVQKESKKIQHHKGNQASTLSLLRDTSSSEMLPNLDVSNNMVGRDKEKERM  165

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
            +  L   S  +LKV+ I GMGGIGKTTLA++++  P I S FD+ AW    +  N +++L
Sbjct  166  LEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIQSRFDVRAWATICKEYNVKEIL  225

Query  251  LGLLNSLVYTNNS--SSDE-DLSAQLRKTLWGQRY  156
            L LL S++  ++   S DE +L+  L+K L  +RY
Sbjct  226  LSLLQSIINIDDKVYSRDEAELADLLQKKLKCRRY  260


 Score = 35.0 bits (79),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 50/101 (50%), Gaps = 6/101 (6%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDI  785
            MA   + SL+RT+EL  L +   P+L    L    +  ++ LHKK+ S+      S   I
Sbjct  1    MAYASIASLIRTMEL--LLTSDSPMLS---LTFDLREEIIELHKKVSSIEAFLKNSEKQI  55

Query  784  GVE-AIKELETKLRDVAFRVEDEIEFQIAHLHETEEDFGIG  665
                A+ ELE +++  A   ED+IEF +     TE++   G
Sbjct  56   HNHMAMTELEARIKGFANVAEDKIEFGLREAMITEDEMQRG  96



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 97/157 (62%), Gaps = 11/157 (7%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELV----KIKNDYMLQRTLDVLPISLADSFQPASEMVGRDK  447
            +++  +L+Q +E ID+  ++ +     +K+      +L  LP    +  QP + MVGR+ 
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHAVE--QPENIMVGREN  147

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+   V  SQ   
Sbjct  148  EFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRTKVTVSQEYC  206

Query  266  DRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             R ++LGLL+S+    ++  D+ L+ +L+K L G+RY
Sbjct  207  VRNVILGLLSSI----SNEPDDQLADRLQKNLKGRRY  239



>gb|ABY61746.1| resistance protein PSH-RGH7 [Solanum tuberosum]
Length=930

 Score = 98.6 bits (244),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    + Q+T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKQQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D  L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDYQLADRLQKHLKGRRY  239



>gb|AGW23829.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
 gb|AGX27502.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
Length=768

 Score = 78.6 bits (192),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 90/159 (57%), Gaps = 18/159 (11%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS--------EMVGRDKEF  441
            LQ  ME+ D++ E+++ I+N      T++ +  S A +  P+S        +MVG D++ 
Sbjct  108  LQLVMEETDSIVEQVMSIQNSC----TVEDVQCSYASAL-PSSGGAPNDGNKMVGFDEDI  162

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              +   L   SS  L+++SI GMGGIGKTTLA  I+ D L+   F +  W   SQ+ + R
Sbjct  163  LELKARLCGESS-TLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVSQNYHLR  221

Query  260  QMLLGLLNSLV--YTNNSSS--DEDLSAQLRKTLWGQRY  156
            Q+LL L+ SL    T + S+  DE+L+  + KTL G+ Y
Sbjct  222  QVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTY  260


 Score = 43.5 bits (101),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 9/98 (9%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIP--CNKHLVLSLHKKLGSLMELFDESRM  791
            MA   V+SL +TLE             Q   IP  C + L  SL +KL S ++ F E   
Sbjct  1    MAYAAVVSLAQTLEHINHHH------HQYCCIPLICEEQLFESLLEKL-SFLQAFLEDNA  53

Query  790  DIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
             IGVE ++ LE ++RD+A+R ED IE  ++    +E++
Sbjct  54   QIGVETVEGLEGRIRDLAYRAEDIIESHVSDQISSEQE  91



>gb|AAF04603.1|AF195939_1 disease resistance protein Gpa2 [Solanum tuberosum]
 emb|CAB55838.1| NBS-LRR protein [Solanum tuberosum subsp. andigenum]
Length=912

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 93/163 (57%), Gaps = 7/163 (4%)
 Frame = -3

Query  638  AAKSSSPCFKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASE  465
              K S   + +  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + 
Sbjct  82   VGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENI  141

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A   
Sbjct  142  MVGRENEFEMMLDQL-ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKAT  200

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             SQ    R +LLGLL+      +   D  L+ QL+K L G+RY
Sbjct  201  VSQEYCVRNVLLGLLS----LTSDEPDYQLADQLQKHLKGRRY  239



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score = 97.4 bits (241),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +     +      +SL D +F QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPDHAFEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48207.1| disease resistance protein RGH5 [Solanum fernandezianum]
Length=912

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 92/163 (56%), Gaps = 7/163 (4%)
 Frame = -3

Query  638  AAKSSSPCFKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASE  465
              K S   + +  +L+Q +E ID+  ++ +   +    +  +T  ++     D  QP + 
Sbjct  82   VGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSFPEHDVEQPENI  141

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVGR+ EFE+++  L+ R  R+L+VVSI G GGIGKTTLA ++Y DP I S FD+ A   
Sbjct  142  MVGRENEFEMMLDQLV-RGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKAT  200

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             SQ    R +LLGLL+      +   D  L+ +LRK L G+RY
Sbjct  201  VSQEYCVRNVLLGLLS----LTSDEPDYHLADRLRKHLKGRRY  239



>gb|AEW48195.1| disease resistance protein RGH6 [Solanum chacoense]
Length=912

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 95/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIASTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L+ +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLADRLQKHLKGRRY  239



>gb|AFB17980.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            QP + MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+
Sbjct  14   QPENIMVGRENEFEMMLDQLA-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDI  72

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R ++LGLL S     +  SD+ L+ +L+K L G+RY
Sbjct  73   RAKATVSQEYCVRNVILGLLPS----RSDESDDQLADRLQKHLKGRRY  116



>gb|AFB17979.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            QP + MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+
Sbjct  14   QPENIMVGRENEFEMMLDQLA-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDI  72

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R ++LGLL S     +  SD+ L+ +L+K L G+RY
Sbjct  73   RAKATVSQEYCVRNVILGLLPS----RSDESDDQLADRLQKHLKGRRY  116



>gb|AEW48202.1| disease resistance protein RGH4 [Solanum ehrenbergii]
 gb|AEW48203.1| disease resistance protein RGH7 [Solanum ehrenbergii]
Length=914

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 95/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIASTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L+ +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLADRLQKHLKGRRY  239



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score = 96.7 bits (239),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 93/156 (60%), Gaps = 9/156 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIK---NDYMLQRTLDVLPISLADSFQPASEMVGRDKE  444
            +++  +L+Q +E ID+  ++ +       D  LQ T  ++        QP + MVGR+ E
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSYSMKDLKLQ-TSSLVSFPEHAYEQPENIMVGRENE  148

Query  443  FEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQND  264
            FE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    
Sbjct  149  FEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPCIMSRFDIRAKATVSQEYCV  207

Query  263  RQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            R +L GLL+S+    +   D+ L+ +L+K L G+RY
Sbjct  208  RNVLHGLLSSI----SDEPDDQLADRLQKHLKGRRY  239



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score = 88.6 bits (218),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = -3

Query  644  YIAAKSSSPCFKLGLILQQGMEDIDAVKEELVK-IKNDYMLQRTLDVLPISLADSFQP--  474
            ++ +KS    +K   IL Q + D+D++KE+L+K +KN+      L  +  S+  S  P  
Sbjct  93   HLPSKSHERLYK---ILLQAICDVDSIKEKLIKQMKNN-----KLQAVNHSIGGSSSPRL  144

Query  473  -----ASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASS  309
                  ++MVG + E E +   L   SS QL+V+SI GMGGIGK+T A +++ DP I S 
Sbjct  145  HVSTLVNDMVGYNIEQEHMRSQLTGHSS-QLEVISIVGMGGIGKSTFANKMFSDPSILSF  203

Query  308  FDLLAWVNASQHQNDRQMLLGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
            FD+  W+  S + + R+MLL LL   V      +  +D +L+  L+K+L G+RY
Sbjct  204  FDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDGELADHLQKSLKGRRY  257


 Score = 31.6 bits (70),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (67%), Gaps = 4/42 (10%)
 Frame = -1

Query  829  LGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            +GSL+E  D S      E +K+L+ K++D+A +VE+++E  I
Sbjct  39   VGSLLEFLDNS----DDEPMKDLQKKVKDLAIKVEEQVESHI  76



>gb|AEW48189.1| disease resistance protein RGH9 [Solanum albicans]
Length=912

 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIASTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L  +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLEDRLQKHLKGRRY  239



>gb|AEW48186.1| disease resistance protein RGH2 [Solanum albicans]
Length=910

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIASTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L  +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLEDRLQKHLKGRRY  239



>gb|ACE79449.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  28   LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+    N       D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARNVLLGLLSSISGKTNEFHEQQGDDQLADQLQKLLKCGRY  139



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score = 88.6 bits (218),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 99/174 (57%), Gaps = 20/174 (11%)
 Frame = -3

Query  644  YIAAKSSSPCFKLGLILQQGMEDIDAVKEELVK-IKNDYMLQRTLDVLPISLADSFQP--  474
            ++ +KS    +K   IL Q + D+D++KE+L+K +KN+      L  +  S+  S  P  
Sbjct  93   HLPSKSHERLYK---ILLQAICDVDSIKEKLIKQMKNN-----KLQAVNHSIGGSSSPRL  144

Query  473  -----ASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASS  309
                  ++MVG + E E +   L   SS QL+V+SI GMGGIGK+T A +++ DP I S 
Sbjct  145  HVSTLVNDMVGYNIEQEHMRSQLTGHSS-QLEVISIVGMGGIGKSTFANKMFSDPSILSF  203

Query  308  FDLLAWVNASQHQNDRQMLLGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
            FD+  W+  S + + R+MLL LL   V      +  +D +L+  L+K+L G+RY
Sbjct  204  FDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDGELADHLQKSLKGRRY  257


 Score = 31.6 bits (70),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (67%), Gaps = 4/42 (10%)
 Frame = -1

Query  829  LGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQI  704
            +GSL+E  D S      E +K+L+ K++D+A +VE+++E  I
Sbjct  39   VGSLLEFLDNS----DDEPMKDLQKKVKDLAIKVEEQVESHI  76



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 95/157 (61%), Gaps = 11/157 (7%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELV----KIKNDYMLQRTLDVLPISLADSFQPASEMVGRDK  447
            +++  +L+Q +E ID+  ++ +     +K+      +L  LP    +  QP + MVGR+ 
Sbjct  90   WEIFFVLEQALEYIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHAVE--QPENIMVGREN  147

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ   
Sbjct  148  EFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYC  206

Query  266  DRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             R +LL LL+S+    +   D+ L+ +L+K L G+RY
Sbjct  207  VRNVLLALLSSI----SDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48193.1| disease resistance protein RGH4 [Solanum chacoense]
Length=914

 Score = 96.3 bits (238),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++   L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFFLEQALECIASTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L+ +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLADRLQKHLKGRRY  239



>gb|AEW48196.1| disease resistance protein RGH7 [Solanum chacoense]
Length=914

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    Q+      +SL + +F QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDQKPQTSSLVSLPEHAFEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+    L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMTRDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LL LL+S     +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLALLSS----TSDEPDDQLADRLQKHLKGRRY  239



>gb|AFB17983.1| Rx-like protein, partial [Solanum chacoense]
Length=350

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            QP + MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+
Sbjct  14   QPENTMVGRENEFEMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDI  72

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  73   RAKATVSQEYCVRNVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  116



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    Q+      +SL + +F QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDQKPQTSSLVSLPEHAFEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+    L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMTRDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPNIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LL LL+S     +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLALLSS----TSDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score = 95.9 bits (237),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 16/160 (10%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLP-----ISLADSF--QPASEMVG  456
            +++   L+Q +E ID+  ++     +D M     D+ P     +SL +    QP + MVG
Sbjct  90   WEIFFFLEQALECIDSTMKQYWMATSDSMK----DLKPQTGSLVSLPEHAVEQPENIMVG  145

Query  455  RDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQ  276
            R+ EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ
Sbjct  146  RENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYTDPYIMSRFDIRAKATVSQ  204

Query  275  HQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
                R +LLGLL+      +   D  L+ +L+K L G+RY
Sbjct  205  EYCVRNVLLGLLS----LTSDEPDYQLADRLQKHLKGRRY  240



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score = 95.5 bits (236),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 94/157 (60%), Gaps = 11/157 (7%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELV----KIKNDYMLQRTLDVLPISLADSFQPASEMVGRDK  447
            +++  +L+Q +E ID+  ++ +     +K+      +L  LP    +  QP + MVGR+ 
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHAVE--QPENIMVGREN  147

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ   
Sbjct  148  EFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYC  206

Query  266  DRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             R +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  207  VRNVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 94/157 (60%), Gaps = 11/157 (7%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELV----KIKNDYMLQRTLDVLPISLADSFQPASEMVGRDK  447
            +++  +L+Q +E ID+  ++ +     +K+      +L  LP    +  QP + MVGR+ 
Sbjct  90   WEIFFVLEQALEYIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHAVE--QPENIMVGREN  147

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ   
Sbjct  148  EFEMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYC  206

Query  266  DRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             R ++LGLL S+    +   D+ L+ +L+K L G+RY
Sbjct  207  VRNVILGLLPSI----SDEPDDQLADRLQKHLKGRRY  239



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPDNIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             + LGLL+      +   D+ L+ +L+K L G+RY
Sbjct  209  NVFLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPDNIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D  L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDYQLADRLQKHLKGRRY  239



>gb|AFB17978.1| Rx-like protein, partial [Solanum brevicaule]
Length=350

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -3

Query  488  DSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASS  309
            D  QP + MVGR+ EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP   S 
Sbjct  11   DVEQPENIMVGRENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYFMSR  69

Query  308  FDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            FD+ A    SQ    R +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  70   FDIRAKATVSQEYCVRNVLLGLLS----LTSDQPDDQLADRLQKHLKGRRY  116



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score = 95.5 bits (236),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 93/158 (59%), Gaps = 13/158 (8%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSF-----QPASEMVGRD  450
            +++  +L+Q +E ID+  ++ +   +     + L     SL  S      QP + MVGR+
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDS---MKDLKPQTSSLVSSPEHAVEQPENIMVGRE  146

Query  449  KEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQ  270
             EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ  
Sbjct  147  NEFEVMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEY  205

Query  269  NDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
              R +L GLL+S+    +   D+ L+ +L+K L G+RY
Sbjct  206  CVRNVLQGLLSSI----SDEPDDQLADRLQKHLKGRRY  239



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 90/156 (58%), Gaps = 13/156 (8%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVK-----IKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEII  432
            LQ+  E ID+   +L +     ++    L ++ D LP     S Q  + MVG + E E +
Sbjct  275  LQKASESIDSNSRKLTESMKSGLQATSSLVQSFD-LP---EHSPQLGNNMVGHENELEDV  330

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
               L++ SS + + ++I+GMGGIGKTT AR+IY DP I S FD+LAWV  S+    R+ML
Sbjct  331  KCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWVTVSKEYCVRKML  390

Query  251  LGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            L LL+ +  T      +  D +L+ +L++ LW +RY
Sbjct  391  LQLLHCIPSTEEVRREARDDGELAGKLKQRLWKRRY  426



>gb|AFB17976.1| Rx-like protein, partial [Solanum acaule]
Length=350

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 7/117 (6%)
 Frame = -3

Query  500  ISLAD-SF-QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRD  327
            +SL D +F QP + MVGR+ EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y D
Sbjct  5    VSLPDHAFEQPENIMVGRENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSD  63

Query  326  PLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            P I S FD+ A    SQ    R +LLGLL+      +   D+ L+ +L++ L G+RY
Sbjct  64   PYIMSRFDIRAKATVSQEYCVRNVLLGLLS----LTSDEPDDQLADRLQEHLKGRRY  116



>gb|AFB17982.1| Rx-like protein, partial [Solanum tuberosum]
Length=320

 Score = 92.8 bits (229),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 5/111 (5%)
 Frame = -3

Query  488  DSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASS  309
            D  QP + MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S 
Sbjct  11   DVEQPENIMVGRENEFEMMLDQLA-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSR  69

Query  308  FDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            FD+ A    SQ    R +LLGLL+      +  SD  L+ +L+K L G+RY
Sbjct  70   FDIRAKATVSQEYCVRNVLLGLLS----LTSDESDYQLADRLQKHLKGRRY  116



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 94/159 (59%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K  ++   Q        SL DS  P        ++MVG + E 
Sbjct  101  ILQRGIENVDSLKEELIKHSDNNTSQAGNS----SLGDSSSPRLHASTLENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E ++  L    S +L+V+S++GMGGIGK+T A++++  P I S FD+  W+  S++ + R
Sbjct  157  ENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYR  215

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
             MLLGLL           +  SD DL+  L+++L G+RY
Sbjct  216  NMLLGLLKDANIGKEEDLDKKSDSDLAVCLKQSLMGRRY  254



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score = 95.1 bits (235),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 94/159 (59%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K  ++   Q        SL DS  P        ++MVG + E 
Sbjct  111  ILQRGIENVDSLKEELIKHSDNNTSQAGNS----SLGDSSSPRLHASTLENDMVGYNIEQ  166

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E ++  L    S +L+V+S++GMGGIGK+T A++++  P I S FD+  W+  S++ + R
Sbjct  167  ENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYR  225

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
             MLLGLL           +  SD DL+  L+++L G+RY
Sbjct  226  NMLLGLLKDANIGKEEDLDKKSDSDLAVCLKQSLMGRRY  264



>ref|XP_009760414.1| PREDICTED: disease susceptibility protein LOV1-like [Nicotiana 
sylvestris]
Length=223

 Score = 87.4 bits (215),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 73/122 (60%), Gaps = 5/122 (4%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD----SFQPASEMVGRDK  447
            +KL   L+Q +E ID++ ++ + I++ Y   + L     SLA     + +P + MVG + 
Sbjct  90   WKLCCCLEQAIECIDSIMKQWMAIRDWYTNIKGLKAQKFSLASIPERAVEPENIMVGHES  149

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE++   L  R S +L+VVSI GMGGIGKTTLA ++Y DP I S FD+   V  SQ   
Sbjct  150  EFEMMQDQLA-RGSSELEVVSIIGMGGIGKTTLANKLYTDPFIMSHFDIRGKVTVSQEYC  208

Query  266  DR  261
            ++
Sbjct  209  EK  210


 Score = 31.6 bits (70),  Expect(2) = 9e-18, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = -1

Query  913  LQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDE-SRMDIGVEAIKELETKLRDVA  737
            + S    I Q  QL  CN   + S ++KL SL  + ++   +   +EA+  LE ++++V 
Sbjct  6    ITSFMSTINQSMQLTGCN---LQSFYEKLESLRSIMEKPCNITEDIEALTSLEAEIKEVV  62

