BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25828_g2_i2 len=1935 path=[15797:0-475 16272:476-499 20041:500-693
27620:694-695 20237:696-758 20300:759-868 12260:869-892
12284:893-912 8095:913-942 8125:943-969 672:970-978 27873:979-988
27883:989-1007 27902:1008-1010 27911:1011-1013 27914:1014-1019
4428:1020-1049 4458:1050-1112 4521:1113-1176 4585:1177-1934]

Length=1935
                                                                      Score     E

ref|XP_006373160.1|  hypothetical protein POPTR_0017s09230g             483   7e-162   
ref|XP_009762725.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    481   2e-161   
ref|XP_009598808.1|  PREDICTED: cysteine-rich receptor-like prote...    485   9e-161   
ref|XP_006449120.1|  hypothetical protein CICLE_v10014504mg             489   1e-160   
gb|KDO37422.1|  hypothetical protein CISIN_1g005846mg                   488   3e-160   
ref|XP_006467962.1|  PREDICTED: cysteine-rich receptor-like prote...    487   1e-159   
ref|XP_009598807.1|  PREDICTED: cysteine-rich receptor-like prote...    486   2e-159   
ref|XP_008224858.1|  PREDICTED: cysteine-rich receptor-like prote...    475   1e-158   
ref|XP_006449119.1|  hypothetical protein CICLE_v10014496mg             483   2e-158   
ref|XP_007213903.1|  hypothetical protein PRUPE_ppa003904mg             478   3e-158   
ref|XP_006343408.1|  PREDICTED: cysteine-rich receptor-like prote...    481   1e-157   
ref|XP_011010158.1|  PREDICTED: cysteine-rich receptor-like prote...    479   6e-157   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10           479   1e-156   
ref|NP_001238492.1|  cysteine-rich protein precursor                    479   1e-156   
ref|XP_007211369.1|  hypothetical protein PRUPE_ppa002516mg             475   3e-155   
ref|XP_008224765.1|  PREDICTED: cysteine-rich receptor-like prote...    474   9e-155   
ref|XP_002304944.2|  hypothetical protein POPTR_0004s02370g             464   2e-154   Populus trichocarpa [western balsam poplar]
emb|CBI29180.3|  unnamed protein product                                468   2e-154   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...    472   5e-154   
gb|KDP20812.1|  hypothetical protein JCGZ_21283                         471   1e-153   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...    470   3e-153   
ref|XP_006468228.1|  PREDICTED: uncharacterized protein LOC102629057    488   3e-153   
gb|KHG16271.1|  Cysteine-rich receptor-like protein kinase 25           469   6e-153   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...    468   1e-152   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...    469   2e-152   
ref|XP_011007635.1|  PREDICTED: cysteine-rich receptor-like prote...    468   4e-152   
ref|XP_008232237.1|  PREDICTED: cysteine-rich receptor-like prote...    466   6e-152   
ref|XP_010087722.1|  Cysteine-rich receptor-like protein kinase 25      466   2e-151   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g             467   2e-151   
ref|XP_009340923.1|  PREDICTED: cysteine-rich receptor-like prote...    466   2e-151   
ref|XP_009357379.1|  PREDICTED: cysteine-rich receptor-like prote...    465   2e-151   
emb|CDP20318.1|  unnamed protein product                                465   3e-151   
ref|XP_003638035.1|  Cysteine-rich receptor-like protein kinase         463   9e-151   
ref|XP_003637976.1|  Cysteine-rich receptor-like protein kinase         463   1e-150   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...    464   1e-150   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...    463   2e-150   
ref|XP_008224859.1|  PREDICTED: cysteine-rich receptor-like prote...    461   6e-150   
ref|XP_004496789.1|  PREDICTED: cysteine-rich receptor-like prote...    461   7e-150   
ref|XP_004496788.1|  PREDICTED: cysteine-rich receptor-like prote...    461   1e-149   
ref|XP_009357385.1|  PREDICTED: cysteine-rich receptor-like prote...    461   1e-149   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...    461   1e-149   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...    460   2e-149   
ref|XP_009340921.1|  PREDICTED: cysteine-rich receptor-like prote...    460   2e-149   
ref|XP_006383962.1|  hypothetical protein POPTR_0004s02500g             460   2e-149   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...    459   3e-149   
ref|XP_006388606.1|  hypothetical protein POPTR_0138s00200g             454   3e-149   
ref|XP_010646899.1|  PREDICTED: cysteine-rich receptor-like prote...    459   6e-149   
gb|KCW75412.1|  hypothetical protein EUGRSUZ_E04171                     449   6e-149   
ref|XP_002304949.2|  hypothetical protein POPTR_0004s02440g             447   6e-149   Populus trichocarpa [western balsam poplar]
ref|XP_002518553.1|  ATP binding protein, putative                      459   8e-149   Ricinus communis
ref|XP_010648190.1|  PREDICTED: cysteine-rich receptor-like prote...    458   2e-148   
ref|XP_010648189.1|  PREDICTED: cysteine-rich receptor-like prote...    458   2e-148   
emb|CBI35672.3|  unnamed protein product                                458   2e-148   
ref|XP_009357380.1|  PREDICTED: cysteine-rich receptor-like prote...    457   3e-148   
ref|XP_009357560.1|  PREDICTED: cysteine-rich receptor-like prote...    453   4e-148   
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...    456   4e-148   
ref|XP_007214583.1|  hypothetical protein PRUPE_ppa026781mg             456   5e-148   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                     456   5e-148   
emb|CAN72253.1|  hypothetical protein VITISV_034184                     456   6e-148   Vitis vinifera
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...    456   8e-148   
ref|XP_008363779.1|  PREDICTED: cysteine-rich receptor-like prote...    456   1e-147   
ref|XP_002518555.1|  ATP binding protein, putative                      456   1e-147   Ricinus communis
gb|KHN02670.1|  Cysteine-rich receptor-like protein kinase 25           459   1e-147   
ref|XP_004172413.1|  PREDICTED: cysteine-rich receptor-like prote...    455   2e-147   
ref|XP_004153532.1|  PREDICTED: cysteine-rich receptor-like prote...    455   2e-147   
ref|XP_006590217.1|  PREDICTED: cysteine-rich receptor-like prote...    463   3e-147   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...    455   5e-147   
ref|XP_008224863.1|  PREDICTED: uncharacterized protein LOC103324571    473   5e-147   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...    453   5e-147   
ref|XP_006606024.1|  PREDICTED: serine/threonine kinase-related p...    454   5e-147   
ref|XP_008370580.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    454   6e-147   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...    454   9e-147   
ref|XP_010057978.1|  PREDICTED: cysteine-rich receptor-like prote...    453   1e-146   
ref|XP_011002059.1|  PREDICTED: cysteine-rich receptor-like prote...    453   2e-146   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...    452   2e-146   
gb|KHG26430.1|  Cysteine-rich receptor-like protein kinase 10           452   3e-146   
ref|XP_010057980.1|  PREDICTED: putative receptor-like protein ki...    451   3e-146   
ref|XP_009364708.1|  PREDICTED: cysteine-rich receptor-like prote...    451   4e-146   
gb|KHN15823.1|  Cysteine-rich receptor-like protein kinase 10           450   1e-145   
gb|KHN15824.1|  Cysteine-rich receptor-like protein kinase 10           451   1e-145   
ref|XP_009338745.1|  PREDICTED: cysteine-rich receptor-like prote...    450   1e-145   
ref|XP_009338737.1|  PREDICTED: cysteine-rich receptor-like prote...    450   1e-145   
ref|XP_006606025.1|  PREDICTED: cysteine-rich receptor-like prote...    449   2e-145   
gb|KFK22120.1|  hypothetical protein AALP_AAs48628U000100               439   3e-145   
ref|XP_009340924.1|  PREDICTED: cysteine-rich receptor-like prote...    450   4e-145   
ref|XP_006291260.1|  hypothetical protein CARUB_v10017391mg             439   4e-145   
ref|XP_010247616.1|  PREDICTED: cysteine-rich receptor-like prote...    449   5e-145   
ref|XP_009364729.1|  PREDICTED: cysteine-rich receptor-like prote...    447   8e-145   
ref|XP_007143184.1|  hypothetical protein PHAVU_007G050600g             448   1e-144   
ref|XP_011002057.1|  PREDICTED: cysteine-rich receptor-like prote...    447   1e-144   
ref|XP_006383965.1|  hypothetical protein POPTR_0004s02530g             448   1e-144   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...    446   3e-144   
ref|XP_010686954.1|  PREDICTED: cysteine-rich receptor-like prote...    446   7e-144   
ref|XP_006291259.1|  hypothetical protein CARUB_v10017391mg             436   8e-144   
gb|KCW75002.1|  hypothetical protein EUGRSUZ_E03765                     447   1e-143   
ref|XP_006413571.1|  hypothetical protein EUTSA_v10024630mg             445   1e-143   
ref|XP_004496786.1|  PREDICTED: cysteine-rich receptor-like prote...    444   1e-143   
ref|XP_010655950.1|  PREDICTED: cysteine-rich receptor-like prote...    445   2e-143   
ref|XP_010059664.1|  PREDICTED: cysteine-rich receptor-like prote...    456   2e-143   
ref|XP_004496787.1|  PREDICTED: cysteine-rich receptor-like prote...    444   2e-143   
ref|XP_004496785.1|  PREDICTED: cysteine-rich receptor-like prote...    445   2e-143   
ref|XP_003592436.1|  Cysteine-rich receptor-like protein kinase         445   2e-143   
ref|XP_007025935.1|  Cysteine-rich RLK 29, putative isoform 1           444   2e-143   
gb|KCW75005.1|  hypothetical protein EUGRSUZ_E03767                     433   3e-143   
emb|CDP16212.1|  unnamed protein product                                435   3e-143   
gb|KCW75004.1|  hypothetical protein EUGRSUZ_E03766                     444   4e-143   
ref|XP_010439209.1|  PREDICTED: cysteine-rich receptor-like prote...    444   4e-143   
ref|XP_006449133.1|  hypothetical protein CICLE_v10014789mg             439   6e-143   
ref|XP_009136824.1|  PREDICTED: putative cysteine-rich receptor-l...    443   6e-143   
ref|XP_007025937.1|  Cysteine-rich RLK 29, putative                     443   8e-143   
gb|KFK23238.1|  hypothetical protein AALP_AAs43447U000100               440   8e-143   
emb|CBI23395.3|  unnamed protein product                                432   1e-142   
ref|XP_010057272.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-142   
gb|KDP20816.1|  hypothetical protein JCGZ_21287                         442   2e-142   
ref|XP_009136831.1|  PREDICTED: putative cysteine-rich receptor-l...    442   2e-142   
emb|CDP19430.1|  unnamed protein product                                432   3e-142   
ref|XP_010448769.1|  PREDICTED: cysteine-rich receptor-like prote...    441   3e-142   
ref|XP_010439210.1|  PREDICTED: cysteine-rich receptor-like prote...    440   3e-142   
ref|XP_004153962.1|  PREDICTED: cysteine-rich receptor-like prote...    440   4e-142   
ref|XP_006383968.1|  hypothetical protein POPTR_0004s02560g             439   6e-142   
ref|XP_006605283.1|  PREDICTED: serine/threonine kinase-like prot...    440   6e-142   
emb|CBI35335.3|  unnamed protein product                                445   6e-142   
ref|XP_009136929.1|  PREDICTED: cysteine-rich receptor-like prote...    441   7e-142   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...    441   7e-142   
ref|XP_006285944.1|  hypothetical protein CARUB_v10007464mg             441   8e-142   
emb|CDP11363.1|  unnamed protein product                                441   8e-142   
gb|KFK28891.1|  hypothetical protein AALP_AA7G061600                    436   9e-142   
ref|XP_010433941.1|  PREDICTED: cysteine-rich receptor-like prote...    440   9e-142   
emb|CDP04899.1|  unnamed protein product                                439   1e-141   
ref|XP_011004252.1|  PREDICTED: putative receptor-like protein ki...    440   1e-141   
gb|KEH43944.1|  cysteine-rich receptor-kinase-like protein              440   1e-141   
gb|KEH43945.1|  cysteine-rich receptor-kinase-like protein              439   1e-141   
ref|XP_010059122.1|  PREDICTED: cysteine-rich receptor-like prote...    431   1e-141   
ref|XP_002877439.1|  hypothetical protein ARALYDRAFT_484965             440   2e-141   
gb|AAN60348.1|  unknown                                                 439   2e-141   Arabidopsis thaliana [mouse-ear cress]
gb|KEH43943.1|  cysteine-rich receptor-kinase-like protein              439   2e-141   
ref|XP_003592434.1|  Cysteine-rich receptor-like protein kinase         444   2e-141   
gb|KDO75602.1|  hypothetical protein CISIN_1g006155mg                   439   3e-141   
emb|CDY41246.1|  BnaA01g12930D                                          439   3e-141   
ref|XP_003556004.1|  PREDICTED: cysteine-rich receptor-like prote...    439   4e-141   
ref|NP_567679.2|  cysteine-rich receptor-like protein kinase 10         439   4e-141   Arabidopsis thaliana [mouse-ear cress]
emb|CAA18465.1|  serine/threonine kinase-like protein                   437   4e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004496761.1|  PREDICTED: cysteine-rich receptor-like prote...    439   4e-141   
ref|XP_003635675.2|  PREDICTED: cysteine-rich receptor-like prote...    428   4e-141   
ref|XP_006283283.1|  hypothetical protein CARUB_v10004319mg             437   9e-141   
ref|XP_008446411.1|  PREDICTED: cysteine-rich receptor-like prote...    453   9e-141   
ref|XP_004496792.1|  PREDICTED: cysteine-rich receptor-like prote...    437   2e-140   
ref|XP_002869784.1|  hypothetical protein ARALYDRAFT_492546             436   2e-140   
ref|XP_010448768.1|  PREDICTED: cysteine-rich receptor-like prote...    436   2e-140   
ref|XP_002518561.1|  ATP binding protein, putative                      435   3e-140   Ricinus communis
ref|XP_009136817.1|  PREDICTED: putative cysteine-rich receptor-l...    440   3e-140   
ref|XP_010052297.1|  PREDICTED: cysteine-rich receptor-like prote...    436   3e-140   
gb|KCW75006.1|  hypothetical protein EUGRSUZ_E03770                     437   3e-140   
gb|KCW75009.1|  hypothetical protein EUGRSUZ_E037791                    427   3e-140   
gb|AAK28315.1|AF224705_1  receptor-like protein kinase 4                436   4e-140   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283285.1|  hypothetical protein CARUB_v10004321mg             436   4e-140   
emb|CDX79132.1|  BnaA01g11990D                                          435   6e-140   
gb|KCW74362.1|  hypothetical protein EUGRSUZ_E03041                     436   7e-140   
ref|XP_007025946.1|  Cysteine-rich protein, putative                    435   7e-140   
ref|XP_010686956.1|  PREDICTED: cysteine-rich receptor-like prote...    435   8e-140   
gb|KEH43947.1|  cysteine-rich receptor-kinase-like protein              435   9e-140   
ref|XP_006606026.1|  PREDICTED: cysteine-rich receptor-like prote...    433   1e-139   
gb|KFK30803.1|  hypothetical protein AALP_AA6G028000                    432   1e-139   
ref|XP_011004253.1|  PREDICTED: cysteine-rich receptor-like prote...    434   1e-139   
emb|CBI39033.3|  unnamed protein product                                433   1e-139   
ref|XP_008377958.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    424   1e-139   
emb|CDY10872.1|  BnaC01g14870D                                          432   1e-139   
gb|KCW75430.1|  hypothetical protein EUGRSUZ_E041921                    425   2e-139   
ref|XP_010439212.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-139   
ref|XP_010655874.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-139   
gb|KCW75425.1|  hypothetical protein EUGRSUZ_E04185                     434   2e-139   
ref|XP_010540876.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-139   
ref|XP_002271125.3|  PREDICTED: cysteine-rich receptor-like prote...    435   2e-139   Vitis vinifera
gb|KDP20815.1|  hypothetical protein JCGZ_21286                         434   2e-139   
ref|XP_010247622.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-139   
ref|XP_010059679.1|  PREDICTED: cysteine-rich receptor-like prote...    433   2e-139   
ref|XP_010529370.1|  PREDICTED: cysteine-rich receptor-like prote...    434   2e-139   
ref|XP_010059687.1|  PREDICTED: cysteine-rich receptor-like prote...    423   3e-139   
ref|XP_011004254.1|  PREDICTED: putative receptor-like protein ki...    432   3e-139   
ref|XP_009135684.1|  PREDICTED: putative cysteine-rich receptor-l...    433   3e-139   
emb|CDY67333.1|  BnaAnng24050D                                          437   3e-139   
ref|XP_007011084.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    433   4e-139   
ref|XP_009137321.1|  PREDICTED: cysteine-rich receptor-like prote...    433   5e-139   
ref|XP_003635466.1|  PREDICTED: putative receptor-like protein ki...    433   8e-139   
ref|XP_006287218.1|  hypothetical protein CARUB_v10000395mg             432   9e-139   
ref|NP_190172.1|  cysteine-rich receptor-like protein kinase 4          433   9e-139   Arabidopsis thaliana [mouse-ear cress]
emb|CDX76348.1|  BnaA08g10520D                                          432   9e-139   
gb|KCW76230.1|  hypothetical protein EUGRSUZ_D00611                     433   1e-138   
ref|XP_002867728.1|  predicted protein                                  432   1e-138   
ref|XP_010426013.1|  PREDICTED: cysteine-rich receptor-like prote...    432   1e-138   
ref|XP_010059683.1|  PREDICTED: putative cysteine-rich receptor-l...    433   1e-138   
emb|CDX94167.1|  BnaC07g38010D                                          432   1e-138   
ref|XP_009137317.1|  PREDICTED: cysteine-rich receptor-like prote...    432   1e-138   
ref|XP_010529574.1|  PREDICTED: cysteine-rich receptor-like prote...    432   1e-138   
ref|XP_010529575.1|  PREDICTED: cysteine-rich receptor-like prote...    432   1e-138   
ref|XP_003637975.1|  Cysteine-rich receptor-like protein kinase         432   1e-138   
emb|CDP04752.1|  unnamed protein product                                432   2e-138   
ref|XP_010059522.1|  PREDICTED: cysteine-rich receptor-like prote...    431   2e-138   
ref|XP_010089690.1|  Cysteine-rich receptor-like protein kinase 10      421   2e-138   
ref|XP_009124034.1|  PREDICTED: cysteine-rich receptor-like prote...    432   2e-138   
ref|XP_009367024.1|  PREDICTED: cysteine-rich receptor-like prote...    432   3e-138   
gb|KHN01543.1|  Cysteine-rich receptor-like protein kinase 29           427   3e-138   
ref|XP_010059516.1|  PREDICTED: putative receptor-like protein ki...    430   3e-138   
ref|XP_010267893.1|  PREDICTED: uncharacterized protein LOC104604997    449   3e-138   
ref|XP_008370321.1|  PREDICTED: cysteine-rich receptor-like prote...    431   4e-138   
ref|XP_010451243.1|  PREDICTED: cysteine-rich receptor-like prote...    422   4e-138   
ref|XP_010433932.1|  PREDICTED: cysteine-rich receptor-like prote...    431   4e-138   
gb|KDP20807.1|  hypothetical protein JCGZ_21278                         437   4e-138   
ref|XP_003555319.1|  PREDICTED: cysteine-rich receptor-like prote...    431   5e-138   
ref|XP_010052442.1|  PREDICTED: cysteine-rich receptor-like prote...    420   5e-138   
ref|XP_004496793.1|  PREDICTED: cysteine-rich receptor-like prote...    429   5e-138   
ref|XP_011076612.1|  PREDICTED: putative receptor-like protein ki...    431   6e-138   
ref|XP_006606016.1|  PREDICTED: cysteine-rich receptor-like prote...    431   6e-138   
gb|KCW61422.1|  hypothetical protein EUGRSUZ_H04149                     424   6e-138   
ref|XP_010433930.1|  PREDICTED: cysteine-rich receptor-like prote...    430   6e-138   
gb|KCW75014.1|  hypothetical protein EUGRSUZ_E03789                     423   6e-138   
ref|XP_006373159.1|  hypothetical protein POPTR_0017s09230g             418   7e-138   
emb|CDP04893.1|  unnamed protein product                                426   7e-138   
ref|XP_003635656.2|  PREDICTED: cysteine-rich receptor-like prote...    419   9e-138   
ref|XP_010052444.1|  PREDICTED: cysteine-rich receptor-like prote...    430   9e-138   
ref|XP_010089688.1|  Cysteine-rich receptor-like protein kinase 29      430   9e-138   
ref|XP_010448770.1|  PREDICTED: cysteine-rich receptor-like prote...    428   9e-138   
ref|XP_006413576.1|  hypothetical protein EUTSA_v10024603mg             430   1e-137   
emb|CDP20316.1|  unnamed protein product                                430   1e-137   
ref|XP_006413566.1|  hypothetical protein EUTSA_v10024631mg             429   1e-137   
ref|NP_849425.1|  cysteine-rich receptor-like protein kinase 5          429   1e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010059677.1|  PREDICTED: cysteine-rich receptor-like prote...    430   1e-137   
ref|XP_006283286.1|  hypothetical protein CARUB_v10004325mg             429   1e-137   
ref|XP_008371138.1|  PREDICTED: cysteine-rich receptor-like prote...    430   1e-137   
ref|XP_007213610.1|  hypothetical protein PRUPE_ppa002309mg             430   2e-137   
ref|XP_010052446.1|  PREDICTED: cysteine-rich receptor-like prote...    429   2e-137   
ref|XP_010448725.1|  PREDICTED: cysteine-rich receptor-like prote...    429   2e-137   
ref|XP_010503062.1|  PREDICTED: cysteine-rich receptor-like prote...    423   2e-137   
emb|CDY10928.1|  BnaA03g45870D                                          429   2e-137   
ref|XP_002867729.1|  cysteine-rich rlk5                                 429   2e-137   
gb|KCW75423.1|  hypothetical protein EUGRSUZ_E04183                     427   3e-137   
emb|CDP16211.1|  unnamed protein product                                429   3e-137   
ref|XP_010057979.1|  PREDICTED: cysteine-rich receptor-like prote...    429   3e-137   
gb|KEH40076.1|  cysteine-rich receptor-kinase-like protein              429   4e-137   
ref|XP_010646639.1|  PREDICTED: putative receptor-like protein ki...    429   4e-137   
ref|NP_194058.2|  cysteine-rich receptor-like protein kinase 19         427   4e-137   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451228.1|  PREDICTED: cysteine-rich receptor-like prote...    429   5e-137   
ref|XP_008377957.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    426   5e-137   
gb|KCW76436.1|  hypothetical protein EUGRSUZ_D00827                     427   5e-137   
ref|XP_009631896.1|  PREDICTED: putative receptor-like protein ki...    428   6e-137   
ref|XP_002316621.2|  hypothetical protein POPTR_0011s03270g             428   8e-137   Populus trichocarpa [western balsam poplar]
ref|XP_006413570.1|  hypothetical protein EUTSA_v10024606mg             427   8e-137   
ref|XP_010529555.1|  PREDICTED: cysteine-rich receptor-like prote...    427   8e-137   
gb|KHN01547.1|  Cysteine-rich receptor-like protein kinase 29           427   1e-136   
ref|XP_009108591.1|  PREDICTED: cysteine-rich receptor-like prote...    427   1e-136   
ref|XP_004496794.1|  PREDICTED: cysteine-rich receptor-like prote...    424   1e-136   
ref|XP_004145170.1|  PREDICTED: polygalacturonase-like                  448   1e-136   
ref|XP_010433931.1|  PREDICTED: cysteine-rich receptor-like prote...    427   1e-136   
ref|NP_194059.1|  putative cysteine-rich receptor-like protein ki...    427   1e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686955.1|  PREDICTED: cysteine-rich receptor-like prote...    427   1e-136   
ref|NP_567677.1|  cysteine-rich receptor-like protein kinase 5          426   2e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136890.1|  PREDICTED: cysteine-rich receptor-like prote...    427   2e-136   
ref|XP_007025939.1|  Cysteine-rich RLK 29                               444   2e-136   
ref|XP_010448724.1|  PREDICTED: cysteine-rich receptor-like prote...    427   2e-136   
emb|CDX94165.1|  BnaC07g37990D                                          426   2e-136   
ref|XP_010412576.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    426   2e-136   
gb|KCW74344.1|  hypothetical protein EUGRSUZ_E03020                     426   2e-136   
gb|KFK28848.1|  hypothetical protein AALP_AA7G056300                    426   2e-136   
ref|XP_009136737.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    426   2e-136   
gb|KFK28849.1|  hypothetical protein AALP_AA7G056300                    426   2e-136   
ref|XP_010059682.1|  PREDICTED: putative receptor-like protein ki...    426   2e-136   
ref|XP_010247032.1|  PREDICTED: uncharacterized protein LOC104590182    442   2e-136   
sp|O65479.2|CRK20_ARATH  RecName: Full=Putative cysteine-rich rec...    426   2e-136   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30804.1|  hypothetical protein AALP_AA6G028100                    426   3e-136   
ref|XP_006413575.1|  hypothetical protein EUTSA_v10024643mg             426   3e-136   
ref|XP_010059142.1|  PREDICTED: putative cysteine-rich receptor-l...    427   3e-136   
gb|KCW75422.1|  hypothetical protein EUGRSUZ_E04182                     415   3e-136   
ref|XP_008364117.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    427   3e-136   
ref|XP_006284972.1|  hypothetical protein CARUB_v10006279mg             426   3e-136   
ref|XP_010059117.1|  PREDICTED: cysteine-rich receptor-like prote...    424   3e-136   
emb|CDX76944.1|  BnaC08g35300D                                          425   4e-136   
ref|XP_010027129.1|  PREDICTED: cysteine-rich receptor-like prote...    424   4e-136   
gb|KCW74323.1|  hypothetical protein EUGRSUZ_E02985                     416   5e-136   
ref|XP_010448756.1|  PREDICTED: cysteine-rich receptor-like prote...    425   6e-136   
ref|XP_010448757.1|  PREDICTED: cysteine-rich receptor-like prote...    425   7e-136   
emb|CDP11364.1|  unnamed protein product                                416   7e-136   
ref|XP_010059510.1|  PREDICTED: uncharacterized protein LOC104447479    442   7e-136   
ref|XP_003635677.2|  PREDICTED: putative receptor-like protein ki...    426   7e-136   
ref|XP_010646640.1|  PREDICTED: putative receptor-like protein ki...    425   7e-136   
emb|CAN74851.1|  hypothetical protein VITISV_019620                     430   8e-136   
ref|NP_001237891.1|  serine/threonine kinase-like protein precursor     422   9e-136   
ref|XP_004496790.1|  PREDICTED: cysteine-rich receptor-like prote...    424   9e-136   
gb|KFK30809.1|  hypothetical protein AALP_AA6G028600                    420   9e-136   
ref|XP_011096160.1|  PREDICTED: cysteine-rich receptor-like prote...    441   1e-135   
emb|CAA18460.1|  protein kinase-like protein                            424   1e-135   
ref|XP_010686952.1|  PREDICTED: putative receptor-like protein ki...    424   1e-135   
gb|KCW76440.1|  hypothetical protein EUGRSUZ_D00831                     423   1e-135   
ref|XP_010451231.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    424   1e-135   
ref|XP_006413574.1|  hypothetical protein EUTSA_v10024843mg             421   1e-135   
ref|XP_006606014.1|  PREDICTED: cysteine-rich receptor-like prote...    424   1e-135   
gb|KCW74840.1|  hypothetical protein EUGRSUZ_E03575                     416   1e-135   
ref|XP_009136899.1|  PREDICTED: cysteine-rich receptor-like prote...    424   1e-135   
ref|XP_010439226.1|  PREDICTED: cysteine-rich receptor-like prote...    424   1e-135   
gb|KHN01554.1|  Cysteine-rich receptor-like protein kinase 29           424   2e-135   
ref|XP_010686970.1|  PREDICTED: putative receptor-like protein ki...    424   2e-135   
ref|XP_010433938.1|  PREDICTED: cysteine-rich receptor-like prote...    425   2e-135   
ref|XP_007025943.1|  Cysteine-rich protein, putative isoform 1          424   2e-135   
gb|KCW74340.1|  hypothetical protein EUGRSUZ_E03013                     413   2e-135   
ref|XP_010529578.1|  PREDICTED: putative cysteine-rich receptor-l...    424   2e-135   
ref|XP_010439220.1|  PREDICTED: cysteine-rich receptor-like prote...    425   2e-135   
ref|XP_010439218.1|  PREDICTED: cysteine-rich receptor-like prote...    423   2e-135   
ref|XP_010686957.1|  PREDICTED: putative receptor-like protein ki...    424   2e-135   
ref|NP_194050.2|  cysteine-rich receptor-like protein kinase 11         424   3e-135   
gb|KCW45414.1|  hypothetical protein EUGRSUZ_L00892                     422   3e-135   
emb|CDO99704.1|  unnamed protein product                                440   3e-135   
ref|XP_007143171.1|  hypothetical protein PHAVU_007G049600g             424   3e-135   
ref|XP_010052445.1|  PREDICTED: cysteine-rich receptor-like prote...    423   3e-135   
ref|XP_010059124.1|  PREDICTED: cysteine-rich receptor-like prote...    412   4e-135   
ref|XP_006606015.1|  PREDICTED: cysteine-rich receptor-like prote...    424   4e-135   
ref|XP_007025922.1|  Cysteine-rich RLK 29, putative isoform 1           424   4e-135   
emb|CDY51977.1|  BnaC06g41760D                                          423   4e-135   
emb|CDY10846.1|  BnaC01g14610D                                          423   4e-135   
gb|KDP20811.1|  hypothetical protein JCGZ_21282                         439   4e-135   
gb|KCW76434.1|  hypothetical protein EUGRSUZ_D00822                     421   4e-135   
ref|XP_006283252.1|  hypothetical protein CARUB_v10004288mg             423   4e-135   
ref|XP_010433937.1|  PREDICTED: cysteine-rich receptor-like prote...    425   4e-135   
ref|XP_007143185.1|  hypothetical protein PHAVU_007G050700g             422   5e-135   
ref|XP_008355943.1|  PREDICTED: cysteine-rich receptor-like prote...    411   5e-135   
ref|XP_010529593.1|  PREDICTED: cysteine-rich receptor-like prote...    423   5e-135   
ref|XP_010529591.1|  PREDICTED: putative cysteine-rich receptor-l...    417   5e-135   
ref|XP_010439222.1|  PREDICTED: cysteine-rich receptor-like prote...    424   5e-135   
ref|XP_008371201.1|  PREDICTED: cysteine-rich receptor-like prote...    423   5e-135   
ref|XP_010054426.1|  PREDICTED: putative cysteine-rich receptor-l...    420   5e-135   
emb|CAB78196.1|  serine/threonine kinase-like protein (fragment)        422   6e-135   
ref|XP_007025923.1|  Cysteine-rich RLK 29, putative isoform 2           423   6e-135   
ref|XP_009631897.1|  PREDICTED: cysteine-rich receptor-like prote...    421   6e-135   
ref|NP_192890.4|  putative cysteine-rich receptor-like protein ki...    422   7e-135   
ref|XP_008224864.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    436   7e-135   
ref|XP_010530411.1|  PREDICTED: putative cysteine-rich receptor-l...    422   7e-135   
ref|XP_010448301.1|  PREDICTED: cysteine-rich receptor-like prote...    423   7e-135   
ref|XP_010267803.1|  PREDICTED: cysteine-rich receptor-like prote...    422   7e-135   
ref|XP_010040185.1|  PREDICTED: putative receptor-like protein ki...    422   7e-135   
gb|KHN02668.1|  Cysteine-rich receptor-like protein kinase 29           419   8e-135   
ref|XP_009357381.1|  PREDICTED: cysteine-rich receptor-like prote...    422   8e-135   
ref|XP_010267802.1|  PREDICTED: putative receptor-like protein ki...    422   8e-135   
gb|KFK26013.1|  hypothetical protein AALP_AA8G191500                    422   8e-135   
ref|XP_010448755.1|  PREDICTED: cysteine-rich receptor-like prote...    424   1e-134   
gb|AAD21872.1|  receptor-like protein kinase homolog RK20-1             422   1e-134   
ref|XP_009347948.1|  PREDICTED: cysteine-rich receptor-like prote...    412   1e-134   
ref|XP_006413567.1|  hypothetical protein EUTSA_v10024894mg             417   1e-134   
ref|NP_192429.1|  cysteine-rich receptor-like protein kinase 25         422   1e-134   
gb|KHN02669.1|  Cysteine-rich receptor-like protein kinase 29           419   1e-134   
ref|XP_008355945.1|  PREDICTED: cysteine-rich receptor-like prote...    422   1e-134   
ref|XP_007143168.1|  hypothetical protein PHAVU_007G049400g             422   1e-134   
ref|XP_008345852.1|  PREDICTED: cysteine-rich receptor-like prote...    422   1e-134   
ref|XP_009136761.1|  PREDICTED: cysteine-rich receptor-like prote...    422   1e-134   
gb|KHN01545.1|  Cysteine-rich receptor-like protein kinase 29           419   2e-134   
gb|EYU23764.1|  hypothetical protein MIMGU_mgv1a019802mg                412   2e-134   
emb|CAA09731.1|  receptor-like protein kinase, RLK3                     421   2e-134   
ref|XP_010112670.1|  Cysteine-rich receptor-like protein kinase 29      421   2e-134   
ref|XP_007214635.1|  hypothetical protein PRUPE_ppa001541mg             426   2e-134   
ref|XP_009108593.1|  PREDICTED: cysteine-rich receptor-like prote...    422   2e-134   
emb|CDY41272.1|  BnaA01g12670D                                          419   2e-134   
ref|XP_010503063.1|  PREDICTED: putative cysteine-rich receptor-l...    421   2e-134   
ref|XP_010540935.1|  PREDICTED: putative cysteine-rich receptor-l...    418   2e-134   
ref|XP_003536563.1|  PREDICTED: cysteine-rich receptor-like prote...    421   2e-134   
ref|XP_010448726.1|  PREDICTED: putative cysteine-rich receptor-l...    421   3e-134   
ref|XP_006283145.1|  hypothetical protein CARUB_v10004176mg             425   3e-134   
emb|CDP11362.1|  unnamed protein product                                420   3e-134   
ref|XP_007143188.1|  hypothetical protein PHAVU_007G051000g             421   3e-134   
ref|XP_010529586.1|  PREDICTED: putative cysteine-rich receptor-l...    420   4e-134   
ref|XP_009112727.1|  PREDICTED: cysteine-rich receptor-like prote...    420   4e-134   
ref|XP_007143162.1|  hypothetical protein PHAVU_007G049100g             421   5e-134   
ref|XP_003635322.2|  PREDICTED: cysteine-rich receptor-like prote...    435   6e-134   
gb|KHN15830.1|  Cysteine-rich receptor-like protein kinase 25           420   6e-134   
ref|XP_010057983.1|  PREDICTED: cysteine-rich receptor-like prote...    420   6e-134   
ref|XP_010433929.1|  PREDICTED: cysteine-rich receptor-like prote...    420   6e-134   
ref|XP_002872592.1|  predicted protein                                  420   6e-134   
ref|XP_010059133.1|  PREDICTED: putative cysteine-rich receptor-l...    416   6e-134   
ref|XP_010529585.1|  PREDICTED: putative cysteine-rich receptor-l...    419   6e-134   
gb|KFK30807.1|  hypothetical protein AALP_AA6G028400                    420   7e-134   
gb|KCW76439.1|  hypothetical protein EUGRSUZ_D00830                     417   7e-134   
ref|XP_009136747.1|  PREDICTED: cysteine-rich receptor-like prote...    420   7e-134   
ref|XP_010540909.1|  PREDICTED: cysteine-rich receptor-like prote...    419   9e-134   
ref|XP_009136754.1|  PREDICTED: cysteine-rich receptor-like prote...    419   9e-134   
ref|XP_006468226.1|  PREDICTED: uncharacterized protein LOC102628483    437   1e-133   
emb|CDY41373.1|  BnaC03g65180D                                          419   1e-133   
ref|XP_006589610.1|  PREDICTED: cysteine-rich receptor-like prote...    419   1e-133   
emb|CDY41244.1|  BnaA01g12950D                                          436   1e-133   
gb|KHN01542.1|  Cysteine-rich receptor-like protein kinase 10           415   1e-133   
gb|KHN15821.1|  Cysteine-rich receptor-like protein kinase 25           417   1e-133   
ref|XP_010540927.1|  PREDICTED: cysteine-rich receptor-like prote...    417   1e-133   
ref|XP_010529589.1|  PREDICTED: putative cysteine-rich receptor-l...    419   1e-133   
ref|XP_010267801.1|  PREDICTED: cysteine-rich receptor-like prote...    417   1e-133   
ref|XP_010514748.1|  PREDICTED: cysteine-rich receptor-like prote...    418   1e-133   
ref|XP_006413569.1|  hypothetical protein EUTSA_v10024579mg             420   1e-133   
gb|KFK30805.1|  hypothetical protein AALP_AA6G028200                    414   2e-133   
ref|XP_010540959.1|  PREDICTED: cysteine-rich receptor-like prote...    418   2e-133   
emb|CDY41247.1|  BnaA01g12920D                                          419   2e-133   
ref|XP_010540918.1|  PREDICTED: cysteine-rich receptor-like prote...    418   2e-133   
gb|KCW61423.1|  hypothetical protein EUGRSUZ_H04150                     419   2e-133   
gb|KHN15822.1|  Cysteine-rich receptor-like protein kinase 25           424   2e-133   
ref|XP_010540946.1|  PREDICTED: cysteine-rich receptor-like prote...    418   2e-133   
ref|XP_002304956.2|  hypothetical protein POPTR_0004s02490g             407   2e-133   
emb|CDY41372.1|  BnaC03g65170D                                          419   2e-133   
ref|XP_010439190.1|  PREDICTED: cysteine-rich receptor-like prote...    422   2e-133   
ref|XP_007206688.1|  hypothetical protein PRUPE_ppa022095mg             420   2e-133   
ref|XP_006285954.1|  hypothetical protein CARUB_v10007481mg             418   2e-133   
ref|XP_010267800.1|  PREDICTED: putative receptor-like protein ki...    418   2e-133   
ref|XP_003556008.1|  PREDICTED: cysteine-rich receptor-like prote...    419   3e-133   
gb|KFK31914.1|  hypothetical protein AALP_AA6G175100                    412   3e-133   
gb|KHN15819.1|  Cysteine-rich receptor-like protein kinase 25           416   3e-133   
ref|XP_006283274.1|  hypothetical protein CARUB_v10004309mg             418   3e-133   
emb|CDY10922.1|  BnaA03g45810D                                          417   3e-133   
ref|XP_010436424.1|  PREDICTED: putative cysteine-rich receptor-l...    429   3e-133   
ref|XP_009137318.1|  PREDICTED: cysteine-rich receptor-like prote...    417   3e-133   
ref|XP_010054425.1|  PREDICTED: cysteine-rich receptor-like prote...    407   3e-133   
ref|XP_010529590.1|  PREDICTED: putative cysteine-rich receptor-l...    418   3e-133   
ref|XP_010057674.1|  PREDICTED: putative receptor-like protein ki...    418   4e-133   
gb|KHN01541.1|  Cysteine-rich receptor-like protein kinase 25           414   4e-133   
ref|XP_008355938.1|  PREDICTED: cysteine-rich receptor-like prote...    412   4e-133   
ref|XP_006383960.1|  hypothetical protein POPTR_0004s02460g             406   4e-133   
emb|CDY55819.1|  BnaCnng29220D                                          419   4e-133   
ref|XP_006590220.1|  PREDICTED: cysteine-rich receptor-like prote...    418   4e-133   
ref|XP_007226138.1|  hypothetical protein PRUPE_ppa014741mg             418   5e-133   
ref|XP_009114807.1|  PREDICTED: cysteine-rich receptor-like prote...    418   5e-133   
ref|XP_010087724.1|  Cysteine-rich receptor-like protein kinase 25      430   5e-133   
ref|XP_010448744.1|  PREDICTED: cysteine-rich receptor-like prote...    417   6e-133   
ref|XP_006282816.1|  hypothetical protein CARUB_v10006547mg             417   6e-133   
ref|XP_008365742.1|  PREDICTED: putative receptor-like protein ki...    409   7e-133   
ref|XP_006283340.1|  hypothetical protein CARUB_v10004380mg             416   7e-133   
ref|XP_010514747.1|  PREDICTED: cysteine-rich receptor-like prote...    417   7e-133   
ref|XP_009617477.1|  PREDICTED: cysteine-rich receptor-like prote...    408   7e-133   
ref|XP_010529592.1|  PREDICTED: cysteine-rich receptor-like prote...    417   8e-133   
emb|CDY68744.1|  BnaCnng60310D                                          417   8e-133   
ref|XP_007143160.1|  hypothetical protein PHAVU_007G048900g             417   8e-133   
gb|AES98408.2|  cysteine-rich receptor-kinase-like protein              417   8e-133   
gb|EYU23766.1|  hypothetical protein MIMGU_mgv1a021757mg                408   9e-133   
ref|NP_194046.2|  cysteine-rich receptor-like protein kinase 7          417   1e-132   
ref|XP_007143203.1|  hypothetical protein PHAVU_007G052500g             417   1e-132   
ref|XP_007025925.1|  Cysteine-rich RLK 29, putative isoform 1           416   1e-132   
ref|XP_008371130.1|  PREDICTED: cysteine-rich receptor-like prote...    407   1e-132   
gb|KCW76455.1|  hypothetical protein EUGRSUZ_D00848                     414   2e-132   
ref|XP_003615455.1|  Cysteine-rich receptor-like protein kinase         416   2e-132   
ref|XP_010448752.1|  PREDICTED: cysteine-rich receptor-like prote...    416   2e-132   
ref|XP_007143159.1|  hypothetical protein PHAVU_007G048800g             416   2e-132   
gb|KHN02663.1|  Cysteine-rich receptor-like protein kinase 29           415   2e-132   
gb|KCW76451.1|  hypothetical protein EUGRSUZ_D00843                     416   2e-132   
ref|XP_002867727.1|  predicted protein                                  416   2e-132   
ref|XP_010647173.1|  PREDICTED: putative receptor-like protein ki...    416   2e-132   
ref|XP_010439208.1|  PREDICTED: cysteine-rich receptor-like prote...    416   3e-132   
ref|XP_010427120.1|  PREDICTED: cysteine-rich receptor-like prote...    415   3e-132   
ref|XP_009136382.1|  PREDICTED: cysteine-rich receptor-like prote...    415   3e-132   
ref|XP_009108599.1|  PREDICTED: cysteine-rich receptor-like prote...    416   3e-132   
ref|XP_010439217.1|  PREDICTED: cysteine-rich receptor-like prote...    414   3e-132   
ref|XP_006398146.1|  hypothetical protein EUTSA_v10000811mg             415   3e-132   
ref|XP_010054435.1|  PREDICTED: cysteine-rich receptor-like prote...    415   4e-132   
ref|XP_009108598.1|  PREDICTED: cysteine-rich receptor-like prote...    416   4e-132   
gb|EYU27838.1|  hypothetical protein MIMGU_mgv1a002249mg                416   4e-132   
ref|XP_008371129.1|  PREDICTED: cysteine-rich receptor-like prote...    407   5e-132   
ref|XP_010492474.1|  PREDICTED: cysteine-rich receptor-like prote...    415   5e-132   
ref|XP_003555326.2|  PREDICTED: cysteine-rich receptor-like prote...    417   5e-132   
emb|CDX94166.1|  BnaC07g38000D                                          416   5e-132   
ref|XP_010665893.1|  PREDICTED: putative receptor-like protein ki...    415   5e-132   
ref|XP_010999534.1|  PREDICTED: cysteine-rich receptor-like prote...    416   5e-132   
gb|KDO56716.1|  hypothetical protein CISIN_1g006317mg                   414   6e-132   
ref|XP_010427119.1|  PREDICTED: cysteine-rich receptor-like prote...    415   7e-132   
emb|CBI33228.3|  unnamed protein product                                403   7e-132   
ref|XP_008384023.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...    414   7e-132   
ref|XP_009136374.1|  PREDICTED: cysteine-rich receptor-like prote...    415   7e-132   
ref|XP_010059136.1|  PREDICTED: putative cysteine-rich receptor-l...    423   7e-132   
ref|XP_003638036.1|  Cysteine-rich receptor-like protein kinase         436   9e-132   
emb|CDY41280.1|  BnaA01g12590D                                          415   9e-132   
ref|NP_194054.2|  cysteine-rich receptor-like protein kinase 15         409   1e-131   
ref|XP_010052451.1|  PREDICTED: cysteine-rich receptor-like prote...    414   1e-131   
ref|XP_010439216.1|  PREDICTED: cysteine-rich receptor-like prote...    414   1e-131   
ref|XP_003637977.1|  Cysteine-rich receptor-like protein kinase         436   1e-131   
ref|XP_007207670.1|  hypothetical protein PRUPE_ppa023045mg             411   1e-131   
ref|XP_008225008.1|  PREDICTED: uncharacterized protein LOC103324687    432   1e-131   
ref|XP_006494831.1|  PREDICTED: putative cysteine-rich receptor-l...    414   1e-131   
gb|KHN02662.1|  Cysteine-rich receptor-like protein kinase 26           414   1e-131   
ref|XP_008338742.1|  PREDICTED: cysteine-rich receptor-like prote...    404   1e-131   
ref|XP_006283273.1|  hypothetical protein CARUB_v10004308mg             414   2e-131   
emb|CDY10917.1|  BnaA03g45760D                                          413   2e-131   
ref|XP_006589611.1|  PREDICTED: cysteine-rich receptor-like prote...    414   2e-131   
gb|KFK28875.1|  hypothetical protein AALP_AA7G059500                    414   2e-131   
ref|XP_009136389.1|  PREDICTED: cysteine-rich receptor-like prote...    412   2e-131   
ref|NP_194062.1|  putative cysteine-rich receptor-like protein ki...    418   2e-131   
ref|XP_009349604.1|  PREDICTED: cysteine-rich receptor-like prote...    414   2e-131   
gb|KCW76435.1|  hypothetical protein EUGRSUZ_D00824                     411   2e-131   
ref|XP_010455562.1|  PREDICTED: putative cysteine-rich receptor-l...    407   2e-131   
ref|XP_006606898.1|  PREDICTED: cysteine-rich receptor-like prote...    413   2e-131   
ref|XP_007143158.1|  hypothetical protein PHAVU_007G048700g             413   2e-131   
gb|KFK28874.1|  hypothetical protein AALP_AA7G059500                    414   3e-131   
gb|KFK28877.1|  hypothetical protein AALP_AA7G059500                    414   3e-131   
ref|XP_010059681.1|  PREDICTED: cysteine-rich receptor-like prote...    402   3e-131   
ref|XP_006481075.1|  PREDICTED: putative cysteine-rich receptor-l...    413   3e-131   
ref|XP_008349189.1|  PREDICTED: cysteine-rich receptor-like prote...    400   4e-131   
gb|KCW75015.1|  hypothetical protein EUGRSUZ_E03792                     402   4e-131   
ref|XP_010469000.1|  PREDICTED: putative cysteine-rich receptor-l...    414   4e-131   
ref|XP_010448745.1|  PREDICTED: cysteine-rich receptor-like prote...    412   4e-131   
gb|KCW74326.1|  hypothetical protein EUGRSUZ_E02992                     401   5e-131   
gb|KCW74377.1|  hypothetical protein EUGRSUZ_E03056                     412   6e-131   
ref|XP_006286770.1|  hypothetical protein CARUB_v10003321mg             412   6e-131   
ref|XP_008441097.1|  PREDICTED: uncharacterized protein LOC103485324    427   6e-131   