Query  736  FRVEDEIE  713
            F  ED+++
Sbjct  63   FNAEDKVD  70



>ref|XP_009773240.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=675

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  485  SFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSF  306
            S Q  + MVG + E E +   L+E SS + +VV+I GMGGIGKTT ARRIY D  I S F
Sbjct  70   SVQLDNNMVGHENELEDMKSTLMETSSDETQVVAIVGMGGIGKTTFARRIYDDLEIKSHF  129

Query  305  DLLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            D+LAWV  S+    R+MLL LL+ +  T      ++ D +L+ +L++ LW +RY
Sbjct  130  DILAWVTMSKEYGVRKMLLQLLHCIPSTEAVSREATDDGELADKLKQKLWKRRY  183



>gb|AGW28125.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score = 78.2 bits (191),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 86/155 (55%), Gaps = 10/155 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRT----LDVLPISLADSFQPASEMVGRDKEFEIIM  429
            LQ  ME+ D++ E+++ I+N   ++         LP S   +    ++MVG D++   + 
Sbjct  108  LQMVMEETDSIIEQVMSIQNSCTVEDVQCSYASALPSS-GGAPNDGNKMVGFDEDLLELK  166

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L   SS  L+++SI GMGGIGKTTLA  I+ D L+   F +  W   SQ  + RQ+LL
Sbjct  167  ARLCGESS-TLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVSQDYHLRQVLL  225

Query  248  GLLNSLV--YTNNSSS--DEDLSAQLRKTLWGQRY  156
             L+ SL    T + S+  DE+L+  + KTL G+ Y
Sbjct  226  ALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTY  260


 Score = 40.4 bits (93),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 11/99 (11%)
 Frame = -1

Query  964  MACVVVLSLMRTLEL---EFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESR  794
            MA   V SL +TLE       Q    P++       C + L  SL +KL S ++ F E  
Sbjct  1    MAYAAVASLAQTLERINHHHHQYCCVPLI-------CEEQLFESLLEKL-SFLQAFLEDN  52

Query  793  MDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
              IG E ++ LE ++RD+A+R ED IE  ++    +E++
Sbjct  53   AQIGGETVEGLEGRIRDLAYRAEDIIESHVSDQISSEQE  91



>gb|AEW48191.1| disease resistance protein RGH2 [Solanum chacoense]
Length=914

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +     +      +SL + +F QP + MVG + EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATADSMKDLKPQTSSLVSLPEHAFEQPENIMVGYENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDKLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +L GLL+S+    +   D+ L+A+L+K L G RY
Sbjct  209  NVLQGLLSSI----SDEPDDQLAARLQKHLKGGRY  239



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVG + EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHDVEQPENIMVGCENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  239



>ref|XP_006352021.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=890

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 95/166 (57%), Gaps = 17/166 (10%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAV--KEELVKIKNDYMLQRTLDVLPISLADSFQPA-------SEMV  459
            +L L+L+Q +E ID+   K  ++  KN YM +   ++  I+   S Q A         MV
Sbjct  13   RLELLLKQQVERIDSAMNKWMIIAEKNMYMTKNKDNI--IANTSSSQHALLEPDENMNMV  70

Query  458  GRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNAS  279
            G + EFE++ G L  R  R+LKVVSI GMGGIGKTTLA +IY DP I S FD+   V  S
Sbjct  71   GDENEFEMMQGRLT-RGGRELKVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIRGNVTVS  129

Query  278  QHQNDRQMLLGLLNSLVYTNNSS-----SDEDLSAQLRKTLWGQRY  156
            Q      +LLGLL+S+   ++        D +L+ QL+K L G+RY
Sbjct  130  QEYCREYVLLGLLSSVSGMSSHEFYEQQDDGELAEQLQKLLKGRRY  175



>ref|XP_011083930.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
 gb|AGW23830.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27501.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27503.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score = 78.2 bits (191),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 89/159 (56%), Gaps = 18/159 (11%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS--------EMVGRDKEF  441
            LQ  ME+ D++ E+++ I+N      T++ +  S A +  P+S        +MVG D++ 
Sbjct  108  LQMVMEETDSIIEQVMSIQNSC----TVEDVQCSYASAL-PSSGGAPNDGNKMVGFDEDL  162

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              +   L   SS  L+++SI GMGGIGKTTLA  I+ D L+   F +  W   SQ  + R
Sbjct  163  LELKARLCGESS-TLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVSQDYHLR  221

Query  260  QMLLGLLNSLV--YTNNSSS--DEDLSAQLRKTLWGQRY  156
            Q+LL L+ SL    T + S+  DE+L+  + KTL G+ Y
Sbjct  222  QVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKGRTY  260


 Score = 40.0 bits (92),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 11/99 (11%)
 Frame = -1

Query  964  MACVVVLSLMRTLEL---EFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESR  794
            MA   V SL +TLE       Q    P++       C + L  SL +KL S ++ F E  
Sbjct  1    MAYAAVASLAQTLERINHHHHQYCCVPLI-------CEEQLFESLLEKL-SFLQAFLEDN  52

Query  793  MDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
              IG E ++ LE ++RD+A+R ED IE  ++    +E++
Sbjct  53   AQIGGETVEGLEGRIRDLAYRAEDIIESHVSDQISSEQE  91



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 91/161 (57%), Gaps = 9/161 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE----MVGRDK  447
            ++L  +L+Q +  ID V  + + ++N Y   + L    +SLAD  QPA E    MVG + 
Sbjct  90   WELFSLLKQAVGHIDYVMNKWMAVQNMYTNSKDLKAQNLSLADVSQPALELENTMVGHET  149

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE++   L  R   +L++VSI GMGGIGKTTLA +IY  P I S FD+ A    S    
Sbjct  150  EFEMLQDQL-ARGGSELEIVSIVGMGGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYR  208

Query  266  DRQMLLGLLNSL-VYTNNSSSDED---LSAQLRKTLWGQRY  156
             R +LLGLL S+ V T      +D   L+ +L+K L G RY
Sbjct  209  ARNVLLGLLFSISVKTYEFYGQQDVGQLADRLQKLLKGGRY  249



>ref|XP_009626593.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 91/161 (57%), Gaps = 9/161 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE----MVGRDK  447
            ++L  +L+Q +  ID V  + + ++N Y   + L    +SLAD  QPA E    MVG + 
Sbjct  90   WELFSLLKQAVGHIDYVMNKWMAVQNMYTNSKDLKAQNLSLADVSQPALELENTMVGHET  149

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE++   L  R   +L++VSI GMGGIGKTTLA +IY  P I S FD+ A    S    
Sbjct  150  EFEMLQDQL-ARGGSELEIVSIVGMGGIGKTTLANKIYTHPFIMSHFDIRAKATVSLEYR  208

Query  266  DRQMLLGLLNSL-VYTNNSSSDED---LSAQLRKTLWGQRY  156
             R +LLGLL S+ V T      +D   L+ +L+K L G RY
Sbjct  209  ARNVLLGLLFSISVKTYEFYGQQDVGQLADRLQKLLKGGRY  249



>gb|AEW48194.1| disease resistance protein RGH5 [Solanum chacoense]
Length=914

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 9/152 (6%)
 Frame = -3

Query  602  LILQQGMEDIDA-VKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEFEII  432
             +L+Q +E ID+ VK+ +    +   L+     L +SL + +F QP + MVG + EFE++
Sbjct  94   FVLEQALECIDSTVKQWMATADSMKDLKPQTSSL-VSLPEHAFEQPENIMVGYENEFEMM  152

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
            +  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R +L
Sbjct  153  LDKLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMSRFDIRAKATVSQEYCVRNVL  211

Query  251  LGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             GLL+S+    +   D+ L+A+L+K L G RY
Sbjct  212  QGLLSSI----SDEPDDQLAARLQKHLKGGRY  239



>ref|XP_010327575.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=790

 Score = 80.1 bits (196),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 82/144 (57%), Gaps = 3/144 (2%)
 Frame = -3

Query  581  EDIDAVKEELVKIKNDYMLQRT--LDVLPISLADSFQPASEMVGRDKEFEIIMGMLIERS  408
            +D+D++++E++ ++     ++   L   P S   S    + +VG + +F II   +  ++
Sbjct  108  KDVDSLRKEVMVVEFSKHGRKCAELATTPSSPEKSTIEENTIVGMEDDFNIIFDRVTAQT  167

Query  407  SRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLV  228
              +L V+ I  MG IGKTTLAR+IY D  I S FD  AWV  S+  N RQMLL + +S+ 
Sbjct  168  D-ELTVIPIFDMGSIGKTTLARKIYDDSYIRSRFDKHAWVTISEEYNQRQMLLEVASSIT  226

Query  227  YTNNSSSDEDLSAQLRKTLWGQRY  156
             +N   SD+ L   + + L G+R+
Sbjct  227  ESNQEMSDDQLMEFVYRGLKGRRF  250


 Score = 37.7 bits (86),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 52/91 (57%), Gaps = 9/91 (10%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCN-KHLVLSLHKKLGSLMELFDESRMD  788
            MA   + SL+ TLE  F     +P   Q+ L PC+ +  V SL++ L +L +LF ++   
Sbjct  1    MAYAAISSLVYTLEQLF-----KP--NQSFLCPCSTQQYVQSLYQNLSAL-QLFLDNTTT  52

Query  787  IGVEAIKELETKLRDVAFRVEDEIEFQIAHL  695
              +E +K +E ++RDV  + ED+++  + ++
Sbjct  53   KDIETLKLVEKRIRDVICKAEDKVDSSLRNI  83



>ref|XP_009624115.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=902

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/156 (38%), Positives = 89/156 (57%), Gaps = 5/156 (3%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEII  432
            KL  +L Q + DID+  ++ +  +    L+    +L  +   + +P + MVG + EFE+ 
Sbjct  97   KLRSLLNQAIRDIDSTTKKWIGTQTSLDLKAQNTILASTSERALEPENMMVGHENEFEM-  155

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
            M + + R + +L+VVSI GMGGIGKTTLA +I+ DPLI   FD+ A V  SQ    R  L
Sbjct  156  MQVQLARGASELEVVSIVGMGGIGKTTLANKIFSDPLIMYHFDIRAKVTISQEYCARNGL  215

Query  251  LGLLNSLVYTNNSS----SDEDLSAQLRKTLWGQRY  156
            LGLL+S+    +       D  L  +L+K L G+RY
Sbjct  216  LGLLSSITGKTDKPYEQQDDGQLKDRLQKLLKGRRY  251



>gb|ACE79429.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22013.1| NBS-coding resistance gene protein [Nicotiana tabacum]
 gb|ACF22015.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  28   LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+    N       D+ L+ +L+K L   RY
Sbjct  87   IRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRY  139



>gb|ACE79448.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  28   LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+    N       D+ L+ +L+K L   RY
Sbjct  87   IRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRY  139



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 94/157 (60%), Gaps = 11/157 (7%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELV----KIKNDYMLQRTLDVLPISLADSFQPASEMVGRDK  447
            +++  +L+Q +E ID+  ++ +     +K+      +L  LP    +  QP + MVGR+ 
Sbjct  90   WEVFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHAVE--QPENIMVGREN  147

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE+++  L+ R  R+L+VVSI GMGGIGK TLA ++Y DP I S FD+ A    SQ   
Sbjct  148  EFEMMLDQLV-RGGRELEVVSIVGMGGIGKATLAAKLYSDPCIMSRFDIRAKATVSQEYC  206

Query  266  DRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             R +L GLL+S+    +   D+ L+ +L+K L G+RY
Sbjct  207  VRNVLQGLLSSI----SDEPDDQLADRLQKHLKGRRY  239



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 4/114 (4%)
 Frame = -3

Query  485  SFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSF  306
            S Q  + MVG + E E +   L++ SS + + ++I+GMGGIGKTT AR+IY DP I S F
Sbjct  152  SPQLGNSMVGHENELEDVKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHF  211

Query  305  DLLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            D+LAWV  S+    R+MLL LL+ +  T      +  D +L+ +L++ LW +RY
Sbjct  212  DILAWVTVSKEYCVRKMLLQLLHCIPSTEEVRREARDDGELAGKLKQRLWKRRY  265



>ref|XP_009759016.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=883

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 9/161 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE----MVGRDK  447
            ++L  +L+Q +  I     + + ++N Y   + L+   +SLAD  QPA E    MVG + 
Sbjct  91   WELFSLLKQAVGHIGFAMNKWMAVQNMYTNSKDLEAQNLSLADVSQPALELENTMVGHET  150

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE++   L  R + +L+VVSI GMGGIGKTTLA +IY DP I S FD+ A    S    
Sbjct  151  EFEMLQDQLT-RGASELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYR  209

Query  266  DRQMLLGLLNSLVYTNNSSSDE----DLSAQLRKTLWGQRY  156
             R +LLGLL S+        D+     L+ +L+K L G RY
Sbjct  210  ARNVLLGLLFSISGKTYEFYDQQDVGQLADRLQKLLKGGRY  250



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 5/108 (5%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            QP + MVGR+ EFE+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+
Sbjct  137  QPENIMVGRENEFEMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDI  195

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R ++LGLL S+    +   D+ L+ +L+K L G+RY
Sbjct  196  RAKATVSQEYCVRNVILGLLPSI----SDEPDDQLADRLQKHLKGRRY  239



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 90/161 (56%), Gaps = 9/161 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE----MVGRDK  447
            ++L  +L+Q +  I     + + ++N Y   + L+   +SLAD  QPA E    MVG + 
Sbjct  91   WELFSLLKQAVGHIGFAMNKWMAVQNMYTNSKDLEAQNLSLADVSQPALELENTMVGHET  150

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            EFE++   L  R + +L+VVSI GMGGIGKTTLA +IY DP I S FD+ A    S    
Sbjct  151  EFEMLQDQLT-RGASELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFDIRAKATVSLEYR  209

Query  266  DRQMLLGLLNSLVYTNNSSSDE----DLSAQLRKTLWGQRY  156
             R +LLGLL S+        D+     L+ +L+K L G RY
Sbjct  210  ARNVLLGLLFSISGKTYEFYDQQDVGQLADRLQKLLKGGRY  250



>gb|AEW48199.1| disease resistance protein RGH6 [Solanum x edinense]
Length=913

 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 94/155 (61%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E I +  ++ +   +    +  +T  ++ +   D  QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIASTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++  DP I S FD+ A V  SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLCSDPYIMSRFDIHAKVTVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             ++LGLL+S+    +   +  L+ +L+K L G+RY
Sbjct  209  NVILGLLSSI----SDEPENQLADRLQKHLKGRRY  239



>gb|AEW48208.1| disease resistance protein RGH4 [Solanum huancabambense]
Length=877

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +   D  QP + MVGR+ E 
Sbjct  90   WEIFFVLEQALECIDSTVKQWMAASDSMKDLKPQTSSLVSLPEHDVEQPDNIMVGRENEL  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +L GLL+S+    +   D  L+ +L+K L G+RY
Sbjct  209  NVLQGLLSSI----SDEPDYQLADRLQKHLKGRRY  239



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score = 92.8 bits (229),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 96/162 (59%), Gaps = 22/162 (14%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K  ++   Q        SL DS  P        ++MVG + E 
Sbjct  101  ILQRGIENVDSLKEELIKHSHNNTSQAGNS----SLGDSSSPRLHASTLENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E ++  L    S +L+V+S++GMGGIGK+T A++++  P I S FD+  W+  S++ + R
Sbjct  157  ENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYR  215

Query  260  QMLLGLLNSLVYTN-------NSSSDEDLSAQLRKTLWGQRY  156
             MLLGL   L+  N       +  S+ DL+  L+++L G+RY
Sbjct  216  NMLLGL---LIDANIGKEEDLDKKSNSDLAVCLKQSLMGRRY  254



>gb|EYU24354.1| hypothetical protein MIMGU_mgv1a019328mg [Erythranthe guttata]
Length=815

 Score = 92.0 bits (227),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 90/154 (58%), Gaps = 10/154 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-----ASEMVGRDKEFEII  432
            LQ  +ED+D++K+++++ + D +    LD+ P S   S  P      + MVG D++   +
Sbjct  61   LQMVIEDMDSIKKKVMEFR-DEIGSNELDMQPTSTTSSSTPFITTGKNTMVGFDEQLLQL  119

Query  431  MGMLI-ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQM  255
            +  L  +RS+RQ  ++ I GMGGIGKTTLA+  Y   LI   FD+  WV  SQ  N +Q+
Sbjct  120  LDKLTGQRSNRQ--IIPIVGMGGIGKTTLAKNSYEHSLIVHHFDIRTWVTISQKYNVKQL  177

Query  254  LLGLLNSLVYTNNSSSDEDLSAQ-LRKTLWGQRY  156
            LL LL+ +    NS  DE L  Q L K LWG+RY
Sbjct  178  LLQLLSMISSEINSEDDEQLLGQKLHKILWGRRY  211



>gb|ABY61745.1| resistance protein PSH-RGH6 [Solanum tuberosum]
Length=873

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD-SF-QPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +     +      +SL + +F QP + MVG + EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHAFEQPENIMVGYENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I   FD+ A    SQ    R
Sbjct  150  EMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPCIMPRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +L GLL+S+    +   D+ L+ +L+K L G+RY
Sbjct  209  NVLQGLLSSI----SDEPDDQLADRLQKHLKGRRY  239



>gb|AEW48204.1| disease resistance protein RGH1 [Solanum fernandezianum]
Length=897

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            QP + MVG + EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+
Sbjct  137  QPENIMVGHENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLAAKLYSDPCIMSRFDI  195

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R +LL LL+S     +   D+ L+ +L+K L G+RY
Sbjct  196  RAKATVSQEYYVRNVLLALLSS----TSDEPDDQLADRLQKHLKGRRY  239



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 95/162 (59%), Gaps = 22/162 (14%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPA-------SEMVGRDKEF  441
            ILQ+G+E++D++KEEL+K  ++     T      SL DS  P        ++MVG + E 
Sbjct  101  ILQRGIENVDSLKEELIKHSHN----NTSQAGNASLDDSSSPGLHASTLENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              +M  L    S +L+V+S++GMGGIGK+T A++++  P I S FD+  W+  S++ + R
Sbjct  157  ANMMSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSENYSYR  215

Query  260  QMLLGLLNSLVYTN-------NSSSDEDLSAQLRKTLWGQRY  156
             MLLGL   L+  N       +  S+ DL+  L+++L G+RY
Sbjct  216  NMLLGL---LIDANIGKEEDLDKKSNSDLAVCLKQSLMGRRY  254