>ref|XP_006373160.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50957.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=419

 Score =   483 bits (1243),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 239/381 (63%), Positives = 292/381 (77%), Gaps = 11/381 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LF     FL  R +K      Q  DV  EI+N ESLQ+D ++IQ  TN FS DNK+GEG
Sbjct  43    VLFCLGFCFLS-RRAKSNKNSAQENDVGNEITNVESLQFDLSSIQDATNHFSADNKLGEG  101

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQ IA+KRLS+ SGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  102   GFGEVYKGTLPNGQAIAVKRLSKGSGQGAAEFKNEVILVAKLQHRNLVRLLGFCLEGEEK  161

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FD E+Q +L+WSKRYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  162   ILVYEFVPNKSLDYFVFDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRLRVIHRDLKAS  221

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ K++DFGMA+IFG+DQTQG T+RIVGTYGYMSPEYAM G+FSVKSD +SFG
Sbjct  222   NILLDGDMNAKVSDFGMARIFGVDQTQGCTNRIVGTYGYMSPEYAMHGQFSVKSDAYSFG  281

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQT   A DL SYAW+ WRDGTP+E++DP LA  +Y+ NEV++C+
Sbjct  282   VLILEIISGKKNSSFYQTGG-AADLASYAWKHWRDGTPLEVMDPTLA-DTYSRNEVMRCI  339

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREI----  442
             HIGLLCVQED   RPTM  VVL+L+SYS      P+EPAF+   R   G +P +E     
Sbjct  340   HIGLLCVQEDPASRPTMATVVLLLNSYSI-TLPLPQEPAFFLHSRTDQGSIPSKEFFADK  398

Query  441   SLELSVTVSDEASTIGKLCPR  379
             S   SV  S +  +I ++ PR
Sbjct  399   SKSNSVPYSGDEGSITEVYPR  419



>ref|XP_009762725.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10, partial [Nicotiana sylvestris]
Length=404

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 233/341 (68%), Positives = 279/341 (82%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI    +LR R S+K N     TD   EIS  ESLQY   +IQ+ T  FS DN+IGEG
Sbjct  29    LLFIFGFCWLRRRASQKFNVAQDMTD-GNEISTAESLQYQLTSIQVATTNFSADNEIGEG  87

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+GQEIA KRLSRSSGQG +EFKNE+ ++AKLQH+NLVRLLGYC + EEK
Sbjct  88    GFGVVYKGILPNGQEIAXKRLSRSSGQGAQEFKNEIVLIAKLQHRNLVRLLGYCFEGEEK  147

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLDYFLFD E+Q +L WS+RYKII GIARGLLYLHEDSRLR+IHRDLK S
Sbjct  148   LLVYEFVPNKSLDYFLFDPEKQQLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKAS  207

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IF IDQ++  T+RIVGTYGYMSPEYAM G++SVKSDVFSFG
Sbjct  208   NILLDADMNPKISDFGMARIFEIDQSEEITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFG  267

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN + YQ ++ A+DLLSY W+ WRDGTP+ I+DP     SY+ NEVIQC+
Sbjct  268   VLLLEIISGKKNSSFYQ-SDGAEDLLSYVWKNWRDGTPLNIMDPTFG-DSYSRNEVIQCI  325

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQ+D ++RPTME VVLML+SYS      P++PAF+
Sbjct  326   HIGLLCVQDDVNQRPTMESVVLMLNSYSVTK-PAPQQPAFF  365



>ref|XP_009598808.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Nicotiana tomentosiformis]
Length=540

 Score =   485 bits (1248),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 235/341 (69%), Positives = 279/341 (82%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL I    +LR R S++       TD   EIS  ESLQY    IQ  T  FS DNKIGEG
Sbjct  165   LLLIFGFCWLRRRGSQEFIVAKDMTD-GNEISTTESLQYQLTNIQAATTNFSADNKIGEG  223

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+GQEIA+KRLSRSSGQG +EFKNE+ ++AKLQH+NLVRLLGYC + EEK
Sbjct  224   GFGVVYKGILPNGQEIAVKRLSRSSGQGAQEFKNEIVLIAKLQHRNLVRLLGYCFEAEEK  283

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLDYFLFD E+QH+L WS+RYKII GIARGLLYLHEDSRLR+IHRDLK S
Sbjct  284   LLVYEFVPNKSLDYFLFDPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKAS  343

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFGIDQ++  T+RIVGTYGYMSPEYAM G++SVKSDVFSFG
Sbjct  344   NILLDADMNPKISDFGMARIFGIDQSEDITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFG  403

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN + YQ ++ A+DLLSY W+ WRDGTP+ I+DP   + SY+ NEVIQC+
Sbjct  404   VLLLEIISGKKNSSFYQ-SDGAEDLLSYVWKNWRDGTPLNIMDPTFGE-SYSRNEVIQCI  461

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED  ERPTME VVLML+SYS    + P++PAF+
Sbjct  462   HIGLLCVQEDVTERPTMESVVLMLNSYSVTK-AAPQQPAFF  501



>ref|XP_006449120.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
 gb|ESR62360.1| hypothetical protein CICLE_v10014504mg [Citrus clementina]
Length=671

 Score =   489 bits (1258),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 243/382 (64%), Positives = 303/382 (79%), Gaps = 13/382 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFI    FLR R +KK+   +  ++   +++  ESLQ+DF TI++ TN FS DNK+GEG
Sbjct  295   VLFILGFCFLR-RKAKKKYNAVPESNADNDLTTLESLQFDFETIEVATNKFSTDNKLGEG  353

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LPSGQEIA+KRLS+SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  354   GFGEVYKGVLPSGQEIAVKRLSKSSGQGAEEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  413

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFL+D E+Q  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  414   ILIYEFVPNKSLDYFLYDPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKAS  473

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSDV+SFG
Sbjct  474   NILLDAEMNPKISDFGMARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFG  533

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII+GKKN N YQ T+ A DLLSYAW+QWRDGTP+++LD  L   SY+ NEVI+C+
Sbjct  534   VLVLEIITGKKNSNFYQ-TDGAADLLSYAWKQWRDGTPLQLLDTNLT-DSYSRNEVIRCI  591

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREI----  442
              +GLLCVQED  ERP+M  +VLML+SYS      P++PAF+   R   G +P +E     
Sbjct  592   QLGLLCVQEDPAERPSMATIVLMLNSYSV-TLPLPQQPAFFIGSRTERG-LPTKEFECSD  649

Query  441   -SLELSVTVSDEASTIGKLCPR  379
              S   S+  S + ++I ++ PR
Sbjct  650   KSTSKSIPWSVDEASITEVYPR  671



>gb|KDO37422.1| hypothetical protein CISIN_1g005846mg [Citrus sinensis]
Length=674

 Score =   488 bits (1257),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 231/341 (68%), Positives = 286/341 (84%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFI    FLR R +KK+   +  ++   +++  ESLQ+DF TI++ TN FS DNK+GEG
Sbjct  298   VLFILGFCFLR-RKAKKKYNAVPESNADNDLTTLESLQFDFETIEVATNKFSTDNKLGEG  356

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LPSGQEIA+KRLS++SGQG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  357   GFGEVYKGVLPSGQEIAVKRLSKASGQGAEEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  416

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFL+D E+Q  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  417   ILVYEFVPNKSLDYFLYDPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKAS  476

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSDV+SFG
Sbjct  477   NILLDAEMNPKISDFGMARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFG  536

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII+GKKN N YQ T+ A DLLSYAW+QWRDGTP+++LD  L   SY+ NEVI+C+
Sbjct  537   VLVLEIITGKKNSNFYQ-TDGAADLLSYAWKQWRDGTPLQLLDTNLT-DSYSRNEVIRCI  594

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
              +GLLCVQED  ERP+M  +VLML+SYS     +P++PAF+
Sbjct  595   QLGLLCVQEDPAERPSMATIVLMLNSYSV-TLPSPQQPAFF  634



>ref|XP_006467962.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Citrus sinensis]
Length=674

 Score =   487 bits (1253),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 231/341 (68%), Positives = 285/341 (84%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFI    FLR R +KK+   +  ++   +++  ESLQ+DF TI++ TN FS DNK+GEG
Sbjct  298   VLFILGFCFLR-RKAKKKYNAVPESNADNDLTTLESLQFDFETIEVATNKFSTDNKLGEG  356

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LPSGQEIA+KRLS++SGQG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  357   GFGEVYKGVLPSGQEIAVKRLSKASGQGAEEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  416

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFL+D E+Q  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  417   ILVYEFVPNKSLDYFLYDPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKAS  476

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSDV+SFG
Sbjct  477   NILLDAEMNPKISDFGMARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVYSFG  536

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII+GKKN N YQ T+ A DLLSYAW+QWRDGTP+++LD  L   SY+ NEVI+C+
Sbjct  537   VLVLEIITGKKNSNFYQ-TDGAADLLSYAWKQWRDGTPLQLLDTNLT-DSYSRNEVIRCI  594

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
              +GLLCVQED  ERP+M  +VLML+SYS      P++PAF+
Sbjct  595   QLGLLCVQEDPAERPSMATIVLMLNSYSV-TLPLPQQPAFF  634



>ref|XP_009598807.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Nicotiana tomentosiformis]
Length=675

 Score =   486 bits (1251),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 235/341 (69%), Positives = 279/341 (82%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL I    +LR R S++       TD   EIS  ESLQY    IQ  T  FS DNKIGEG
Sbjct  300   LLLIFGFCWLRRRGSQEFIVAKDMTD-GNEISTTESLQYQLTNIQAATTNFSADNKIGEG  358

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+GQEIA+KRLSRSSGQG +EFKNE+ ++AKLQH+NLVRLLGYC + EEK
Sbjct  359   GFGVVYKGILPNGQEIAVKRLSRSSGQGAQEFKNEIVLIAKLQHRNLVRLLGYCFEAEEK  418

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLDYFLFD E+QH+L WS+RYKII GIARGLLYLHEDSRLR+IHRDLK S
Sbjct  419   LLVYEFVPNKSLDYFLFDPEKQHLLNWSRRYKIIGGIARGLLYLHEDSRLRVIHRDLKAS  478