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 89/153 (58%), Gaps = 11/153 (7%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKNDYMLQRTL---DVLP---ISLADSFQPASEMV-GRDKEFEIIMG  426
            MED+ ++  E++K+K+ +     L   +VLP   +S  DS      +V G DK+ E I  
Sbjct  316  MEDVISITREVIKVKDTFGAGEGLWHSNVLPGASLSRRDSGGVRKNVVVGFDKDLEQIKT  375

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
              I+ SS+ L+++SI GMGGIGKTTLAR++Y DP I   FD   WV  SQ  + RQ+LLG
Sbjct  376  QWIDDSSK-LEIISIVGMGGIGKTTLARQVYDDPSIFYHFDTRGWVAVSQEYSLRQVLLG  434

Query  245  LLNS---LVYTNNSSSDEDLSAQLRKTLWGQRY  156
            LL+S   L       SD  L+  L K L G+RY
Sbjct  435  LLDSTKMLTEEMQDESDARLAEFLYKCLKGRRY  467



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 86/150 (57%), Gaps = 3/150 (2%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKI--KNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGM  423
            LQQ  EDI  +++E +KI  K     +++L     S  D       MVGRD + + ++  
Sbjct  105  LQQVAEDISHLQKESMKIQHKGKQASKKSLVRGSSSAKDVLNVKKNMVGRDDQRKRLLED  164

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I S FD+ AW   S H N +++LL L
Sbjct  165  LTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNVKEILLSL  224

Query  242  LNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
            L S +       DE +L+  L+K+L  +RY
Sbjct  225  LRSRMGDTFYMEDEAELADMLQKSLKSRRY  254



>gb|AAV88068.1| NBS-LRR protein [Ipomoea batatas]
Length=849

 Score = 63.9 bits (154),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 67/136 (49%), Gaps = 9/136 (7%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKN--DYMLQRTLDVLPISLADSF--QPAS---EMVGRDKEFE  438
            L Q + +       L+KI N  D        ++P SL  S   QP      MVGR  ++ 
Sbjct  94   LHQTLIEAAENAAHLLKISNESDDESNECHSLIPWSLDTSLRLQPPKLEGRMVGRRNDYL  153

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
            ++   L+   S Q +V+ I GM GIGKTTLA  +Y D  +AS FD+ AW+  S     RQ
Sbjct  154  LVKNQLL--YSDQRRVILIVGMNGIGKTTLAASVYEDSSVASHFDVRAWITMSGEYTMRQ  211

Query  257  MLLGLLNSLVYTNNSS  210
             L  LL +L   N+ +
Sbjct  212  TLHDLLLTLAEPNHET  227


 Score = 51.2 bits (121),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 53/98 (54%), Gaps = 14/98 (14%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDI  785
            M CV + SLM T+EL+FL+S+PR  +  ++       L +   +KL SL     +     
Sbjct  1    MGCVALTSLMATIELQFLRSIPRVSILDDE-------LPIKFFEKLSSLQAFLQQKS---  50

Query  784  GVEAIKELETKLRDVAFRVEDEIEFQIAH--LHETEED  677
               AI++LE ++RD A   ED IE Q+++  L +  ED
Sbjct  51   --GAIRDLEIQIRDFALDAEDRIEIQLSNFLLAKNRED  86



>gb|ACF22006.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=186

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  6    LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  64

Query  302  LLAWVNASQHQNDRQMLLGLLNSLV  228
            + A    SQ    R +LLGLL+S++
Sbjct  65   IRAKATVSQEYCARNVLLGLLSSII  89



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 92/155 (59%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +      QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHAVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L++VSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEIVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +L GLL+S+    +   D+ L+ +L+K L  +RY
Sbjct  209  NVLQGLLSSI----SDEPDDQLADRLQKRLKCRRY  239



>gb|ACE79400.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 68/112 (61%), Gaps = 5/112 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  28   LEPEDKMVGLENEFEMMQDQLA-RGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQR  159
            + A    SQ    R +LLGLL+S+    N       D+ L+ +L+K L   R
Sbjct  87   IRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCAR  138



>ref|XP_011072647.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=541

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 86/164 (52%), Gaps = 24/164 (15%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIK------NDYMLQRTLDVLPI-SLADSFQPASE--MVGRDKE  444
            LQ+ + D+D +K+++++IK       D  L R  +  P  SL+ S     +  MVGRD  
Sbjct  109  LQKVIADMDLIKKQVIEIKVKIGIVQDPQLHRNSN--PAGSLSSSILQGHKQAMVGRDDA  166

Query  443  FEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQND  264
               IM  L  + S  L ++ I GMGGIGKTTLAR +Y +PLI   FD+ AWV  SQ  N 
Sbjct  167  LNEIMDKLTRQQSDCL-IIPIVGMGGIGKTTLARNVYENPLIVEYFDIRAWVTVSQEYNT  225

Query  263  RQMLLGLLNSLVYTNNSS--------SDEDLSAQLRKTLWGQRY  156
            R++LL     LV  NN           DE L   L K L G+RY
Sbjct  226  REILL----ELVCPNNKERKEALREIPDEGLGEMLYKCLCGRRY  265



>gb|AEW48211.1| disease resistance protein RGH1 [Solanum hougasii]
Length=814

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVGR+ EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A   
Sbjct  42   MVGRENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  100

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             SQ    R +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  101  VSQEYCVRNVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  139



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVGR+ EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A   
Sbjct  42   MVGRENEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  100

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             SQ    R +LLGLL+      +   D+ L+ +L+K L G+RY
Sbjct  101  VSQEYCVRNVLLGLLS----LTSDEPDDQLADRLQKHLKGRRY  139



>ref|XP_011072192.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=881

 Score = 70.1 bits (170),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIK---NDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMG  426
            L + + +ID++ EEL+  +    D + ++ L VL  S  D+    + MVG D++   +  
Sbjct  108  LDEVLVEIDSLVEELLNDRCGLKDLLPRQHLPVLGSS-RDARVGKNVMVGFDEDVMELKH  166

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L    S+ L+V+ I+GMGG+GKTTLAR +Y D L+   FDL AWV  SQ      ++ G
Sbjct  167  RLTGWESK-LQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDDVIRG  225

Query  245  LLNSLVYTNN---SSSDEDLSAQLRKTLWGQRY  156
            LL +     N     S +DL+  L K L G+RY
Sbjct  226  LLANFGVVINRPKEKSVQDLTQTLWKFLKGRRY  258


 Score = 43.5 bits (101),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (54%), Gaps = 11/99 (11%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQL-IPCNKHLVLSLHKKLGSLMELFDESRMD  788
            MA   ++SLM TLEL         IL  ++      KH ++S+++K+  L  LF++S   
Sbjct  1    MAHSALVSLMNTLEL---------ILHSDRFHFFRAKHYIISIYRKVRFLQTLFEDSPQK  51

Query  787  IGVEAIKELETKLRDVAFRVEDEIEFQIA-HLHETEEDF  674
               E +  LE ++RD A  +ED +EF ++  ++E  + F
Sbjct  52   SSQEEVDSLEIRIRDSASVIEDLVEFYVSEQVYEDSDRF  90



>gb|EYU26873.1| hypothetical protein MIMGU_mgv1a025130mg [Erythranthe guttata]
Length=811

 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 82/150 (55%), Gaps = 8/150 (5%)
 Frame = -3

Query  587  GMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGMLIE  414
             +++  +++EELVK+K  Y+  +       + +    P SE  MVG D     IMG L  
Sbjct  113  AIQEFHSIEEELVKMKK-YVHAKISITTEATSSSRPLPVSETIMVGFDGHVNEIMGALFS  171

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
              S  L+++SI GMGGIGKTTL   +Y  P I   F + AW   SQ   ++++LLGLL+ 
Sbjct  172  NES-NLQIISIVGMGGIGKTTLTTHVYNKPFIVQHFHVRAWFTVSQEYTEKEILLGLLHQ  230

Query  233  LVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            +  TN    +  SD  L  +L KTL G++Y
Sbjct  231  IDNTNQDDAHEISDGKLGDKLYKTLLGRKY  260



>gb|EYU24356.1| hypothetical protein MIMGU_mgv1a022056mg [Erythranthe guttata]
Length=775

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/149 (38%), Positives = 85/149 (57%), Gaps = 7/149 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGMLI  417
            LQ   E+ID++K+++++ K +  L+      P     S    + MVG D++   ++  L 
Sbjct  45   LQTVFEEIDSIKDKVMEFKEEVGLKDDHYTQPTC---STPEKNTMVGFDEQLLRLLDKLT  101

Query  416  -ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLL  240
             +R  RQ  V+ I GMGGIGKTTLA+  Y   LI   FD+  WV  SQ  N R++ + LL
Sbjct  102  GQRCDRQ--VIPIVGMGGIGKTTLAKNAYEHSLIVHRFDIRTWVTISQEYNVRELFVQLL  159

Query  239  NSLVYTNNSSSDEDLSAQ-LRKTLWGQRY  156
            ++L+   +S ++E L  Q L K LWG+RY
Sbjct  160  STLISEMDSETNEQLLGQKLHKILWGRRY  188



>gb|ACF22012.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S FD
Sbjct  28   LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFVMSHFD  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            + A    SQ      +LLGLL+S+    N       D+ L+ +L+K L   RY
Sbjct  87   IRAKATVSQEYCAGNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRY  139



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score = 90.1 bits (222),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 69/113 (61%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP I S FD
Sbjct  138  LEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFD  196

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+    N       D+ L+ +L+K L   RY
Sbjct  197  IRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCGRY  249



>gb|EYU24163.1| hypothetical protein MIMGU_mgv1a019941mg, partial [Erythranthe 
guttata]
Length=843

 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 90/159 (57%), Gaps = 14/159 (9%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE------MVGRDKEFEI  435
            +Q  ++D D+++EELV+I+ D++  +       SL+ S            MVG D     
Sbjct  107  VQTSIQDFDSIEEELVRIEKDHVQHKNSITTEASLSSSSSRPLLPIGKNIMVGFDGHVNE  166

Query  434  IMGML-IERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
            IMG L  + S+RQ  ++ I GMGGIGKTTLA  +Y +P I   F + AW   SQ    ++
Sbjct  167  IMGALSTDESNRQ--IIPIVGMGGIGKTTLATHVYTNPFIVQHFHVRAWFTVSQEYTKKE  224

Query  257  MLLGLLNSLVYTNNSSS----DED-LSAQLRKTLWGQRY  156
            +LLGLL+ +   N++ +    DED L  +L KTL+G++Y
Sbjct  225  ILLGLLHKINNKNSNDAHDMNDEDELGDKLHKTLFGRKY  263



>gb|ACE79442.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22007.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 94/165 (57%), Gaps = 22/165 (13%)
 Frame = -3

Query  608  LGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRD  450
            L  ILQ+G+E++D++KEEL+K   +   Q        SL DS  P        ++MVG +
Sbjct  98   LSEILQRGIENVDSLKEELIKHSQNNTSQAGNS----SLGDSSSPRLHASTLENDMVGYN  153

Query  449  KEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQ  270
             E   ++G L    S +L+V+S++GMGGIGK+T A+ ++  PLI S FD+  W+  S+  
Sbjct  154  IEQANMLGQLTS-GSPELEVISVTGMGGIGKSTFAKNLFSHPLILSFFDIRGWITVSEDY  212

Query  269  NDRQMLLGLLNSLVYTN-------NSSSDEDLSAQLRKTLWGQRY  156
              R++LLGL   L+  N       +  +D DL+  L++ L G+RY
Sbjct  213  IYRKILLGL---LIDANIGKEEDLDKKNDSDLAVCLKQRLMGRRY  254



>gb|ACE79425.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 94/165 (57%), Gaps = 22/165 (13%)
 Frame = -3

Query  608  LGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRD  450
            L  ILQ+G+E++D++KEEL+K   +   Q        +L DS  P        ++MVG +
Sbjct  98   LSEILQRGIENVDSLKEELIKDSQNNTSQAGNS----ALGDSSSPRLHALTLENDMVGYN  153

Query  449  KEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQ  270
             E   ++  L    S +L+V+S++GMGGIGK+T A++++  P I S FD+  W+  S+  
Sbjct  154  IEQANMLSRLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSFFDIRGWITVSEDY  212

Query  269  NDRQMLLGLLNSLVYTN-------NSSSDEDLSAQLRKTLWGQRY  156
            + R+MLLGL   LV  N       +  SD DL+  L++ L G+RY
Sbjct  213  SYRKMLLGL---LVDANIGKEEDLDKKSDSDLAVCLKQNLMGRRY  254



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 85/150 (57%), Gaps = 3/150 (2%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKI--KNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGM  423
            LQQ  EDI  V++E +KI  K     +++L     S  D       MVGRD + + ++  
Sbjct  105  LQQVAEDISRVQKESMKIQQKGKQASKKSLVQGSSSAKDVLNVKKNMVGRDDQRKRLLED  164

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L   SS +LKV+ I GMGGIGKTTLA+ +Y D  I S FD+ AW   S H N +++LL L
Sbjct  165  LTRGSSGELKVIPILGMGGIGKTTLAKEVYNDVSIRSHFDVRAWATVSSHHNIKEILLSL  224

Query  242  LNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
            L S +       DE +L+  L+K+L  +RY
Sbjct  225  LRSRMGDTFYMEDEAELADMLQKSLKSRRY  254



>gb|ACE79412.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>gb|AEW48200.1| disease resistance protein RGH7 [Solanum x edinense]
Length=908

 Score = 89.0 bits (219),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 90/155 (58%), Gaps = 7/155 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDY--MLQRTLDVLPISLADSFQPASEMVGRDKEF  441
            +++  +L+Q +E ID+  ++ +   +    +  +T  ++ +      QP + MVGR+ EF
Sbjct  90   WEIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSLPEHAVEQPENIMVGRENEF  149

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            E+++  L  R  R+L+VVSI GMGGIGKTTLA ++Y D  I S FD+ A    SQ    R
Sbjct  150  EMMLDQL-ARGGRELEVVSIVGMGGIGKTTLATKLYSDLCIMSRFDIRAKATVSQEYCVR  208

Query  260  QMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +LLGLL+      +   D  L+ +L+K L G+RY
Sbjct  209  NVLLGLLS----LTSDEPDYQLADRLQKHLKGRRY  239



>gb|ACE79489.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  135



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 83.6 bits (205),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 23/166 (14%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKI--KNDYMLQRTLDVLPISLADSFQPAS-------EMVGRDK  447
            IL+Q ++DI +V +EL+K   KN+  L   L     S+  S  P S       EMVG   
Sbjct  97   ILEQAIQDIYSVNQELIKQRNKNNNSLSGNL-----SIGGSTSPRSRVSTLENEMVGHIN  151

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            E   +   LI   S QL+V+SI+GMGGIGK+T A++++ DP +   FD+  W+  S+  +
Sbjct  152  EQANMRRRLITGHSSQLEVISIAGMGGIGKSTFAKKLFSDPSVVGFFDVRGWITVSKDYS  211

Query  266  DRQMLLGLLNSLV---------YTNNSSSDEDLSAQLRKTLWGQRY  156
             R+ML+ LL             Y      + +L+ +L+K+  G+RY
Sbjct  212  SRKMLISLLQDATGVKVEINPQYQEVEVINAELADRLQKSFKGKRY  257


 Score = 28.1 bits (61),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 4/61 (7%)
 Frame = -1

Query  862  NKHLVLSLHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETE  683
            NK    SL++K+GSL+E  D S      E +K+L+ K++DV   VEDE+E QI  + E +
Sbjct  28   NKECSKSLYEKVGSLLEFLDNSDN----ELMKDLQKKVKDVVNEVEDEVESQIVRIMEKD  83

Query  682  E  680
            E
Sbjct  84   E  84



>gb|ACE79488.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=255

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  135



>gb|ACE79487.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79494.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=256

 Score = 85.9 bits (211),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  135



>gb|ACE79491.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=257

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  22   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  81

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  82   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  136



>gb|ACE79495.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=249

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  17   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  76

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  77   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  131



>gb|ACE79492.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  18   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  77

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  78   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  132



>gb|ACE79493.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  18   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  77

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  78   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  132



>gb|ACE79490.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 1/115 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            S  D       MVGRD + + ++  L  RSS +LKV+ I GMGGIGKTTLA+ +Y D  I
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE-DLSAQLRKTLWGQRY  156
             S FD+ AW   S H N +++LL LL S +       DE +L+  L+K+L  +RY
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLRSRMGDTFYMEDEAELADMLQKSLKSRRY  135



>gb|ACE79413.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = -3

Query  476  PASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLL  297
            P S+M+G + EFE++   L  R +R+L+VVS+ GMGGIGKTTLA ++Y DP I S FD+ 
Sbjct  30   PQSKMIGLENEFEMMQDQL-SRGARELEVVSVVGMGGIGKTTLANKLYSDPFIMSHFDIR  88

Query  296  AWVNASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
            A    SQ    R +LL LL+S+    N       D+ L+ +L+K L   RY
Sbjct  89   AKATVSQEYCARNVLLRLLSSISGKTNEFQEQQEDDQLADRLQKLLKCGRY  139



>gb|EYU40390.1| hypothetical protein MIMGU_mgv1a018316mg [Erythranthe guttata]
Length=865

 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 83/164 (51%), Gaps = 21/164 (13%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            ++  ++   +++EELVKIK     + ++     S +    P  E  MVG D     IMG 
Sbjct  93   VRTAIQQFHSIEEELVKIKKYVQAKISITTEAASSSRPLLPIGENTMVGFDDHLIQIMGA  152

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S  L+V+SI GMGGIGKTTLA  +Y  P I   F +  W   SQ   ++++LLGL
Sbjct  153  LSTDES-NLRVISIVGMGGIGKTTLATHVYNKPFIVQHFHVCVWFTVSQEYTEKEILLGL  211

Query  242  LNSLVYTNNSSSDE---------------DLSAQLRKTLWGQRY  156
            L  +   NN++ DE                L  +L KTL+G++Y
Sbjct  212  LRQI---NNTNRDEQKTGDDDDDYDDDDDQLGNKLHKTLFGRKY  252



>ref|XP_009794810.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=345

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 15/155 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS----EMVGRDKEFEII  432
            I+QQ ++DID+VKE  +K       QR  ++   + + +    S    +MVG + E E++
Sbjct  82   IMQQAIKDIDSVKEWFIK-------QRENNISAGASSSAQYHVSTIENDMVGYNIEQELM  134

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
               L   SS QL+V+SI GMGGIGK+T A++++ DP I S FD+  W+  S+  + R++L
Sbjct  135  RDQLRGHSS-QLEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWITVSKDYSLRRIL  193

Query  251  LGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
            LGLL   +      +  SD+ L+ +L+K+L G+RY
Sbjct  194  LGLLQDAIGVKEMLDKVSDDALADRLQKSLKGRRY  228



>gb|EYU21177.1| hypothetical protein MIMGU_mgv1a018978mg [Erythranthe guttata]
Length=745

 Score = 88.2 bits (217),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 17/147 (12%)
 Frame = -3

Query  575  IDAVKEELVKIKNDYMLQRTLDVL-----PISLADSFQPASEMVGRDKEFEIIMGMLI-E  414
            +D++K+++++ K+D+ +Q    +L     P+   D     + MVG D++   ++  L  +
Sbjct  1    MDSIKKKVMEFKDDHNMQPAYSMLASPSTPLITTDK----NTMVGFDEQLLQLLDKLTGQ  56

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
            +S+RQ  ++ I GMGGIGKTTLA+  Y   LI   FD+  WV  SQ  N +Q+LL LL+ 
Sbjct  57   QSNRQ--IIPIVGMGGIGKTTLAQNAYEHSLIVHHFDIRTWVTVSQKYNVKQLLLQLLSE  114

Query  233  LVYTNNSSSDEDLSAQ-LRKTLWGQRY  156
                NNS  DE L  Q L K LWG+RY
Sbjct  115  ----NNSQMDEQLLGQKLHKMLWGRRY  137



>gb|ACE79438.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLEDEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>ref|XP_011072191.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=884

 Score = 70.5 bits (171),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 84/153 (55%), Gaps = 8/153 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIK---NDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMG  426
            L + + +ID++ EEL+  +    D + ++ L VL  S  D+    + MVG D++   +  
Sbjct  108  LDEVLVEIDSLVEELLNDRCGLKDLLPRQHLPVLGSS-RDARVGKNVMVGFDEDVMELKH  166

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L    S+ L+V+ I+GMGG+GKTTLAR +Y D L+   FDL AWV  SQ      ++ G
Sbjct  167  RLTGWESK-LQVIPITGMGGVGKTTLARNLYDDSLVKDHFDLCAWVTISQTYLVDDVIRG  225

Query  245  LLNSLVYTNN---SSSDEDLSAQLRKTLWGQRY  156
            LL +     N     S +DL+  L K L G+RY
Sbjct  226  LLANFGVVINRPKEKSVQDLTQTLWKFLKGRRY  258


 Score = 40.8 bits (94),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 48/89 (54%), Gaps = 10/89 (11%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQL-IPCNKHLVLSLHKKLGSLMELFDESRMD  788
            MA   ++SLM TLEL         IL  ++      KH ++S+++K+  L  LF++S   
Sbjct  1    MAHSALVSLMNTLEL---------ILHSDRFDFFRAKHHIISIYRKVRFLQTLFEDSPQK  51

Query  787  IGVEAIKELETKLRDVAFRVEDEIEFQIA  701
               E +  LE ++RD A  +ED +EF ++
Sbjct  52   SSQEEMDSLEIRIRDSASVIEDLVEFYVS  80



>gb|EYU24175.1| hypothetical protein MIMGU_mgv1a026011mg [Erythranthe guttata]
Length=860

 Score = 88.2 bits (217),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 81/146 (55%), Gaps = 18/146 (12%)
 Frame = -3

Query  566  VKEELVKIKNDYMLQR------TLDVLPISLADSFQPA---SEMVGRDKEFEIIMGMLIE  414
            +++ELVK K D  +QR      T      S +    PA   + MVG D   + IMG L  
Sbjct  117  IEKELVKFKKD--MQRPNNYYLTTKASSSSSSRPLLPACGKNSMVGFDNHMDEIMGALST  174

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
              S  L+++SI GMGGIGKTTLA  ++ +P I   F L AW   SQ   D+++LLGLL+ 
Sbjct  175  NES-NLRIISIVGMGGIGKTTLATNVFNNPFIVEHFQLRAWFTVSQEYTDKKILLGLLHQ  233

Query  233  LVYTNNSSSDEDLSAQLRKTLWGQRY  156
            +      + D ++  +L KTL+G++Y
Sbjct  234  I------NDDYEIGDRLHKTLFGRKY  253



>gb|ACF22011.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTL  +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLTNKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>gb|ACF22014.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTL  +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLVNKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Erythranthe 
guttata]
Length=690

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 97/166 (58%), Gaps = 10/166 (6%)
 Frame = -3

Query  632  KSSSPCFKLGLILQQGMEDIDAVKEELVKIK--NDYMLQRTLDVLPISLADSFQPA--SE  465
            K+ SP ++L L L++ +E +D++K+++++IK      +  T    P S + +F  A  S+
Sbjct  114  KTISP-WRLKLGLRKVIEKMDSIKKKVIEIKQIKGNAVNLTHSPSPTS-STAFMGAEKSK  171

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG + +   +M  L  R   + +++ I GMGGIGKTTLAR +Y +PLI   FD+  WV 
Sbjct  172  MVGFEDDLLQLMERLTGRQPNR-QIIPIVGMGGIGKTTLARNVYENPLIVQHFDICCWVT  230

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
             SQ  + R++LL LL+  +   +    +D   L  QL K+L+G RY
Sbjct  231  VSQEYSVRKVLLELLSCQIKPTSEMDGKDEAQLGEQLYKSLFGMRY  276



>ref|XP_009796570.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=557

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 83/148 (56%), Gaps = 9/148 (6%)
 Frame = -3

Query  575  IDAVKEELVKIKNDYMLQRTLDVLPISLADS----FQPASEMVGRDKEFEIIMGMLIERS  408
            ID+  ++ + I+N     + L    +SL  +     +P  +MVG + EFE++   L  R 
Sbjct  268  IDSTMKKWMAIQNKLKNIQDLKAQDLSLVSTSRHGLEPEDKMVGLENEFEMVQDQL-ARG  326

Query  407  SRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLV  228
            +R+L+VVSI GMGGIGKTTLA +IY DP + S F + A    SQ    R +LLGLL+S+ 
Sbjct  327  ARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFGIRAKATVSQEYCARYVLLGLLSSIS  386

Query  227  YT----NNSSSDEDLSAQLRKTLWGQRY  156
                  +    D+ L+ QL+K L   RY
Sbjct  387  GKFDEFHEHQDDDQLADQLQKLLKCGRY  414



>gb|ACE79451.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 67/113 (59%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGK TLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKITLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
            + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>gb|EYU24168.1| hypothetical protein MIMGU_mgv1a022184mg, partial [Erythranthe 
guttata]
Length=802

 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 83/153 (54%), Gaps = 20/153 (13%)
 Frame = -3

Query  566  VKEELVKIK------NDYMLQRT-----LDVLPISLADSFQPASEMVGRDKEFEIIMGML  420
            +++ELV+ K      N+Y L  T         P+ LA      + MVG D   + IMG L
Sbjct  117  IEKELVRFKKDMQRPNNYYLTTTKASSSSSSRPLLLAGG---KNNMVGFDNHMDEIMGAL  173

Query  419  IERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLL  240
                S  L+++SI GMGGIGKTTLA  ++ +P I   F L AW   SQ   D+++LLGLL
Sbjct  174  STNES-NLRIISIVGMGGIGKTTLATNVFNNPFIVEHFQLRAWFTVSQEYTDKKILLGLL  232

Query  239  NSLVYTNNSSS-----DEDLSAQLRKTLWGQRY  156
            + +  T  ++      D+ +  +L KTL+G++Y
Sbjct  233  HQINNTYRNAHEIVDDDDAIGDRLHKTLFGRKY  265



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 90/154 (58%), Gaps = 10/154 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-----ASEMVGRDKEFEII  432
            L++ +ED+D++K+++++ + D       D+ P S   S  P      + MVG D++   +
Sbjct  138  LEKVIEDMDSIKKKVMEFR-DESGSNEHDMQPTSTTSSSTPRITTDKNTMVGFDEQLISL  196

Query  431  MGMLI-ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQM  255
            +  L  +RS+RQ  ++ I GMGGIGKTTLA+  Y   LIA  FD+  WV  SQ  N +++
Sbjct  197  LDKLTGQRSNRQ--IIPIVGMGGIGKTTLAKNAYEHSLIAHHFDIRTWVTISQKYNVKEL  254

Query  254  LLGLLNSLVYTNNSSSDEDLSAQ-LRKTLWGQRY  156
            LL LL+ +    +S  DE L  Q L K LWG+RY
Sbjct  255  LLQLLSMISSEIDSEHDEQLLGQKLHKILWGRRY  288



>gb|AGX27504.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=373

 Score = 75.1 bits (183),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/155 (34%), Positives = 85/155 (55%), Gaps = 10/155 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRT----LDVLPISLADSFQPASEMVGRDKEFEIIM  429
            L+  ME+I+++ E ++ I+N+  ++         +P S   +    ++MVG +++   + 
Sbjct  103  LRMVMEEINSIVERVMNIQNNCAVEDVQCSYTSAVPSS-GGAPNDGNKMVGFNEDLLELK  161

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L   SS+ L+++SI GMGGIGKTTLA  I+ D L+A  F +  W   SQ  + RQ+LL
Sbjct  162  ARLCGESSK-LQIISIVGMGGIGKTTLATNIFNDSLVAYHFHVRVWTTVSQDYHLRQVLL  220

Query  248  GLLNSLVYTNNSS----SDEDLSAQLRKTLWGQRY  156
             L+ SL     +      DE+L   + KTL G+ Y
Sbjct  221  DLVASLTDQKTTDLSNMKDEELVECVYKTLKGRTY  255


 Score = 34.7 bits (78),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 14/90 (16%)
 Frame = -1

Query  964  MACVVVLSLMRTLEL--EFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRM  791
            MA   V+SL +TL+      Q    P++       C + L  SL +KL      F ++ +
Sbjct  1    MAYAAVVSLAQTLQHINHHHQYCSIPLI-------CEEQLFESLREKL-----TFLQAFL  48

Query  790  DIGVEAIKELETKLRDVAFRVEDEIEFQIA  701
            +I  E ++ LE ++RD+A+R ED IE  ++
Sbjct  49   EIDGETVEGLEGRIRDLAYRAEDIIESHVS  78



>gb|ACE79424.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 5/108 (5%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNN----SSSDEDLSAQLRKTL  171
            + A    SQ    R +LLGLL+S+   ++       D+ L+ QL+K L
Sbjct  87   IRAKATVSQEYCARYVLLGLLSSISGKSDEFHEHQDDDQLADQLQKLL  134



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score = 81.3 bits (199),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 88/159 (55%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E +D++KE L+K   +  LQ        SL DS  P        ++MVG + E 
Sbjct  101  ILQRAIEKVDSLKEGLIKHSQNENLQAGNS----SLCDSSSPRLHAPTLENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L   S+  L+V+S++GMGGIGK+T A+ +   P I S FD+  WV  S+  + R
Sbjct  157  ANMLSQLTGGSA-PLEVISVTGMGGIGKSTFAKNLSSHPSILSFFDICGWVTVSEDYSFR  215

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            +MLLGLL            + +D+ L+ +L+K L G+RY
Sbjct  216  KMLLGLLKDANIAKEEELENKNDQVLADRLKKGLKGRRY  254


 Score = 28.1 bits (61),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  841  LHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
            L++K+ SL EL D S      E  + L  +++ +A  VEDE+E Q+  + + + D
Sbjct  37   LYEKVDSLHELLDNS----DAEQTENLHAEVKHIANEVEDEVESQMQVVMDEQHD  87



>ref|XP_009786702.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=928

 Score = 86.7 bits (213),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 93/155 (60%), Gaps = 15/155 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS----EMVGRDKEFEII  432
            I+QQ ++DID+VKE  +K       QR  ++   + + +    S    +MVG + E E++
Sbjct  153  IMQQAIKDIDSVKEWFIK-------QRENNISAGASSSAQYHVSTIENDMVGYNIEQELM  205

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
               L   SS QL+V+SI GMGGIGK+T A++++ DP I S FD+  W+  S+  + R++L
Sbjct  206  RDQLRGHSS-QLEVISIVGMGGIGKSTFAKKMFSDPSIMSFFDVRGWITVSKDYSLRRIL  264

Query  251  LGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
            LGLL   +      +  SD+ L+ +L+K+L G+RY
Sbjct  265  LGLLQDAIGVKEMLDKVSDDALADRLQKSLKGRRY  299



>ref|XP_004250409.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=843

 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = -3

Query  581  EDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGMLIERSSR  402
            +D+D++++E+++++ +    R           S    + ++G D EF  I+  L  +++ 
Sbjct  107  KDVDSLRKEVMQMEFNKHGTRYETTPSSPQKSSIDEENTIIGMDDEFNTILDRLTTQTN-  165

Query  401  QLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYT  222
            +L V+ I GMGGIGKTTLA+++Y D  I S FD  AWV  S+  N RQMLL + +S+  +
Sbjct  166  ELTVIPIFGMGGIGKTTLAKKVYDDSYIRSRFDKHAWVTISEDFNQRQMLLEVASSITGS  225

Query  221  NNSSSDEDLSAQLRKTLWGQRY  156
            N   SD+ L   + K L G+R+
Sbjct  226  NQEKSDDQLMEIVYKGLKGRRF  247



>gb|AEW48215.1| disease resistance protein RGH7 [Solanum leptophyes x Solanum 
sparsipilum]
Length=921

 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE-----MVGRD  450
            ++L   L+Q +E ID+   + + I + Y   +        L+   + A E     MVG +
Sbjct  90   WELCCSLEQEVECIDSFMMQWLAIWDWYNNIKDFKAQNFCLSKIPELAVERSEDIMVGYE  149

Query  449  KEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQ  270
             EFE+++  L+ R  R+L+VVSI GMGGIGKTTLA ++Y DP I S FD+ A    SQ  
Sbjct  150  NEFEMMLDQLV-RGGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEY  208

Query  269  NDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
              R +L GLL S     +  SD+ L+ +L+K L  +RY
Sbjct  209  CVRNVLQGLLPS----RSDESDDQLADRLQKHLKARRY  242



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG D++   I   LI +SSR L+VV I GMGGIGKTTLARR+Y D LIA  F + AW N
Sbjct  147  IVGLDEDLLRIKDRLIVQSSR-LEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTN  205

Query  284  ASQHQNDRQMLLGLLNSLVYTNN----SSSDEDLSAQLRKTLWGQRY  156
             SQ  + R++ LG+L S+   N+    +S++E L+ ++ ++L G++Y
Sbjct  206  VSQEFDTREIFLGILRSIGAVNDEVERNSTNEQLAERVYRSLKGRKY  252



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score = 85.5 bits (210),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 72/107 (67%), Gaps = 5/107 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG D++   I   LI +SSR L+VV I GMGGIGKTTLARR+Y D LIA  F + AW N
Sbjct  147  IVGLDEDLLRIKDRLIVQSSR-LEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTN  205

Query  284  ASQHQNDRQMLLGLLNSLVYTNN----SSSDEDLSAQLRKTLWGQRY  156
             SQ  + R++ LG+L S+   N+    +S++E L+ ++ ++L G++Y
Sbjct  206  VSQEFDTREIFLGILRSIGAVNDEVERNSTNEQLAERVYRSLKGRKY  252



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score = 86.3 bits (212),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 84/154 (55%), Gaps = 8/154 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIK------NDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEI  435
            LQ+ + D+D +K E+++IK      +D + + ++    +S +        MVG D     
Sbjct  109  LQKVIADMDLIKNEVIEIKESMGIVHDQLHRNSVPAGSLSSSPLTGQKQAMVGVDDILND  168

Query  434  IMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQM  255
            IM  L  R     ++V I GMGGIGKTTLAR +Y +PLI   FD  AWV  S+  N R++
Sbjct  169  IMDKLT-RQQSGCQIVPIIGMGGIGKTTLARHVYENPLIVEYFDFRAWVTVSREYNTREI  227

Query  254  LLGLLNSLVY-TNNSSSDEDLSAQLRKTLWGQRY  156
            LL L++     T    S+E+L   L K+L G+RY
Sbjct  228  LLNLVSQKSKETMEIMSEEELGEMLYKSLAGKRY  261



>gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=249

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  33   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  91

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  92   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  136



>gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=245

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  26   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  84

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  85   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  129



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            SL  S    + +VG + +F II+  +  ++  +L V+ I GMGGIGKTTLAR++Y D  I
Sbjct  138  SLEKSTIEENTIVGMEDDFNIILDRVTTQTD-ELTVIPIFGMGGIGKTTLARKVYDDSYI  196

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             S FD  AWV  SQ  N+RQMLL L++S+  +   +SD++L   + + L G+++
Sbjct  197  RSRFDKQAWVTISQEYNERQMLLELVSSITGSKKETSDDELMEIVYRGLKGRKF  250



>gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  33   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  91

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  92   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  136



>gb|ACF22008.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 66/109 (61%), Gaps = 5/109 (5%)
 Frame = -3

Query  485  SFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSF  306
              +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F
Sbjct  27   GLEPEDKMVGLENEFEMMQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHF  85

Query  305  DLLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTL  171
             + A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L
Sbjct  86   GIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLL  134



>gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  33   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  91

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  92   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  136



>gb|EYU31287.1| hypothetical protein MIMGU_mgv1a022746mg, partial [Erythranthe 
guttata]
Length=472

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 7/113 (6%)
 Frame = -3

Query  476  PASE--MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
            P SE  MVG D     IMG L    S  L+++SI GMGGIGKTTL   +Y  P I   F 
Sbjct  34   PVSETIMVGFDGHVNEIMGALFSNES-NLQIISIVGMGGIGKTTLTTHVYNKPFIVQHFH  92

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            + AW   SQ   ++++LLGLL+ +  TN    +  SD  L  +L KTL G++Y
Sbjct  93   VRAWFTVSQEYTEKEILLGLLHQIDNTNQDDAHEISDGKLGDKLYKTLLGRKY  145



>gb|ACE79508.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  33   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  91

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  92   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  136



>gb|ACE79441.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 5/113 (4%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
             +P  +MVG + EFE++   L  R +R+L+VVSI GMGGIGKTTLA +IY DP + S F 
Sbjct  28   LEPEDKMVGLENEFEMVQDQL-ARGARELEVVSIVGMGGIGKTTLANKIYSDPFMMSHFG  86

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
              A    SQ    R + LGLL+S+       +    D+ L+ QL+K L   RY
Sbjct  87   TRAKATVSQEYCARYVPLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCGRY  139



>gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  34   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  92

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  93   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  137



>dbj|BAD18094.1| NBS-LRR protein [Ipomoea batatas]
Length=255

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 1/85 (1%)
 Frame = -3

Query  485  SFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSF  306
            S +P + MVG D EFE I   LI  S ++L+V+SI GMGGIGKTTL +R+Y +  I S F
Sbjct  21   SSEPKNVMVGCDDEFETIGHKLISHS-KKLEVISIVGMGGIGKTTLVQRVYENTSIVSHF  79

Query  305  DLLAWVNASQHQNDRQMLLGLLNSL  231
            D+ AW   SQ  N  +MLL LL  +
Sbjct  80   DVRAWTTVSQEYNLEEMLLDLLGCI  104