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFGIDQ++  T+RIVGTYGYMSPEYAM G++SVKSDVFSFG
Sbjct  479   NILLDADMNPKISDFGMARIFGIDQSEDITNRIVGTYGYMSPEYAMHGQYSVKSDVFSFG  538

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN + YQ ++ A+DLLSY W+ WRDGTP+ I+DP   + SY+ NEVIQC+
Sbjct  539   VLLLEIISGKKNSSFYQ-SDGAEDLLSYVWKNWRDGTPLNIMDPTFGE-SYSRNEVIQCI  596

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED  ERPTME VVLML+SYS    + P++PAF+
Sbjct  597   HIGLLCVQEDVTERPTMESVVLMLNSYSVTK-AAPQQPAFF  636



>ref|XP_008224858.1| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Prunus mume]
Length=424

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 297/380 (78%), Gaps = 10/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F+  R  KK++   +      +IS  ESLQ+DF+TI   TN FS DNK+GEG
Sbjct  49    LLFVVGCCFITRRARKKRSAAAEAPSGENDISTIESLQFDFSTIVAATNNFSDDNKLGEG  108

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQE+A+KRLS++SGQG +EFKNE+ +VAKLQH+NLVRL G+C + EEK
Sbjct  109   GFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKNEMVLVAKLQHRNLVRLYGFCLEGEEK  168

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+V N SLDYFLFD E+Q  L+W++RYKII GIARG++YLHEDSRLRIIHRDLK S
Sbjct  169   ILVYEYVSNKSLDYFLFDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKAS  228

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G+FSVKSD++SFG
Sbjct  229   NILLDGEMHPKISDFGMARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFG  288

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP + + SY+ +EVI+C+
Sbjct  289   VLLLEIISGKKNSYFFQ-TDAAEDLVSHAWKLWRDGTPLELLDPSM-RDSYSRSEVIRCI  346

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM+ VVLML+SYS      P +PAF+     +  M +I+LE  ++
Sbjct  347   HIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPEQPAFFLRSRTEGNMPKITLESDLS  405

Query  420   VS------DEASTIGKLCPR  379
             VS      DEAS I  + PR
Sbjct  406   VSKSTPSVDEAS-ITAVYPR  424



>ref|XP_006449119.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
 gb|ESR62359.1| hypothetical protein CICLE_v10014496mg [Citrus clementina]
Length=674

 Score =   483 bits (1244),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 230/340 (68%), Positives = 284/340 (84%), Gaps = 4/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF+A L FLR R  KK N  +   +   +++  ESLQ+DF TI++ TN FS DNK+GEGG
Sbjct  299   LFVACLCFLRRRAKKKYNA-VPEENADNDLTILESLQFDFETIEVATNKFSTDNKLGEGG  357

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+LPSGQEIA+KRLS SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + EEKI
Sbjct  358   FGEVYKGVLPSGQEIAVKRLSASSGQGAQEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKI  417

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFVPN SLDYFL+D E+Q  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK SN
Sbjct  418   LVYEFVPNKSLDYFLYDPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASN  477

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD  M+PKI+DFGMA+IFG+DQTQGNTSRI GT+GYM+PEYAM G+FSVKSDV+ FGV
Sbjct  478   ILLDAEMNPKISDFGMARIFGVDQTQGNTSRIAGTFGYMAPEYAMHGQFSVKSDVYGFGV  537

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKN + YQ T+ A+DLLSYAW+QWRDGTP+++LDP L   S++ NEVI+C+ 
Sbjct  538   LVLEIITGKKNSSFYQ-TDGARDLLSYAWKQWRDGTPLQLLDPNLT-DSHSRNEVIRCIQ  595

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +GLLCVQED  ERP+M  +VLML+SYS     +P++PAF+
Sbjct  596   LGLLCVQEDPAERPSMATIVLMLNSYSV-TLPSPQQPAFF  634



>ref|XP_007213903.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
 gb|EMJ15102.1| hypothetical protein PRUPE_ppa003904mg [Prunus persica]
Length=541

 Score =   478 bits (1231),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 298/380 (78%), Gaps = 10/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F+  R  KK++   +      +IS+ ESLQ+DF+TI   TN FS DNK+GEG
Sbjct  166   LLFVVGCCFITRRARKKRSAAAEAPSGVNDISSVESLQFDFSTIVAATNNFSDDNKLGEG  225

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQ++A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRL G+C + EEK
Sbjct  226   GFGQVYKGILSNGQQVAVKRLSRNSGQGAEEFKNEMVLVAKLQHRNLVRLYGFCLEGEEK  285

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+V N SLDYFLFD E+Q  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK S
Sbjct  286   ILVYEYVSNKSLDYFLFDPEKQGQLDWSRRYKIIAGIARGIMYLHEDSRLRIIHRDLKAS  345

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G+FSVKSD++SFG
Sbjct  346   NILLDGEMHPKISDFGMARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFG  405

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP + + SY+ +EVI+C+
Sbjct  406   VLLLEIISGKKNSYFFQ-TDAAEDLMSHAWKLWRDGTPLELLDPSM-RDSYSRSEVIRCI  463

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM+ VVLML+SYS      P +PAF+     +  M +I+LE  ++
Sbjct  464   HIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPEQPAFFLRSRTEGNMPKITLESDLS  522

Query  420   VS------DEASTIGKLCPR  379
             +S      DEAS I  + PR
Sbjct  523   ISKSTPSVDEAS-ITAVYPR  541



>ref|XP_006343408.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Solanum tuberosum]
Length=662

 Score =   481 bits (1238),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 235/341 (69%), Positives = 280/341 (82%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL I    ++R R S++ N   + TD   EIS  ESLQY   TI++ T  FS DNKIGEG
Sbjct  289   LLVILGFCWIRSRTSREFNVVEEITD-EDEISAAESLQYHLNTIRVATTNFSIDNKIGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP GQEIA+KRLSRSSGQG +EFKNE+ ++AKLQH+NLVRLLGYC + +EK
Sbjct  348   GFGVVYKGKLPDGQEIAVKRLSRSSGQGIEEFKNEIVLIAKLQHRNLVRLLGYCLEGDEK  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFD E+Q +L+WS+RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  408   ILVYEFVPNKSLDYFLFDPEKQQLLDWSRRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFGIDQ++  TSRIVGTYGYMSPEYAM G++SVKSDVFSFG
Sbjct  468   NILLDAEMNPKISDFGMARIFGIDQSEEITSRIVGTYGYMSPEYAMHGQYSVKSDVFSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN   YQ ++  +DLLSY W+ WRDGTP+ I+DP+ A+ SY+ NEVIQC+
Sbjct  528   VLLLEIISGKKNSAFYQ-SDGGEDLLSYVWKNWRDGTPLNIMDPIFAE-SYSRNEVIQCI  585

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED +ERPTM+ VVLML+SYS      P++PAF+
Sbjct  586   HIGLLCVQEDVNERPTMDSVVLMLNSYSITT-QPPKQPAFF  625



>ref|XP_011010158.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score =   479 bits (1234),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 237/381 (62%), Positives = 289/381 (76%), Gaps = 11/381 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LF  V  FL  R +K      Q  DV  EI+N ESLQ+D ++IQ  TN FS DNK+GEG
Sbjct  299   VLFCLVFCFLS-RRAKSSKYSAQENDVGNEITNVESLQFDLSSIQDATNHFSADNKLGEG  357

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQ IA+KRLS+ SGQG  EFKNEV +VAKLQH+NLVRL G+C + +EK
Sbjct  358   GFGEVYKGTLPNGQAIAVKRLSKGSGQGAAEFKNEVILVAKLQHRNLVRLFGFCLEGDEK  417

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDYFLFD E+Q +L+WSKRYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  418   ILVYEYVPNKSLDYFLFDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRLRVIHRDLKAS  477

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ K++DFGMA+IFG+DQT G T+RIVGTYGYMSPEYAM G+FSVKSD +SFG
Sbjct  478   NILLDGDMNAKVSDFGMARIFGVDQTHGCTNRIVGTYGYMSPEYAMHGQFSVKSDAYSFG  537

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQT   A DL SY W+ WRDGTP+E++DP L   +Y+ NEVI+C+
Sbjct  538   VLILEIISGKKNSSFYQTGG-AADLASYVWKHWRDGTPLEVMDPTLT-DTYSRNEVIRCI  595

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREI----  442
             HIGLLCVQED   RPTM  VVLML+SYS      P+EPAF+   R   G +P +E     
Sbjct  596   HIGLLCVQEDPASRPTMATVVLMLNSYSI-TLPLPQEPAFFLHSRTDQGSIPSKEFFADK  654

Query  441   SLELSVTVSDEASTIGKLCPR  379
             S   SV  S +  +I ++ PR
Sbjct  655   SKTNSVPYSGDEGSITEVYPR  675



>gb|KHN30448.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=669

 Score =   479 bits (1233),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 296/376 (79%), Gaps = 6/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+FI  + FL  R  KKQ   ++      +I   +SLQ+DF+TI+  TN FS DNK+GEG
Sbjct  298   LIFIVGICFLSRRARKKQQGSVKEGKTAYDIPTVDSLQFDFSTIEAATNKFSADNKLGEG  357

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SGQ +A+KRLS+SSGQG +EFKNEV VVAKLQH+NLVRLLG+C + EEK
Sbjct  358   GFGEVYKGTLSSGQVVAVKRLSKSSGQGGEEFKNEVVVVAKLQHRNLVRLLGFCLQGEEK  417

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDY LFD E+Q  L+W +RYKII GIARG+ YLHEDSRLRIIHRDLK S
Sbjct  418   ILVYEYVPNKSLDYILFDPEKQRELDWGRRYKIIGGIARGIQYLHEDSRLRIIHRDLKAS  477

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFG+DQTQGNTSRIVGTYGYM+PEYAM GEFSVKSDV+SFG
Sbjct  478   NILLDGDMNPKISDFGMARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFG  537

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EI+SGKKN + YQ T+ A+DLLSYAW+ W+DGTP+E++DP+L + SY  NEVI+ +
Sbjct  538   VLLMEILSGKKNSSFYQ-TDGAEDLLSYAWQLWKDGTPLELMDPIL-RESYNQNEVIRSI  595

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM--REISLELS  427
             HIGLLCVQED  +RPTM  +VLML S +T    TP +PAF+ + SG  P   +E+  + S
Sbjct  596   HIGLLCVQEDPADRPTMATIVLMLDS-NTVTLPTPTQPAFFVH-SGTDPNMPKELPFDQS  653

Query  426   VTVSDEASTIGKLCPR  379
             + +S    +I ++ PR
Sbjct  654   IPMSVNDMSISEMDPR  669



>ref|NP_001238492.1| cysteine-rich protein precursor [Glycine max]
 gb|ACM89479.1| cysteine-rich protein [Glycine max]
Length=667

 Score =   479 bits (1232),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 296/376 (79%), Gaps = 6/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+FI  + FL  R  KKQ   ++      +I   +SLQ+DF+TI+  TN FS DNK+GEG
Sbjct  296   LIFIVGICFLSRRARKKQQGSVKEGKTAYDIPTVDSLQFDFSTIEAATNKFSADNKLGEG  355

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SGQ +A+KRLS+SSGQG +EFKNEV VVAKLQH+NLVRLLG+C + EEK
Sbjct  356   GFGEVYKGTLSSGQVVAVKRLSKSSGQGGEEFKNEVVVVAKLQHRNLVRLLGFCLQGEEK  415

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDY LFD E+Q  L+W +RYKII GIARG+ YLHEDSRLRIIHRDLK S
Sbjct  416   ILVYEYVPNKSLDYILFDPEKQRELDWGRRYKIIGGIARGIQYLHEDSRLRIIHRDLKAS  475

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFG+DQTQGNTSRIVGTYGYM+PEYAM GEFSVKSDV+SFG
Sbjct  476   NILLDGDMNPKISDFGMARIFGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFG  535

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EI+SGKKN + YQ T+ A+DLLSYAW+ W+DGTP+E++DP+L + SY  NEVI+ +
Sbjct  536   VLLMEILSGKKNSSFYQ-TDGAEDLLSYAWQLWKDGTPLELMDPIL-RESYNQNEVIRSI  593

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM--REISLELS  427
             HIGLLCVQED  +RPTM  +VLML S +T    TP +PAF+ + SG  P   +E+  + S
Sbjct  594   HIGLLCVQEDPADRPTMATIVLMLDS-NTVTLPTPTQPAFFVH-SGTDPNMPKELPFDQS  651

Query  426   VTVSDEASTIGKLCPR  379
             + +S    +I ++ PR
Sbjct  652   IPMSVNDMSISEMDPR  667



>ref|XP_007211369.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
 gb|EMJ12568.1| hypothetical protein PRUPE_ppa002516mg [Prunus persica]
Length=663

 Score =   475 bits (1222),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 226/368 (61%), Positives = 290/368 (79%), Gaps = 3/368 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F+  R  KK++   +      +IS  ESLQ+DF+TI   TN FS DNK+GEG
Sbjct  288   LLFVVGCCFITRRARKKRSAAAEAPSGENDISTIESLQFDFSTIVAATNNFSDDNKLGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQE+A+KRLS++SGQG +EFKNE+ +VAKLQH+NLVRL G+C + EEK
Sbjct  348   GFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKNEMVLVAKLQHRNLVRLYGFCLEGEEK  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+V N SLDYFLFD E+Q  L+W++RYKII GIARG++YLHEDSRLRIIHRDLK  
Sbjct  408   ILVYEYVSNKSLDYFLFDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKAG  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G+FSVKSD++SFG
Sbjct  468   NILLDREMHPKISDFGMARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP + + SY+ +EVI+C+
Sbjct  528   VLLLEIISGKKNSCFFQ-TDAAEDLVSHAWKLWRDGTPLELLDPSM-RDSYSRSEVIRCI  585

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM+ VVLML+SYS      P +PAF+     +  M +I+LE  ++
Sbjct  586   HIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPEQPAFFLRSRTEGNMPKITLESDLS  644

Query  420   VSDEASTI  397
             +S    ++
Sbjct  645   ISKSTPSV  652



>ref|XP_008224765.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Prunus 
mume]
Length=679

 Score =   474 bits (1220),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 297/380 (78%), Gaps = 10/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F+  R  KK++   +      +IS  ESLQ+DF+TI   TN FS DNK+GEG
Sbjct  304   LLFVVGCCFITRRARKKRSAAAEAPSGENDISTIESLQFDFSTIVAATNNFSDDNKLGEG  363

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NL+RL G+C + EEK
Sbjct  364   GFGQVYKGILSNGQEVAVKRLSRNSGQGAEEFKNEMVLVAKLQHRNLIRLYGFCLEGEEK  423

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+V N SLDYFLFD E+Q  L+W++RYKII GIARG++YLHEDS+LRIIHRDLK S
Sbjct  424   ILVYEYVSNKSLDYFLFDPEKQGHLDWARRYKIIAGIARGIMYLHEDSQLRIIHRDLKAS  483

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA+IFG+DQTQ NTSRIVGTYGYM+PEYAM G+FSVKSD++SFG
Sbjct  484   NILLDGEMHPKISDFGMARIFGVDQTQANTSRIVGTYGYMAPEYAMHGQFSVKSDLYSFG  543

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIISGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP + + SY+ +EVI+C+
Sbjct  544   VLLLEIISGKKNSYFFQ-TDAAEDLVSHAWKLWRDGTPLELLDPSM-RDSYSRSEVIRCI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM+ VVLML+SYS      P +PAF+     +  M +I+LE  ++
Sbjct  602   HIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPEQPAFFLRSRTEGNMPKITLESDLS  660

Query  420   VS------DEASTIGKLCPR  379
             +S      DEAS I  + PR
Sbjct  661   ISKSTPSVDEAS-ITAVYPR  679



>ref|XP_002304944.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
 gb|EEE85455.2| hypothetical protein POPTR_0004s02370g [Populus trichocarpa]
Length=403

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 224/340 (66%), Positives = 271/340 (80%), Gaps = 5/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF     FLR   ++K    +   DV  EI+ EESLQ+D +TI+  TN  SPDNK+GEGG
Sbjct  28    LFCMCFCFLR--RARKTRDYVPENDVGDEITTEESLQFDLSTIEAATNNCSPDNKLGEGG  85

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG LP+GQ+IA+KRLSR+SGQG  EFKNEV +VAKLQH+NLVRL G+C +REEKI
Sbjct  86    FGEVYKGTLPNGQQIAVKRLSRNSGQGAAEFKNEVVLVAKLQHRNLVRLQGFCLEREEKI  145

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFV N SLDYFLFD ERQ +L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK SN
Sbjct  146   LVYEFVSNKSLDYFLFDPERQGLLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASN  205

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKI+DFG+A+IF +DQTQ +T+RIVGTYGYMSPEYAM G FSVKSDV+SFGV
Sbjct  206   ILLDGDMNPKISDFGLARIFVVDQTQASTNRIVGTYGYMSPEYAMHGRFSVKSDVYSFGV  265

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKN + YQT   A DL+SY W  WRDGTP+E+LDP L   +Y+ NEVI+C+H
Sbjct  266   LILEIITGKKNSSFYQTGG-APDLVSYVWNHWRDGTPLEVLDPTLT-DTYSRNEVIRCIH  323

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQED   RP M  +VL L+SY      +P+E AF+
Sbjct  324   IGLLCVQEDPAIRPAMATIVLTLNSYLV-TLPSPQEAAFF  362



>emb|CBI29180.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   468 bits (1204),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 297/380 (78%), Gaps = 9/380 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F  + Y    R +KK+   L+  +V   I+ E+SLQ+D ATIQ  TN FS  NKIGEG
Sbjct  147   VIFSILCYCFIRRCAKKRYDTLEAENVEFNITTEQSLQFDLATIQAATNNFSDHNKIGEG  206

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L SGQEIAIKRLS+SSGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  207   GFGAVYKGTLSSGQEIAIKRLSKSSGQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  266

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDYFLFD +++  L+WS+RYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  267   ILVYEYVPNKSLDYFLFDPDKRGQLDWSRRYKIIGGIARGILYLHEDSRLRVIHRDLKAS  326

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+IFG+DQTQGNT+R+VGTYGYMSPEYAM G FSVKSDV+SFG
Sbjct  327   NVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFG  386

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK++ N +  +++A+DLLSYAW+ WR+ TP+E + P   ++S++ NEVI+C+
Sbjct  387   VLVLEIISGKRS-NCFHESDQAEDLLSYAWKLWRNDTPLEFMGPT-TRNSFSKNEVIRCI  444

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGS-GKVPMREI----S  439
             H+GLLCVQED D+RP+M  VVLMLSSYS      P++PA F R G+    P+  +    S
Sbjct  445   HMGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPASFSRTGALSDFPIMALESDQS  503

Query  438   LELSVTVSDEASTIGKLCPR  379
                S+T S   ++I  L PR
Sbjct  504   ASKSMTWSVNEASITDLYPR  523



>ref|XP_003556014.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 2 [Glycine max]
Length=666

 Score =   472 bits (1214),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 226/343 (66%), Positives = 279/343 (81%), Gaps = 4/343 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI  ++ L  R +KK+N+  Q      EIS  ESL++DF+TI+  T+ FS  NK+GEG
Sbjct  292   LLFIVGIWLLSKRAAKKRNSA-QDPKTETEISAVESLRFDFSTIEAATDKFSDANKLGEG  350

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LPSGQE+A+KRLS++SGQG  EFKNEVEVVAKLQHKNLVRLLG+C + EEK
Sbjct  351   GFGEVYKGLLPSGQEVAVKRLSKNSGQGGTEFKNEVEVVAKLQHKNLVRLLGFCLEGEEK  410

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDY LFD E+Q  L+W++RYKI+ GIARG+ YLHEDSRL+IIHRDLK S
Sbjct  411   ILVYEFVANKSLDYILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRLKIIHRDLKAS  470

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM GE+S KSDV+SFG
Sbjct  471   NVLLDGDMNPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGEYSAKSDVYSFG  530

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK+N + Y+ T+ A+DLLSYAW+ W+D  P+E++D  L + SYT NEVI+C+
Sbjct  531   VLILEIISGKRNSSFYE-TDVAEDLLSYAWKLWKDEAPLELMDQSL-RESYTRNEVIRCI  588

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRN  472
             HIGLLCVQED  +RPTM  VVLML SYS      P +PAFY N
Sbjct  589   HIGLLCVQEDPIDRPTMASVVLMLDSYSV-TLQVPNQPAFYIN  630



>gb|KDP20812.1| hypothetical protein JCGZ_21283 [Jatropha curcas]
Length=673

 Score =   471 bits (1212),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 291/370 (79%), Gaps = 9/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LF     FLR R ++K+   +Q  D   +I+  ESLQ+D +TI+  T+ FS D K+G G
Sbjct  295   VLFCMGFCFLR-RRARKKYDAVQEDDAGNDITTVESLQFDLSTIEAATSKFSDDKKLGGG  353

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQEIA+KRLS  SGQG  EFKNEV ++AKLQH+NLVRLLG+C +REEK
Sbjct  354   GFGDVYKGRLPNGQEIAVKRLSEGSGQGSVEFKNEVLLLAKLQHRNLVRLLGFCLEREEK  413

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFD E++ VL+WS+RYKII GIARG+LYLH+DSRL IIHRDLK S
Sbjct  414   ILVYEFVPNKSLDYFLFDPEKRGVLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKVS  473

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ KI+DFGMA+IFG+DQTQGNT+R+VGTYGYMSPEYAM G+FS+KSD++SFG
Sbjct  474   NILLDADMNAKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGQFSIKSDMYSFG  533

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + Y+ T+ A DL+SY W+ WR+GTP+E+LDP L   S++ +EV++C+
Sbjct  534   VLVLEIISGKKNSSFYE-TDGANDLVSYVWKHWRNGTPMEVLDPTLV-DSHSRSEVLRCI  591

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
              IGLLCVQED  +RPTM  +VLMLSSYS      P++PAF+ N        E S++L   
Sbjct  592   QIGLLCVQEDPADRPTMPTIVLMLSSYSV-TLPVPQQPAFFLNSGS-----EQSMQLKGF  645

Query  420   VSDEASTIGK  391
              SD+++TI K
Sbjct  646   ESDKSTTISK  655



>ref|XP_008345332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   470 bits (1209),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 228/370 (62%), Positives = 296/370 (80%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R S+K+  + +  + +GE  I+  ESLQ+ FATIQ  T+ FS D+K+G
Sbjct  288   LLFV-VGYCCITRRSRKKYNQAEADEPSGENDITTVESLQFHFATIQAATSNFSDDHKLG  346

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  347   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  406

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  407   EKILVYEYVPNKSLDCFLFDHEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  466

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G+FSVKSD++S
Sbjct  467   ASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYS  526

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LDP L + SY+  EVI+
Sbjct  527   FGVLVLEIISGKKNSNFFQ-TDVAEDLTSHAWKLWRDGTSLELLDPCL-RDSYSRIEVIR  584

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  + + P++PAF+        M +I+LE  
Sbjct  585   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLALPKQPAFFLQSRPMGNMSKITLESD  643

Query  426   VTVSDEASTI  397
              +++  + ++
Sbjct  644   QSINKSSPSV  653



>ref|XP_006468228.1| PREDICTED: uncharacterized protein LOC102629057 [Citrus sinensis]
Length=1332

 Score =   488 bits (1257),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 232/340 (68%), Positives = 286/340 (84%), Gaps = 4/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF+A L FLR R  KK N  +   +   +++  ESLQ+DF TI++ TN FS DNK+GEGG
Sbjct  957   LFVACLCFLRRRAKKKYNA-VPEENADNDLTILESLQFDFETIEVATNKFSTDNKLGEGG  1015

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+LPSGQEIA+KRLS SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + EEKI
Sbjct  1016  FGEVYKGVLPSGQEIAVKRLSASSGQGAQEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKI  1075

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFVPN SLDYFL+D E+Q  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK SN
Sbjct  1076  LVYEFVPNKSLDYFLYDPEKQGQLDWSRRYKIIGGIARGILYLHEDSRLRIIHRDLKASN  1135

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD  M+PKI+DFGMA+IFG+DQTQGNTSRIVGT+GYM+PEYAM G+FSVKSDV+ FGV
Sbjct  1136  ILLDAEMNPKISDFGMARIFGVDQTQGNTSRIVGTFGYMAPEYAMHGQFSVKSDVYGFGV  1195

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKN + YQ T+ A+DLLSYAW+QWRDGTP+++LDP L   SY+ NEVI+C+H
Sbjct  1196  LVLEIITGKKNSSFYQ-TDGARDLLSYAWKQWRDGTPLQLLDPNLT-DSYSRNEVIRCIH  1253

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +GLLCVQED  ERP++  +VLML+SYS     +P++PAF+
Sbjct  1254  LGLLCVQEDPAERPSLATIVLMLNSYSV-TLPSPQQPAFF  1292


 Score =   378 bits (971),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/310 (60%), Positives = 240/310 (77%), Gaps = 3/310 (1%)
 Frame = -1

Query  1410  ISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEK  1231
             +S+EE      A I+  T+ FS  NK+G+GG+G+VYKG+LP+G+E+A+KRLSR S QG +
Sbjct  313   VSSEELPFVHLAVIKAATDGFSDSNKLGQGGFGTVYKGVLPNGKEVAVKRLSRKSWQGLE  372

Query  1230  EFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKR  1051
             EFKNE+ ++AKLQH+NLVRL+G   + EEK+LIYE +PN SLD F+FDSER+  L W+  
Sbjct  373   EFKNEIILIAKLQHRNLVRLVGCGIEGEEKLLIYELMPNRSLDCFIFDSERRLQLNWNTC  432

Query  1050  YKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNT  871
             Y II GI++GLLYLHEDSRL+IIHRDLK SN+LLD +M  KI+DFGMA+IF  +Q   NT
Sbjct  433   YNIIGGISKGLLYLHEDSRLKIIHRDLKPSNVLLDKDMVAKISDFGMARIFCENQKTANT  492

Query  870   SRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAW  691
              R+VGTYGYM+PEYAM+G FSVKSDVFSFGV++LEIISGK+N   Y  T  AQ LL+Y W
Sbjct  493   RRVVGTYGYMAPEYAMEGLFSVKSDVFSFGVIVLEIISGKRNSGFY-LTGHAQTLLAYVW  551

Query  690   EQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTN  511
             + W++G  +E +DP+L KSS ++ +V++C+HIGLLCVQED   RPTM +VV +L S S  
Sbjct  552   QLWKEGKEMEFVDPLLMKSS-SIPQVVRCIHIGLLCVQEDPAVRPTMSNVVALLGSESI-  609

Query  510   NWSTPREPAF  481
               S PR+P F
Sbjct  610   ALSEPRQPPF  619



>gb|KHG16271.1| Cysteine-rich receptor-like protein kinase 25 [Gossypium arboreum]
Length=662

 Score =   469 bits (1206),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 230/368 (63%), Positives = 289/368 (79%), Gaps = 9/368 (2%)
 Frame = -1

Query  1464  RNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPS  1285
             R ++++   ++  +   +IS  ESLQYDF+TI++ TN FS  NK+GEGG+G VYKG LP+
Sbjct  298   RRARRKYKAVEEENAKDDISTIESLQYDFSTIEVATNNFSNSNKLGEGGFGEVYKGTLPN  357

Query  1284  GQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSL  1105
             GQEIA+KRLSRSSGQG +EFKNE  +VAKLQH+NLVRLLG+C +REEKILIYEFV N SL
Sbjct  358   GQEIAVKRLSRSSGQGIEEFKNEALLVAKLQHRNLVRLLGFCLEREEKILIYEFVLNKSL  417

Query  1104  DYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKI  925
             D FLFD E+Q  L+WS RYKII G+ARG+LYLHEDSRL+IIHRDLK SNILLD +M+PKI
Sbjct  418   DCFLFDPEKQAQLDWSTRYKIIVGVARGILYLHEDSRLKIIHRDLKVSNILLDSDMNPKI  477

Query  924   ADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKN  745
             +DFGMA+IFG+DQTQ  T R+VGTYGYMSPEYAM G+FSVKSDVFSFGV++LEIISGK+N
Sbjct  478   SDFGMARIFGVDQTQETTKRVVGTYGYMSPEYAMHGQFSVKSDVFSFGVLVLEIISGKRN  537

Query  744   RNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDAD  565
              N Y+ T+ A DL+SY+W+QW++GTP+E+LD VL K +Y+ NE I+C+ IGLLCVQED  
Sbjct  538   SNFYR-TDAADDLISYSWKQWKNGTPLELLDTVL-KDNYSRNEFIRCIQIGLLCVQEDPA  595

Query  564   ERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG--SGKVPMREISLELSVTVSDEAS----  403
             ERPTM  + +ML+SYS      P +PAF+ N    GK+P  E+  + S + S   S    
Sbjct  596   ERPTMATIAMMLNSYSV-TLPVPNQPAFFCNSRTQGKMPNMELESDQSTSRSTPWSINEV  654

Query  402   TIGKLCPR  379
             +I +L PR
Sbjct  655   SITELDPR  662



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score =   468 bits (1205),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 297/380 (78%), Gaps = 9/380 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F  + Y    R +KK+   L+  +V   I+ E+SLQ+D ATIQ  TN FS  NKIGEG
Sbjct  284   VIFSILCYCFIRRCAKKRYDTLEAENVEFNITTEQSLQFDLATIQAATNNFSDHNKIGEG  343

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L SGQEIAIKRLS+SSGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  344   GFGAVYKGTLSSGQEIAIKRLSKSSGQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  403

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDYFLFD +++  L+WS+RYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  404   ILVYEYVPNKSLDYFLFDPDKRGQLDWSRRYKIIGGIARGILYLHEDSRLRVIHRDLKAS  463

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+IFG+DQTQGNT+R+VGTYGYMSPEYAM G FSVKSDV+SFG
Sbjct  464   NVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRFSVKSDVYSFG  523

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK++ N +  +++A+DLLSYAW+ WR+ TP+E + P   ++S++ NEVI+C+
Sbjct  524   VLVLEIISGKRS-NCFHESDQAEDLLSYAWKLWRNDTPLEFMGPT-TRNSFSKNEVIRCI  581

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGS-GKVPMREI----S  439
             H+GLLCVQED D+RP+M  VVLMLSSYS      P++PA F R G+    P+  +    S
Sbjct  582   HMGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPASFSRTGALSDFPIMALESDQS  640

Query  438   LELSVTVSDEASTIGKLCPR  379
                S+T S   ++I  L PR
Sbjct  641   ASKSMTWSVNEASITDLYPR  660



>ref|XP_009340926.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=705

 Score =   469 bits (1206),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 290/370 (78%), Gaps = 5/370 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNE--ESLQYDFATIQLITNVFSPDNKIG  1327
             +L + V Y    R ++K+  +    + +GE  N   +SLQ+DFA IQ  T+ FS D+K+G
Sbjct  328   VLLLVVAYCCITRGARKKYNQEAADEPSGENDNSSVKSLQFDFAAIQAATSNFSDDHKLG  387

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYK +L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + +
Sbjct  388   EGGFGQVYKAILSNGQEVAVKRLSRNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCVEGQ  447

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SLD  LFD E+Q  L+WS+R+KII GIARG++YLHEDSRLRIIHRDLK
Sbjct  448   EKILIYEFVPNKSLDCLLFDPEKQGQLDWSRRFKIISGIARGIMYLHEDSRLRIIHRDLK  507

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGT+GYMSPEYAM G FSVKSD++S
Sbjct  508   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYAMHGHFSVKSDMYS  567

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FG+++LEIISGKKN N +Q +N A+DL+S+AW+ WRDGTP+E+LDP L + SY+  E I+
Sbjct  568   FGILVLEIISGKKNSNFFQ-SNAAEDLMSHAWKLWRDGTPLELLDPCL-RDSYSRTEAIR  625

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ +VLMLSSYS     +P++PAF+        M E +L+ +
Sbjct  626   CIHIGLLCVQEDPADRPTMQSIVLMLSSYSV-TLPSPQKPAFFLQSRAMGNMSEATLDSA  684

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  685   QSISKSSLSV  694



>ref|XP_011007635.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=675

 Score =   468 bits (1203),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 287/376 (76%), Gaps = 11/376 (3%)
 Frame = -1

Query  1482  LYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVY  1303
             + F  +R ++K    +   D   EI+ EESLQ+D +T++  TN FS DNK+GEGG+G VY
Sbjct  303   MCFCFLRRARKIRDYVPENDDGNEITTEESLQFDLSTVEAATNNFSADNKLGEGGFGEVY  362

Query  1302  KGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEF  1123
             KG L +GQ+IA+KRLSR+SGQG  EFKNEV +VAKLQH+NLVR+ G+C KREEKIL+YEF
Sbjct  363   KGTLFNGQQIAVKRLSRNSGQGAAEFKNEVVLVAKLQHRNLVRMQGFCLKREEKILVYEF  422

Query  1122  VPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDV  943
             V N SLDYFLFDSERQ +L+WSKRYKII GIARG+LYLHEDSRLRIIHRDLK SNILLD 
Sbjct  423   VFNKSLDYFLFDSERQGLLDWSKRYKIIGGIARGILYLHEDSRLRIIHRDLKASNILLDG  482

Query  942   NMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEI  763
             +M+PKI+DFG+A+IF +DQTQ +T+RIVGTYGYMSPEYAM G FSVKSDV+SFGV++LEI
Sbjct  483   DMNPKISDFGLARIFVVDQTQASTNRIVGTYGYMSPEYAMHGRFSVKSDVYSFGVLILEI  542

Query  762   ISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLC  583
             I+GKKN + YQT   A DL+SY W+ WRDGTP+E+LDP L   +Y+ NEVI+C+HIGLLC
Sbjct  543   ITGKKNSSFYQTGG-AVDLVSYVWKHWRDGTPLEVLDPTLTY-TYSRNEVIRCIHIGLLC  600

Query  582   VQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--------RNGSGKVPMREISLELS  427
             VQED   RP M  +VL L++YS      P+EPAF+         N S K  + E S   S
Sbjct  601   VQEDPAIRPAMVTIVLTLNTYSV-TLPLPQEPAFFFHSTITDEVNSSSKEFLLEHSKSKS  659

Query  426   VTVSDEASTIGKLCPR  379
             V  S +  +I ++ PR
Sbjct  660   VAYSVDEDSITEVYPR  675



>ref|XP_008232237.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=659

 Score =   466 bits (1200),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 228/358 (64%), Positives = 283/358 (79%), Gaps = 4/358 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F R R  KK N  +Q  +V  EI++ ESLQ+D  TI+  T+ FS  N++GEG
Sbjct  283   LLFLVGCCFFRRRARKKYNV-IQQQNVGNEINSVESLQFDLRTIEAATDNFSDQNRLGEG  341

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VY+G+LP GQ+IA+KRLS  SGQG +EFKNEV +VAKLQH+NLVRLLG+CS+ EEK
Sbjct  342   GFGEVYEGILPDGQQIAVKRLSTGSGQGVEEFKNEVVLVAKLQHRNLVRLLGFCSEGEEK  401

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE V N SLD+FLFDSE Q  L+WS RYKII GIARGLLYLH+DSRL+IIHRDLK S
Sbjct  402   ILVYELVENKSLDHFLFDSENQVKLDWSSRYKIIGGIARGLLYLHQDSRLKIIHRDLKAS  461

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+I G+DQTQG+T RIVGT+GYMSPEYAM G+FSVKSDV+S G
Sbjct  462   NILLDGDMNPKIADFGMARIVGVDQTQGSTRRIVGTFGYMSPEYAMHGQFSVKSDVYSLG  521

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKKN + Y  ++R +DLLSYAW  WRDGTP+E+LDP L + SY   EV +CV
Sbjct  522   VLILEIVTGKKNISFYN-SDRGEDLLSYAWRHWRDGTPLELLDPNL-RDSYAKAEVTRCV  579

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             HIGLLCVQE+ DERPTM+ +VLMLSSYS    + P+ PAF  + S ++ M  ++ E S
Sbjct  580   HIGLLCVQENPDERPTMQSIVLMLSSYSV-TMALPQMPAFVLHSSTELNMPSLTTESS  636



>ref|XP_010087722.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
 gb|EXB29710.1| Cysteine-rich receptor-like protein kinase 25 [Morus notabilis]
Length=667

 Score =   466 bits (1198),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 230/380 (61%), Positives = 296/380 (78%), Gaps = 12/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I    FLR R  KK N      D  GEI+  ESLQ+D ATI+L TN FS +NK+GEG
Sbjct  294   VLLIFGFCFLRKRGEKKYNAVDNKND--GEITTIESLQFDLATIELATNKFSAENKLGEG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V+KG+L   ++IA+KRLS+SS QG +EFKNEV ++AKLQH+NLVRLLG+C + EEK
Sbjct  352   GFGEVFKGILHDEKQIAVKRLSKSSVQGAEEFKNEVVLLAKLQHRNLVRLLGFCLEGEEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLDYFL+D E+Q  L+WS+R+KII GIARG+LYLHEDS+LRIIHRDLK S
Sbjct  412   LLVYEFVPNKSLDYFLYDPEKQGELDWSRRHKIIGGIARGILYLHEDSQLRIIHRDLKAS  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +++PKI+DFGMA+IF +DQTQGNTSRIVGTYGYMSPEYAM G+FS+KSD +SFG
Sbjct  472   NILLDADVNPKISDFGMARIFEVDQTQGNTSRIVGTYGYMSPEYAMHGQFSIKSDAYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ ++ A+DLLSYAW+ W++GTP+++LDP L   SY+ NEV++C+
Sbjct  532   VLILEIISGKKNSSFYQ-SDYAEDLLSYAWKLWKEGTPLKLLDPTLM-DSYSENEVVKCI  589

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED ++RPTM+ +VLM +SYS      P +PAFY      +P  E+  + S +
Sbjct  590   HIGLLCVQEDPEDRPTMKTIVLMFNSYSV-TLPVPEKPAFYNRTESDMPAMEMKYDQSPS  648

Query  420   VS------DEASTIGKLCPR  379
              +      +EAS I +L PR
Sbjct  649   TAGYPLSVNEAS-ITELYPR  667



>ref|XP_007157184.1| hypothetical protein PHAVU_002G049500g [Phaseolus vulgaris]
 gb|ESW29178.1| hypothetical protein PHAVU_002G049500g [Phaseolus vulgaris]
Length=719

 Score =   467 bits (1202),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 235/381 (62%), Positives = 295/381 (77%), Gaps = 14/381 (4%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI  + FL  R  KK + K +  +V  +I+  ESLQ+ F TI+  TN FS DNK+GEG
Sbjct  346   LLFIVGICFLSRRARKKASAK-EGKNVD-DITTLESLQFGFGTIEAATNNFSADNKLGEG  403

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V+KG LPSGQ IA+KRLS+SSGQG +EFKNEV VVAKLQH+NLVRLLG+C + EEK
Sbjct  404   GFGEVFKGTLPSGQVIAVKRLSKSSGQGGEEFKNEVVVVAKLQHRNLVRLLGFCLQGEEK  463

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDY LFD E+Q  L+W +RYKII+G ARG  YLHEDSRLRIIHRDLK S
Sbjct  464   ILVYEYVPNKSLDYTLFDPEKQSELDWRRRYKIIQGTARGTQYLHEDSRLRIIHRDLKAS  523

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFG+DQTQGNT RIVGTYGYM+PEYAM GEFSVKSDV+SFG
Sbjct  524   NILLDGDMNPKISDFGMARIFGVDQTQGNTDRIVGTYGYMAPEYAMHGEFSVKSDVYSFG  583

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EIISGKKN + YQ T+ A+DLLSYAW  W+DGTP+E++DP+L + SY  NE+I+ +
Sbjct  584   VLLMEIISGKKNSSFYQ-TDGAEDLLSYAWLLWKDGTPLELMDPIL-RESYNQNEIIRSI  641

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM-------REI  442
             HIGLLCVQED ++RPTM  +VLML S +T    TP+ PAF+ +      M       + I
Sbjct  642   HIGLLCVQEDPEDRPTMATIVLMLDS-NTVTLPTPKRPAFFIHSGTDATMPKGQQFDQSI  700

Query  441   SLELSVTVSDEASTIGKLCPR  379
             +  L ++++D   +I ++ PR
Sbjct  701   TKSLPMSIND--VSISEMDPR  719



>ref|XP_009340923.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=694

 Score =   466 bits (1199),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 232/381 (61%), Positives = 303/381 (80%), Gaps = 11/381 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R  +K+     T + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  318   LLFV-VGYCCITRRVRKKYNAAATNEPSGENDITTVESLQFDFATIQAATSNFSDDHKLG  376

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L  GQE+A+KRLS++SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  377   EGGFGQVYKGILSDGQEVAVKRLSKNSGQGSEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  436

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  437   EKILVYEYVPNKSLDRFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  496

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M+PKI+DFGMA+IFG+DQ+Q NTSRIVGTYGYMSPEYAM G+FS+KSD++S
Sbjct  497   ASNILLDGEMNPKISDFGMARIFGVDQSQANTSRIVGTYGYMSPEYAMHGQFSIKSDMYS  556

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDG  +E+LDP L + SY+  EVI+
Sbjct  557   FGVLVLEIISGKKNSNFFQ-TDIAEDLTSHAWKLWRDGRSLELLDPCL-RDSYSRTEVIR  614

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGS-GKVPMREISLE  433
             CVHIGLLCVQED  +RPTM+ +VLML+SYS  +  +P++PAF+ R+G+ G +   ++  +
Sbjct  615   CVHIGLLCVQEDPTDRPTMQSLVLMLNSYSV-SLPSPKQPAFFLRSGAVGSMSDPKLESD  673

Query  432   LSVTVSDEA---STIGKLCPR  379
              S+T S ++    +I +L PR
Sbjct  674   QSITKSSQSVNEESITELYPR  694



>ref|XP_009357379.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=669

 Score =   465 bits (1197),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 225/370 (61%), Positives = 286/370 (77%), Gaps = 5/370 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+     +  R  KK N        +GE  I+  ESLQ+ FATIQ  T+ FS D+K+G
Sbjct  292   LLFVVGYCCITRRARKKYNLAAAADQPSGENDITTVESLQFHFATIQAATSNFSDDHKLG  351

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  352   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  411

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLD FLFD E+Q  L+WS RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  412   EKILVYEYVPNKSLDCFLFDPEKQGQLDWSTRYKIISGIARGIMYLHEDSRLRIIHRDLK  471

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGTYGYMSPEYAM G FSVKSD++S
Sbjct  472   ASNILLDGEMHPKISDFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYS  531

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+ A+DL+S+AW+ WRDG P+E+LDP L + SY+  EVI+
Sbjct  532   FGVLVLEIISGKKNSYFFQ-TDAAEDLMSHAWKLWRDGAPLELLDPCL-RDSYSRTEVIR  589

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ +VLML+SYS  +   P+ PAF+        M E +L+ +
Sbjct  590   CIHIGLLCVQEDPADRPTMQSIVLMLNSYSV-SLPLPQRPAFFLQSRAMGNMLEATLDST  648

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  649   QSISKSSPSV  658



>emb|CDP20318.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   465 bits (1197),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/378 (62%), Positives = 284/378 (75%), Gaps = 9/378 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL +  ++ +R R+ K+ +  ++ TD + + S  ESLQY  + IQ ITN FS +NKIGEG
Sbjct  306   LLLVGFIFLIR-RSRKRYDAIVEATDAS-QFSTPESLQYSLSLIQAITNNFSAENKIGEG  363

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +GQEIA+KRLSRSS QG +EFKNE+ +VA LQH+NLVRLLG+C + EEK
Sbjct  364   GFGHVYKGTLQNGQEIAVKRLSRSSMQGLEEFKNEILLVANLQHRNLVRLLGFCFEGEEK  423

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD FLFD E+QH+L+WS+RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  424   LLIYEFVPNKSLDCFLFDPEKQHMLDWSRRYKIIAGIARGLLYLHEDSRLRIIHRDLKAS  483

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA++FG DQ+   T  I GTYGYMSPEYAM G FS KSDVFSFG
Sbjct  484   NILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFG  543

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKKN + YQ ++ AQDLLS+ W+ WRDGTP+ +LDP+L  SS   NEVIQ +
Sbjct  544   VLVLEIVTGKKNSSFYQ-SDGAQDLLSHCWKNWRDGTPVALLDPILGNSS-ARNEVIQSI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED DERP M  VVLMLSS S     TP  PAF+     +    E   + S +
Sbjct  602   HIGLLCVQEDVDERPNMASVVLMLSSRSA-TLPTPDRPAFFVRSKTESFPSEFQFDASTS  660

Query  420   VSDEAS----TIGKLCPR  379
              S  AS    T+ +L PR
Sbjct  661   NSMPASVNETTVTELYPR  678



>ref|XP_003638035.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=657

 Score =   463 bits (1192),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL + V +  +    KK ++  Q      +IS  ESL++D +T++  TN FS  NK+GEG
Sbjct  300   LLIVGVCFLSKRAWKKKHDSAAQDPKTETDISTVESLRFDLSTLEEATNKFSEANKLGEG  359

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LPSGQEIA+KRLS+ SGQG ++FKNEVE+VA+LQH+NL RLLG+C +REEK
Sbjct  360   GFGEVYKGSLPSGQEIAVKRLSKHSGQGGEQFKNEVELVAQLQHRNLARLLGFCLEREEK  419

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDY LFD E+Q +L+W++RYKII GIARG+ YLHEDSRL+IIHRDLK S
Sbjct  420   ILVYEFVANKSLDYILFDPEKQRLLDWTRRYKIIGGIARGIQYLHEDSRLKIIHRDLKAS  479

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMAK+FG+DQTQGNTSRIVGTYGYMSPEYAM GEFS+KSDV+SFG
Sbjct  480   NILLDGDMNPKISDFGMAKLFGVDQTQGNTSRIVGTYGYMSPEYAMHGEFSIKSDVYSFG  539

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+++EIISGKK+ N++  T  A DL++YAW+ W++GTP+E++D  + + SYT NE I+C+
Sbjct  540   VLVMEIISGKKS-NSFYETGVADDLVTYAWKLWKNGTPLELVDHTV-RESYTPNEAIRCI  597

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED ++RPTM  VVLML S+ T     P++PAF+ +      M  I +  S T
Sbjct  598   HIGLLCVQEDPEDRPTMATVVLMLDSF-TVTLPVPKQPAFFLHSGTDSNMPTIQISQSTT  656



>ref|XP_003637976.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|KEH43946.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=661

 Score =   463 bits (1192),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/360 (61%), Positives = 282/360 (78%), Gaps = 3/360 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL + V +  +    KK ++  Q      +IS  ESL++D +T++  TN FS  NK+GEG
Sbjct  304   LLIVGVCFLSKRAWKKKHDSAAQDPKTETDISTVESLRFDLSTLEEATNKFSEANKLGEG  363

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LPSGQEIA+KRLS+ SGQG ++FKNEVE+VA+LQH+NL RLLG+C +REEK
Sbjct  364   GFGEVYKGSLPSGQEIAVKRLSKHSGQGGEQFKNEVELVAQLQHRNLARLLGFCLEREEK  423

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDY LFD E+Q +L+W++RYKII GIARG+ YLHEDSRL+IIHRDLK S
Sbjct  424   ILVYEFVANKSLDYILFDPEKQRLLDWTRRYKIIGGIARGIQYLHEDSRLKIIHRDLKAS  483

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMAK+FG+DQTQGNTSRIVGTYGYMSPEYAM GEFS+KSDV+SFG
Sbjct  484   NILLDGDMNPKISDFGMAKLFGVDQTQGNTSRIVGTYGYMSPEYAMHGEFSIKSDVYSFG  543

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+++EIISGKK+ N++  T  A DL++YAW+ W++GTP+E++D  + + SYT NE I+C+
Sbjct  544   VLVMEIISGKKS-NSFYETGVADDLVTYAWKLWKNGTPLELVDHTV-RESYTPNEAIRCI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED ++RPTM  VVLML S+ T     P++PAF+ +      M  I +  S T
Sbjct  602   HIGLLCVQEDPEDRPTMATVVLMLDSF-TVTLPVPKQPAFFLHSGTDSNMPTIQISQSTT  660



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score =   464 bits (1193),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 293/370 (79%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I+  ESLQ+ FATIQ  T+ FS D+K+G
Sbjct  300   LLFV-VGYCWITRRARKKYNQAAADEPSGENDITTAESLQFHFATIQAATSNFSDDHKLG  358

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  359   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGIEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  418

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+W++RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  419   EKILVYEYVLNKSLDCFLFDPEKQGQLDWTRRYKIISGIARGIMYLHEDSQLRIIHRDLK  478

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G+FSVKSD++S
Sbjct  479   ASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYS  538

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LDP L + SY+  EVI+
Sbjct  539   FGVLVLEIISGKKNSNFFQ-TDAAEDLSSHAWKLWRDGTSLELLDPCL-RDSYSRTEVIR  596

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  +   P++PAF+        M +ISLE  
Sbjct  597   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLPLPKQPAFFLQSRAVGNMPKISLESD  655

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  656   QSISKSSPSV  665



>ref|XP_008340068.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=668

 Score =   463 bits (1191),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 230/374 (61%), Positives = 293/374 (78%), Gaps = 10/374 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  292   LLFV-VGYCCITRRARKKYNQAAADEPSGENDITTVESLQFDFATIQAATSNFSDDHKLG  350

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  351   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  410

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  411   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  470

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G FSVKSD+ S
Sbjct  471   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGHFSVKSDLXS  530

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LD  L + SY+  EVI+
Sbjct  531   FGVLVLEIISGKKNSNFFQ-TDAAEDLASHAWKLWRDGTSLELLDQCL-RDSYSRTEVIR  588

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLE  433
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  +   P++PAF+      G +PM  I+LE
Sbjct  589   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLPLPKQPAFFLQSRTVGNMPM--ITLE  645

Query  432   LSVTVSDEASTIGK  391
                ++S  + ++ +
Sbjct  646   SDQSISKSSPSVNE  659



>ref|XP_008224859.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Prunus 
mume]
Length=668

 Score =   461 bits (1187),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 226/358 (63%), Positives = 280/358 (78%), Gaps = 4/358 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    FLR R  KK N  +Q  +V  EI++ ESLQ+D  TI+  T+ FS  N++GEG
Sbjct  292   LLFLVGCCFLRRRARKKYNV-IQQQNVGSEINSMESLQFDLRTIEAATDNFSDQNRLGEG  350

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP GQ+IA+KRLSR SGQG +EFKNEV +VAKLQH+NLVRLLG+C++ EEK
Sbjct  351   GFGEVYKGTLPDGQQIAVKRLSRGSGQGAEEFKNEVVLVAKLQHRNLVRLLGFCAEGEEK  410

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE V N SLD+FLFDSE    L+WS RYKII GIARGLLYLH+DS L+IIHRDLK S
Sbjct  411   ILVYELVENKSLDHFLFDSENHVKLDWSSRYKIIGGIARGLLYLHQDSPLKIIHRDLKAS  470

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILL+ +M+PKIADFGMA+I G+DQTQGNT RIVGT GYMSPEYAM G+FSVKSDV+S G
Sbjct  471   NILLNGDMNPKIADFGMARIVGVDQTQGNTRRIVGTIGYMSPEYAMHGQFSVKSDVYSLG  530

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKKN + Y  ++R +DLLSYAW  WRDGTP+E+LDP L + SY   EV +CV
Sbjct  531   VLILEIVTGKKNTSFYN-SDRGEDLLSYAWRHWRDGTPLELLDPNL-RDSYAKAEVTRCV  588

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             HIGLLCVQE  DERPTM+ +VLMLSSYS    + P++PA + +   ++ M  ++ E S
Sbjct  589   HIGLLCVQEIPDERPTMQSIVLMLSSYSV-TMALPQKPALFLHSRSELNMPSLTTESS  645



>ref|XP_004496789.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=670

 Score =   461 bits (1187),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI  + F   R +KK+    Q      +I+  ESL++D AT++  TN FS  NK+G+G
Sbjct  304   LLFIVGVCFFCKRAAKKKRDVAQEPRTETDITIVESLRFDLATLEKATNNFSEANKLGQG  363

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKGML SGQEIA+KRLS++SGQG +EFKNEV +VA+LQH+NL RLLG+C +REEK
Sbjct  364   GFGQVYKGMLSSGQEIAVKRLSKNSGQGGEEFKNEVMLVAQLQHRNLARLLGFCLEREEK  423

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDY LFD E+Q  L+W++RYKIIRGIARG+ YLHEDSRL+IIHRDLK S
Sbjct  424   ILVYEFVANKSLDYILFDPEKQSGLDWTRRYKIIRGIARGIQYLHEDSRLKIIHRDLKVS  483

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFGMAK+FG+DQTQGNTSR+VGTYGYMSPEYAM+GEFS+KSD++SFG
Sbjct  484   NILLDGNMNPKISDFGMAKLFGMDQTQGNTSRMVGTYGYMSPEYAMRGEFSIKSDIYSFG  543

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+++EIISGKKN  ++  T  A+DL+SYAW+ W++G+ +E++D  L K SYT NEVI+C+
Sbjct  544   VLIMEIISGKKNI-SFHETGVAEDLMSYAWKLWKNGSSLELVDDTL-KESYTPNEVIRCI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM  ++LML SY T +   P +PAF+ +       R+I +  S T
Sbjct  602   HIGLLCVQEDPADRPTMATIMLMLDSY-TVSLPLPIQPAFFLHSGTDPNTRKIEISESTT  660



>ref|XP_004496788.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=675

 Score =   461 bits (1186),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/360 (62%), Positives = 284/360 (79%), Gaps = 3/360 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI  + F   R +KK+    Q      +I+  ESL++D AT++  TN FS  NK+G+G
Sbjct  309   LLFIVGVCFFCKRAAKKKRDVAQEPRTETDITIVESLRFDLATLEKATNNFSEANKLGQG  368

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKGML SGQEIA+KRLS++SGQG +EFKNEV +VA+LQH+NL RLLG+C +REEK
Sbjct  369   GFGQVYKGMLSSGQEIAVKRLSKNSGQGGEEFKNEVMLVAQLQHRNLARLLGFCLEREEK  428

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDY LFD E+Q  L+W++RYKIIRGIARG+ YLHEDSRL+IIHRDLK S
Sbjct  429   ILVYEFVANKSLDYILFDPEKQSGLDWTRRYKIIRGIARGIQYLHEDSRLKIIHRDLKVS  488

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFGMAK+FG+DQTQGNTSR+VGTYGYMSPEYAM+GEFS+KSD++SFG
Sbjct  489   NILLDGNMNPKISDFGMAKLFGMDQTQGNTSRMVGTYGYMSPEYAMRGEFSIKSDIYSFG  548

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+++EIISGKKN  ++  T  A+DL+SYAW+ W++G+ +E++D  L K SYT NEVI+C+
Sbjct  549   VLIMEIISGKKNI-SFHETGVAEDLMSYAWKLWKNGSSLELVDDTL-KESYTPNEVIRCI  606

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM  ++LML SY T +   P +PAF+ +       R+I +  S T
Sbjct  607   HIGLLCVQEDPADRPTMATIMLMLDSY-TVSLPLPIQPAFFLHSGTDPNTRKIEISESTT  665



>ref|XP_009357385.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=662

 Score =   461 bits (1185),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 225/370 (61%), Positives = 289/370 (78%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+     T + + E  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  286   LLFV-VGYCCITRRARKKYNTAATNEPSSENDITTVESLQFDFATIQAATSNFSNDHKLG  344

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+S QG KEFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  345   EGGFGQVYKGTLSNGQEVAVKRLSRNSSQGTKEFKNEMVLVAKLQHRNLVRLLGFCLEGE  404

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  405   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  464

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGTYGYMSPEYAM G FSVKSD++S
Sbjct  465   ASNILLDGEMHPKISDFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYS  524

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+ A+DL+S+AW+ WRDG P+E+LDP L + SY+  EVI+
Sbjct  525   FGVLVLEIISGKKNSYFFQ-TDAAEDLMSHAWKLWRDGAPLELLDPCL-RDSYSRTEVIR  582

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SY+      P++PAF+        M E +L+ +
Sbjct  583   CIHIGLLCVQEDPVDRPTMQSVVLMLNSYAV-TLPLPQQPAFFLQSRAMGNMSEATLDSA  641

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  642   QSISKSSLSV  651



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score =   461 bits (1185),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 292/370 (79%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I+  ESLQ+ FATIQ  T+ FS D+K+G
Sbjct  287   LLFV-VGYCWITRRARKKYNQAAADEPSGENDITTAESLQFHFATIQAATSNFSDDHKLG  345

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  346   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGIEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  405

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+W++RYKII GIARG+LYLHEDS+LRIIHRDLK
Sbjct  406   EKILVYEYVLNKSLDCFLFDPEKQGQLDWTRRYKIISGIARGILYLHEDSQLRIIHRDLK  465

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G+FSVKSD++S
Sbjct  466   ASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDLYS  525

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LD  L + SY+  EVI+
Sbjct  526   FGVLVLEIISGKKNSNFFQ-TDAAEDLASHAWKLWRDGTSLELLDLCL-RDSYSRTEVIR  583

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  +   P++PAF+        M +ISLE  
Sbjct  584   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLPLPKQPAFFLQSRAVGNMPKISLESD  642

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  643   QSISKSSLSV  652



>ref|XP_008349286.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   460 bits (1183),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/374 (61%), Positives = 291/374 (78%), Gaps = 10/374 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I   ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  288   LLFV-VGYCCITRRARKKYNQAAADEPSGENDIXTVESLQFDFATIQAATSNFSDDHKLG  346