>ref|XP_006365682.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=835

 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 72/116 (62%), Gaps = 1/116 (1%)
 Frame = -3

Query  503  PISLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDP  324
            P SL  S    + +VG + +F II+  +  ++  +L V+ I GMGGIGKTTLAR+++ D 
Sbjct  136  PSSLEKSKIEENTIVGMEDDFNIILDRVTSQTD-ELTVIPIFGMGGIGKTTLARKVFGDS  194

Query  323  LIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             I S FD  AWV  S+  N+RQMLL +++S+  +   +SD+ L   + K L G+R+
Sbjct  195  YIRSRFDKHAWVTISEEYNERQMLLEVVSSITGSKQETSDDQLMEIVYKGLKGRRF  250



>ref|XP_009600479.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=861

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 70/113 (62%), Gaps = 7/113 (6%)
 Frame = -3

Query  476  PAS--EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
            PAS  E+VG D   E IMG L+ R SR+L VVSI GM G GKTTLAR +  DP+I S FD
Sbjct  138  PASNEELVGFDDVRETIMGRLL-RGSRELDVVSIVGMAGSGKTTLARSLKNDPIIVSHFD  196

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNNSS----SDEDLSAQLRKTLWGQRY  156
            + A    +Q    + +LL +L+++ Y   S      D +L+ +LRKTL+ +RY
Sbjct  197  IQAECRVTQVYTRKDLLLSILSNIAYYEPSELSKGDDYELADRLRKTLFTKRY  249



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 87/153 (57%), Gaps = 11/153 (7%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKNDYMLQRTL---DVLP---ISLADSFQPASEMVGR-DKEFEIIMG  426
            ME+I ++ +E++K+ + +     L    VLP   +S  DS      +V   DK+ E I  
Sbjct  218  MEEIISITKEVIKVMDTFGAGECLWHSSVLPGASLSRRDSGGVGKNVVVGFDKDLEEIKT  277

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
              I+ SS+ L+++SI GMGGIGKTTLAR+IY DP I   FD   WV  SQ  + RQ+LLG
Sbjct  278  RWIDDSSK-LEIISIVGMGGIGKTTLARQIYDDPSIFYHFDTRGWVAVSQEYSLRQVLLG  336

Query  245  LLNS---LVYTNNSSSDEDLSAQLRKTLWGQRY  156
            LL+S   L       SD  L+  L K L G+RY
Sbjct  337  LLDSTKMLTEEMQDESDPRLAEFLYKCLKGRRY  369



>emb|CDP05538.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 86/156 (55%), Gaps = 15/156 (10%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS--------EMVGRDKEFEIIM  429
            ME+I  ++ +L KI  D ML+  +    ++L +   P           +VG   E E I+
Sbjct  453  MEEIKLIRTDLEKINVDKMLKSRMPGADMNL-NQLNPGQLNTSRLQDVVVGFKDEAETII  511

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L  R S QL +VSI GM G+GKTTLA+++Y DP +   F+  AW   SQ    R++LL
Sbjct  512  NRLT-RGSAQLDIVSIVGMPGLGKTTLAKKVYHDPAVKYYFNRCAWCCVSQVYRIRELLL  570

Query  248  GLLNSLVYTN-----NSSSDEDLSAQLRKTLWGQRY  156
             +L+ +  +N     +++SDEDL  QL ++L  QRY
Sbjct  571  DILSDITVSNVRLSSSNTSDEDLVEQLWRSLKRQRY  606



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score = 79.0 bits (193),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 88/159 (55%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E +D++KE L+K   +  LQ        SL DS  P        ++MVG + E 
Sbjct  101  ILQRAIEKVDSLKEGLIKHSQNNNLQAGNS----SLCDSSSPRLHAPTLENDMVGYNIEQ  156

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L   S+  L+V+S++GMGGIGK+T  +++   P + S FD+  WV  S+  + R
Sbjct  157  ADMLSQLTGGST-PLEVISVTGMGGIGKSTFTKKLSSHPAVLSFFDIRGWVTVSEDYSFR  215

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            + LLGLL +          + SD+ L+ +L+K L G+RY
Sbjct  216  KTLLGLLKNANIAKEEELENKSDQVLADRLKKGLKGRRY  254


 Score = 28.1 bits (61),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  841  LHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
            L++K+ SL EL D S      E  + L  +++ +A  VEDE+E Q+  + + + D
Sbjct  37   LYEKVDSLHELLDNS----DAEQTENLHAEVKHIANEVEDEVESQMQVVMDEQHD  87



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score = 79.0 bits (193),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 88/159 (55%), Gaps = 16/159 (10%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ +E +D++KE L+K   +  LQ        SL DS  P        ++MVG + E 
Sbjct  112  ILQRAIEKVDSLKEGLIKHSQNNNLQAGNS----SLCDSSSPRLHAPTLENDMVGYNIEQ  167

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L   S+  L+V+S++GMGGIGK+T  +++   P + S FD+  WV  S+  + R
Sbjct  168  ADMLSQLTGGST-PLEVISVTGMGGIGKSTFTKKLSSHPAVLSFFDIRGWVTVSEDYSFR  226

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            + LLGLL +          + SD+ L+ +L+K L G+RY
Sbjct  227  KTLLGLLKNANIAKEEELENKSDQVLADRLKKGLKGRRY  265


 Score = 28.1 bits (61),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query  841  LHKKLGSLMELFDESRMDIGVEAIKELETKLRDVAFRVEDEIEFQIAHLHETEED  677
            L++K+ SL EL D S      E  + L  +++ +A  VEDE+E Q+  + + + D
Sbjct  48   LYEKVDSLHELLDNS----DAEQTENLHAEVKHIANEVEDEVESQMQVVMDEQHD  98



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 85/153 (56%), Gaps = 6/153 (4%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKND---YMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMG  426
            LQQ  ED+D + +E  KI++       +  +     S  D  +  + MVGRD + + ++ 
Sbjct  105  LQQVAEDMDHIWKESTKIQDKGKQVSKESLVHDFSSSTNDILKVKNNMVGRDDQRKQLLE  164

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L    S + KV+ I GMGGIGKTTLA+ +Y D  I   FD+ AW   SQ  N +++LLG
Sbjct  165  DLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHAWATISQQHNKKEILLG  224

Query  245  LLNSLVYTNNSSS---DEDLSAQLRKTLWGQRY  156
            LL+S +  ++      + +L+  L+K+L  +RY
Sbjct  225  LLHSTIKMDDRVKMIGEAELADMLQKSLKRKRY  257



>gb|EYU24183.1| hypothetical protein MIMGU_mgv1a021378mg, partial [Erythranthe 
guttata]
Length=828

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 5/107 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG D+    IM ML    S + +++ I GMGGIGKTTLA  +Y +P I   F++ AW  
Sbjct  157  MVGFDEHLIQIMSMLATDESDR-RIIPIVGMGGIGKTTLATNVYNNPFIVEKFEVRAWFV  215

Query  284  ASQHQNDRQMLLGLLNSLVYTNNS----SSDEDLSAQLRKTLWGQRY  156
             SQ    +++LLGLL  +V T  +    + D++L  +L KTL+G+RY
Sbjct  216  VSQECTGKEILLGLLRQVVTTGRNELEMNDDDELGEKLHKTLFGRRY  262



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (55%), Gaps = 4/151 (3%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVL---PISLADSFQPASEMVGRDKEFEIIMG  426
            LQQ   +ID +++E  KI++   L      L     S  D       M+GRD E + ++ 
Sbjct  105  LQQAANNIDRLQKESTKIQDKGKLASNKSSLVQDSSSTKDILNVKKNMMGRDDERKRLLE  164

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L    S + KV+ I+GMGGIGKTTLA+ ++ D  I S FD+ AW   SQ  + +++LL 
Sbjct  165  DLTRGFSSECKVIPITGMGGIGKTTLAKDVFNDVSIRSHFDVRAWATISQQYDVKEILLS  224

Query  245  LLNSLV-YTNNSSSDEDLSAQLRKTLWGQRY  156
            LL S + YT     + DL+  L+K+L  +RY
Sbjct  225  LLRSTMGYTFYMGDEADLADMLQKSLKSKRY  255



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 91/159 (57%), Gaps = 17/159 (11%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-------ASEMVGRDKEF  441
            ILQ+ + ++D++KEE+ K   +  LQ        SL DS  P        ++MVG + E 
Sbjct  101  ILQRAI-NVDSLKEEVFKHSQNNNLQAGNS----SLGDSSSPRLHASTLENDMVGYNTEQ  155

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L  R S +L+V +++GMGGIGK+T A++I+  P + S FD+  W+  S+  + R
Sbjct  156  ANMLSQLT-RDSPELEVNAVTGMGGIGKSTFAKKIFAHPPVLSFFDICGWITVSEDYSYR  214

Query  260  QMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            +MLLGLL  +        +  +D DL+  L+++L G+RY
Sbjct  215  KMLLGLLKDVNIGKEEDLDKKNDSDLAVCLKQSLMGRRY  253



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score = 84.3 bits (207),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score = 84.3 bits (207),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_006356562.1| PREDICTED: putative late blight resistance protein homolog R1A-3-like 
[Solanum tuberosum]
Length=278

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 66/106 (62%), Gaps = 6/106 (6%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG +K  EIIM  LI R +++  V++I GM G+GKTTLA+++Y +P I + FD+ AW  
Sbjct  31   VVGFEKHAEIIMNKLI-RGTKERDVITIYGMPGLGKTTLAKKVYNNPSIVNYFDVKAWCT  89

Query  284  ASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
             SQ  N R +L+ +      TN+      D+D++  LRK L G+RY
Sbjct  90   VSQAYNRRTLLVEIFKQA--TNDKIKIKEDDDVADMLRKVLIGKRY  133



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_006356561.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=767

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            ++VG +K+ EIIM  LI R +++  V+SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  31   QVVGFEKDAEIIMMKLI-RGTKERDVISIYGMPGLGKTTLARKVYNNPYIVNHFDVKAWC  89

Query  287  NASQHQNDRQMLLGLLNSLVYTNNSS---SDEDLSAQLRKTLWGQRY  156
              SQ  N R +L+ +      TN  S    D+D++  LR+ L G+RY
Sbjct  90   AVSQAYNRRTLLVDIFEQA--TNGDSEIKEDDDVADMLRRVLIGKRY  134



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score = 76.3 bits (186),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 82/154 (53%), Gaps = 9/154 (6%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS----EMVGRDKEFEIIM  429
            LQ+ +E+ D+ K ++++ +N  M  + L       A S + AS     MVG   E   I 
Sbjct  99   LQRVVENFDSAKLQVMEFRN--MGSKNLAPKNSFSAGSLRLASGGKNSMVGFVDEMLQIK  156

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L  + S +L V+SI GMGG GKTTLAR +Y D  I   F   AWV  SQ  + R++LL
Sbjct  157  DRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWVTISQEYHLREILL  216

Query  248  GLLNS---LVYTNNSSSDEDLSAQLRKTLWGQRY  156
            GLL S   L       S E+L+  L K+L G+RY
Sbjct  217  GLLMSMKKLTGKKCEDSYEELAEYLYKSLKGRRY  250


 Score = 30.0 bits (66),  Expect(2) = 4e-14, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
 Frame = -1

Query  964  MACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDI  785
            MA   V+SL+ TLE           ++    I  NK  +  L  K+ S ++ F E     
Sbjct  1    MAYASVVSLIETLEE----------IRDGHEILYNKEQIECLLSKV-SFLQTFLEDFSQK  49

Query  784  GVEAIKELETKLRDVAFRVEDEIEFQIAH  698
              + +KELET++RD A+  ++ I+  I++
Sbjct  50   NSKEVKELETQIRDAAYAAQNMIDSYISN  78



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 85/152 (56%), Gaps = 8/152 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGM  423
            LQQ  ++ID V++E  KIK+     +     P  + DS     E  M+GRD E + ++  
Sbjct  105  LQQVAQEIDRVQKESTKIKDK---GKQASNKPSLVQDSSLANVENNMLGRDDERKRLLED  161

Query  422  LIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGL  243
            L    S + KV+ I GMGGIGKTTLA+ ++ D  I S FD+ +W   S   N +++LL L
Sbjct  162  LTRGFSGEPKVIPIVGMGGIGKTTLAKEVFDDVTIRSHFDVRSWATVSSQHNVKEILLSL  221

Query  242  LNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
            L+S    N+    ED   L+  LRK+L G+RY
Sbjct  222  LSSRKEMNDKYYKEDEPELADMLRKSLKGKRY  253



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 84.0 bits (206),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 90/176 (51%), Gaps = 33/176 (19%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE-------MVGRDKEF  441
            ILQ+ +E ID++KEEL K + +  +Q        SL  S  P S        MVG + E 
Sbjct  106  ILQRAIEAIDSIKEELFKQRENNNMQAGNS----SLGGSNSPESHVSTLENNMVGYNDEQ  161

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L    SRQL+V+SI GMGGIGK+T A+R++ DP +   FD+  WV  S+  + R
Sbjct  162  ASMLRQLTG-DSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVTVSKDYSIR  220

Query  260  QMLLGLLNSLVYTNNSSSDED---------------------LSAQLRKTLWGQRY  156
            +MLL LL       +  SDE+                     L+ +L+K+L G+RY
Sbjct  221  KMLLSLLQDAGVELDKVSDEEQADDLQESDEELDHVQKINNALADRLQKSLKGRRY  276



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 84.0 bits (206),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 90/176 (51%), Gaps = 33/176 (19%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASE-------MVGRDKEF  441
            ILQ+ +E ID++KEEL K + +  +Q        SL  S  P S        MVG + E 
Sbjct  96   ILQRAIEAIDSIKEELFKQRENNNMQAGNS----SLGGSNSPESHVSTLENNMVGYNDEQ  151

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              ++  L    SRQL+V+SI GMGGIGK+T A+R++ DP +   FD+  WV  S+  + R
Sbjct  152  ASMLRQLTG-DSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVTVSKDYSIR  210

Query  260  QMLLGLLNSLVYTNNSSSDED---------------------LSAQLRKTLWGQRY  156
            +MLL LL       +  SDE+                     L+ +L+K+L G+RY
Sbjct  211  KMLLSLLQDAGVELDKVSDEEQADDLQESDEELDHVQKINNALADRLQKSLKGRRY  266



>ref|XP_009603187.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=677

 Score = 83.6 bits (205),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 90/155 (58%), Gaps = 8/155 (5%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTL---DVLPI-SLADSFQPASEMVGRDKEFEIIM  429
            LQQ  + +D+++EEL+K KN+    + L   +  P+ S        +  VG +  F  ++
Sbjct  103  LQQIGKVMDSIQEELMKFKNENQHIKDLPAINFFPLRSSGHVVDEENAFVGMENVFNKVL  162

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              LI  ++R+L VVS+ GMGGIGK+TLA  I+R+  +   FD+ +WV  SQ  + R+MLL
Sbjct  163  NQLIGGNARELNVVSVVGMGGIGKSTLAGSIFRNTSVFYHFDVSSWVTVSQEYDVREMLL  222

Query  248  GLLN----SLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             +L+    SL    ++ S++ L  Q+ + L G+RY
Sbjct  223  DVLSFGTPSLKAMYSNLSNDQLLEQVYRKLKGKRY  257



>ref|XP_006356519.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=762

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ EIIM  LI R +++  ++SI GM G+GKTTL R++Y +P I   FD+ AW 
Sbjct  31   EVVGFEKDAEIIMKKLI-RGTKERDLISIFGMPGLGKTTLTRKVYNNPYIVDHFDVKAWC  89

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
              SQ  N R +L+ +      TNN      D+D++  LR+ L G+RY
Sbjct  90   AVSQAYNRRTLLVEIFKQT--TNNEIKIKEDDDVADMLRRVLIGKRY  134



>ref|XP_006355088.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1261

 Score = 83.6 bits (205),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = -3

Query  461  VGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNA  282
            VG ++E   I+  L++    +L V+SI GM G+GKTTLA ++Y++ L+A+ F++ AW   
Sbjct  534  VGHEEEEARIICQLLDEHESELDVISIVGMPGLGKTTLANKVYKNTLVATHFNVRAWCTV  593

Query  281  SQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            SQ  N  ++L G+L  +  +    S++DL+  LR+ L  +RY
Sbjct  594  SQKYNKSKVLRGILQQVTVSEKKESEDDLAENLRRALLDKRY  635



>ref|XP_006367915.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Solanum tuberosum]
Length=383

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 70/107 (65%), Gaps = 5/107 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            ++G D++   I   LI +SSR L+VV I GMGGIGKTTLARR+Y D LIA  F + AW N
Sbjct  151  IIGLDEDLLKIKDRLIVQSSR-LEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTN  209

Query  284  ASQHQNDRQMLLGLLNSLVYTNN----SSSDEDLSAQLRKTLWGQRY  156
             SQ  + R++ LG+L S+    +    +S++E L+ ++ ++L G +Y
Sbjct  210  VSQEFDTREIFLGILRSIGVVKDEVERNSTNEQLAERVYRSLKGMKY  256



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 90/160 (56%), Gaps = 14/160 (9%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYM-LQRTLDVLPISLADSFQPASE-------MVGRDKEF  441
            L + ++D+  +K+++++IK   + ++  L + P SLA +    S        MVG D+  
Sbjct  117  LDKVIQDMGLIKKDVMEIKESNIGIEDHLHMNPSSLAGAASSRSPLTTKQETMVGFDELL  176

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
              +M  L  + S  L+++ I GMGGIGKTTLAR  Y  PLI   FD+ AWV  SQH N +
Sbjct  177  IEVMDKLTGQQS-NLRIIPIVGMGGIGKTTLARNSYAKPLIVHHFDVRAWVTISQHYNVQ  235

Query  260  QMLLGLLNSLVYTN-----NSSSDEDLSAQLRKTLWGQRY  156
             +L+ +L  +         +  S+ +LS ++ K+LWG+RY
Sbjct  236  DILIEILLCVSKYESREILSGKSEGELSERVHKSLWGRRY  275



>ref|XP_006361240.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=859

 Score = 77.8 bits (190),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 96/176 (55%), Gaps = 25/176 (14%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVL-----PISLADSFQ----------  477
            +L +IL+Q +EDID+VKEEL K + +  LQ     +     P SL  + +          
Sbjct  50   RLLIILKQAIEDIDSVKEELSKPRKNNKLQAGNGSVGGTCSPRSLVSTLENDMVGHSDEQ  109

Query  476  ------PASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIA  315
                     +MVG   E E + G L   SS QL+V+SI+GMGGIGK+T A++++ DP I 
Sbjct  110  DMVGHSDEQDMVGHSDEQERVRGELTGDSS-QLEVISITGMGGIGKSTFAKKMFSDPSIV  168