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLS +SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  347   EGGFGQVYKGTLSNGQEVAVKRLSXNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  406

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDS LRIIHRDLK
Sbjct  407   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSXLRIIHRDLK  466

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G FSVKSD+FS
Sbjct  467   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGHFSVKSDLFS  526

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LD  L + SY+  EVI+
Sbjct  527   FGVLVLEIISGKKNSNFFQ-TDAAEDLASHAWKLWRDGTSLELLDQCL-RDSYSRTEVIR  584

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLE  433
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  +   P++PAF+      G +PM  I+LE
Sbjct  585   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLPLPKQPAFFLQSRTVGNMPM--ITLE  641

Query  432   LSVTVSDEASTIGK  391
                ++S  + ++ +
Sbjct  642   SDQSISKSSPSVNE  655



>ref|XP_009340921.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=670

 Score =   460 bits (1184),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/370 (61%), Positives = 289/370 (78%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y  R R ++K+     T + + E  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  294   LLFV-VGYCCRTRRARKKYNTAATNEPSSENDITTVESLQFDFATIQAATSNFSNDHKLG  352

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L + QE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  353   EGGFGQVYKGTLSNSQEVAVKRLSRNSSQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  412

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDSRL+IIHRDLK
Sbjct  413   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLKIIHRDLK  472

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGTYGYMSPEYAM G FSVKSD++S
Sbjct  473   ASNILLDGEMHPKISDFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHFSVKSDLYS  532

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+ A+DL+S+AW+ WRDG P+E+LDP L + SY+  EVI+
Sbjct  533   FGVLMLEIISGKKNSYFFQ-TDAAEDLMSHAWKLWRDGAPLELLDPCL-RDSYSRTEVIR  590

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SYS      P++PAF+        M E +L+ +
Sbjct  591   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPQQPAFFLQSRAMGNMLEATLDSA  649

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  650   QSISKSSLSV  659



>ref|XP_006383962.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
 gb|ERP61759.1| hypothetical protein POPTR_0004s02500g [Populus trichocarpa]
Length=673

 Score =   460 bits (1184),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 285/379 (75%), Gaps = 10/379 (3%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF     FLR R  +K    ++  DV  EIS EESLQ+D +TI+  TN FSPDNK+GEGG
Sbjct  299   LFCLGFGFLR-RRGRKNRDSVKEKDVGDEISTEESLQFDLSTIEAATNNFSPDNKLGEGG  357

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG  P+GQ IA+KRLS+ SG G  EFKNE+ +VAKLQH+NLVRLLGYC + EEK+
Sbjct  358   FGEVYKGTFPNGQHIAVKRLSKYSGHGAAEFKNEIVLVAKLQHRNLVRLLGYCLEGEEKL  417

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFVPN SLDYFLFD  +Q +L+W  RYKII GIARGLLYLHEDSRLRIIHRDLK SN
Sbjct  418   LIYEFVPNKSLDYFLFDPAKQGLLDWLSRYKIIGGIARGLLYLHEDSRLRIIHRDLKASN  477

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD  M+P+IADFG+AKIFG+DQ+QG TSRI GT+GYMSPEYAM G++SVKSDV+SFGV
Sbjct  478   VLLDGEMNPRIADFGVAKIFGVDQSQGITSRIAGTFGYMSPEYAMHGQYSVKSDVYSFGV  537

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ+ N   DLL YAW+QW++G  +E++DP L   SY+ NE+ +C+H
Sbjct  538   LILEIISGKKNSSFYQSDN-GMDLLRYAWQQWKNGAALELVDPSLG-DSYSRNEITRCLH  595

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLELSV  424
             I LLCVQED ++RPT+  VVLML+S+S  +   PREP+ +        +P+ E+  + S 
Sbjct  596   IALLCVQEDPNDRPTLTSVVLMLTSFSI-SLPLPREPSSFEQSMTISSLPLTELESDQSN  654

Query  423   TVSDEAS----TIGKLCPR  379
               S   S    +I +L PR
Sbjct  655   IKSKPLSVNDVSITELYPR  673



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score =   459 bits (1182),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 225/370 (61%), Positives = 290/370 (78%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  IS  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  288   LLFV-VGYCCITRRARKKYNQAAADEPSGENDISTVESLQFDFATIQAATSNFSDDHKLG  346

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLS +SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  347   EGGFGQVYKGTLSNGQEVAVKRLSXNSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  406

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  407   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  466

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM G FSVKSD++S
Sbjct  467   ASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGXFSVKSDLYS  526

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDG  +E+LD  + + SY+  EVI+
Sbjct  527   FGVLVLEIISGKKNSNFFQ-TDAAEDLASHAWKLWRDGKSLELLDQCM-RDSYSRTEVIR  584

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLML+SYS  + + P+ PAF+        M +I+LE  
Sbjct  585   CIHIGLLCVQEDPADRPTMQSVVLMLNSYSV-SLALPKXPAFFLQSRAVGNMPKITLESD  643

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  644   QSISKSSPSV  653



>ref|XP_006388606.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
 gb|ERP47520.1| hypothetical protein POPTR_0138s00200g [Populus trichocarpa]
Length=505

 Score =   454 bits (1168),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 223/380 (59%), Positives = 286/380 (75%), Gaps = 9/380 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L  ++ Y    + ++K+   +Q  +V  EI++ +SLQ+   TI+  TN F+ +NKIG+G
Sbjct  129   VLLFSLCYCYVHKKARKEYNAIQEGNVGDEITSVQSLQFQLGTIEAATNNFAEENKIGKG  188

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VY+G LP+GQ IA+KRLS++SGQG  EFKNEV +VA+LQH+NLVRLLGYC + EEK
Sbjct  189   GFGDVYRGTLPNGQHIAVKRLSKNSGQGAAEFKNEVVLVARLQHRNLVRLLGYCLEGEEK  248

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD  +Q +L WS RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  249   ILIYEFVPNKSLDYFLFDPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  308

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+PKIADFGMAKIFG DQ+QGNTS+I GT+GYM PEYAM G+FSVKSDV+SFG
Sbjct  309   NVLLDGEMNPKIADFGMAKIFGGDQSQGNTSKIAGTFGYMPPEYAMHGQFSVKSDVYSFG  368

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ+ N   DL+SYAW+QW++G  +E++D      SY+ NE+ +CV
Sbjct  369   VLILEIISGKKNSSFYQSDN-GLDLVSYAWKQWKNGAVLELMDSSFG-DSYSRNEITRCV  426

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG--KVPMREISLELS  427
             HIGLLCVQED ++RPT+  +VLML+S+S      PREPA++       K P  E+  + S
Sbjct  427   HIGLLCVQEDPNDRPTLSTIVLMLTSFSV-TLPLPREPAYFGQSRTVPKFPTTELESDRS  485

Query  426   VTVSDEAS----TIGKLCPR  379
              + S   S    +I +L PR
Sbjct  486   TSKSKPLSVNDMSITELYPR  505



>ref|XP_010646899.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=668

 Score =   459 bits (1181),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 218/344 (63%), Positives = 279/344 (81%), Gaps = 4/344 (1%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGY  1315
             F+   +  R R +KK+ +  +   V  +I+  +SLQ+DF T++  TN FS DNKIGEGG+
Sbjct  295   FLCYCWLNRKRKAKKKYSSTEEEKVENDITTVQSLQFDFGTLEAATNNFSDDNKIGEGGF  354

Query  1314  GSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKIL  1135
             G VYKG L SG+EIAIKRLSRSS QG  EFKNEV +VAKLQH+NLVRLLG+C + EEKIL
Sbjct  355   GDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKIL  414

Query  1134  IYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNI  955
             +YE+VPN SLD FLFD ++Q  L+WS+RYKII GIARG+LYLHEDS+L++IHRDLK SN+
Sbjct  415   VYEYVPNKSLDCFLFDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQLKVIHRDLKASNV  474

Query  954   LLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVM  775
             LLD +M+PKI+DFGMA+IFG DQT+G+T R+VGTYGYMSPEYAM+G FS KSDV+SFGV+
Sbjct  475   LLDGDMNPKISDFGMARIFGGDQTRGSTKRVVGTYGYMSPEYAMRGHFSAKSDVYSFGVL  534

Query  774   LLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHI  595
             +LEIISGKK  + Y+ +++ +DLL YAW+ WRDGTP+E++DP++ + SY  NEVI+C+H+
Sbjct  535   VLEIISGKKISHFYE-SDQTEDLLGYAWKLWRDGTPLELMDPIM-RDSYARNEVIRCIHM  592

Query  594   GLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             GLLCVQED D+RP+M  VVLMLSSYS      P++PAF+  GSG
Sbjct  593   GLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPAFFI-GSG  634



>gb|KCW75412.1| hypothetical protein EUGRSUZ_E04171 [Eucalyptus grandis]
Length=391

 Score =   449 bits (1155),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 220/370 (59%), Positives = 280/370 (76%), Gaps = 7/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L   +   LR R  KK +  ++  D   E++  ESLQ+D ATIQ  TN FSP NK+GEG
Sbjct  15    VLVFLICCLLR-RKGKKTHEVVKGKDGANELTTMESLQFDLATIQAATNDFSPKNKLGEG  73

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP GQ+IA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+C + +EK
Sbjct  74    GFGEVFQGRLPDGQQIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEK  133

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLDYFLFD ++   L WS RYKI+ GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  134   LLAYEFVPNKSLDYFLFDPQKSSQLNWSLRYKIVSGIARGMLYLHEDSRLRIIHRDLKCS  193

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+PKI+DFGMA+IFG+DQT  + ++IVGT+GYMSPEYAM GEFSVKSDV+SFG
Sbjct  194   NVLLDSEMNPKISDFGMARIFGVDQTLASINKIVGTFGYMSPEYAMHGEFSVKSDVYSFG  253

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EII GKKN N Y   +  + L SY W +WRDGT +++LDP +   SY+ +EV++C+
Sbjct  254   VLLIEIICGKKN-NFYHQLDGGEYLASYVWNKWRDGTALKVLDPAIM-DSYSRDEVLRCL  311

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLC+QED   RPTM DVVLMLSS +  N   PR PAF+   R+G   +PM+E+    
Sbjct  312   HIGLLCIQEDPAIRPTMADVVLMLSS-NYFNPPLPRHPAFFIRSRSGGVSIPMKELGSNQ  370

Query  429   SVTVSDEAST  400
             S + +  +ST
Sbjct  371   STSRTMPSST  380



>ref|XP_002304949.2| hypothetical protein POPTR_0004s02440g [Populus trichocarpa]
 gb|EEE85460.2| hypothetical protein POPTR_0004s02440g [Populus trichocarpa]
Length=354

 Score =   447 bits (1151),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 216/340 (64%), Positives = 267/340 (79%), Gaps = 5/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF     FLR   ++K    +   DV  EI+ EESLQ+D +TI+  TN FS DNK+GEGG
Sbjct  13    LFCMCFCFLR--RARKTRDYVPENDVGDEITTEESLQFDLSTIEAATNNFSADNKLGEGG  70

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VY+G LP+GQ+IA+KRLSR+SGQG  EFKNEV +VAKLQH+NL R+ G+C + EE I
Sbjct  71    FGEVYRGTLPNGQQIAVKRLSRNSGQGAAEFKNEVVLVAKLQHRNLARVQGFCLEGEENI  130

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             ++YEFV N SLDYFLFD ERQ +L+WS+RYKII GIA G+LYLHEDSRLRIIHRDLK SN
Sbjct  131   IVYEFVCNKSLDYFLFDPERQGLLDWSRRYKIIGGIALGILYLHEDSRLRIIHRDLKASN  190

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKI+DFGMA+IF +DQ+Q +T RIVGTYGYMSPEYAM G FSVKSDV+SFGV
Sbjct  191   ILLDGDMNPKISDFGMARIFVVDQSQASTIRIVGTYGYMSPEYAMHGRFSVKSDVYSFGV  250

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKN + YQT   A DL+SY W+ WRDGT +E+LDP L   +Y+ NEVI+C+H
Sbjct  251   LILEIITGKKNSSFYQTGG-AADLVSYVWKHWRDGTQLEVLDPTLT-DTYSRNEVIRCIH  308

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +GLLCVQED   RP M  +VL L+S S     +P+EPAF+
Sbjct  309   VGLLCVQEDPAIRPAMATIVLTLNSNSV-TLPSPQEPAFF  347



>ref|XP_002518553.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43940.1| ATP binding protein, putative [Ricinus communis]
Length=674

 Score =   459 bits (1180),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 223/364 (61%), Positives = 283/364 (78%), Gaps = 7/364 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
               F+   Y LR R  KK +   Q  D   EI+  ESLQ D  TI+  T+ FS  NK+GEG
Sbjct  300   FFFLGCCY-LRRRARKKYDAG-QEDDAGNEITTVESLQIDLNTIEAATDKFSAANKLGEG  357

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQEIA+K+LSRSS QG +EFKNEV ++AKLQH+NLVRLLG+C +  EK
Sbjct  358   GFGKVYKGTLPNGQEIAVKKLSRSSVQGAQEFKNEVVLLAKLQHRNLVRLLGFCLEGAEK  417

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFD+++Q  L+W  RYKI+ GIARG++YLHEDS+L+IIHRDLK S
Sbjct  418   ILVYEFVPNKSLDYFLFDAKKQGQLDWQTRYKIVGGIARGIIYLHEDSQLKIIHRDLKVS  477

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFG+DQTQGNT+RIVGTYGYMSPEYAM G FSVKSD++SFG
Sbjct  478   NILLDKDMNPKISDFGMARIFGVDQTQGNTNRIVGTYGYMSPEYAMHGHFSVKSDIYSFG  537

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII GKKN + Y+  + A DL+SY W  W+DGTP+E++DPVL K SY+ NEV++C+
Sbjct  538   VLVLEIICGKKNSSFYE-IHGASDLVSYVWTHWKDGTPMEVVDPVL-KDSYSRNEVLRCI  595

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGK--VPMREISLELS  427
              IGLLCVQEDA +RPTM  ++LML+S+S      PR+PAF+ + S +  +PM  +  + S
Sbjct  596   QIGLLCVQEDATDRPTMATIMLMLNSFSV-TLPVPRQPAFFLHSSSEPTMPMEGLQSDKS  654

Query  426   VTVS  415
              T S
Sbjct  655   TTKS  658



>ref|XP_010648190.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=681

 Score =   458 bits (1178),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/380 (60%), Positives = 294/380 (77%), Gaps = 11/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             + +I    F+  +  KK NT+ +  +V  +I+  +SLQ+DF T+Q  TN FS DNKIG+G
Sbjct  307   IFYILCYCFISRKARKKYNTEEE--NVENDITTVQSLQFDFGTLQAATNNFSDDNKIGQG  364

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SGQEIAIKRLSRSS QG  EFKNE+ +VAKLQH+NLVRLLG+C + EEK
Sbjct  365   GFGDVYKGTLSSGQEIAIKRLSRSSVQGAVEFKNEIVLVAKLQHRNLVRLLGFCLEGEEK  424

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLD F+FD ++Q  L+WS+RY II GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  425   ILVYEYVPNKSLDCFVFDPDKQGQLDWSRRYNIIGGIARGVLYLHEDSRLRVIHRDLKAS  484

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+I G+DQTQGNT+R+VGTYGYMSPEYAM+G FS KSDV+SFG
Sbjct  485   NVLLDGDMNPKISDFGMARIVGVDQTQGNTNRVVGTYGYMSPEYAMRGHFSAKSDVYSFG  544

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + Y+ + + + L SYAW+ WRDGTP+E++DP++   SY  NEVI+C+
Sbjct  545   VLVLEIISGKKNGSFYE-SGQTEGLPSYAWKLWRDGTPLELMDPMMG-DSYARNEVIRCI  602

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGS-GKVPMREISLELS  427
             H+GLLCVQED D+RP+M  VVLMLSSYS      P++PAF+ R+G+    P+  +  + S
Sbjct  603   HMGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPAFFIRSGTQSGFPINALESDQS  661

Query  426   VTVSDEAS----TIGKLCPR  379
              + S   S    +I +L PR
Sbjct  662   ASKSTPWSLNETSISELYPR  681



>ref|XP_010648189.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=682

 Score =   458 bits (1178),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 227/380 (60%), Positives = 293/380 (77%), Gaps = 10/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             + +I    F+  +  KK NT+ +   V  +I+  +SLQ+DF T+Q  TN FS DNKIG+G
Sbjct  307   IFYILCYCFISRKARKKYNTE-EENAVENDITTVQSLQFDFGTLQAATNNFSDDNKIGQG  365

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SGQEIAIKRLSRSS QG  EFKNE+ +VAKLQH+NLVRLLG+C + EEK
Sbjct  366   GFGDVYKGTLSSGQEIAIKRLSRSSVQGAVEFKNEIVLVAKLQHRNLVRLLGFCLEGEEK  425

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLD F+FD ++Q  L+WS+RY II GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  426   ILVYEYVPNKSLDCFVFDPDKQGQLDWSRRYNIIGGIARGVLYLHEDSRLRVIHRDLKAS  485

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+I G+DQTQGNT+R+VGTYGYMSPEYAM+G FS KSDV+SFG
Sbjct  486   NVLLDGDMNPKISDFGMARIVGVDQTQGNTNRVVGTYGYMSPEYAMRGHFSAKSDVYSFG  545

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + Y+ + + + L SYAW+ WRDGTP+E++DP++   SY  NEVI+C+
Sbjct  546   VLVLEIISGKKNGSFYE-SGQTEGLPSYAWKLWRDGTPLELMDPMMG-DSYARNEVIRCI  603

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGS-GKVPMREISLELS  427
             H+GLLCVQED D+RP+M  VVLMLSSYS      P++PAF+ R+G+    P+  +  + S
Sbjct  604   HMGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPAFFIRSGTQSGFPINALESDQS  662

Query  426   VTVSDEAS----TIGKLCPR  379
              + S   S    +I +L PR
Sbjct  663   ASKSTPWSLNETSISELYPR  682



>emb|CBI35672.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   458 bits (1179),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/346 (63%), Positives = 280/346 (81%), Gaps = 4/346 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F  + Y    R +KK+ +  +   V  +I+  +SLQ+DF T++  TN FS DNKIGEG
Sbjct  324   VIFSILCYCFICRKAKKKYSSTEEEKVENDITTVQSLQFDFGTLEAATNNFSDDNKIGEG  383

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SG+EIAIKRLSRSS QG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  384   GFGDVYKGTLSSGKEIAIKRLSRSSAQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  443

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLD FLFD ++Q  L+WS+RYKII GIARG+LYLHEDS+L++IHRDLK S
Sbjct  444   ILVYEYVPNKSLDCFLFDPDKQGQLDWSRRYKIIGGIARGILYLHEDSQLKVIHRDLKAS  503

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+PKI+DFGMA+IFG DQT+G+T R+VGTYGYMSPEYAM+G FS KSDV+SFG
Sbjct  504   NVLLDGDMNPKISDFGMARIFGGDQTRGSTKRVVGTYGYMSPEYAMRGHFSAKSDVYSFG  563

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKK  + Y+ +++ +DLL YAW+ WRDGTP+E++DP++ + SY  NEVI+C+
Sbjct  564   VLVLEIISGKKISHFYE-SDQTEDLLGYAWKLWRDGTPLELMDPIM-RDSYARNEVIRCI  621

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             H+GLLCVQED D+RP+M  VVLMLSSYS      P++PAF+  GSG
Sbjct  622   HMGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPAFFI-GSG  665



>ref|XP_009357380.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=671

 Score =   457 bits (1176),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 288/370 (78%), Gaps = 5/370 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +LF  V Y    R +K +  +    + +GE  I+  ESLQ+DF TIQ  T+ FS D+K+G
Sbjct  294   VLFFVVGYCCITRRAKYKYNEAAADEPSGENDITTVESLQFDFTTIQAATSNFSDDHKLG  353

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSR SGQG +EFKNE+ +V KLQH++LVRLLG+C + E
Sbjct  354   EGGFGQVYKGILSNGQEVAVKRLSRDSGQGAEEFKNEMVLVGKLQHRSLVRLLGFCLEGE  413

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YEFVPN SLDYFLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  414   EKILVYEFVPNKSLDYFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  473

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGT+GYMSPEYAM G FSVKSD++S
Sbjct  474   ASNILLDGEMHPKISDFGMARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSVKSDLYS  533

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+ A+DL+S+AW+ WRDGTP+++LDP L + SY   EVI+
Sbjct  534   FGVLVLEIISGKKNSYFFQ-TDPAEDLMSHAWKLWRDGTPLDLLDPCL-RDSYLRIEVIR  591

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLC+QE+  +RPTM+ V+LML+SYS      P++P F+        M E +L+ +
Sbjct  592   CIHIGLLCLQENPTDRPTMQSVILMLNSYSV-TMPLPQQPTFFLRSRAVGNMSEATLDSA  650

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  651   QSISKSSPSV  660



>ref|XP_009357560.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=564

 Score =   453 bits (1166),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 218/370 (59%), Positives = 290/370 (78%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R +K +  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  188   LLFV-VGYCCITRRAKYKYNEAAVDEPSGETDITTVESLQFDFATIQAATSNFSDDHKLG  246

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLS +S QG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  247   EGGFGQVYKGILSNGQEVAVKRLSMNSDQGVEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  306

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLD+FLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  307   EKILVYEYVPNKSLDHFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  366

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGT+GYMSPEYAM G FSVKSD++S
Sbjct  367   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYAMHGRFSVKSDLYS  426

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEII+GKKN   +Q T+ A+DLLS+AW+ W+DG P+E+LDP L + SY+  EVI+
Sbjct  427   FGVLVLEIITGKKNSYFFQ-TDAAEDLLSHAWKLWKDGAPLELLDPCL-RDSYSRTEVIR  484

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ ++LML+SYS      P++P F+        + E +++ +
Sbjct  485   CIHIGLLCVQEDPADRPTMQSLILMLNSYSL-TLPLPQQPTFFHQSRAVGNISEATMDSA  543

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  544   QSISKSSPSV  553



>ref|XP_010057745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=644

 Score =   456 bits (1173),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 285/364 (78%), Gaps = 8/364 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+A  +  R R + K +  +Q  D +G  EISN +SLQYD ATIQ  T+ FS  NK+G
Sbjct  271   LLFLACCF--RRRKAAKTHEAVQG-DQSGASEISNADSLQYDLATIQTATDNFSHQNKLG  327

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G V++G LP+GQ+IA+KRLS+SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + E
Sbjct  328   EGGFGKVFQGRLPNGQQIAVKRLSQSSGQGAQEFKNEVLLVAKLQHRNLVRLLGFCLEGE  387

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EK+L+YEFVPN SLDY LFD ++   L+WS+RYKI+ GIARG+LYLHEDSRLRIIHRDLK
Sbjct  388   EKLLVYEFVPNKSLDYCLFDPKKSKELDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLK  447

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M+PKI+DFGMA+I G+DQTQ NT++IVGT+GYMSPEYAM G+FSVKSDV+S
Sbjct  448   ASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYS  507

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV+LLE++SGKKN + +   +  +DL SYAW+ WRDG P+E+LDP +    Y+ +EV++
Sbjct  508   FGVLLLELVSGKKN-SFFFDKDGGEDLASYAWKNWRDGKPLEVLDPTIG-DLYSRDEVLR  565

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM  VVLMLSSYS  + + P +PAF+     + PM  +  + S
Sbjct  566   CLHIGLLCVQEDPMDRPTMASVVLMLSSYSV-SLAQPLQPAFFLRSRTERPMTNLESDQS  624

Query  426   VTVS  415
              + S
Sbjct  625   TSRS  628



>ref|XP_007214583.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
 gb|EMJ15782.1| hypothetical protein PRUPE_ppa026781mg [Prunus persica]
Length=659

 Score =   456 bits (1174),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 223/356 (63%), Positives = 279/356 (78%), Gaps = 4/356 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    FLR R ++K+   +Q  +V  EI++ ESLQ+D  TI+  T+ FS  N++GEG
Sbjct  283   LLFLVGCCFLR-RRARKKYKVIQQQNVGSEINSVESLQFDLRTIEAATDNFSDQNRLGEG  341

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP GQ+IA+KRLSR SGQG +EFKNEV +VAKLQH+NLVRLLG+C++ EEK
Sbjct  342   GFGEVYKGTLPDGQQIAVKRLSRGSGQGAEEFKNEVVLVAKLQHRNLVRLLGFCAEGEEK  401

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE V N SLD+FLFDSE    L+WS RYKII GIARGLLYLH+DS L+IIHRDLK S
Sbjct  402   ILVYELVENKSLDHFLFDSENPVKLDWSSRYKIIGGIARGLLYLHQDSPLKIIHRDLKAS  461

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILL+ +M+PKIADFGMA+I G+DQTQGNT RIVGT GYMSPEYAM G+FSVKSDV+S G
Sbjct  462   NILLNGDMNPKIADFGMARIVGVDQTQGNTRRIVGTIGYMSPEYAMHGQFSVKSDVYSLG  521

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKKN + Y  ++R +DLLSYAW  WRDGTP+E+LDP L + SY   EV +CV
Sbjct  522   VLILEIVTGKKNTSFYN-SDRGEDLLSYAWRHWRDGTPLELLDPNL-RDSYAKAEVTRCV  579

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLE  433
             HIGLLCVQE  DERPTM+ VVLMLSSYS    + P++P  + +   ++ M  ++ E
Sbjct  580   HIGLLCVQEIPDERPTMQSVVLMLSSYSV-TMALPQKPVLFLHSGTELNMPSLTTE  634



>gb|KCW75000.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=665

 Score =   456 bits (1174),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/364 (61%), Positives = 285/364 (78%), Gaps = 8/364 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+A  +  R R + K +  +Q  D +G  EISN +SLQYD ATIQ  T+ FS  NK+G
Sbjct  292   LLFLACCF--RRRKAAKTHEAVQG-DQSGASEISNADSLQYDLATIQTATDNFSHQNKLG  348

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G V++G LP+GQ+IA+KRLS+SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + E
Sbjct  349   EGGFGKVFQGRLPNGQQIAVKRLSQSSGQGAQEFKNEVLLVAKLQHRNLVRLLGFCLEGE  408

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EK+L+YEFVPN SLDY LFD ++   L+WS+RYKI+ GIARG+LYLHEDSRLRIIHRDLK
Sbjct  409   EKLLVYEFVPNKSLDYCLFDPKKSKELDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLK  468

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M+PKI+DFGMA+I G+DQTQ NT++IVGT+GYMSPEYAM G+FSVKSDV+S
Sbjct  469   ASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYS  528

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV+LLE++SGKKN + +   +  +DL SYAW+ WRDG P+E+LDP +    Y+ +EV++
Sbjct  529   FGVLLLELVSGKKN-SFFFDKDGGEDLASYAWKNWRDGKPLEVLDPTIG-DLYSRDEVLR  586

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM  VVLMLSSYS  + + P +PAF+     + PM  +  + S
Sbjct  587   CLHIGLLCVQEDPMDRPTMASVVLMLSSYSV-SLAQPLQPAFFLRSRTERPMTNLESDQS  645

Query  426   VTVS  415
              + S
Sbjct  646   TSRS  649



>emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]
Length=655

 Score =   456 bits (1173),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 225/379 (59%), Positives = 290/379 (77%), Gaps = 9/379 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             +F  + Y    R ++++    +  +V  +I+  +SLQ+DF T+Q  TN FS DNKIG+GG
Sbjct  280   IFYILCYCFISRKARQKYNTTEEENVENDITTVQSLQFDFGTLQAATNNFSDDNKIGQGG  339

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYK  L SGQEIAIKRLSRSS QG  EFKNE+ +VAKLQH+NLVRLLG+C + EEKI
Sbjct  340   FGDVYKVTLSSGQEIAIKRLSRSSVQGAVEFKNEIVLVAKLQHRNLVRLLGFCLEGEEKI  399

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLD FLFD ++Q  L+WS+RY II GIARG+LYLHEDSRLR+IHRDLK SN
Sbjct  400   LVYEYVPNKSLDCFLFDPDKQGQLDWSRRYMIIGGIARGILYLHEDSRLRVIHRDLKASN  459

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD +M+PKI+DFGMA+IFG+DQTQGNT+R+VGTYGYMSPEYAM G FS KSDV+SFGV
Sbjct  460   VLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGHFSAKSDVYSFGV  519

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN   Y+ + + + L SYAW+ WRDGTP+E++DP++   SY  NEVI+C+H
Sbjct  520   LVLEIISGKKNSRFYE-SGQTEGLPSYAWKLWRDGTPLELMDPMMG-DSYARNEVIRCIH  577

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGS-GKVPMREISLELSV  424
             +GLLCVQED D+RP+M  VVLMLSSYS      P++PAF+ R+G+    P+  +  + S 
Sbjct  578   MGLLCVQEDPDDRPSMASVVLMLSSYSV-TLPLPQQPAFFIRSGTQSGFPINALESDQSA  636

Query  423   TVSDEAS----TIGKLCPR  379
             + S   S    +I +L PR
Sbjct  637   SKSTPWSLNETSISELYPR  655



>ref|XP_004511332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=684

 Score =   456 bits (1174),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 272/340 (80%), Gaps = 4/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  + FL  R ++K    LQ      +I+N ESLQ+DFATI+  TN FS DNK+GEGG
Sbjct  311   LFIVAICFLSKR-ARKNRDSLQEGKTAYDITNVESLQFDFATIEAATNKFSADNKLGEGG  369

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L SGQEIA+KRLS+SSGQG +EFKNEV VVAKLQH+NL RLLG+C + EEKI
Sbjct  370   FGEVYKGTLTSGQEIAVKRLSKSSGQGGEEFKNEVVVVAKLQHRNLARLLGFCLQGEEKI  429

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDY LFD E+Q  L+W +R K+I+GIARG+ YLHEDSRLRIIHRDLK SN
Sbjct  430   LVYEYVPNKSLDYILFDPEKQRELDWGRRNKVIKGIARGMQYLHEDSRLRIIHRDLKASN  489

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKI+DFGMA+I G+DQTQGNTSRIVGTYGYM+PEYAM GEFSVKSDV+SFGV
Sbjct  490   ILLDGDMNPKISDFGMARIVGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFGV  549

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             +++EII+GKKN + Y  ++ A DLLSY W+ W++G P+E++DP L + S+  NEV++ +H
Sbjct  550   LIMEIITGKKNSSFYD-SDGADDLLSYTWKMWKEGAPLEMVDPTL-RESHNPNEVMRSIH  607

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQED  ERPTM  +VLML S +T     P++PA +
Sbjct  608   IGLLCVQEDPAERPTMASIVLMLDS-NTVTLPNPKQPASF  646



>ref|XP_008363779.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=678

 Score =   456 bits (1173),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 226/375 (60%), Positives = 288/375 (77%), Gaps = 13/375 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R +K +  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  302   LLFV-VGYCCITRRAKYKYNEAAADEPSGENDITTVESLQFDFATIQAATSNFSDDHKLG  360

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSR SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  361   EGGFGQVYKGILSNGQEVAVKRLSRDSGQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  420

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLDYFLFD E+Q  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  421   EKILVYEYVLNKSLDYFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  480

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGT+GYMSPEYAM G FSVKSD++S
Sbjct  481   ASNILLDGEMHPKISDFGMARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSVKSDMYS  540

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEI+SGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP L + SY+  EVI+
Sbjct  541   FGVLVLEIVSGKKNSYFFQ-TDPAEDLVSHAWKLWRDGTPLELLDPCL-RDSYSRTEVIR  598

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HI LLC+QE+  +RPTM+ V+LML+SY T     P++PAF+        M E      
Sbjct  599   CIHISLLCLQENPADRPTMQSVILMLNSY-TVTLPLPQQPAFFLRSRAVGNMLE------  651

Query  426   VTVSDEASTIGKLCP  382
              T  D A +I K  P
Sbjct  652   -TTQDSAQSISKSSP  665



>ref|XP_002518555.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43942.1| ATP binding protein, putative [Ricinus communis]
Length=671

 Score =   456 bits (1172),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 226/380 (59%), Positives = 289/380 (76%), Gaps = 12/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LF     +LR R  KK +   +  +   EI+  ESLQ D  T++  TN FS DNK+GEG
Sbjct  298   VLFSLAYCYLRRRPRKKYDAVQEDGN---EITTVESLQIDLNTVEAATNKFSADNKLGEG  354

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+GQEIA+K+LSRSSGQG +EFKNEV ++AKLQH+NLVRLLG+C +  EK
Sbjct  355   GFGEVYKGILPNGQEIAVKKLSRSSGQGAQEFKNEVVLLAKLQHRNLVRLLGFCLEGAEK  414

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFD E+Q  L+WS RYKI+ GIARG+LYLHEDS+LRI+HRDLK S
Sbjct  415   ILVYEFVSNKSLDYFLFDPEKQRQLDWSTRYKIVGGIARGILYLHEDSQLRIVHRDLKVS  474

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFG A+IFG+DQ+QGNT RIVGTYGYMSPEYAM G+FSVKSD++SFG
Sbjct  475   NILLDRNMNPKISDFGTARIFGVDQSQGNTKRIVGTYGYMSPEYAMHGQFSVKSDMYSFG  534

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII GKKN + Y+  + A DL+SY W+ WRDGTP+E++DPV+ K SY+ NEV++C+
Sbjct  535   VLILEIICGKKNSSFYE-IDGAGDLVSYVWKHWRDGTPMEVMDPVI-KDSYSRNEVLRCI  592

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF--YRNGSGKVPMREISLELS  427
              IGLLCVQED  +R TM  VVLML+S+S      P++PAF  +      +PM+ + L+ S
Sbjct  593   QIGLLCVQEDPADRLTMATVVLMLNSFSV-TLPVPQQPAFLIHSRSQPTMPMKGLELDKS  651

Query  426   VTVSDEAST----IGKLCPR  379
                S + S     I ++ PR
Sbjct  652   TPKSMQLSVDQEPITQIYPR  671



>gb|KHN02670.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=800

 Score =   459 bits (1182),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 225/374 (60%), Positives = 289/374 (77%), Gaps = 10/374 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTT------DVTGEISNEESLQYDFATIQLITNVFSPD  1339
             LLFI  +YFLR R SKK NT +Q +      D   ++ + ESLQ+D  T++  TN FS +
Sbjct  414   LLFIVGVYFLRKRASKKNNTFVQDSSNLSFADDLTDVGDVESLQFDLPTVEAATNRFSDE  473

Query  1338  NKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYC  1159
             NKIG+GG+G VYKG+LP+GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C
Sbjct  474   NKIGQGGFGVVYKGVLPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFC  533

Query  1158  SKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIH  979
              + +EKILIYE++PN SLDYFLFD  +Q  L+WS+RYKII GIARG+ YLHEDS+LRIIH
Sbjct  534   LEGQEKILIYEYIPNKSLDYFLFDPAKQKELDWSRRYKIIVGIARGIQYLHEDSQLRIIH  593

Query  978   RDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKS  799
             RDLK SN+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKS
Sbjct  594   RDLKASNVLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKS  653

Query  798   DVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVN  619
             DVFSFGV++LEI+SGKKN + YQ +N A DLLS+AW+ W   TP+E+LDP L + SY+ N
Sbjct  654   DVFSFGVLVLEIVSGKKNTDFYQ-SNHADDLLSHAWKNWTLQTPLELLDPTL-RGSYSRN  711

Query  618   EVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREIS  439
             EV +C+HIGLLCVQE+  +RP+M  + LML+SYS    S P++PA +  G G   + +  
Sbjct  712   EVNRCIHIGLLCVQENPSDRPSMATIALMLNSYSV-TMSMPQQPASFLRGRGPNRLNQ-G  769

Query  438   LELSVTVSDEASTI  397
             ++   + +D+++T 
Sbjct  770   MDSDQSTTDQSTTC  783



>ref|XP_004172413.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=666

 Score =   455 bits (1170),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 272/341 (80%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF     FLR R +K++N+ ++   V  E++  +SLQ+DF  I+  TN FS +NK+GEG
Sbjct  293   LLFFVGCCFLRQR-AKRRNSAVKEDSVVNEMTTADSLQFDFKKIEAATNKFSEENKLGEG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSV+KGML  GQEIA+KRLSR S QG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  352   GFGSVFKGMLEDGQEIAVKRLSRGSLQGSEEFKNEVMLVAKLQHRNLVRLLGFCLEGEEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEF+PN SLD+ LFD E Q  L W KRY+II GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  412   ILIYEFIPNKSLDFLLFDEEGQKQLNWLKRYRIINGIARGILYLHEDSRLRIIHRDLKAS  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ KI+DFGMA+I  +DQ+QGNTSRIVGTYGYMSPEYAM G FS+KSDV+SFG
Sbjct  472   NILLDEDMNAKISDFGMARIVQMDQSQGNTSRIVGTYGYMSPEYAMHGNFSMKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LE+ISG KN +T+  +N A+D+L+YAW  W+DG P+E+LDP L K SY+ NEV++C+
Sbjct  532   VLVLEMISGMKN-STFYLSNLAEDILTYAWALWKDGIPLELLDPTL-KDSYSRNEVLRCI  589

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQED + RP+M  +VLML+SYS      P+EPA +
Sbjct  590   HIALLCVQEDPNSRPSMASIVLMLNSYSV-TLPIPKEPALF  629



>ref|XP_004153532.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cucumis sativus]
Length=666

 Score =   455 bits (1170),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 272/341 (80%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF     FLR R +K++N+ ++   V  E++  +SLQ+DF  I+  TN FS +NK+GEG
Sbjct  293   LLFFVGCCFLRQR-AKRRNSAVKEDSVVNEMTTADSLQFDFKKIEAATNKFSEENKLGEG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSV+KGML  GQEIA+KRLSR S QG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  352   GFGSVFKGMLEDGQEIAVKRLSRGSLQGSEEFKNEVMLVAKLQHRNLVRLLGFCLEGEEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEF+PN SLD+ LFD E Q  L W KRY+II GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  412   ILIYEFIPNKSLDFLLFDEEGQKQLNWLKRYRIINGIARGILYLHEDSRLRIIHRDLKAS  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ KI+DFGMA+I  +DQ+QGNTSRIVGTYGYMSPEYAM G FS+KSDV+SFG
Sbjct  472   NILLDEDMNAKISDFGMARIVQMDQSQGNTSRIVGTYGYMSPEYAMHGNFSMKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LE+ISG KN +T+  +N A+D+L+YAW  W+DG P+E+LDP L K SY+ NEV++C+
Sbjct  532   VLVLEMISGMKN-STFYLSNLAEDILTYAWALWKDGIPLELLDPTL-KDSYSRNEVLRCI  589

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQED + RP+M  +VLML+SYS      P+EPA +
Sbjct  590   HIALLCVQEDPNSRPSMASIVLMLNSYSV-TLPIPKEPALF  629



>ref|XP_006590217.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Glycine max]
Length=960

 Score =   463 bits (1192),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/368 (61%), Positives = 289/368 (79%), Gaps = 4/368 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI  +YFLR R SKK NT +Q ++   ++ + ESLQ+D  T++  TN FS +NKIG+G
Sbjct  580   LLFIVGVYFLRKRASKKYNTFVQDSNDLTDVGDVESLQFDLPTVEAATNRFSDENKIGQG  639

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LPSGQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C + +EK
Sbjct  640   GFGVVYKGVLPSGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGQEK  699

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYE++PN SLDYFLFD  +Q  L+WS+RYKII GIARG+ YLHEDS+LRIIHRD+K S
Sbjct  700   ILIYEYIPNKSLDYFLFDPAKQKELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDVKAS  759

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKSDVFSFG
Sbjct  760   NVLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFG  819

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SGKKN + YQ +N A DLLS+AW+ W   TP+E+LDP L + SY+ NEV +C+
Sbjct  820   VLVLEIVSGKKNTDFYQ-SNHADDLLSHAWKNWTLQTPLELLDPTL-RGSYSRNEVNRCI  877

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQE+  +RP+M  + LML+SYS    S P++PA +  G G   + +  ++   +
Sbjct  878   HIGLLCVQENPSDRPSMATIALMLNSYSV-TMSMPQQPASFLRGRGPNRLNQ-GMDSDQS  935

Query  420   VSDEASTI  397
              +D+++T 
Sbjct  936   TTDQSTTC  943



>ref|XP_003556018.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=707

 Score =   455 bits (1171),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 223/361 (62%), Positives = 286/361 (79%), Gaps = 5/361 (1%)
 Frame = -1

Query  1482  LYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVY  1303
             ++ L  R +KK+N++ Q      EIS  ESL++DF+TI+  T  FS  NK+GEGG+G VY
Sbjct  339   IWILCKRAAKKRNSE-QDPKTGTEISAVESLRFDFSTIEAATQKFSEANKLGEGGFGEVY  397

Query  1302  KGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEF  1123
             KG+LPSGQE+A+KRLS+ SGQG +EFKNEVE+VAKLQH+NLVRLLG+C + EEKIL+YEF
Sbjct  398   KGLLPSGQEVAVKRLSKISGQGGEEFKNEVEIVAKLQHRNLVRLLGFCLEGEEKILVYEF  457

Query  1122  VPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDV  943
             V N SLDY LFD E+Q  L+W++RYKI+ GIARG+ YLHEDSRL+IIHRDLK SN+LLD 
Sbjct  458   VVNKSLDYILFDPEKQKSLDWTRRYKIVEGIARGIQYLHEDSRLKIIHRDLKASNVLLDG  517

Query  942   NMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEI  763
             +M+PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMSPEYAM GE+S KSDV+SFGV++LEI
Sbjct  518   DMNPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGEYSAKSDVYSFGVLVLEI  577

Query  762   ISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLC  583
             +SGKKN + Y+ T+ A+DLLSYAW+ W+D TP+E+L+  L + SYT NEVI+ +HIGLLC
Sbjct  578   LSGKKNSSFYE-TDVAEDLLSYAWKFWKDETPLELLEHSL-RESYTPNEVIRSIHIGLLC  635

Query  582   VQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM-REISLELSVTVSDEA  406
             VQED  +RPTM  VVLMLSSYS      P +PA + +   +  M + + ++ S+T S   
Sbjct  636   VQEDPADRPTMASVVLMLSSYSV-TLPVPNQPALFMHSRTESNMLKWVQIDQSITKSTTK  694

Query  405   S  403
             S
Sbjct  695   S  695



>ref|XP_008224863.1| PREDICTED: uncharacterized protein LOC103324571 [Prunus mume]
Length=1411

 Score =   473 bits (1218),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 296/380 (78%), Gaps = 10/380 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    F+  R  KK++   +      +IS  ESLQ+DF+TI   TN FS DNK+GEG
Sbjct  299   LLFVVGCCFITRRARKKRSAAAEAPSGENDISTIESLQFDFSTIVAATNNFSDDNKLGEG  358

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQE+A+KRLS++SGQG +EFKNE+ +VAKLQH+NLVRL G+C + EEK
Sbjct  359   GFGQVYKGILSNGQEVAVKRLSKNSGQGAEEFKNEMVLVAKLQHRNLVRLYGFCLEGEEK  418

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+V N SLDYFLFD E+Q  L+W++RYKII GIARG++YLHEDSRLRIIHRDLK S
Sbjct  419   ILVYEYVSNKSLDYFLFDPEKQGQLDWARRYKIIAGIARGIMYLHEDSRLRIIHRDLKAS  478

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G+FSVKSD++SFG
Sbjct  479   NILLDREMHPKISDFGMARIFGVDQTQANTSRIVGTYGYMSPEYAMHGQFSVKSDLYSFG  538

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEIIS KKN   +Q T+ A+DL+S+AW+ WRDGTP+E+LDP + + SY+ +EVI+C+
Sbjct  539   VLLLEIISSKKNSYFFQ-TDAAEDLVSHAWKLWRDGTPLELLDPSM-RDSYSRSEVIRCI  596

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM+ VVLML+SYS      P +PAF+     +  M +I+LE  ++
Sbjct  597   HIGLLCVQEDPADRPTMQSVVLMLNSYSV-TLPLPEQPAFFLRSRTEGNMPKITLESDLS  655

Query  420   VS------DEASTIGKLCPR  379
             VS      DEAS I  + PR
Sbjct  656   VSKSTPSVDEAS-ISAVYPR  674


 Score =   416 bits (1070),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 265/340 (78%), Gaps = 10/340 (3%)
 Frame = -1

Query  1479  YFLRIRNSKKQ-----NTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGY  1315
             +F+R R+ +K+     N K    D   + ++ ESLQ+D  TI+  TN FS  NK+GEGG+
Sbjct  1047  FFVRRRSIRKKYNTAPNQKKGRNDY--DTNSVESLQFDLETIETATNKFSESNKLGEGGF  1104

Query  1314  GSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKIL  1135
             G V+KG L +GQEIA+KRLS+SS QG +EFKNEV +VAKLQH+NLVRLLG+C + EE IL
Sbjct  1105  GVVFKGTLANGQEIAVKRLSKSSKQGVQEFKNEVALVAKLQHRNLVRLLGFCLEGEETIL  1164

Query  1134  IYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNI  955
             +YE+VPN SLDYFLF+S+++  L+WS R  I  GIARG+LYLHEDSRLR+IHRDLK SNI
Sbjct  1165  VYEYVPNKSLDYFLFESKQREQLDWSSRCMITGGIARGILYLHEDSRLRVIHRDLKASNI  1224

Query  954   LLDVNMDPKIADFGMAKIFGI-DQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             LLD NM+PKI+DFGMA++FG+ DQTQGNT RIVGTYGYM+PEYAM+G +SVKSDVFSFGV
Sbjct  1225  LLDGNMNPKISDFGMARMFGVEDQTQGNTKRIVGTYGYMAPEYAMEGLYSVKSDVFSFGV  1284

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             +LLEII+G++N   +  TN A  L+ YAW+ W +   +E++DP+L K+S + NE ++ +H
Sbjct  1285  LLLEIIAGRRNFLGFHPTNSAPTLIGYAWQIWNERKGLELMDPLL-KNSCSPNEFLRYIH  1343

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQE+A+ RPTM  VVLML S  T + S P +PAF+
Sbjct  1344  IGLLCVQEEANNRPTMSTVVLMLKS-ETTSLSGPEKPAFF  1382



>ref|XP_010448753.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=656

 Score =   453 bits (1166),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/375 (60%), Positives = 291/375 (78%), Gaps = 8/375 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LF+A   FL  R  K  +T   T+   G+ I+  +SLQ D+  IQ  T+ F+  NKIG+G
Sbjct  288   LFVAGYCFLARRAKKSYDT---TSVFDGDDITTADSLQLDYRKIQTATDDFAASNKIGQG  344

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L  G E+A+KRLS+SSGQGE EFKNEV +VAKLQH+NLVRLLG+C   EE+
Sbjct  345   GFGEVYKGTLTDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEER  404

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YE+VPN SLDYFLFD E+Q  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK S
Sbjct  405   VLVYEYVPNKSLDYFLFDPEKQGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKAS  464

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQT+ NT+RIVGTYGYMSPEYAM G++S+KSDV+SFG
Sbjct  465   NILLDADMNPKIADFGMARIFGLDQTEENTNRIVGTYGYMSPEYAMHGQYSMKSDVYSFG  524

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ T+ A DL+SYAW+ W +GTP+E++DP +A  ++  +EV++CV
Sbjct  525   VLVLEIISGKKNSSFYQ-TDGAHDLVSYAWKLWSNGTPLELVDPTIA-DNFQKSEVVRCV  582

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSV  424
             HIGLLCVQED  ERPT+ ++VLML+S +T   S PR+P  F+++  GK P+   S   S+
Sbjct  583   HIGLLCVQEDPVERPTLSNIVLMLTS-NTMTLSVPRQPGLFFQSRLGKDPLDTFSTTRSL  641

Query  423   TVSDEASTIGKLCPR  379
               S + +TI  L PR
Sbjct  642   IGSVDDATITDLYPR  656



>ref|XP_006606024.1| PREDICTED: serine/threonine kinase-related protein [Glycine max]
Length=664

 Score =   454 bits (1167),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 221/348 (64%), Positives = 275/348 (79%), Gaps = 5/348 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTT--DVTGEISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLFI  +YFL  R SKK NT +Q +  D   ++ + ESLQ+D AT++  T+ FS +NKIG
Sbjct  282   LLFIVGVYFLCKRASKKYNTFVQDSIADDLTDVGDVESLQFDLATVEAATDRFSDENKIG  341

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG+ P+GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C + +
Sbjct  342   QGGFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGQ  401

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYE++PN SLD FLFD  +Q  L+WS+RYKII GIARG+ YLHEDS+LRIIHRDLK
Sbjct  402   EKILIYEYIPNKSLDRFLFDPVKQRELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDLK  461

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SN+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKSDVFS
Sbjct  462   ASNVLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVFS  521

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEI+SGKKN   YQ +N A DLLS+AW+ W + TP+E+LDP L + SY+ NEV +
Sbjct  522   FGVLVLEIVSGKKNTEFYQ-SNHADDLLSHAWKNWTEKTPLELLDPTL-RGSYSRNEVNR  579

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             C+HIGLLCVQE+  +RP+M  + LML+SYS    S PR+PA    G G
Sbjct  580   CIHIGLLCVQENPSDRPSMATIALMLNSYSV-TMSMPRQPASLLRGRG  626



>ref|XP_008370580.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=661

 Score =   454 bits (1167),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 219/370 (59%), Positives = 290/370 (78%), Gaps = 6/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R +K +  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  285   LLFV-VGYCCITRRAKYKYNEAAADEPSGENDITTVESLQFDFATIQAATSNFSEDHKLG  343

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+  +GQE+A+KRLSR SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  344   EGGFGQVYKGIFSNGQEVAVKRLSRDSGQGAEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  403

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLDYFLFD E+Q  L+WS RYKII GIARG++YLHEDSRL+IIHRDLK
Sbjct  404   EKILVYEYVPNKSLDYFLFDPEKQGQLDWSIRYKIISGIARGIMYLHEDSRLKIIHRDLK  463

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ +T+RIVGT+GYMSPEYAM G FS+KSD++S
Sbjct  464   ASNILLDGEMHPKISDFGMARIFGVDQTQADTNRIVGTFGYMSPEYAMHGHFSIKSDLYS  523

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEI+SGKKN   +Q T+ A+DL+S+AW+ WRDGTP+E+L+P L + SY+  EVI+
Sbjct  524   FGVLVLEIVSGKKNSYFFQ-TDPAEDLMSHAWKLWRDGTPLELLNPCL-RDSYSRTEVIR  581

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQE+  +RPTM+ V+LM++S S      P++PAF+        M E +L+ +
Sbjct  582   CIHIGLLCVQENPADRPTMQSVILMINSDSV-TLPLPQQPAFFFRSRAVGNMSEATLDST  640

Query  426   VTVSDEASTI  397
              +++  +S +
Sbjct  641   QSINKSSSYV  650



>ref|XP_004511333.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=683

 Score =   454 bits (1167),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 220/340 (65%), Positives = 273/340 (80%), Gaps = 5/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  + FL  R ++K    LQ    T +I+N ESLQ+DFATI+  TN FS DNK+GEGG
Sbjct  311   LFIVAICFLSKR-ARKNRDSLQEGK-TYDITNVESLQFDFATIEAATNKFSADNKLGEGG  368

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L SGQEIA+KRLS+SSGQG +EFKNEV VVAKLQH+NL RLLG+C + EEKI
Sbjct  369   FGEVYKGTLTSGQEIAVKRLSKSSGQGGEEFKNEVVVVAKLQHRNLARLLGFCLQGEEKI  428

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDY LFD E+Q  L+W +R K+I+GIARG+ YLHEDSRLRIIHRDLK SN
Sbjct  429   LVYEYVPNKSLDYILFDPEKQRELDWGRRNKVIKGIARGMQYLHEDSRLRIIHRDLKASN  488

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKI+DFGMA+I G+DQTQGNTSRIVGTYGYM+PEYAM GEFSVKSDV+SFGV
Sbjct  489   ILLDGDMNPKISDFGMARIVGVDQTQGNTSRIVGTYGYMAPEYAMHGEFSVKSDVYSFGV  548

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             +++EII+GKKN + Y  ++ A DLLSY W+ W++G P+E++DP L + S+  NEV++ +H
Sbjct  549   LIMEIITGKKNSSFYD-SDGADDLLSYTWKMWKEGAPLEMVDPTL-RESHNPNEVMRSIH  606

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQED  ERPTM  +VLML S +T     P++PA +
Sbjct  607   IGLLCVQEDPAERPTMASIVLMLDS-NTVTLPNPKQPASF  645



>ref|XP_010057978.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Eucalyptus 
grandis]
 gb|KCW75398.1| hypothetical protein EUGRSUZ_E04152 [Eucalyptus grandis]
Length=666

 Score =   453 bits (1165),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/367 (60%), Positives = 283/367 (77%), Gaps = 6/367 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRN-SKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             LLF+A    LR R  +K      +      +I+N ESLQYDFATIQ  T+ FS  NK+GE
Sbjct  293   LLFLACC--LRQRKVTKPYKVVREDQSSVNDITNAESLQYDFATIQTATDNFSHQNKLGE  350

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G V++G L +GQ+IA+KRLS+ SGQG  EFKNEV +VAKLQH+NLVR+LG+C + EE
Sbjct  351   GGFGEVFQGRLTNGQQIAVKRLSQGSGQGVGEFKNEVLLVAKLQHRNLVRMLGFCLEGEE  410

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             K+L+YEFVPN SLDYFLFD E+   L+WS+RYKI+ GIARG+LYLHEDSRLRIIHRDLK 
Sbjct  411   KLLVYEFVPNKSLDYFLFDPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKA  470

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD  M PKI+DFGMA+I  +DQTQ NT++IVGT+GYMSPEYAM G+FSVKSDV+SF
Sbjct  471   SNILLDSEMIPKISDFGMARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSF  530

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV+LLE+ISGKKN   YQ ++  +DL SY W+ WRDGTP+E+LDP +   SY+ +EV++C
Sbjct  531   GVLLLELISGKKNSFFYQ-SDGGEDLASYVWKNWRDGTPLEVLDPAVG-DSYSRDEVLRC  588

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSV  424
             +HIGLLCVQED  +RPTM ++VLML+SYS  + + P++PAF+     +  M+E+  + S 
Sbjct  589   LHIGLLCVQEDPMDRPTMANIVLMLNSYSV-SLALPQQPAFFLRSRTETSMKELESDQSA  647

Query  423   TVSDEAS  403
             + S   S
Sbjct  648   SRSTPVS  654



>ref|XP_011002059.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Populus 
euphratica]
Length=680

 Score =   453 bits (1165),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 282/365 (77%), Gaps = 9/365 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF     FLR R  +K    ++  +V  EIS EESLQ+D +TI+  TN FSPDNK+GEGG
Sbjct  306   LFCLGFCFLR-RRGRKNRDSVKEKEVGDEISTEESLQFDLSTIEAATNNFSPDNKLGEGG  364

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G V+KG  P+GQ IA+KRLS+ SG G  EFKNE+ +VAKLQH+NLVRLLGYC + EEK+
Sbjct  365   FGEVFKGTFPNGQHIAVKRLSKYSGHGAAEFKNEIVLVAKLQHRNLVRLLGYCLEGEEKL  424

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFVPN SLDYFLFD  +Q +L+W  RYKI+ G+ARGLLYLHEDSRLRIIHRDLK SN
Sbjct  425   LIYEFVPNKSLDYFLFDPAKQGLLDWLSRYKIMGGLARGLLYLHEDSRLRIIHRDLKASN  484

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD  M+PKIADFGMAKIFG+DQ+QG TSRI GT+GYM+PEYAMQG++SVKSDV+SFGV
Sbjct  485   VLLDGEMNPKIADFGMAKIFGVDQSQGITSRIAGTFGYMAPEYAMQGQYSVKSDVYSFGV  544

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ+ N    L++YAW+QW++G  +E++DP L   SY+ NE+ +C+H
Sbjct  545   LILEIISGKKNSSFYQSDN-GLYLVNYAWKQWKNGAALELVDPSLG-DSYSRNEITRCLH  602

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVTV  418
             I LLCVQED ++RPT+ +VVLML+S+S  +   P+EP+ +        M   SL L+   
Sbjct  603   IALLCVQEDPNDRPTLTEVVLMLTSFSI-SLPLPQEPSSFEQS-----MTVSSLPLTELE  656

Query  417   SDEAS  403
             SD+++
Sbjct  657   SDQSN  661



>ref|XP_009338731.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=665

 Score =   452 bits (1163),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/370 (59%), Positives = 286/370 (77%), Gaps = 5/370 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +L I V Y    R ++K+  +    + +G+  I+   +LQ+DFA IQ  T+ FS D+K+G
Sbjct  288   VLLIVVGYCCITRRARKKYNQAAADEPSGDNDITTVGALQFDFAAIQAATSNFSDDHKLG  347

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + +
Sbjct  348   EGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGQ  407

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SL+ FLFD ERQ  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  408   EKILIYEFVPNKSLNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  467

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGT+GYMSPEY   G FSVKSD++S
Sbjct  468   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYS  527

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+  +D++S+AW+ WRDG P+E+LDP L +  Y+  EVI+
Sbjct  528   FGVLVLEIISGKKNSEFFQ-TDATEDIMSHAWKLWRDGAPLELLDPCL-RDFYSRIEVIR  585

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLMLSSYS     +P++PAF+        M + +L+ +
Sbjct  586   CIHIGLLCVQEDPADRPTMQSVVLMLSSYSL-TLPSPQQPAFFLQSRAMGNMSKATLDST  644

Query  426   VTVSDEASTI  397
              ++S  + ++
Sbjct  645   QSISKSSPSV  654



>gb|KHG26430.1| Cysteine-rich receptor-like protein kinase 10 [Gossypium arboreum]
Length=661