Query  314  SSFDLLAWVNASQHQNDRQMLLGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
              F++  W+  S+  + ++MLL LL   +  N   +   D++L+  L+K+L  +RY
Sbjct  169  GFFNVCGWITVSKDYSLKKMLLSLLQDAIGVNEQLDEKPDDELADCLQKSLKKRRY  224


 Score = 27.7 bits (60),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -1

Query  769  KELETKLRDVAFRVEDEIEFQIAHLHETEE  680
            K LE  ++D+A  VEDE+E Q   + E EE
Sbjct  12   KILEQAIKDIANEVEDEVESQALRIMEKEE  41



>gb|ACE79401.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 65/106 (61%), Gaps = 5/106 (5%)
 Frame = -3

Query  476  PASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLL  297
            P S+M+G + EFE++   L  R +R+L+VV I GMGGIGKTTLA +IY DP + S F + 
Sbjct  30   PQSKMIGLENEFEMMQDRL-SRGARELEVVLIVGMGGIGKTTLANKIYSDPFMMSHFGIR  88

Query  296  AWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTL  171
            A    SQ    R +LLGLL+S+       +    D+ L+ QL+K L
Sbjct  89   AKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLL  134



>gb|ACE79434.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            +P  +MVG + EFE++   L  R +++L+VVSI GMGGIGKTTLA +IY DP I S F +
Sbjct  29   EPEDKMVGLENEFEMMQDQL-ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGI  87

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R +LL LL+S+       +    D+ L+ +L+K L   RY
Sbjct  88   RAKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLLKCGRY  139



>gb|ACE79422.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            +P  +MVG + EFE++   L  R +++L+VVSI GMGGIGKTTLA +IY DP I S F +
Sbjct  29   EPEDKMVGLENEFEMMQDQL-ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGI  87

Query  299  LAWVNASQHQNDRQMLLGLLNSLVYT----NNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R +LL LL+S+       +    D+ L+ +L+K L   RY
Sbjct  88   RAKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLLKCGRY  139



>ref|XP_011072135.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=540

 Score = 82.8 bits (203),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 79/150 (53%), Gaps = 8/150 (5%)
 Frame = -3

Query  584  MEDIDAVKEELVKI----KNDYMLQRTLDVLPI---SLADSFQPASEMVGRDKEFEIIMG  426
            +E +D VK EL+ +    +     Q+ +  LP    ++  S   +S MVG D+  E IM 
Sbjct  110  IEKLDCVKSELMMVVEEERASLQAQKPISSLPACSSTVLPSSAKSSTMVGFDERLERIMD  169

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L       L+++ I GMGGIGKTTLAR ++  P I   FD+  W   SQ  + R +L+ 
Sbjct  170  ELTGHKC-DLQILPIVGMGGIGKTTLARNVFDHPYIVHYFDMRIWFTISQEYSSRGILVH  228

Query  245  LLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            LLN      NS +  +L  +L K L+G++Y
Sbjct  229  LLNDGRNQENSKTLAELGQRLYKNLFGRKY  258



>ref|XP_009766122.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=469

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E I+  +I+  +++L V+SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  29   EVVGFEKDAESIIKKMIQ-GTKELDVISIYGMPGLGKTTLARKVYNNPSIVNYFDVKAWC  87

Query  287  NASQHQNDRQMLLGLLNSLV-YTNNSSSDEDLSAQLRKTLWGQRY  156
            + SQ  N  ++L  + N +  Y +    D D++ +L+KTL G+RY
Sbjct  88   SVSQAYNRIKLLGEIFNQVTGYKSEIDDDVDIADKLQKTLKGRRY  132



>ref|XP_009793286.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
 ref|XP_009793288.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=493

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 91/156 (58%), Gaps = 10/156 (6%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQ----RTLDVLPISLADSFQPASEMVGRDKEFEII  432
            I Q+ +E++D++KEEL+    +  LQ       D   + L  S    ++MVG + E   +
Sbjct  155  ISQRAIENVDSLKEELITHIQNNNLQAGNSSRGDSSSLRLHSS-TLENDMVGYNIEQSNM  213

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
            M  L   S+ +L+V+S++GMGGIGK+T A+R++  P + S FD+  W+  S+  + R+ML
Sbjct  214  MSQLTGGST-ELEVISVTGMGGIGKSTFAKRLFSHPSVLSFFDIRGWIIVSEDYSYRKML  272

Query  251  LGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
            LGLL    +      +  SD DL+  L+++L G+RY
Sbjct  273  LGLLTDANFGKKEELDKKSDSDLAFCLKQSLMGRRY  308



>gb|EYU24178.1| hypothetical protein MIMGU_mgv1a024402mg [Erythranthe guttata]
Length=769

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 64/108 (59%), Gaps = 7/108 (6%)
 Frame = -3

Query  464  MVGRDKEFEIIMGML-IERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            MVG D     IMG L  + S+RQ  ++ I GMGGIGKTTLA  +Y  P I   F + AW 
Sbjct  124  MVGFDGHVNEIMGALSTDESNRQ--IIPIVGMGGIGKTTLATHVYNKPFIVQHFHVRAWF  181

Query  287  NASQHQNDRQMLLGLLNSLVYTNNSSSDE----DLSAQLRKTLWGQRY  156
              SQ   ++++LLGLL+ +  TN + + E     L  +L KTL+G++Y
Sbjct  182  TVSQEYTEKEILLGLLHQIDNTNQNDAHEMNAGKLGDKLYKTLFGRKY  229



>ref|XP_006355091.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=1697

 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = -3

Query  536   DYMLQRTLDVLPISLADSFQPASEM-VGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIG  360
             D+ L     V PI    S  P  E+ VG +KE   I+G L+ +   +L V+SI GM G+G
Sbjct  908   DHPLDAKSFVEPIESTSS--PFVEVTVGHEKEESQIIGQLLNQHESELDVISIVGMPGLG  965

Query  359   KTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYT-NNSSSDEDLSAQL  183
             KTTLA ++Y + L+AS F + AW   SQ  N  ++L  +L  +  +    S D DL+ +L
Sbjct  966   KTTLANKVYNNTLVASHFKIRAWCTVSQKYNKSKVLREILQQVASSEEKESEDHDLAEKL  1025

Query  182   RKTLWGQRY  156
             R+ L+ +RY
Sbjct  1026  RRALYDKRY  1034



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 69/115 (60%), Gaps = 7/115 (6%)
 Frame = -3

Query  482  FQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
            FQ  + MVG +  FEI+   L  R + +L+V+SI GMGGIGK+TLA ++Y DP I S FD
Sbjct  134  FQSENMMVGHENAFEIMQDQL-ARGATELQVISIVGMGGIGKSTLAIKLYNDPFIMSHFD  192

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVYTNN------SSSDEDLSAQLRKTLWGQRY  156
            + A V  SQ    R +LLG+L+S+  +           D  L+ +L+K L G+RY
Sbjct  193  IRAKVIVSQEYCKRNVLLGILSSISGSGTIGEFYEQQDDGQLADRLQKYLKGKRY  247



>ref|XP_004251533.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=930

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 68/114 (60%), Gaps = 5/114 (4%)
 Frame = -3

Query  485  SFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSF  306
            S +  + MVG + EFE++   L  R +  L+VVSI GMGGIGKTTLA +IY DP + S F
Sbjct  187  SLEHENVMVGHENEFEMMQDQLT-RGASDLEVVSIVGMGGIGKTTLANKIYTDPFVMSCF  245

Query  305  DLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDE----DLSAQLRKTLWGQRY  156
            D  A V  SQ    R +LL LL+S+    + + +E     L+ QL+K L G RY
Sbjct  246  DKRAKVTISQDYCVRNVLLRLLSSISGKTHQTYEEQDDGQLADQLQKLLKGPRY  299



>ref|XP_009761073.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761075.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761076.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=764

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD   W 
Sbjct  29   EVVGFEKDAESIMKKLI-GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWC  87

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ   +R +L+ +L      N     D+D++ +LRKTL G+RY
Sbjct  88   SVSQTYIERTLLIEILKQATGGNYEIKEDDDIADKLRKTLIGRRY  132



>gb|EYU24152.1| hypothetical protein MIMGU_mgv1a018081mg, partial [Erythranthe 
guttata]
Length=832

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -3

Query  470  SEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAW  291
            + MVG D     IMG L    S  L+++SI GMGG+GKTTLA  ++ +P I   F L AW
Sbjct  157  NNMVGFDDHMVEIMGALSTNES-NLRIISIVGMGGMGKTTLATNVFNNPFIVEHFQLRAW  215

Query  290  VNASQHQNDRQMLLGLLNSLVYTNNSSS-----DEDLSAQLRKTLWGQRY  156
               SQ   D+++LLGLL+ +  T  ++      D+ +  +L KTL+G++Y
Sbjct  216  FTVSQEYTDKKILLGLLHQINNTYRNAHEIVDDDDAIGDRLHKTLFGRKY  265



>ref|XP_006365692.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=592

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = -3

Query  497  SLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLI  318
            SL  S    + +VG + +F  I+  L  ++ ++L V+ I GMGGIGKTTLAR++Y +  I
Sbjct  139  SLEKSTIEENTIVGMEDDFNTILDRLTAQT-KKLTVIPIFGMGGIGKTTLARKVYDNSYI  197

Query  317  ASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
             S FD  AWV  S+  N+RQMLL +++S+  +N   S++ L   + + L G+R+
Sbjct  198  RSRFDKHAWVTVSEKYNERQMLLEVVSSITGSNQEMSNDRLMEIVYRGLKGRRF  251



>emb|CDP05594.1| unnamed protein product [Coffea canephora]
Length=1250

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 84/171 (49%), Gaps = 11/171 (6%)
 Frame = -3

Query  638  AAKSSSPCFKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS---  468
             A S  P +   +      E+I     E+V +K  Y + + + V    LA S +  +   
Sbjct  457  CAISGIPIWHQIICFSDIQEEIKFCGTEIVTMKQKYNIGKQIAVTTSKLAHSSRGNNSKF  516

Query  467  --EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLA  294
              ++VG   E   I+ +L    S+  ++VSI GM G+GKTTLAR++Y DP   S F  LA
Sbjct  517  DEDVVGFKDEANQIIDLLTS-GSKNREIVSIVGMPGVGKTTLARKVYNDPSTTSYFHELA  575

Query  293  WVNASQHQNDRQMLLGLLNSLVYTNN-----SSSDEDLSAQLRKTLWGQRY  156
            W   SQ    R +LL +L  L  + +       S+EDL  QLR+ L  QRY
Sbjct  576  WCYVSQVYTSRDLLLAILKCLSVSIDDVKLSKMSNEDLEEQLRRCLLKQRY  626



>gb|EYU23504.1| hypothetical protein MIMGU_mgv1a021434mg [Erythranthe guttata]
Length=861

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 88/158 (56%), Gaps = 17/158 (11%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKND-------YMLQRTLDVLPISLADSFQPA-SEMVGRDKEF  441
            LQ  +E++D+V++++++ K++       YM Q T  ++      ++ P  + MVG D++ 
Sbjct  128  LQTVIEEMDSVEKKVMEFKDEIGSKDDRYMQQPTCSMV----TTTWTPGKNTMVGFDEQL  183

Query  440  EIIMGMLI-ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQND  264
              ++  L  +R  RQ  V+ I GMGGIGKTTLA+  Y   L    FD+  WV  SQ  N 
Sbjct  184  LRLLDKLTGQRCDRQ--VIPIVGMGGIGKTTLAKNAYEHSLTMHHFDIRTWVTVSQKYNV  241

Query  263  RQMLLGLLNSLVYTN-NSSSDEDLSAQ-LRKTLWGQRY  156
            R++ + L + L+ +  N   DE L  Q L K LWG+RY
Sbjct  242  RELFVQLHSRLISSEINGEIDEQLLGQKLHKILWGRRY  279



>ref|XP_011072133.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=874

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 84/147 (57%), Gaps = 8/147 (5%)
 Frame = -3

Query  575  IDAVKEELVKIKNDY---MLQRTLDVLPISLAD---SFQPASEMVGRDKEFEIIMGMLIE  414
            I+++ +EL+ +K ++     Q+ + +LP+  +D   S    S +VG D+    +M  L  
Sbjct  114  IESITKELMMVKEEWADPQEQKPIALLPLGSSDALSSIDKNSTVVGFDEHLVRVMDELT-  172

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
            R    L++  I GMGGIGKTTLAR I+  P I + FD+  W+  SQ    R+++L LLN 
Sbjct  173  RDEPDLQIFPIVGMGGIGKTTLARSIFEHPYIVNHFDMRRWLTISQENRVRKIVLDLLND  232

Query  233  L-VYTNNSSSDEDLSAQLRKTLWGQRY  156
            + +  +N  +  +L + L K L+G+RY
Sbjct  233  VKIEDDNKKTLAELGSLLYKKLFGRRY  259



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 86/160 (54%), Gaps = 11/160 (7%)
 Frame = -3

Query  611  KLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPAS-----EMVGRDK  447
            + G   QQ  ++ID VK +L+K K +  LQ        S   S +P +     +MVGR  
Sbjct  93   RFGKFCQQATQEIDYVKAQLIKQKENKNLQAGNSSTDGS--SSLRPHASILEDDMVGRTI  150

Query  446  EFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
            E + I+  L +R S +L+V+S+ GM GIGK+TLA+ I++D  I   F +  W+  S++ N
Sbjct  151  ERDRIINKL-KRRSNKLEVISVVGMAGIGKSTLAKDIFQDTFIKQYFHIRKWITVSENCN  209

Query  266  DRQMLLGLLNSLVYTN---NSSSDEDLSAQLRKTLWGQRY  156
             R+MLL LL          N  +D DL+   + +L  +RY
Sbjct  210  FRKMLLDLLQDATAKKEELNKKTDGDLAGIFQNSLKVERY  249



>ref|XP_009765789.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=732

 Score = 81.6 bits (200),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG ++E E++M  L+    RQL V+SI GM G+GKTTLA+R+Y    I++ FD+  W  
Sbjct  1    MVGFERETEMLMDQLV-TGPRQLDVISIFGMPGLGKTTLAKRLYDHESISNRFDIRLWCC  59

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSS---SDEDLSAQLRKTLWGQRY  156
            +SQ  + R +L  LLN +   + S+   SD++L+  L K L G+RY
Sbjct  60   SSQSYDKRSLLFELLNHICKLDTSTKEKSDDELAEMLYKHLKGKRY  105



>ref|XP_006355089.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=1360

 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 66/102 (65%), Gaps = 0/102 (0%)
 Frame = -3

Query  461  VGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNA  282
            VG +++   I+  L++    +L V+SI GM G+GKTTLA ++Y++ L+AS F++ AW   
Sbjct  552  VGHEEDESWIIDQLLDEHESELDVISIVGMPGLGKTTLANKVYKNTLVASHFNVRAWCTV  611

Query  281  SQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
            SQ  N  ++LL +L  +  +    S++DL+ ++R+ L+ +RY
Sbjct  612  SQKYNKSKVLLEILQQVTGSEGKESEDDLADKVRRALFDKRY  653



>ref|XP_011072136.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=877

 Score = 81.3 bits (199),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 81/147 (55%), Gaps = 8/147 (5%)
 Frame = -3

Query  575  IDAVKEELVKIKNDY---MLQRTLDVLPISLAD---SFQPASEMVGRDKEFEIIMGMLIE  414
            I+++ +EL+  K ++     Q+ +  LP+  +D   S    S +VG D+    +M  L  
Sbjct  114  IESIIKELMMAKEEWADPQEQKPIASLPVGSSDVLSSIDKNSTVVGFDEHLVRVMDELT-  172

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
            R    L++  I GMGGIGKTTLAR I+  P I + FD+  W+  SQ  N R+++L LLN 
Sbjct  173  RDELDLQIFPIVGMGGIGKTTLARNIFEHPYIVNHFDMCKWLTISQENNVRKIVLDLLND  232

Query  233  L-VYTNNSSSDEDLSAQLRKTLWGQRY  156
            +    +N  +  +L   L K L+G+RY
Sbjct  233  VKTEDDNKKTLAELGNLLHKKLFGRRY  259



>ref|XP_010312507.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=874

 Score = 80.9 bits (198),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG   +F  I+  +  +++ +L V+ I GMGGIGKTTLA+++Y D  I S FD LAWV 
Sbjct  143  VVGMKDDFNTILDRVTAQTN-ELTVIPIFGMGGIGKTTLAKKVYDDSFICSRFDKLAWVT  201

Query  284  ASQHQNDRQMLLGLLNSLVY-TNNSSSDEDLSAQLRKTLWGQRY  156
             S+  N+RQMLL +++S+    N   SD++L   + + L G+R+
Sbjct  202  ISEEYNERQMLLEVVSSVTTGGNQEKSDDELMEIVYRGLKGRRF  245



>ref|XP_009774730.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009774732.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ E IM  L    +++L V+SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  29   EVVGFEKDAESIMKKLT-GGAKELDVISIYGMPGLGKTTLARKVYNNPSIVNYFDVKAWC  87

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ  N R +LL +        +    D D++ +L+KTL G+RY
Sbjct  88   SVSQAYNRRTLLLEIFKQATRDKSEIKEDVDIADKLQKTLKGRRY  132



>ref|XP_006366309.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=614

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 80/145 (55%), Gaps = 7/145 (5%)
 Frame = -3

Query  572  DAVKEELVKI---KNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGMLIERSSR  402
            D++K  L+K+   +NDY    T D +      S    + ++  D +   +   LI   S+
Sbjct  100  DSIKAYLMKVMNSRNDYDALLTRDTVERDSEYSPHLKATVLDLDNDLMTVKSRLIGPHSK  159

Query  401  QLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYT  222
             L VVSI GMGGIGKTTLAR++Y D  +   F + AW+  SQ    R+MLLG+L      
Sbjct  160  -LDVVSIVGMGGIGKTTLARKVYDDIYMEHHFYIRAWITVSQMHQLREMLLGILRCFSLV  218

Query  221  NNSS---SDEDLSAQLRKTLWGQRY  156
            N+++   S E L+ Q+ ++L G+RY
Sbjct  219  NDNTYLKSTEQLAEQVYRSLKGRRY  243



>ref|XP_009774731.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009774733.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=787

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG  K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  29   EVVGFVKDAESIMKKLI-VGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNYFDVKAWC  87

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ  N R +LL +        +    D D++ +L+KTL G+RY
Sbjct  88   SVSQAYNRRTLLLEIFKQATRDKSEIKEDVDIADKLQKTLKGRRY  132



>gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Erythranthe guttata]
Length=895