 Score =   452 bits (1162),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 220/365 (60%), Positives = 287/365 (79%), Gaps = 9/365 (2%)
 Frame = -1

Query  1455  KKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQE  1276
             K++  K   T+V  +I+  +SLQ+D+ATI+  T+ FS  NK+GEGG+G VYKG+L + QE
Sbjct  300   KRRAKKKYDTNVGYDITTIDSLQHDYATIEAATDKFSDANKLGEGGFGEVYKGILSNQQE  359

Query  1275  IAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYF  1096
             IA+K+LSR SGQG++EFKNEV +VAKLQH+NLVRLLG+C +REEKIL+YE+ PN SLDYF
Sbjct  360   IAVKKLSRGSGQGDEEFKNEVVLVAKLQHRNLVRLLGFCLEREEKILVYEYAPNKSLDYF  419

Query  1095  LFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADF  916
             +FD  +Q  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK SNILLD +M+PKI+DF
Sbjct  420   VFDPAKQGQLDWLRRYKIIEGIARGLLYLHEDSRLRIIHRDLKASNILLDGDMNPKISDF  479

Query  915   GMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNT  736
             GMA+IFG+DQTQG T R+VGTYGYMSPEYAMQG+FSVKSD +SFGV++LEI+SG++N + 
Sbjct  480   GMARIFGVDQTQGTTRRVVGTYGYMSPEYAMQGQFSVKSDAYSFGVLVLEIVSGQRNSDF  539

Query  735   YQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERP  556
             Y+T   AQDL+SYAW+ W+DG  +E+LDPVL + +Y+ NEVI+C+ +GLLCVQED  +RP
Sbjct  540   YETEG-AQDLISYAWKLWKDGRSLELLDPVL-RDNYSRNEVIRCIQLGLLCVQEDPADRP  597

Query  555   TMEDVVLMLSSYSTNNWSTPREPAFYRNG--SGKVPMREI----SLELSVTVSDEASTIG  394
             TM  VVL+L+SYS      P++PAF       G++P + +    S   S+  S+   +I 
Sbjct  598   TMATVVLLLNSYSA-TLQVPKQPAFVLQSRTDGRMPDKGLESDQSTSQSMPWSNNEVSIT  656

Query  393   KLCPR  379
             +L PR
Sbjct  657   ELYPR  661



>ref|XP_010057980.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010057981.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Eucalyptus grandis]
Length=659

 Score =   451 bits (1161),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 216/370 (58%), Positives = 283/370 (76%), Gaps = 7/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L +++   LR R  KK +  ++  D   E++  ESLQ+DFAT+Q  TN FSP+NK+GEG
Sbjct  284   VLVVSICCLLR-RKRKKTHEVVKGKDGANELTTVESLQFDFATMQAATNDFSPENKLGEG  342

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G +P GQ+IA+KRLSRSS QG++E KNEV +VAKLQH+NLVRLLG+C + ++K
Sbjct  343   GFGEVFQGRIPDGQQIAVKRLSRSSRQGDEELKNEVLLVAKLQHRNLVRLLGFCLEGDKK  402

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLDYFLFD ++   L WS RYKI+ GI RG+LYLHEDSRLRIIHRDLK S
Sbjct  403   LLAYEFVPNKSLDYFLFDPQKSSQLNWSVRYKIVSGITRGMLYLHEDSRLRIIHRDLKCS  462

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQ Q +T++IVGT+GYMSPEYAM GEFSVKSDV+SFG
Sbjct  463   NILLDSEMNPKISDFGMARIFGVDQIQASTNKIVGTFGYMSPEYAMHGEFSVKSDVYSFG  522

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             ++L+EII GKKN N Y   +  + L SY W +WR+GTP+++LDP +   SY+ +EV++C+
Sbjct  523   ILLIEIICGKKN-NFYHQLDGGEYLASYVWNKWRNGTPLKVLDPAIV-DSYSRDEVLRCL  580

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLC+QED   RPTM  +VLMLSS +  N   PR PAF+   R+G   +PM E+ L  
Sbjct  581   HIGLLCIQEDPAIRPTMATIVLMLSS-NYFNPPLPRHPAFFVRSRSGGLSIPMEELGLNQ  639

Query  429   SVTVSDEAST  400
             S + +  +ST
Sbjct  640   STSRTLPSST  649



>ref|XP_009364708.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=650

 Score =   451 bits (1160),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 226/379 (60%), Positives = 294/379 (78%), Gaps = 9/379 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+++G
Sbjct  276   LLFV-VGYCCITRRARKKYNQAAADEPSGENDITTVESLQFDFATIQAATSNFSDDHRLG  334

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG L +GQE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  335   KGGFGQVYKGTLSNGQEVAVKRLSRNSCQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  394

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RY+II GIARG++YLHEDSRLRIIHRDLK
Sbjct  395   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRLRIIHRDLK  454

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IF +DQTQ NT+RIVGTYGYMSPEYAM G+FSVKSD++S
Sbjct  455   ASNILLDGDMHPKISDFGMARIFEVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDMYS  514

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEII+GKKN + +Q TN A++L S+AW+ WRD T +E+LDP L + SY+  EVI+
Sbjct  515   FGVLVLEIINGKKNSHFFQ-TNAAENLASHAWKLWRDETSLELLDPSL-RDSYSRTEVIR  572

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLE  433
             C+HIGLLCVQED  +RPTM+ VVLML+ YS  N   P+EPAF+  G   G   M  +  +
Sbjct  573   CIHIGLLCVQEDPADRPTMQSVVLMLNGYSV-NLPLPKEPAFFLQGKVVGNTSMTTLESD  631

Query  432   LS-VTVSDEASTIGKLCPR  379
             ++  ++S    +I KL PR
Sbjct  632   INKSSMSVYNGSITKLYPR  650



>gb|KHN15823.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=659

 Score =   450 bits (1158),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 275/343 (80%), Gaps = 4/343 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  + FLR R SKK NT +Q + +  ++++ ESLQ+D ATI+  TN FS +NKIG+GG
Sbjct  286   LFIVGVCFLRKRASKKYNTFVQDS-IVDDLTDVESLQFDLATIEAATNGFSDENKIGQGG  344

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+LP+ QEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C +  EKI
Sbjct  345   FGVVYKGILPNRQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGREKI  404

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYE++ N SLD+FLFD  +Q  L+WS+RY II GIARG+LYLHEDS+LRIIHRDLK SN
Sbjct  405   LIYEYITNKSLDHFLFDPVKQRELDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASN  464

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGT+GYMSPEYAM+G+FSVKSDVFSFGV
Sbjct  465   VLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGV  524

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + YQ +N+A DLLSYAW+ W + TP++ LDP L + SY+ NEV +C+H
Sbjct  525   LVLEIVSGKKNTDLYQ-SNQADDLLSYAWKNWTEQTPLQFLDPTL-RGSYSRNEVNRCIH  582

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             IGLLCVQE+  +RP+M  + LML+SYS    S PR+PA +  G
Sbjct  583   IGLLCVQENPSDRPSMATIALMLNSYSV-TLSMPRQPASFLRG  624



>gb|KHN15824.1| Cysteine-rich receptor-like protein kinase 10 [Glycine soja]
Length=665

 Score =   451 bits (1159),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 219/346 (63%), Positives = 273/346 (79%), Gaps = 4/346 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+  +YFLR R SKK NT  Q + +  ++ + ESLQ+D A ++  T  FS +NKIG+G
Sbjct  286   LLFVVGVYFLRKRASKKYNTFAQDS-IVDDLIDVESLQFDLAMVEAATEGFSDENKIGQG  344

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+ P+GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C + +EK
Sbjct  345   GFGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGQEK  404

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYE++PN SLD FLFD  +Q  L+WS+RYKII GIARG+ YLHEDS+LRIIHRDLK S
Sbjct  405   ILIYEYIPNKSLDRFLFDPVKQRELDWSRRYKIIVGIARGIQYLHEDSQLRIIHRDLKAS  464

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKSDVFSFG
Sbjct  465   NVLLDENMNPKISDFGMAKIFRADQTQINTGRIVGTYGYMSPEYAMRGQFSVKSDVFSFG  524

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SGKKN   YQ +N A DLLS+AW+ W + TP+E+LDP L + SY+ NEV +C+
Sbjct  525   VLVLEIVSGKKNTEFYQ-SNHADDLLSHAWKNWTEQTPLELLDPTL-RGSYSRNEVNRCI  582

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             HIGLLCVQE+  +RP+M  + LML+SYS    S PR+PA    G G
Sbjct  583   HIGLLCVQENPSDRPSMATIALMLNSYSV-TMSMPRQPASLLRGRG  627



>ref|XP_009338745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X3 [Pyrus x bretschneideri]
Length=649

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/358 (60%), Positives = 279/358 (78%), Gaps = 5/358 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +L I V Y    R ++K+  +    + +G+  I+   +LQ+DFA IQ  T+ FS D+K+G
Sbjct  288   VLLIVVGYCCITRRARKKYNQAAADEPSGDNDITTVGALQFDFAAIQAATSNFSDDHKLG  347

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + +
Sbjct  348   EGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGQ  407

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SL+ FLFD ERQ  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  408   EKILIYEFVPNKSLNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  467

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGT+GYMSPEY   G FSVKSD++S
Sbjct  468   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYS  527

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+  +D++S+AW+ WRDG P+E+LDP L +  Y+  EVI+
Sbjct  528   FGVLVLEIISGKKNSEFFQ-TDATEDIMSHAWKLWRDGAPLELLDPCL-RDFYSRIEVIR  585

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLE  433
             C+HIGLLCVQED  +RPTM+ VVLMLSSYS     +P++PAF+        M + +L+
Sbjct  586   CIHIGLLCVQEDPADRPTMQSVVLMLSSYSL-TLPSPQQPAFFLQSRAMGNMSKATLD  642



>ref|XP_009338737.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=650

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 216/366 (59%), Positives = 284/366 (78%), Gaps = 5/366 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +L I V Y    R ++K+  +    + +G+  I+   +LQ+DFA IQ  T+ FS D+K+G
Sbjct  288   VLLIVVGYCCITRRARKKYNQAAADEPSGDNDITTVGALQFDFAAIQAATSNFSDDHKLG  347

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + +
Sbjct  348   EGGFGKVYKGILSNGQEVAVKRLSRNSDQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGQ  407

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SL+ FLFD ERQ  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  408   EKILIYEFVPNKSLNCFLFDPERQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  467

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M PKI+DFGMA+IFG+DQTQ NT+RIVGT+GYMSPEY   G FSVKSD++S
Sbjct  468   ASNILLDGEMHPKISDFGMARIFGVDQTQANTNRIVGTFGYMSPEYVRHGHFSVKSDLYS  527

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN   +Q T+  +D++S+AW+ WRDG P+E+LDP L +  Y+  EVI+
Sbjct  528   FGVLVLEIISGKKNSEFFQ-TDATEDIMSHAWKLWRDGAPLELLDPCL-RDFYSRIEVIR  585

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQED  +RPTM+ VVLMLSSYS     +P++PAF+        M + +L+ +
Sbjct  586   CIHIGLLCVQEDPADRPTMQSVVLMLSSYSL-TLPSPQQPAFFLQSRAMGNMSKATLDST  644

Query  426   VTVSDE  409
              ++ ++
Sbjct  645   QSIIEQ  650



>ref|XP_006606025.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Glycine max]
Length=659

 Score =   449 bits (1156),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 275/343 (80%), Gaps = 4/343 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  + FLR R SKK NT +Q + +  ++++ ESLQ+D ATI+  TN FS +NKIG+GG
Sbjct  286   LFIVGVCFLRKRASKKYNTFVQDS-IVDDLTDVESLQFDLATIEAATNGFSDENKIGQGG  344

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+LP+ QEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C +  EKI
Sbjct  345   FGVVYKGILPNRQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGREKI  404

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYE++ N SLD+FLFD  +Q  L+WS+RY II GIARG+LYLHEDS+LRIIHRDLK SN
Sbjct  405   LIYEYITNKSLDHFLFDPVKQRELDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASN  464

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGT+GYMSPEYAM+G+FSVKSDVFSFGV
Sbjct  465   VLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGV  524

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + YQ  N+A DLLSYAW+ W + TP+++LDP L + SY+ NEV +C+H
Sbjct  525   LVLEIVSGKKNTDFYQ-PNQADDLLSYAWKNWTEQTPLQLLDPTL-RGSYSRNEVNRCIH  582

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             IGLLCVQE+  +RP+M  + LML+SYS    S PR+PA +  G
Sbjct  583   IGLLCVQENPSDRPSMATIALMLNSYSV-TLSMPRQPASFLRG  624



>gb|KFK22120.1| hypothetical protein AALP_AAs48628U000100, partial [Arabis alpina]
Length=392

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 286/376 (76%), Gaps = 8/376 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFIA   FL  R  KK+N    +     +I+  +SLQ D+ TIQ  TN F+  NKIGEGG
Sbjct  22    LFIAGYCFLAKR--KKKNYDTASAFDGDDITTADSLQLDYRTIQTATNNFAESNKIGEGG  79

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQGE+EFKNEV +VAKLQH+NLVRLLG+C + EE++
Sbjct  80    FGQVYKGTLLDGTEVAVKRLSKSSGQGEREFKNEVVLVAKLQHRNLVRLLGFCLEGEERV  139

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYF+FD  +Q  L+WS+RYKII GIARG+LYLH+DSRL I+HRDLK SN
Sbjct  140   LVYEYVPNESLDYFVFDPAKQGQLDWSRRYKIIGGIARGILYLHQDSRLTIVHRDLKASN  199

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD +M+PKIADFGMA+IFGIDQT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV
Sbjct  200   VLLDADMNPKIADFGMARIFGIDQTEQNTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGV  259

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP +  +    NEV++CVH
Sbjct  260   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGQPLELVDPAIVDNCQR-NEVVRCVH  317

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPM--REISLELS  427
             IGLLCVQED  +RPT+  +VLML+S +T     PR+P  F+++   K P+   + S   S
Sbjct  318   IGLLCVQEDPVDRPTLSSIVLMLTS-NTVTLPVPRQPGLFFQSRPEKDPLDSSQFSNSRS  376

Query  426   VTVSDEASTIGKLCPR  379
                S + ++I ++ PR
Sbjct  377   PLGSVDDASITEVYPR  392



>ref|XP_009340924.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Pyrus x bretschneideri]
Length=693

 Score =   450 bits (1157),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/358 (62%), Positives = 281/358 (78%), Gaps = 7/358 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R  +K+     T + +GE  I+  ESLQ+DFATIQ  T+ FS D+K+G
Sbjct  318   LLFV-VGYCCITRRVRKKYNAAATNEPSGENDITTVESLQFDFATIQAATSNFSDDHKLG  376

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L  GQE+A+KRLS++SGQG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  377   EGGFGQVYKGILSDGQEVAVKRLSKNSGQGSEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  436

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+VPN SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDS+LRIIHRDLK
Sbjct  437   EKILVYEYVPNKSLDRFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSQLRIIHRDLK  496

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M+PKI+DFGMA+IFG+DQ+Q NTSRIVGTYGYMSPEYAM G FSVKSD++S
Sbjct  497   ASNILLDGEMNPKISDFGMARIFGVDQSQANTSRIVGTYGYMSPEYAMHGRFSVKSDMYS  556

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV+LLEII+GKKN   +Q T+ A+DLLS+AW+ WRDG P E+LDP L + SY+  EVI+
Sbjct  557   FGVLLLEIITGKKNSYFFQ-TDAAKDLLSHAWKLWRDGAPFELLDPYL-RDSYSRIEVIR  614

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLE  433
             C+HI LLCVQED  +RP ++ V+LML+SYS      P +PAF  +      M E +++
Sbjct  615   CIHISLLCVQEDPADRPAIQSVILMLNSYSI-TLPLP-QPAFSLHSRAVGNMSEATMD  670



>ref|XP_006291260.1| hypothetical protein CARUB_v10017391mg, partial [Capsella rubella]
 gb|EOA24158.1| hypothetical protein CARUB_v10017391mg, partial [Capsella rubella]
Length=400

 Score =   439 bits (1130),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 283/377 (75%), Gaps = 5/377 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+F+AV   +R + ++    +   T+   +I+N  SLQ+DF  I++ TN F   NK+G+G
Sbjct  26    LVFLAVFISVRAKKTRTTYERELPTEERDDITNAGSLQFDFKAIEVATNRFCETNKLGQG  85

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+ PSG  +A+KRLS++SGQGE+EF NEV VVAKLQH+NLVRLLG+C KR+E+
Sbjct  86    GFGEVYKGIFPSGVHVAVKRLSKTSGQGEREFANEVVVVAKLQHRNLVRLLGFCLKRDER  145

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FD   Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  146   ILVYEFVPNKSLDYFIFDPTMQSQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  205

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  206   NILLDADMNPKIADFGMARIFGMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  265

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK N N YQ  N   +L++Y W  W +G+ +E++DP     +Y + EV +C+
Sbjct  266   VLVLEIISGKMNSNLYQMDNGPGNLVTYTWRLWSNGSLLELVDPSF-HDNYRIKEVSRCI  324

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELS-  427
             HI LLC+QE+AD+RPTM  +V ML++ S+   + P+ P  F+RN   +  + ++S+  S 
Sbjct  325   HIALLCLQEEADDRPTMSAIVQMLTT-SSMALAVPQRPGFFFRNKYEQGGLVDLSINTSA  383

Query  426   -VTVSDEASTIGKLCPR  379
               +V D +S I ++ PR
Sbjct  384   LCSVDDASSIITQVTPR  400



>ref|XP_010247616.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Nelumbo 
nucifera]
Length=676

 Score =   449 bits (1155),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 221/367 (60%), Positives = 276/367 (75%), Gaps = 8/367 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL   + YF  IR  KK+     T +   EI + +SLQ++ + +   TN FS DNKIGEG
Sbjct  305   LLLSTLCYFSLIRKKKKE-----TDNGGNEIKDMQSLQFNLSAVIAATNNFSDDNKIGEG  359

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +GQ+IA+KRLSRSSGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  360   GFGCVYKGKLSNGQDIAVKRLSRSSGQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEK  419

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFDS+++  L+W  RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  420   ILIYEFVPNKSLDYFLFDSDKRACLDWPTRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  479

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ KI+DFGMA+IFG+DQ+Q NT+RIVGTYGYM PEYAM G FSVKSDV+SFG
Sbjct  480   NILLDSDMNSKISDFGMARIFGVDQSQANTNRIVGTYGYMPPEYAMHGHFSVKSDVYSFG  539

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEI++GKKN +++  +   +DLL YAW  W +GT +E+LDP+L +  Y+ +EV++C+
Sbjct  540   VLLLEIVTGKKN-SSFNQSEFGEDLLHYAWRNWNEGTALELLDPILTE-HYSRDEVMRCI  597

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HIGLLCVQED  +RPTM  VVLML+SYS      P  PA + +      M     E   T
Sbjct  598   HIGLLCVQEDVADRPTMATVVLMLNSYSV-TLELPLRPASFGHSKMVSSMATSETERQAT  656

Query  420   VSDEAST  400
              SD++++
Sbjct  657   DSDKSTS  663



>ref|XP_009364729.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=653

 Score =   447 bits (1151),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 224/379 (59%), Positives = 293/379 (77%), Gaps = 9/379 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+  +    + +GE  I+  ESLQ+DFATIQ  T+ FS D+++G
Sbjct  279   LLFV-VGYCCITRRARKKYNQAAADEPSGENDITTVESLQFDFATIQAATSNFSDDHRLG  337

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG L +GQE+A+KRLSR+S QG +EFKNE+ +VAKLQH+NLVRLLG+C + E
Sbjct  338   KGGFGQVYKGTLSNGQEVAVKRLSRNSCQGTEEFKNEMVLVAKLQHRNLVRLLGFCLEGE  397

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RY+II GIARG++YLHEDSRLRIIHRDLK
Sbjct  398   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYQIISGIARGIMYLHEDSRLRIIHRDLK  457

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IF +DQTQ NT+RIVGTYGYMSPEYAM G+FSVKSD++S
Sbjct  458   ASNILLDGDMHPKISDFGMARIFEVDQTQANTNRIVGTYGYMSPEYAMHGQFSVKSDMYS  517

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEII+GKKN + +Q TN A++L S+AW+ WRD   +E+LDP L + SY+  EVI+
Sbjct  518   FGVLVLEIINGKKNSHFFQ-TNAAENLASHAWKLWRDEISLELLDPSL-RDSYSRTEVIR  575

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLE  433
             C+HIGLLCVQED  +RPTM+ VVLML+ YS  N   P+EPAF+  G   G   M  +  +
Sbjct  576   CIHIGLLCVQEDPADRPTMQSVVLMLNGYSV-NLPLPKEPAFFLQGKVVGNTSMTTLESD  634

Query  432   LS-VTVSDEASTIGKLCPR  379
             ++  ++S    +I +L PR
Sbjct  635   INKSSMSVYNGSITELYPR  653



>ref|XP_007143184.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
 gb|ESW15178.1| hypothetical protein PHAVU_007G050600g [Phaseolus vulgaris]
Length=661

 Score =   448 bits (1152),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 215/345 (62%), Positives = 271/345 (79%), Gaps = 3/345 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  + FLR R S +     +   +  ++++ ESLQ+D ATI+  TN FS +NKIG+GG
Sbjct  282   LFIVGVCFLRKRASNRYINSFRQDSIVDDLTDVESLQFDLATIEAATNRFSDENKIGQGG  341

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+LP GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C + +EKI
Sbjct  342   FGVVYKGVLPDGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGQEKI  401

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYE++PN SLDYFLFDS +Q  L+WSKRYKII GIARG+LYLHEDS+LRI+HRDLK SN
Sbjct  402   LIYEYIPNKSLDYFLFDSIKQRELDWSKRYKIIVGIARGILYLHEDSQLRIVHRDLKASN  461

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM+ KI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FS+KSDVFSFGV
Sbjct  462   VLLDENMNSKISDFGMAKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSMKSDVFSFGV  521

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + YQ +N A DLL +AW++W + T +E LDP L + S + NEV +C+H
Sbjct  522   LVLEIVSGKKNTDFYQ-SNHADDLLIFAWKKWTEQTTMEFLDPAL-RGSCSRNEVNRCIH  579

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             IGLLCVQE+  +RP+M  + LML+SYS    S PR+PA +  G G
Sbjct  580   IGLLCVQENPSDRPSMATIALMLNSYSV-TLSMPRQPASFLRGRG  623



>ref|XP_011002057.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Populus euphratica]
Length=668

 Score =   447 bits (1151),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 271/341 (79%), Gaps = 3/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L  ++ Y    + ++K+   +Q  +   EI++ +SLQ+   TI+  TN F+ +NKIG+G
Sbjct  292   VLLFSLCYCYVHQKARKEYNAIQEGNGGDEITSVQSLQFQLGTIEAATNNFAEENKIGKG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VY+G LP+GQ IA+KRLS++SGQG  EFKNEV +VA+LQH+NLVRLLGYC + EEK
Sbjct  352   GFGDVYRGTLPNGQHIAVKRLSKNSGQGAAEFKNEVVLVARLQHRNLVRLLGYCLQGEEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD  +Q +L WS RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  412   ILIYEFVPNKSLDYFLFDPAKQGLLNWSSRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+PKIADFGMAKIFG DQ+QGNTS+I GT+GYM PEYAM G+FSVKSDV+SFG
Sbjct  472   NVLLDGEMNPKIADFGMAKIFGGDQSQGNTSKIAGTFGYMPPEYAMHGQFSVKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ+ N   DL+SYAW+QW++G  +E++D  L   SY+ NE+ +C+
Sbjct  532   VLILEIISGKKNSSFYQSDN-GLDLVSYAWKQWKNGAALELMDASLGH-SYSRNEITRCI  589

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED ++RPT+  +VL+L+S+S      PREPA++
Sbjct  590   HIGLLCVQEDPNDRPTLATIVLVLTSFSV-TLPLPREPAYF  629



>ref|XP_006383965.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
 gb|ERP61762.1| hypothetical protein POPTR_0004s02530g [Populus trichocarpa]
Length=683

 Score =   448 bits (1152),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/341 (62%), Positives = 271/341 (79%), Gaps = 3/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L  ++ Y    + ++K+   +Q  +V  EI++ +SLQ+   TI+  TN F+ +NKIG+G
Sbjct  292   VLLFSLCYCYAHQKARKEYNAIQEGNVGDEITSVQSLQFQLGTIEAATNNFAEENKIGKG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VY+G LP+GQ IA+KRLS++SGQG  EFKNEV +VA+LQH+NLVRLLGYC + EEK
Sbjct  352   GFGDVYRGTLPNGQHIAVKRLSKNSGQGAAEFKNEVVLVARLQHRNLVRLLGYCLEGEEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD  +Q +L WS RYKII GIARGL+YLHEDSRLRIIHRDLK S
Sbjct  412   ILIYEFVPNKSLDYFLFDPAKQGLLNWSSRYKIIGGIARGLIYLHEDSRLRIIHRDLKAS  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+PKIADFGMAKIFG DQ+QGNT++I GT+GYM PEYAM G+FSVKSDV+SFG
Sbjct  472   NVLLDGEMNPKIADFGMAKIFGGDQSQGNTNKIAGTFGYMPPEYAMHGQFSVKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ+ N   DL+SYAW+QW++G  +E++D      SY+ NE+ +CV
Sbjct  532   VLILEIISGKKNSSFYQSDN-GLDLVSYAWKQWKNGAVLELMDSSFGD-SYSRNEITRCV  589

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED ++RPT+  +VLML+S+S      PREPA++
Sbjct  590   HIGLLCVQEDPNDRPTLSTIVLMLTSFSV-TLPLPREPAYF  629



>ref|XP_008384459.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=658

 Score =   446 bits (1148),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 227/381 (60%), Positives = 292/381 (77%), Gaps = 13/381 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE--ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+ V Y    R ++K+       +++GE  I+  ESLQ+DFATIQ  T+ FS  +K+G
Sbjct  284   LLFV-VGYCCIXRRARKKYNXAAXDELSGEXDITTVESLQFDFATIQETTSNFS--DKLG  340

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG L +GQE+A+KRLSR+SGQG +EFKNE+ +VAKLQH+NLVR LG+C + E
Sbjct  341   EGGFGQVYKGTLSNGQEVAVKRLSRNSGQGTEEFKNEMVLVAKLQHRNLVRXLGFCLEGE  400

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YE+V N SLD FLFD E+Q  L+WS+RYKII GIARG++YLHEDSRLRIIHRDLK
Sbjct  401   EKILVYEYVLNKSLDCFLFDPEKQGQLDWSRRYKIISGIARGIMYLHEDSRLRIIHRDLK  460

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD +M PKI+DFGMA+IFG+DQTQ NT+RIVGTYGYMS EYAM G+FSVKSD++S
Sbjct  461   ASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSXEYAMHGQFSVKSDMYS  520

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN N +Q T+ A+DL S+AW+ WRDGT +E+LDP L + SY+  EVI+
Sbjct  521   FGVLVLEIISGKKNSNFFQ-TDAAEDLASHAWKLWRDGTSLELLDPSL-RDSYSXTEVIR  578

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISLE  433
             C+H GLLCVQED  +RP M+ VVLML+SYS  +   P++PAF+      G   M  +  +
Sbjct  579   CIHXGLLCVQEDPVDRPXMQXVVLMLNSYSV-SLPLPKZPAFFLQSKAVGNPSMTTLESD  637

Query  432   LSVTVSDEA---STIGKLCPR  379
              S++ S  +    +I +L PR
Sbjct  638   QSISKSSPSVYEGSITELYPR  658



>ref|XP_010686954.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Beta 
vulgaris subsp. vulgaris]
Length=665

 Score =   446 bits (1146),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 260/312 (83%), Gaps = 2/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             + +  +SLQYD AT+QL T+ FS +NKI EGG+G VYKG+L +GQEIA+KRLS+SSGQG 
Sbjct  317   DFATLDSLQYDLATLQLATDSFSEENKIAEGGFGGVYKGILSNGQEIAVKRLSKSSGQGA  376

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEV  +AKLQH+NLVRLLG+C    EK+L+YE+VPN SLD+F+FD ++Q  L+W K
Sbjct  377   QEFKNEVLFIAKLQHRNLVRLLGFCLAEGEKLLVYEYVPNKSLDHFIFDPKKQGQLDWVK  436

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARG+LYLHEDSRLRIIHRDLK SN+LLD +M+PK++DFGMAKIFG+DQ QGN
Sbjct  437   RYKIIGGIARGMLYLHEDSRLRIIHRDLKASNVLLDADMNPKVSDFGMAKIFGVDQIQGN  496

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             TSR+VGTYGYMSPEYAM G+FSVKSDV+SFGV++LEIIS K+N + YQ +  A+DLLSYA
Sbjct  497   TSRVVGTYGYMSPEYAMHGKFSVKSDVYSFGVLVLEIISSKRNSSFYQ-SGYAKDLLSYA  555