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 90/158 (57%), Gaps = 14/158 (9%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYM---LQR---TLDVLPISLADSFQPASEMVGRDKEFEI  435
            L + ++++D +K+E++++K + M   L +   T+D+ P  L   F   +  VG D   E 
Sbjct  100  LTEVIQEMDFIKKEVMQMKENNMGLFLHKDSSTVDIGP--LRSRFTGQNATVGFDDVMEE  157

Query  434  IMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQM  255
            +M ML  R S + +++ I GMGGIGKTTLAR +Y   LI   FD+LAW   SQ  + R +
Sbjct  158  MMDMLTGRQSTR-QIIPIVGMGGIGKTTLARNLYGSRLIVRHFDMLAWATISQEYSMRGI  216

Query  254  LLGLLNSLVY-----TNNSSSDEDLSAQLRKTLWGQRY  156
            LL +L  +       T ++  +++L   L KTL G+RY
Sbjct  217  LLEILLCIKSQESKETYSAMREDELGLVLHKTLIGRRY  254



>ref|XP_009802397.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
 ref|XP_009802398.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=898

 Score = 67.4 bits (163),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/160 (33%), Positives = 85/160 (53%), Gaps = 6/160 (4%)
 Frame = -3

Query  617  CFKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLA--DSFQPASEMVGRDKE  444
            C KL  I QQ  ++ID+ KEEL+K +N+ +   +      S    D+    ++M G + E
Sbjct  92   CAKLAKISQQATQEIDSFKEELIKQENNNLQGESSSTSGSSSPRLDASILENDMEGYNVE  151

Query  443  FEIIMGMLIERS-SRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQN  267
               ++  L  RS S Q +V S+ GM GIGK+T A+ I+  P I   F +  W+  S+  +
Sbjct  152  RGSMVQQLTRRSGSDQREVFSVVGMPGIGKSTFAKTIFLHPSIRRVFHIRGWITVSKDYD  211

Query  266  DRQMLLGLLNSLVYTNNSSSDED---LSAQLRKTLWGQRY  156
             R+MLL LL+++   +   +  D   L+ +L+  L  +RY
Sbjct  212  LRKMLLVLLDAIGKKDPVDAKIDIGKLAERLKNGLKRERY  251


 Score = 35.0 bits (79),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 11/94 (12%)
 Frame = -1

Query  961  ACVVVLSLMRTLELEFLQSLPRPILQQNQLIPCNKHLVLSLHKKLGSLMELFDESRMDIG  782
            A   + SL+ T++ + LQS     LQ+N      +HL  SL +K GSL   F     ++ 
Sbjct  3    AYAALTSLLGTID-QLLQS-NLSGLQENH----KRHLK-SLKEKFGSLQASFG----NVD  51

Query  781  VEAIKELETKLRDVAFRVEDEIEFQIAHLHETEE  680
             E  KE++ +++DVA   EDE+E  +  L E +E
Sbjct  52   GEPTKEMQARIKDVARDTEDEVESLVKQLMEQDE  85



>ref|XP_009772626.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772627.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772628.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=791

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG  K+ E IM  LI   +++L V+SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  29   EVVGFVKDAESIMKKLI-VGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNYFDVKAWC  87

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            + SQ  N R +LL +        +    D D++ +L+KTL G+RY
Sbjct  88   SVSQAYNRRTLLLEIFKQATRDKSEIKEDVDIADKLQKTLKGRRY  132



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 82/155 (53%), Gaps = 13/155 (8%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPA----SEMVGRDKEFEII  432
             LQQ +  ID++  EL  I  D +           L  +F P     +E+VG D + + I
Sbjct  53   CLQQTLVSIDSIGRELGNIYVDRLTSENEQ-----LGGAFSPNPNQRNEVVGLDDDCQSI  107

Query  431  MGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
               LI   SR L++V+I GMGGIGKTTLARR++ D     +F + AW   SQ    R +L
Sbjct  108  FDRLITVPSR-LEIVAIVGMGGIGKTTLARRVFDDLSTVYNFHVRAWATVSQVFRQRDVL  166

Query  251  LGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
            L LL S  +  +     ++E+L+  L ++L G+RY
Sbjct  167  LALLRSTTHVTDEIYRKNNEELAQDLYRSLKGKRY  201



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%), Gaps = 2/104 (2%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG   +F II+  L  ++  +L V+ I GMGGIGKTTLAR++Y D  I S FD LAWV 
Sbjct  150  VVGMKDDFNIILDRLTAQTD-ELIVIPILGMGGIGKTTLARKVYDDSCIRSRFDKLAWVT  208

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSS-SDEDLSAQLRKTLWGQRY  156
             SQ  N+RQMLL +++S+    +   S+++L   + + L G+R+
Sbjct  209  ISQEYNERQMLLEVVSSITTKGSQEMSNDELMEIVYRGLKGRRF  252



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 80.5 bits (197),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 89/156 (57%), Gaps = 11/156 (7%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLAD--SFQPAS---EMVGRDKEFEI  435
             LQQ +EDI  ++EE+ KI ND ++   L  L  +L D  S  P +   E VG D +  +
Sbjct  247  CLQQTVEDIVDIREEMRKI-NDTLVNGNLK-LGDTLNDDSSLSPPAQKNEAVGLDDDL-M  303

Query  434  IMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQ---HQND  264
            +M   + R   +L+VV+I GMGGIGKTTLAR+I+ DP    +F   AWV  SQ    +N 
Sbjct  304  LMSERLSRVPSRLEVVTIVGMGGIGKTTLARKIFDDPSTICNFHACAWVQVSQVYRLRNL  363

Query  263  RQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
               LL  +  L   N + S+E+L+  L ++L G+RY
Sbjct  364  LLGLLKCVTQLKDENCAKSNEELAEDLYRSLKGKRY  399



>gb|ACF21987.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=261

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 72/125 (58%), Gaps = 12/125 (10%)
 Frame = -3

Query  497  SLADSFQP-------ASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARR  339
            S+ DS  P        ++MVG + E   ++  L  R S +L+V+S++GMGGIGK+T A++
Sbjct  5    SIGDSSSPRLHAPTHENDMVGYNIEQANMLSQLT-RDSPELEVISVTGMGGIGKSTFAKK  63

Query  338  IYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTL  171
            ++  P + S FD+  WV  S+  + R MLLGLL           +  SD DL+  L+++L
Sbjct  64   LFSHPSVLSFFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSL  123

Query  170  WGQRY  156
             G+RY
Sbjct  124  MGRRY  128



>gb|EYU28611.1| hypothetical protein MIMGU_mgv1a025283mg, partial [Erythranthe 
guttata]
Length=872

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 66/107 (62%), Gaps = 6/107 (6%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG D   + IMG L    S  L+++SI GMGGIGKTTLA  +Y +P I   F + AW  
Sbjct  167  MVGFDDHMDEIMGALSTNES-NLRIISIVGMGGIGKTTLATNVYNNPFIVEMFGIRAWFT  225

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSSS----DEDLSAQLRKTLWGQRY  156
             SQ   + ++LLGLL+ +  T+ ++     D++L  +L KTL+G++Y
Sbjct  226  VSQEYTE-EILLGLLHQINNTDRNAHDMIDDDELGDKLYKTLFGRKY  271



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 67/112 (60%), Gaps = 5/112 (4%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            +P  +MVG + EFE++   L  R +++L+VVSI GMGGIGKTTLA +IY DP I S F +
Sbjct  139  EPEDKMVGLENEFEMMQDQL-ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGI  197

Query  299  LAWVNASQHQNDRQMLLGLLNSLV----YTNNSSSDEDLSAQLRKTLWGQRY  156
             A    SQ    R +LL LL+S+       +    D+ L+ +L+K L   RY
Sbjct  198  RAKATVSQEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLLKCGRY  249



>ref|XP_004242250.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=762

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG + + E+IM  LI R +++  V+SI GM G+GKTTLAR++Y +P IA+ FD+ AW 
Sbjct  31   EVVGFENDAEVIMMKLI-RGTKERDVISIYGMPGLGKTTLARKVYNNPSIANYFDVKAWC  89

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
              SQ  N R +L+ +      T++      D+D++  LR+ L G+RY
Sbjct  90   AVSQAYNRRTLLVEIFKQA--TDDEIKIKEDDDVADMLRRVLIGKRY  134



>gb|ACE79399.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = -3

Query  479  QPASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDL  300
            +P  +MVG + EFE++   L  R +++L+VVSI GMGGIGKTTLA +IY DP I S F +
Sbjct  29   EPEDKMVGLENEFEMMQDQL-ARGAKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGI  87

Query  299  LAWVNASQHQNDRQMLLGLLNSL  231
             A    SQ    R +LL LL+S+
Sbjct  88   RAKATVSQEYCARYVLLRLLSSI  110



>ref|XP_009765788.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=364

 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 67/106 (63%), Gaps = 4/106 (4%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            M+G + E E++M  L+    RQL V+SI GM G+GKTTLA+R+Y    I++ FD+  W  
Sbjct  1    MIGFEIETEMLMEKLV-TGPRQLDVISIFGMPGLGKTTLAKRLYDHESISNRFDIRLWCC  59

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSS---SDEDLSAQLRKTLWGQRY  156
            +SQ  + + +L  LLN +   + S+   SD++L+ +L K L G+RY
Sbjct  60   SSQSYDKKSLLFELLNHICKLDTSTKEKSDDELAEKLYKHLKGKRY  105



>ref|XP_009603167.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=885

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVL--PISLADSFQP-ASEMVGRDKEFEIIM  429
            ILQ+ +E ID++KEEL K + +  +Q     L    SL        + MVG + E   ++
Sbjct  106  ILQRAVEAIDSIKEELFKQRENNNMQAGNSSLGGSNSLGSHVSTLENNMVGYNDEQASML  165

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L    SRQL+V+SI GMGGIGK+T A+R++ DP +   FD+  W+  S+  + R+MLL
Sbjct  166  RQLT-GDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWITMSKDYSIRKMLL  224

Query  248  GLLNSLVYTNNSSSDEDLSAQLRKT  174
             LL       +  SDE+ +  L+K+
Sbjct  225  SLLQDAGVDLDKVSDEEQADHLQKS  249



>gb|ACE79431.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79450.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79460.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 72/125 (58%), Gaps = 12/125 (10%)
 Frame = -3

Query  497  SLADSFQP-------ASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARR  339
            S+ DS  P        ++MVG + E   ++  L  R S +L+V+S++GMGGIGK+T A++
Sbjct  16   SIGDSSSPRLHAPTHENDMVGYNIEQANMLSQLT-RDSPELEVISVTGMGGIGKSTFAKK  74

Query  338  IYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTL  171
            ++  P + S FD+  WV  S+  + R MLLGLL           +  SD DL+  L+++L
Sbjct  75   LFSHPSVLSFFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSL  134

Query  170  WGQRY  156
             G+RY
Sbjct  135  MGRRY  139



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score = 80.1 bits (196),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 84/150 (56%), Gaps = 8/150 (5%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQP-ASEMVGRDKEFEIIMGMLIERS  408
            ++++ ++ EE++KIK     +    V  I  A+   P  + MVG D++   I   L   S
Sbjct  159  VDEVCSIVEEVMKIKQSQNTEHIFQVTRIFSAEVNSPRKTTMVGFDEDLMEIKDQLCGDS  218

Query  407  SRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLV  228
            S+ L+++ + GMGGIGKTTLA  I+ DPLI   F + AW+  SQ  N R+++  LL+S+ 
Sbjct  219  SK-LQIIPLVGMGGIGKTTLATNIFHDPLIEYHFHIRAWITISQRYNIREIIRSLLSSIS  277

Query  227  YTNNSSSDE------DLSAQLRKTLWGQRY  156
               +  S E      +L+  L K+L G+++
Sbjct  278  TNTDKLSRETEDREMELAVCLYKSLKGRKF  307



>gb|ACF21990.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=272

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 72/125 (58%), Gaps = 12/125 (10%)
 Frame = -3

Query  497  SLADSFQP-------ASEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARR  339
            S+ DS  P        ++MVG + E   ++  L  R S +L+V+S++GMGGIGK+T A++
Sbjct  16   SIGDSSSPRLHAPTHENDMVGYNIEQANMLSQLT-RDSPELEVISVTGMGGIGKSTFAKK  74

Query  338  IYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTL  171
            ++  P + S FD+  WV  S+  + R MLLGLL           +  SD DL+  L+++L
Sbjct  75   LFSHPSVLSFFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSL  134

Query  170  WGQRY  156
             G+RY
Sbjct  135  MGRRY  139



>gb|EYU31572.1| hypothetical protein MIMGU_mgv1a024734mg [Erythranthe guttata]
Length=826

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/154 (32%), Positives = 88/154 (57%), Gaps = 12/154 (8%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKND---YMLQRTLDVLPISLADSFQPASE----MVGRDKEFEIIMG  426
            +ED+D++K+ +++ K +      ++    +PI+ + S +  +     M+G D++   ++ 
Sbjct  105  IEDMDSIKKRVMEFKEERRGSKNRKPTYSMPITTSTSSRLVTNGKNTMIGFDEKLIQLLH  164

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
                + S QL++++I GMGGIGKTTLA+  Y   LI   FD+ AW   SQ  N +++LL 
Sbjct  165  RFTGQPS-QLQIITIVGMGGIGKTTLAKHTYEHSLITKYFDIRAWTTVSQTYNVKEILLQ  223

Query  245  LLNSLVYTNNSSS----DEDLSAQLRKTLWGQRY  156
            L+     + N+ S    +E++  QL + LWG+RY
Sbjct  224  LVYGQSKSRNTESNRETEEEVGKQLYQELWGRRY  257



>ref|XP_006345616.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=530

 Score = 79.7 bits (195),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (61%), Gaps = 2/104 (2%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            ++G + +F  I   LI + + +L V+ I GMGGIGKTTLAR++Y D  I S FD  AWV 
Sbjct  32   IIGMEDDFNTIFDRLISQRN-ELTVIPIFGMGGIGKTTLARKVYDDSYIRSRFDRHAWVT  90

Query  284  ASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
             S   N RQMLL L+ S+  +N    SD+ L   + + L G+R+
Sbjct  91   VSNEYNKRQMLLELVYSITGSNQEMMSDDQLMVNVYRGLKGRRF  134



>gb|EYU24172.1| hypothetical protein MIMGU_mgv1a025900mg, partial [Erythranthe 
guttata]
Length=885

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 95/182 (52%), Gaps = 21/182 (12%)
 Frame = -3

Query  641  IAAKSSSPCFKLGLILQQGME----DIDAVKEELVKIK------NDYMLQRTLDVLPISL  492
            +AA+S S   +   +L +G+E    +   +++ELVK K      N+Y L  T      S 
Sbjct  87   LAARSRSDREESSNLLFEGVEISIQEFLFIEKELVKFKKDMQRPNNYYLTTTKASSSSSS  146

Query  491  ADSFQPA---SEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPL  321
            +    PA   ++MVG +   + IMG L    S  L+++SI GMGGIGKTTLA  +  +P 
Sbjct  147  SRPLLPAGGKNKMVGFNDHMDEIMGALSTNES-NLRIISIVGMGGIGKTTLAINVSNNPY  205

Query  320  IASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNSSSD-------EDLSAQLRKTLWGQ  162
            I   F L AW   SQ   D+++LLGLL+ +  T  ++ +         +   L KTL+G+
Sbjct  206  IVEHFQLRAWFTVSQEYTDKKILLGLLHQINNTYRNAHEIDDDDDDYAIGDILHKTLFGR  265

Query  161  RY  156
            +Y
Sbjct  266  KY  267



>ref|XP_009603166.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=913

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYMLQRTLDVL--PISLADSFQP-ASEMVGRDKEFEIIM  429
            ILQ+ +E ID++KEEL K + +  +Q     L    SL        + MVG + E   ++
Sbjct  106  ILQRAVEAIDSIKEELFKQRENNNMQAGNSSLGGSNSLGSHVSTLENNMVGYNDEQASML  165

Query  428  GMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLL  249
              L    SRQL+V+SI GMGGIGK+T A+R++ DP +   FD+  W+  S+  + R+MLL
Sbjct  166  RQLT-GDSRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWITMSKDYSIRKMLL  224

Query  248  GLLNSLVYTNNSSSDEDLSAQLRKT  174
             LL       +  SDE+ +  L+K+
Sbjct  225  SLLQDAGVDLDKVSDEEQADHLQKS  249



>gb|EYU24185.1| hypothetical protein MIMGU_mgv1a024774mg [Erythranthe guttata]
Length=880

 Score = 80.1 bits (196),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 85/151 (56%), Gaps = 9/151 (6%)
 Frame = -3

Query  584  MEDIDAVKEELVK-IKNDYMLQRTLDVLPISLADSFQPASE--MVGRDKEFEIIMGMLIE  414
            ++++ ++ ++LVK IK D   Q +L     S +    P+S+  MVG  K    +M  L  
Sbjct  63   IQELHSIHKQLVKMIKKDVQPQNSLSRGASSTSSKPLPSSKGTMVGFQKHLIQMMTTLTA  122

Query  413  RSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNS  234
              S  L+++S+ GMGGIGKTTLA  ++  PL+   F L AWV  S+  N +++LLGLL  
Sbjct  123  NES-NLRIISVVGMGGIGKTTLATNVFNKPLVLEHFHLRAWVTISKECNKKEILLGLLLQ  181

Query  233  LV--YTN---NSSSDEDLSAQLRKTLWGQRY  156
            +   Y N    +  +E L  +L K L+G++Y
Sbjct  182  ISNGYGNVKEMNDEEETLGDKLYKELFGRKY  212



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 67/108 (62%), Gaps = 6/108 (6%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG D     +M  L E+ S  L+++ I GMGGIGKTTLAR +Y  PLI   FD+ AWV 
Sbjct  152  MVGFDDLLIEVMDKLSEQQS-NLRIIPIVGMGGIGKTTLARNVYAKPLIMHHFDIRAWVT  210

Query  284  ASQHQNDRQMLLGLLNSL-----VYTNNSSSDEDLSAQLRKTLWGQRY  156
             SQ+ N + +L+ +L  +     + + ++ S+ +L  ++ K+LWG+RY
Sbjct  211  VSQNYNVQDILIEILLCISKDESLESLSAKSEGELGERVHKSLWGRRY  258



>gb|EYU25639.1| hypothetical protein MIMGU_mgv1a022176mg, partial [Erythranthe 
guttata]
Length=432

 Score = 79.3 bits (194),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 82/153 (54%), Gaps = 22/153 (14%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSF-QPASEM---VGRDKEFEIIM  429
            LQ  +E+ID++K  ++  K++            S  D F QP   M   VG D++   ++
Sbjct  79   LQTVIEEIDSIKNTVMGFKDEIG----------SKDDHFTQPKCSMNTMVGFDEQLLRLL  128

Query  428  GMLI-ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQML  252
              L  ++S+RQ  V+ I GMGGIGKTTLA+  Y   LI   FD+  WV  S   N +++L
Sbjct  129  DKLTGQQSNRQ--VIPIVGMGGIGKTTLAKNTYEHSLIMHHFDIRTWVTISPKYNVKELL  186

Query  251  LGLLNSLVYTNNSSSDEDLSAQ-LRKTLWGQRY  156
            L LL+      NS  DE L  Q L K LWG+RY
Sbjct  187  LQLLSE----KNSQIDEQLLGQKLHKMLWGRRY  215



>gb|EYU23607.1| hypothetical protein MIMGU_mgv1a019784mg [Erythranthe guttata]
Length=814

 Score = 79.7 bits (195),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/151 (34%), Positives = 84/151 (56%), Gaps = 9/151 (6%)
 Frame = -3

Query  584  MEDIDAVKEELVKIKNDYMLQRTLDVLP-------ISLADSFQPASEMVGRDKEFEIIMG  426
            ++D+D +K+++++ + +       D+ P        S+       + MVG D+E   I+ 
Sbjct  84   IQDMDYIKKKVIEFEEEITSGSKDDLPPAYSMPVTTSIRRFIADKNTMVGFDEELNEILD  143

Query  425  MLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLG  246
             L  +SS + +++ + GMGGIGKTTLA+  Y   LI   FD+  WV  SQ+ + R +LL 
Sbjct  144  KLTGQSSNR-QIIPVVGMGGIGKTTLAKNAYEHSLILYHFDIRTWVTISQNYSVRGILLQ  202

Query  245  LLNSLVYTNNSSSDED-LSAQLRKTLWGQRY  156
            LL+ +    +S +DE  L  +L K LWG+RY
Sbjct  203  LLSRVSIEIDSETDEQLLGEKLYKMLWGRRY  233



>emb|CDP12799.1| unnamed protein product [Coffea canephora]
Length=1156

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 6/113 (5%)
 Frame = -3

Query  479  QPASE-MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFD  303
            QP+ E +VGRD E +II+  L +R S QL ++ I GM G+GKTTLA ++Y DP I   F 
Sbjct  441  QPSHEDLVGRDDEVKIIINRL-KRGSMQLDIIPIWGMPGLGKTTLANKVYCDPSIEFHFY  499

Query  302  LLAWVNASQHQNDRQMLLGLLNSLVY-TNNSS---SDEDLSAQLRKTLWGQRY  156
            + AW   SQ  + R +LL +L+   + ++N S   SD+DL  +LRK L   +Y
Sbjct  500  IRAWCCVSQVYSMRSLLLQILHGTGFKSSNQSLEMSDDDLEEKLRKVLRRNKY  552



>ref|XP_006356564.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=758

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 74/128 (58%), Gaps = 9/128 (7%)
 Frame = -3

Query  515  LDVLPISLADSFQPA-------SEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGK  357
            +DV+  S   S +P+        E+VG +K  EI+M  L +  +++  V+SI GM G+GK
Sbjct  1    MDVVETSGEPSTKPSITSIYDDDEVVGFEKHAEIMMKKLTQ-GTKERDVISIYGMPGLGK  59

Query  356  TTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNNS-SSDEDLSAQLR  180
            TTLAR++Y +P I S FD+ AW   SQ  N R +L+ +       ++    D+D++  LR
Sbjct  60   TTLARKVYYNPSIVSHFDVKAWCAVSQAYNRRTLLVEIFKQATNADSEIKEDDDVADMLR  119

Query  179  KTLWGQRY  156
            K+L  +RY
Sbjct  120  KSLISRRY  127



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = -3

Query  470  SEMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAW  291
            + +VG D+E + I+  L E     L+VVS+ GMGG+GKTTLAR++Y DP I   F L AW
Sbjct  154  ANVVGFDEEAKTIIHRLTE-GPEHLEVVSVIGMGGLGKTTLARKVYVDPSIEYHFYLRAW  212

Query  290  VNASQHQNDRQMLLGLLNSLVYTNN---SSSDEDLSAQLRKTLWGQRY  156
            V  SQ  + R++  G+L SL   NN   + SD+ L+ +L + L   RY
Sbjct  213  VYVSQEYSRREVFRGILESLGLMNNQMLNMSDDWLAEELCRHLRNNRY  260



>gb|ACQ42905.1| tomato spotted wilt virus susceptible protein [Solanum lycopersicum]
 gb|ACQ42906.1| tomato spotted wilt virus susceptible protein [Solanum lycopersicum]
 gb|ACQ42908.1| tomato spotted wilt virus susceptible protein [Solanum lycopersicum]
Length=220

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 67/105 (64%), Gaps = 2/105 (2%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG + + E ++  LI R + +L VV I GMGG GKTT+AR++Y + +I S FD+ AW 
Sbjct  22   EVVGFENKAEELIDYLI-RGTNELDVVPIVGMGGQGKTTIARKLYNNDIIVSRFDVRAWC  80

Query  287  NASQHQNDRQMLLGLLNSLV-YTNNSSSDEDLSAQLRKTLWGQRY  156
              SQ  N R++L  + + +  + +N ++ + L+  LR+ L G+RY
Sbjct  81   IISQTYNQRELLQDIFSQVTGFNDNGATVDVLADMLRRKLMGKRY  125



>ref|XP_009625970.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=165

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 66/107 (62%), Gaps = 5/107 (5%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            MVG + E   ++G L   S+ Q++V+S++GMGGIGK+T A++++ DP + S FD   W+ 
Sbjct  1    MVGYNNEQTSMLGQLTGGST-QMEVISVTGMGGIGKSTFAKKLFTDPSVLSFFDTRGWIT  59

Query  284  ASQHQNDRQMLLGLLNSLVYTN----NSSSDEDLSAQLRKTLWGQRY  156
             S++ + R MLL L   +        ++ SD +L+  L++ L G+RY
Sbjct  60   VSENYSYRMMLLALFQYVAIGKEEELDNKSDSELAVCLKQGLMGRRY  106



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 83/163 (51%), Gaps = 23/163 (14%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIK-----NDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEII  432
              Q +E+I ++K E+V++      +D       D  PI+  DS    +++VG D     I
Sbjct  108  FSQIVEEIKSIKSEVVQLFEKKSISDRKFTMPSDFTPIAEEDS----NKLVGLDA---YI  160

Query  431  MGMLIERSSRQL--KVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN------ASQ  276
            + +L + S   L  +V+ I GMGGIGKTTLA RIY DP I   F + AW+        SQ
Sbjct  161  LKLLHQLSGFPLDRQVIPIVGMGGIGKTTLAERIYNDPFIIYHFYVRAWITIPQKHLMSQ  220

Query  275  HQNDRQMLLGLLNSL---VYTNNSSSDEDLSAQLRKTLWGQRY  156
                R+M LGLL       Y  +  S+E+L  ++ K L G RY
Sbjct  221  PYRVREMFLGLLKCFANVTYNTSQMSNEELGEKVYKALKGMRY  263



>ref|XP_009604598.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1252

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVK--IKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEF  441
             +L  +L + +E I  +KEE+ +   KN  ++       PI ++ S   +  +VG +KE 
Sbjct  479  LQLIFLLPRIIEKIKLIKEEVQQKIPKNRGLVVVNSPKKPIEISKSSATSQIIVGFEKET  538

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            + I+  L  +   ++ V+SI GM G+GKTTLA ++Y +  +   FD+ AW    Q +N++
Sbjct  539  KEIISKLT-KGPTEIDVISIVGMPGLGKTTLAYKVYNEKFVVDHFDVRAWCTVDQERNEK  597

Query  260  QMLLGLLNSLV----YTNNSSSDEDLSAQLRKTLWGQRY  156
            ++L  + N ++      N    D+D++ +LRK L G+RY
Sbjct  598  KLLQKIYNQVIGLKERFNEDGIDDDVADKLRKQLCGKRY  636



>gb|AAU93590.2| Late blight resistance protein, putative [Solanum demissum]
Length=1151

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 86/157 (55%), Gaps = 15/157 (10%)
 Frame = -3

Query  584  MEDIDAVKEELVKI------KNDYMLQRTLDVLP--ISLADSFQPA---SEMVGRDKEFE  438
            ++++  +KEE+ KI      K D++L  TLD  P  IS   +  P     E+VG +   E
Sbjct  444  IKEVILIKEEVTKIQEKELFKFDFVLHDTLDTTPAHISSESTNTPRMTDEEVVGFEDVME  503

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
             +   LI R ++QL V+S+ GM G+GKTT+A ++Y D L+ S FD+ A    SQ  + R 
Sbjct  504  KLRDQLI-RGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRS  562

Query  257  MLLGLLNSLV---YTNNSSSDEDLSAQLRKTLWGQRY  156
            +LL +L   +    T    S + L  QLRKTL  +RY
Sbjct  563  VLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRY  599



>ref|XP_006356563.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=1174

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +KE EIIM  LI R +++  ++SI GM G+GKTTLAR++Y +P I + FD+ AW 
Sbjct  437  EVVGFEKEAEIIMMKLI-RGTKERDLISIYGMAGLGKTTLARKVYNNPYIVNHFDVKAWC  495

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
              SQ  N   +L+ +      TN+      ++D++  LR+ L G+RY
Sbjct  496  ALSQVYNRTTLLIEIFKQA--TNDEIEIKEEDDVADMLRRVLIGKRY  540



>gb|ABO93001.1| putative disease resistance protein [Solanum tuberosum]
Length=1208

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 86/157 (55%), Gaps = 15/157 (10%)
 Frame = -3

Query  584  MEDIDAVKEELVKI------KNDYMLQRTLDVLP--ISLADSFQPA---SEMVGRDKEFE  438
            ++++  +KEE+ KI      K D++L  TLD  P  IS   +  P     E+VG +   E
Sbjct  490  IKEVILIKEEVTKIQEKELFKFDFVLHDTLDTTPAHISSESTNTPRMTDEEVVGFEDVME  549

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
             +   LI R ++QL V+S+ GM G+GKTT+A ++Y D L+ S FD+ A    SQ  + R 
Sbjct  550  KLRDQLI-RGTKQLDVISVVGMPGLGKTTVANKLYSDKLVVSRFDICAKCCVSQAYSRRS  608

Query  257  MLLGLLNSLV---YTNNSSSDEDLSAQLRKTLWGQRY  156
            +LL +L   +    T    S + L  QLRKTL  +RY
Sbjct  609  VLLSILRDAIGESPTLTKLSTDVLVDQLRKTLLWKRY  645



>ref|XP_009604596.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604597.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1258

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 88/159 (55%), Gaps = 7/159 (4%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVK--IKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEF  441
             +L  +L + +E I  +KEE+ +   KN  ++       PI ++ S   +  +VG +KE 
Sbjct  485  LQLIFLLPRIIEKIKLIKEEVQQKIPKNRGLVVVNSPKKPIEISKSSATSQIIVGFEKET  544

Query  440  EIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDR  261
            + I+  L  +   ++ V+SI GM G+GKTTLA ++Y +  +   FD+ AW    Q +N++
Sbjct  545  KEIISKLT-KGPTEIDVISIVGMPGLGKTTLAYKVYNEKFVVDHFDVRAWCTVDQERNEK  603

Query  260  QMLLGLLNSLV----YTNNSSSDEDLSAQLRKTLWGQRY  156
            ++L  + N ++      N    D+D++ +LRK L G+RY
Sbjct  604  KLLQKIYNQVIGLKERFNEDGIDDDVADKLRKQLCGKRY  642



>ref|XP_009758242.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009758243.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1269

 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 85/159 (53%), Gaps = 8/159 (5%)
 Frame = -3

Query  614  FKLGLILQQGMEDIDAVKEELVKIKNDYMLQRTLDV-----LPISLADSFQPASEMVGRD  450
             +L  +L   +E I  +KE++  +       R L V      P+ ++ S   +  +VG +
Sbjct  473  LQLIFLLPDTIEKIKLIKEDVFNLVKKSPENRALIVEKSPNKPV-VSKSSIASQVLVGFE  531

Query  449  KEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQ  270
            +E + I+  LI      + V+SI GM G+GKTTLA R+Y D  + S FD+LAW    Q +
Sbjct  532  EERDYIIRKLI-CGPTDIDVISIVGMPGLGKTTLAYRVYNDKSVISHFDILAWCTVDQER  590

Query  269  NDRQMLLGLLNSLVYTNNS-SSDEDLSAQLRKTLWGQRY  156
            N+R +L  + N +  +N   S D D+  +LRK L+G RY
Sbjct  591  NERILLQKIFNQVTNSNEKFSEDIDVVDKLRKKLYGGRY  629



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 85/142 (60%), Gaps = 9/142 (6%)
 Frame = -3

Query  569  AVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGMLIERSSRQLKV  390
             V+ + V+ K D +  + L+   I   D  Q   E++ + K  +I   ++++ SS  L+V
Sbjct  88   VVQSKRVRRKADMIFHQNLEY-AIEEIDLIQ--REVIEKIKVNKIKDRLIVQSSS--LEV  142

Query  389  VSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLNSLVYTNN--  216
            V I GMGGIGKTTLARR+Y D LIA  F + AW N SQ  + R++ LG+L S+   N+  
Sbjct  143  VPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGVVNDEV  202

Query  215  --SSSDEDLSAQLRKTLWGQRY  156
              +S++E L+ ++ ++L G +Y
Sbjct  203  ERNSTNEQLAERVYRSLKGMKY  224



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 63/108 (58%), Gaps = 6/108 (6%)
 Frame = -3

Query  464  MVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVN  285
            +VG D+    +M  L  + S  L ++ I GMGGIGKTTLAR +Y  PLI   FD+ AWV 
Sbjct  183  VVGLDELLIEVMDKLTGQQS-NLHIIPIVGMGGIGKTTLARNVYAKPLIMQHFDIRAWVT  241

Query  284  ASQHQNDRQMLLGLLNSLVYTNNSS-----SDEDLSAQLRKTLWGQRY  156
             SQ+ N +++LL +L  +    N       S+ +L   + KTLWG+RY
Sbjct  242  VSQNYNVQEILLEILLCISKEKNLESLSWMSEGELGETVHKTLWGRRY  289



>ref|XP_010322784.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
isoform X2 [Solanum lycopersicum]
Length=761

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ EIIM  LI R +++  ++SI GM G+GKTTLAR++Y +P I + F++ AW 
Sbjct  31   EVVGFEKDAEIIMKKLI-RGTKERDLISIYGMPGLGKTTLARKVYNNPSIVNYFEVKAWC  89

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
              SQ  N   +L+ +      TN+      D+D++  LRK L G+RY
Sbjct  90   AVSQAYNRSTLLVEIFKQA--TNDKIKIKEDDDVADMLRKVLIGKRY  134



>ref|XP_010320708.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Solanum lycopersicum]
Length=866

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 90/148 (61%), Gaps = 4/148 (3%)
 Frame = -3

Query  596  LQQGMEDIDAVKEELVKIKNDYMLQRTLDVLPISLADSFQPASEMVGRDKEFEIIMGMLI  417
            LQQ   ++D++++E++ I+      +  ++   S + + +  +  VG  K+++ I+  L 
Sbjct  106  LQQVETELDSLRKEVIVIEFHKRGSKLTEITTTSFSSTEE--TTYVGMKKDYKAILNCL-  162

Query  416  ERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQMLLGLLN  237
               +++L V+S+ GMGGIGKTTLAR+++ + +I   F+  AWV  S+  N RQMLL + +
Sbjct  163  NAQTKELIVISLIGMGGIGKTTLARKVFDNSIIRDRFEKHAWVTISEQYNKRQMLLEVAS  222

Query  236  SLVYTNNSS-SDEDLSAQLRKTLWGQRY  156
            S+   NN   S+++L   + ++L G+R+
Sbjct  223  SISGVNNQEMSNDELMVIVYRSLKGRRF  250



>ref|XP_004242254.2| PREDICTED: putative late blight resistance protein homolog R1C-3 
isoform X1 [Solanum lycopersicum]
Length=773

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 67/107 (63%), Gaps = 6/107 (6%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E+VG +K+ EIIM  LI R +++  ++SI GM G+GKTTLAR++Y +P I + F++ AW 
Sbjct  31   EVVGFEKDAEIIMKKLI-RGTKERDLISIYGMPGLGKTTLARKVYNNPSIVNYFEVKAWC  89

Query  287  NASQHQNDRQMLLGLLNSLVYTNNS---SSDEDLSAQLRKTLWGQRY  156
              SQ  N   +L+ +      TN+      D+D++  LRK L G+RY
Sbjct  90   AVSQAYNRSTLLVEIFKQA--TNDKIKIKEDDDVADMLRKVLIGKRY  134



>ref|XP_009769811.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=147

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = -3

Query  467  EMVGRDKEFEIIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWV  288
            E VG + + + I+ +L  R  R+  VVSI GM G+GKTTLA++I++D  + S FD+ AWV
Sbjct  23   EPVGLEDDADKIIKLLT-RGIRERDVVSIFGMPGLGKTTLAKKIFKDSSVVSHFDVRAWV  81

Query  287  NASQHQNDRQMLLGLLNSLVYTNNSSSDEDLSAQLRKTLWGQRY  156
              SQ  + R++L  +   +        + D++  LRK L G+RY
Sbjct  82   TISQSYDVRELLRNIYKQVTGVKYDDGESDIADVLRKCLMGKRY  125



>gb|EYU33966.1| hypothetical protein MIMGU_mgv1a001110mg [Erythranthe guttata]
Length=887

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 93/159 (58%), Gaps = 14/159 (9%)
 Frame = -3

Query  599  ILQQGMEDIDAVKEELVKIKNDYM---LQR---TLDVLPISLADSFQPASEMVGRDKEFE  438
             L++ ++++D +K+E++++K + M   L +   T+D+ P+    + Q A+  VG D   E
Sbjct  99   CLKEVIQEMDFIKKEVMQMKENNMGLFLHKDSSTVDIGPLRSRLTGQNAT--VGFDDVME  156

Query  437  IIMGMLIERSSRQLKVVSISGMGGIGKTTLARRIYRDPLIASSFDLLAWVNASQHQNDRQ  258
             +M ML  R S + +++ I GMGGIGKTTLAR +Y   LI   FD+LAW   SQ  + + 
Sbjct  157  EMMDMLTGRQSTR-QIIPIVGMGGIGKTTLARNLYVSRLIVRHFDMLAWATISQEYSMKG  215

Query  257  MLLGLLNSLVY-----TNNSSSDEDLSAQLRKTLWGQRY  156
            +LL +L  +       T ++  +++L   L KTL G+RY
Sbjct  216  ILLEILLCIKSQESKETYSAMREDELGLVLHKTLIGRRY  254



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2809052750556