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W+QW+DG  +E +DP + + S + +EV++C+H+GLLCVQE  DERPTM   +LML ++ST
Sbjct  556   WKQWKDGKHMEFVDPTI-RESCSSSEVLRCMHLGLLCVQEALDERPTMARAMLMLDTHST  614

Query  513   NNWSTPREPAFY  478
                  P+EPAF+
Sbjct  615   IFPPVPKEPAFF  626



>ref|XP_006291259.1| hypothetical protein CARUB_v10017391mg, partial [Capsella rubella]
 gb|EOA24157.1| hypothetical protein CARUB_v10017391mg, partial [Capsella rubella]
Length=392

 Score =   436 bits (1121),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 282/377 (75%), Gaps = 13/377 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+F+AV  F+ +R  K + T  +      E+  E SLQ+DF  I++ TN F   NK+G+G
Sbjct  26    LVFLAV--FISVRAKKTRTTYER------ELPTEGSLQFDFKAIEVATNRFCETNKLGQG  77

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+ PSG  +A+KRLS++SGQGE+EF NEV VVAKLQH+NLVRLLG+C KR+E+
Sbjct  78    GFGEVYKGIFPSGVHVAVKRLSKTSGQGEREFANEVVVVAKLQHRNLVRLLGFCLKRDER  137

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FD   Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  138   ILVYEFVPNKSLDYFIFDPTMQSQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  197

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  198   NILLDADMNPKIADFGMARIFGMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  257

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK N N YQ  N   +L++Y W  W +G+ +E++DP     +Y + EV +C+
Sbjct  258   VLVLEIISGKMNSNLYQMDNGPGNLVTYTWRLWSNGSLLELVDPSF-HDNYRIKEVSRCI  316

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELS-  427
             HI LLC+QE+AD+RPTM  +V ML++ S+   + P+ P  F+RN   +  + ++S+  S 
Sbjct  317   HIALLCLQEEADDRPTMSAIVQMLTT-SSMALAVPQRPGFFFRNKYEQGGLVDLSINTSA  375

Query  426   -VTVSDEASTIGKLCPR  379
               +V D +S I ++ PR
Sbjct  376   LCSVDDASSIITQVTPR  392



>gb|KCW75002.1| hypothetical protein EUGRSUZ_E03765 [Eucalyptus grandis]
Length=728

 Score =   447 bits (1150),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 269/337 (80%), Gaps = 3/337 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             +I+N ESLQYDFATI+  T+ FS  NK+GEGG+G V++G LP+GQ+IA+KRLS+ SGQG 
Sbjct  383   DITNAESLQYDFATIKTATDNFSHQNKLGEGGFGEVFQGRLPNGQQIAVKRLSQGSGQGA  442

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV +VAKLQH+NLVR+LG+C + EEK+L+YEFVPN SLD FLFD E+   L WS+
Sbjct  443   AEFKNEVLLVAKLQHRNLVRMLGFCLEGEEKLLVYEFVPNKSLDNFLFDPEKSKQLNWSR  502

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKI+ GIARG+LYLHEDSRLRIIHRDLK SNILLD  M PKI+DFGMA+I  +DQTQ N
Sbjct  503   RYKIVCGIARGMLYLHEDSRLRIIHRDLKASNILLDSEMIPKISDFGMARIVVVDQTQAN  562

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T++IVGT+GYMSPEYAM G+FS KSDV+SFGV+LLE+ISGKKN + YQ  +  +DL SY 
Sbjct  563   TNKIVGTFGYMSPEYAMHGQFSAKSDVYSFGVLLLELISGKKNSSFYQLDDN-EDLASYV  621

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W+ WRDGTP+E+LDP +   SY+ +EV++C+HIGLLCVQED  +RPTM ++VLML+SYS 
Sbjct  622   WKNWRDGTPLEVLDPAVG-DSYSRDEVLRCLHIGLLCVQEDPMDRPTMANIVLMLNSYSV  680

Query  513   NNWSTPREPAFYRNGSGKVPMREISLELSVTVSDEAS  403
              + + P++PA +     +  M+E+  + S + S   S
Sbjct  681   -SLALPQQPALFFRSRTETSMKELKSDQSASRSAPVS  716



>ref|XP_006413571.1| hypothetical protein EUTSA_v10024630mg [Eutrema salsugineum]
 gb|ESQ55024.1| hypothetical protein EUTSA_v10024630mg [Eutrema salsugineum]
Length=658

 Score =   445 bits (1144),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 220/374 (59%), Positives = 287/374 (77%), Gaps = 10/374 (3%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             FIA   FL  R  K  +T   ++   G+ I+  +SLQ D+ +IQ  T  F+  NKIG+GG
Sbjct  293   FIAGYCFLAKRAKKAYHT---SSAFDGDDITTADSLQLDYRSIQTATTDFAESNKIGQGG  349

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+K+LS+SSGQGE EFKNEV VVAKLQH+NLVRLLG+C + EE++
Sbjct  350   FGEVYKGTLLDGTEVAVKKLSKSSGQGEAEFKNEVTVVAKLQHRNLVRLLGFCLEGEERV  409

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYFLFD  +Q  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK SN
Sbjct  410   LVYEYVPNKSLDYFLFDPAKQAQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASN  469

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAMQG +S+KSDV+SFGV
Sbjct  470   ILLDADMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMQGHYSMKSDVYSFGV  529

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +GTP++++DP++  +    NEV++CVH
Sbjct  530   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGTPLDLVDPIIVDNCQR-NEVVRCVH  587

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSVT  421
             IGLLCVQED  +RPT+  +VLML+S +T     PR+P  F+++  GK P+   +  L  +
Sbjct  588   IGLLCVQEDPADRPTLSTIVLMLTS-NTVTLPVPRQPGLFFQSRPGKDPLDSTTKSLLGS  646

Query  420   VSDEASTIGKLCPR  379
             V D  ++I ++ PR
Sbjct  647   VDD--ASITEVYPR  658



>ref|XP_004496786.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Cicer arietinum]
Length=656

 Score =   444 bits (1143),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 268/336 (80%), Gaps = 3/336 (1%)
 Frame = -1

Query  1476  FLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKG  1297
             FL +  SKK+  +    ++  EIS+ ESLQ+D ATI++ TN FS DNKIG+GGYG VYKG
Sbjct  296   FLFLMKSKKRRKETLRENIGLEISSPESLQFDLATIEIATNNFSDDNKIGKGGYGQVYKG  355

Query  1296  MLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVP  1117
             +LP GQEIA+KRLS+SSGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKILIYE+VP
Sbjct  356   ILPDGQEIAVKRLSKSSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILIYEYVP  415

Query  1116  NGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNM  937
             N SLD+FLFD ++Q  L WS+RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM
Sbjct  416   NKSLDHFLFDPQKQKQLTWSERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNM  475

Query  936   DPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIIS  757
              PKI+DFGMA++  I+Q QG T+R+VGTYGYMSPEYAM G FSVKSDVFSFGVMLLEIIS
Sbjct  476   IPKISDFGMARMVAIEQIQGQTNRVVGTYGYMSPEYAMHGHFSVKSDVFSFGVMLLEIIS  535

Query  756   GKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQ  577
             GKKN  T+++  R  DLLS AW QW+  +P ++LDP++ + SYT NEV +CV IGLLCVQ
Sbjct  536   GKKNSYTFESC-RIDDLLSNAWNQWKGESPFQLLDPIM-QESYTPNEVEKCVQIGLLCVQ  593

Query  576   EDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             E  D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  594   ESPDDRPTMGTVVSYLNNLSI-EMPFPLEPAFFMHG  628



>ref|XP_010655950.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 262/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  1422  VTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSG  1243
             V  +I+  +SLQ+DF T++  TN FS DNKIGEGG+G VYKG L SG+EIAIKRLSRSS 
Sbjct  317   VENDITTVQSLQFDFGTLEATTNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSA  376

Query  1242  QGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLE  1063
             QG  EFKNEV +VAKLQH+NLVRLLG+C + EEKIL+YE+VPN SLD+FLFD ++Q  L+
Sbjct  377   QGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDHFLFDPDKQGQLD  436

Query  1062  WSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQT  883
             WS+RYKII  IARG+LYLHEDS L++IHRDLK SN+LLD +M+PKI+DFGMA+IFG+DQT
Sbjct  437   WSRRYKIIGRIARGILYLHEDSPLKVIHRDLKASNVLLDGDMNPKISDFGMARIFGVDQT  496

Query  882   QGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLL  703
             +G+T R+VGTYGYMSPEYAM G FS KSDV+SFGV++LEIISGKKN   Y+ + + +DLL
Sbjct  497   RGSTKRVVGTYGYMSPEYAMHGHFSAKSDVYSFGVLVLEIISGKKNSCFYE-SGQTEDLL  555

Query  702   SYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSS  523
             SYAW+ WR+GTP+E++DP++   SY  NEVI+C+H+GLLCVQED ++RP+M  VVLMLSS
Sbjct  556   SYAWKLWRNGTPLELMDPIMG-DSYARNEVIRCIHMGLLCVQEDPEDRPSMASVVLMLSS  614

Query  522   YSTNNWSTPREPAF  481
             YS      P++PAF
Sbjct  615   YSVTP-PLPQQPAF  627



>ref|XP_010059664.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=1054

 Score =   456 bits (1173),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/355 (62%), Positives = 280/355 (79%), Gaps = 8/355 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LLF+A  +  R R   K    +Q  D +G  EISN ESLQYD ATIQ  TN FS  NK+G
Sbjct  681   LLFLACCF--RRRKVAKTYGAVQG-DHSGASEISNAESLQYDLATIQAATNNFSHQNKLG  737

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G V++G LP+GQ+IA+KRLS+SSGQG +EFKNEV +VAKLQH+NLVRLLG+C + E
Sbjct  738   EGGFGEVFQGRLPNGQQIAVKRLSQSSGQGAQEFKNEVLLVAKLQHRNLVRLLGFCLEGE  797

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EK+L+YEFV N SLDY LFD E+   L+W +RYKI+ GIARG+LYLHEDSRLRIIHRDLK
Sbjct  798   EKLLVYEFVLNKSLDYCLFDPEKSKELDWLRRYKIVCGIARGMLYLHEDSRLRIIHRDLK  857

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD  M+PKI+DFGMA+I G+DQTQ NT++IVGT+GYMSPEYAM G+FSVKSDV+S
Sbjct  858   ASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYS  917

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV+LLE++SGKKN   ++  +  +DL SYAW+ WRDG P+E+LDP +    Y+ +EV++
Sbjct  918   FGVLLLELVSGKKNSFFFE-EDGGEDLASYAWKNWRDGKPLEVLDPAIGD-LYSRDEVLR  975

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREI  442
             C+HIGLLCVQED  +RPTM  VVLMLSSYS  + ++P +PAF+     ++PM+ +
Sbjct  976   CLHIGLLCVQEDPMDRPTMATVVLMLSSYSV-SLASPLQPAFFLRSRTEIPMKNL  1029



>ref|XP_004496787.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X3 [Cicer arietinum]
Length=653

 Score =   444 bits (1142),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 268/336 (80%), Gaps = 3/336 (1%)
 Frame = -1

Query  1476  FLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKG  1297
             FL +  SKK+  +    ++  EIS+ ESLQ+D ATI++ TN FS DNKIG+GGYG VYKG
Sbjct  296   FLFLMKSKKRRKETLRENIGLEISSPESLQFDLATIEIATNNFSDDNKIGKGGYGQVYKG  355

Query  1296  MLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVP  1117
             +LP GQEIA+KRLS+SSGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKILIYE+VP
Sbjct  356   ILPDGQEIAVKRLSKSSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILIYEYVP  415

Query  1116  NGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNM  937
             N SLD+FLFD ++Q  L WS+RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM
Sbjct  416   NKSLDHFLFDPQKQKQLTWSERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNM  475

Query  936   DPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIIS  757
              PKI+DFGMA++  I+Q QG T+R+VGTYGYMSPEYAM G FSVKSDVFSFGVMLLEIIS
Sbjct  476   IPKISDFGMARMVAIEQIQGQTNRVVGTYGYMSPEYAMHGHFSVKSDVFSFGVMLLEIIS  535

Query  756   GKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQ  577
             GKKN  T+++  R  DLLS AW QW+  +P ++LDP++ + SYT NEV +CV IGLLCVQ
Sbjct  536   GKKNSYTFESC-RIDDLLSNAWNQWKGESPFQLLDPIM-QESYTPNEVEKCVQIGLLCVQ  593

Query  576   EDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             E  D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  594   ESPDDRPTMGTVVSYLNNLSI-EMPFPLEPAFFMHG  628



>ref|XP_004496785.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=671

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 268/336 (80%), Gaps = 3/336 (1%)
 Frame = -1

Query  1476  FLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKG  1297
             FL +  SKK+  +    ++  EIS+ ESLQ+D ATI++ TN FS DNKIG+GGYG VYKG
Sbjct  296   FLFLMKSKKRRKETLRENIGLEISSPESLQFDLATIEIATNNFSDDNKIGKGGYGQVYKG  355

Query  1296  MLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVP  1117
             +LP GQEIA+KRLS+SSGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKILIYE+VP
Sbjct  356   ILPDGQEIAVKRLSKSSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILIYEYVP  415

Query  1116  NGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNM  937
             N SLD+FLFD ++Q  L WS+RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM
Sbjct  416   NKSLDHFLFDPQKQKQLTWSERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNM  475

Query  936   DPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIIS  757
              PKI+DFGMA++  I+Q QG T+R+VGTYGYMSPEYAM G FSVKSDVFSFGVMLLEIIS
Sbjct  476   IPKISDFGMARMVAIEQIQGQTNRVVGTYGYMSPEYAMHGHFSVKSDVFSFGVMLLEIIS  535

Query  756   GKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQ  577
             GKKN  T+++  R  DLLS AW QW+  +P ++LDP++ + SYT NEV +CV IGLLCVQ
Sbjct  536   GKKNSYTFESC-RIDDLLSNAWNQWKGESPFQLLDPIM-QESYTPNEVEKCVQIGLLCVQ  593

Query  576   EDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             E  D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  594   ESPDDRPTMGTVVSYLNNLSI-EMPFPLEPAFFMHG  628



>ref|XP_003592436.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES62687.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=673

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 259/312 (83%), Gaps = 3/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             EIS  E LQ+DF TI   TN FS DNK+GEGG+G VYKGML +GQEIA+KRLSRSSGQG 
Sbjct  323   EISRVEFLQFDFDTIATATNNFSGDNKLGEGGFGEVYKGMLFNGQEIAVKRLSRSSGQGI  382

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEV +VAKLQH+NLVR+LG+C   EEK+LIYEF+PN SLDYFLFD E+ H + W +
Sbjct  383   EEFKNEVVLVAKLQHRNLVRILGFCLDGEEKMLIYEFMPNKSLDYFLFDPEKAHQINWPR  442

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARG+LYLHEDSRLRIIHRDLK SNILLD N++PKI+DFGMA+IFG+DQT+G 
Sbjct  443   RYKIIEGIARGMLYLHEDSRLRIIHRDLKASNILLDENLNPKISDFGMARIFGVDQTRGI  502

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T+R+VGT GYMSPEYAM GEFS+K+DV+SFGV++LEII+GKK   +++ +  A+DLLSYA
Sbjct  503   TNRVVGTLGYMSPEYAMHGEFSIKTDVYSFGVLVLEIITGKK-ITSFRESGYAEDLLSYA  561

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W++W DGTP+E+LD  L + SYT  EV +C+H+GL CVQED D+RP+M+ VVL+LSS+S 
Sbjct  562   WKKWNDGTPLELLDMTL-RDSYTSVEVTRCIHVGLCCVQEDPDQRPSMQTVVLLLSSHSV  620

Query  513   NNWSTPREPAFY  478
                  P+ PA Y
Sbjct  621   -TLEPPQRPAGY  631



>ref|XP_007025935.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
 gb|EOY28557.1| Cysteine-rich RLK 29, putative isoform 1 [Theobroma cacao]
Length=666

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 270/341 (79%), Gaps = 10/341 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+ I++  FLR R   K   K++T D   EI   ESLQ+DFATI++ T+ FS  NK+G+G
Sbjct  291   LITISICIFLRAR---KNWEKVETVD---EIIRVESLQFDFATIRVATDNFSDANKLGQG  344

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG+LP GQE+A+KRLS  SGQGE EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  345   GFGAVYKGLLPDGQEVAVKRLSTDSGQGEVEFKNEVLLVAKLQHRNLVRLLGFCLEGRER  404

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+F+FD  ++  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  405   LLIYEFVPNASLDHFIFDQVKRIQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  464

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKIADFGMA++F  D+TQGNTSRIVGTYGYM+PEYAM G+FSVKSDVFSFG
Sbjct  465   NILLDAEMIPKIADFGMARLFVRDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFG  524

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN N ++     +DLLSYAW+ WR+GT + ++DP L   S   NE+++C+
Sbjct  525   VIILEIISGQKN-NCFRNGETVEDLLSYAWKNWREGTALNLIDPTLRDGSR--NEMLRCI  581

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQE+   RPTM  VVLML+S+S  +   P +PAF+
Sbjct  582   HIGLLCVQENVANRPTMATVVLMLNSFSI-SLPLPSQPAFF  621



>gb|KCW75005.1| hypothetical protein EUGRSUZ_E03767 [Eucalyptus grandis]
Length=363

 Score =   433 bits (1114),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 203/325 (62%), Positives = 265/325 (82%), Gaps = 3/325 (1%)
 Frame = -1

Query  1419  TGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQ  1240
             T E++  ESL Y  ATIQ  TN FS  NK+GEGG+G+V++G LP+GQEIA+K+LS+SSGQ
Sbjct  16    TSELTTTESLLYHLATIQAATNNFSHQNKLGEGGFGAVFQGRLPNGQEIAVKKLSKSSGQ  75

Query  1239  GEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEW  1060
             G  EFKNEV +VAKLQH+NLVRLLG+C + EEK+L+YEFVPN SLDYFLFD +++  L+W
Sbjct  76    GVGEFKNEVALVAKLQHRNLVRLLGFCLEGEEKLLVYEFVPNKSLDYFLFDPDKRRQLDW  135

Query  1059  SKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQ  880
             S+RYKII GIARG+LYLHEDSR RIIHRDLK SNILLD +M+PKI+DFGMA+IFG DQT+
Sbjct  136   SRRYKIISGIARGMLYLHEDSRFRIIHRDLKPSNILLDSDMNPKISDFGMARIFGADQTR  195

Query  879   GNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLS  700
               T+ IVGT+GY+SPEYAM+G+ S KSDV+SFGV+ LEII GKKN   +Q ++  ++L S
Sbjct  196   AKTNHIVGTFGYLSPEYAMRGQISAKSDVYSFGVLTLEIICGKKNSCFFQ-SDGGENLAS  254

Query  699   YAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSY  520
             YAW+ WR GTP+E+LDP ++ ++Y+++EV++C+HIGLL VQED  +RPTM  +VLML+S+
Sbjct  255   YAWKHWRAGTPLEVLDPFIS-NAYSIDEVVRCLHIGLLGVQEDPADRPTMASIVLMLTSH  313

Query  519   STNNWSTPREPAFYRNGSGKVPMRE  445
             S    S PR+PAF+   S +  ++E
Sbjct  314   SV-KLSQPRQPAFFLQRSTERRLKE  337



>emb|CDP16212.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 219/356 (62%), Positives = 270/356 (76%), Gaps = 9/356 (3%)
 Frame = -1

Query  1428  TDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRS  1249
              D   EIS  ESLQY  + IQ  TN FS  N+IGEGG+G VYKG+L +GQE+A+KRLSRS
Sbjct  64    VDGVAEISTAESLQYSLSAIQTATNNFSVANEIGEGGFGRVYKGVLANGQEVAVKRLSRS  123

Query  1248  SGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHV  1069
             SGQG +EFKNE+ VVAKLQH+NLVRLLG+C + EEKILIYEFVPN SLDYFLFDSE++  
Sbjct  124   SGQGAEEFKNEIVVVAKLQHRNLVRLLGFCLEGEEKILIYEFVPNRSLDYFLFDSEKKRS  183

Query  1068  LEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGID  889
             L WS+RYKII GIARGLLYLHEDSRLRI+HRDLK SNILLD NM PKIADFGMAKI G+D
Sbjct  184   LNWSRRYKIIGGIARGLLYLHEDSRLRIVHRDLKASNILLDGNMSPKIADFGMAKICGVD  243

Query  888   QTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQD  709
             Q+ GNT+RI GT+GYM+PEY   G+FSVKSDVFS GV++LEII+GKKN +++  +  ++ 
Sbjct  244   QSVGNTNRIAGTFGYMAPEYTRCGQFSVKSDVFSLGVVVLEIITGKKN-SSFNVSEDSEG  302

Query  708   LLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLML  529
             LLSYAW+ WR+G P+ +LD  +  S    NEVIQCV +GL+CV+E+  +RPTM  VV ML
Sbjct  303   LLSYAWKHWRNGDPLALLDSSIGDSCIK-NEVIQCVQVGLVCVEEEVSKRPTMASVVQML  361

Query  528   SSYSTNNWSTPREPA-FYRNGS-GKVPMREI----SLELSVTVSDEASTIGKLCPR  379
             ++ S     TP  PA F R+GS G+V   E+    +  +S   S   ++I + CPR
Sbjct  362   NNSSV-TLPTPHCPAVFRRHGSEGRVGELEVEQSNTERISAPSSVNEASITEPCPR  416



>gb|KCW75004.1| hypothetical protein EUGRSUZ_E03766 [Eucalyptus grandis]
Length=666

 Score =   444 bits (1142),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/367 (60%), Positives = 282/367 (77%), Gaps = 6/367 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVT-GEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             LLF+A    LR R   K    +Q    +  +I+N ESLQYDFATIQ  T+ FS  NK+GE
Sbjct  293   LLFLACC--LRRRKVTKPYEVVQEDQSSVNDIANAESLQYDFATIQAATDNFSHQNKLGE  350

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G V++G L +G +IA+KRLS+ SGQG  EFKNEV +VAKLQH+NLVR+LG+C + EE
Sbjct  351   GGFGEVFQGRLNNGHQIAVKRLSQGSGQGVGEFKNEVLLVAKLQHRNLVRMLGFCLEGEE  410

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             K+L+YEFVPN SLDYFLFD E+   L+WS+RYKI+ GIARG+LYLHEDSRLRIIHRDLK 
Sbjct  411   KLLVYEFVPNKSLDYFLFDPEKSKQLDWSRRYKIVCGIARGMLYLHEDSRLRIIHRDLKA  470

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD  M PKI+DFGMA+I  +DQTQ NT++IVGT+GYMSPEYAM G+FSVKSDV+SF
Sbjct  471   SNILLDSEMIPKISDFGMARIVVVDQTQANTNKIVGTFGYMSPEYAMHGQFSVKSDVYSF  530

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV+LLE+ISGKKN   YQ ++  +DL S+ W+ WRDGTP+E+LD  +   SY+ +EV++C
Sbjct  531   GVLLLELISGKKNSFFYQ-SDGGEDLASHVWKNWRDGTPLEVLDLAVG-DSYSRDEVLRC  588

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSV  424
             +HIGLLCVQED  +RPTM ++VLML+SYS  + + P++PAF+     +  M+E+  + S 
Sbjct  589   LHIGLLCVQEDPMDRPTMANIVLMLNSYSV-SLALPQQPAFFLRSRTETLMKELESDQSA  647

Query  423   TVSDEAS  403
             + S   S
Sbjct  648   SRSTPVS  654



>ref|XP_010439209.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Camelina sativa]
Length=666

 Score =   444 bits (1141),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 222/376 (59%), Positives = 286/376 (76%), Gaps = 10/376 (3%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             FIA   FL  R  K  +T   T+   G+ I+  +SLQ D+  IQ  T+ F+  NKIG+GG
Sbjct  297   FIAGYCFLAKRAKKSYDT---TSAYDGDDITTADSLQLDYRKIQTATDDFAASNKIGQGG  353

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQGE EFKNEV VVAKLQH+NLV+LLG+C   EE++
Sbjct  354   FGEVYKGTLTDGTEVAVKRLSKSSGQGEVEFKNEVVVVAKLQHRNLVKLLGFCLDGEERL  413

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+Y++VPN SLD+FLFD  +Q  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK SN
Sbjct  414   LVYDYVPNKSLDFFLFDPAKQGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASN  473

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G++S+KSD++SFGV
Sbjct  474   ILLDADMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDIYSFGV  533

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +GTP E++DP +A  S+  NEV++CVH
Sbjct  534   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGTPSELVDPAIA-DSFQRNEVVRCVH  591

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPM--REISLELS  427
             IGLLCVQED  ERPT+  +V+ML+S +T     PR+P  F+++  GK P+   + S   S
Sbjct  592   IGLLCVQEDPAERPTLSSIVMMLTS-NTVTLPVPRQPGLFFQSRIGKDPLDTDQFSTTRS  650

Query  426   VTVSDEASTIGKLCPR  379
             +  S + +TI  L PR
Sbjct  651   LIGSVDDATITDLYPR  666



>ref|XP_006449133.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
 gb|ESR62373.1| hypothetical protein CICLE_v10014789mg [Citrus clementina]
Length=555

 Score =   439 bits (1130),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 213/342 (62%), Positives = 270/342 (79%), Gaps = 6/342 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG-EISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             +L I + +FLR R   + N+K+++    G EI+  ESLQ+DF TI++ T+ FS  NK+G+
Sbjct  173   ILIIFICFFLR-RRKPRDNSKVKSEAAAGDEINRAESLQFDFNTIRVATDNFSDANKLGQ  231

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G+VYKG L  G EIA+KRLSR SGQG+ EFKNEV +VA LQH+NLVRLLG+  +  E
Sbjct  232   GGFGAVYKGRLYDGAEIAVKRLSRDSGQGDLEFKNEVLLVANLQHRNLVRLLGFSLEGNE  291

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             ++LIYEFVPN SLD+F+FD  R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLKT
Sbjct  292   RLLIYEFVPNTSLDHFIFDPTRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKT  351

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SN+LLD  M PKIADFGMA++F +D+TQGNTSRIVGTYGYM+PEYAM G++SVKSDVFSF
Sbjct  352   SNVLLDAEMTPKIADFGMARLFEMDETQGNTSRIVGTYGYMAPEYAMHGQYSVKSDVFSF  411

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISG++N N ++     +DLLS AW+ WR+GT + I+DP L  SS ++ E+I+C
Sbjct  412   GVLVLEIISGQRN-NCFRNGETVEDLLSSAWKNWREGTTVNIIDPTL--SSGSITEMIRC  468

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +HIGLLCVQE+   RPTM  VVLML+SYS      P EPAF+
Sbjct  469   IHIGLLCVQENVASRPTMASVVLMLNSYSL-TLPVPSEPAFF  509



>ref|XP_009136824.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X2 [Brassica rapa]
Length=672

 Score =   443 bits (1140),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 211/377 (56%), Positives = 284/377 (75%), Gaps = 9/377 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LL +AVL F     +K++ T  +T  +    +I+   SLQ+DF  I+  T+ FS  NK+G
Sbjct  302   LLLVAVLIF----RAKRKTTAYETEPLADGDDITTAGSLQFDFRAIEAATDKFSESNKLG  357

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLVRLLG+C + E
Sbjct  358   QGGFGQVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGFCLEGE  417

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YEFVPN SLDYFLFDS  Q  L+W KR KII GIARG+LYLH+DSRL IIHRDLK
Sbjct  418   EKILVYEFVPNKSLDYFLFDSTMQSQLDWKKRCKIIAGIARGILYLHQDSRLTIIHRDLK  477

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
               NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+S
Sbjct  478   AGNILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYS  537

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN + YQ  + A +L++Y W  W +G+P+E++DP   + +Y  NE+ +
Sbjct  538   FGVLVLEIISGKKNSSLYQMDDSAGNLVTYTWRLWSNGSPLELVDPSF-QDNYQTNEITR  596

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLEL  430
             C+HI LLCVQE+A++RPTM  ++ ML++ S+   + PR P  F+R+   +V   + S+ +
Sbjct  597   CIHIALLCVQEEAEDRPTMSAILQMLTT-SSIALAVPRPPGFFFRSRHEQVGRADPSMHM  655

Query  429   SVTVSDEASTIGKLCPR  379
             S   S + ++I  + PR
Sbjct  656   SALCSVDDASITSVAPR  672



>ref|XP_007025937.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
 gb|EOY28559.1| Cysteine-rich RLK 29, putative [Theobroma cacao]
Length=680

 Score =   443 bits (1140),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/350 (60%), Positives = 267/350 (76%), Gaps = 4/350 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+   + + LR+R SK +    +  +   EI + ESLQY+F+TI+  T+ FS  NK+G+G
Sbjct  302   LISSCIFFILRVRKSKVKAETREAAEAVDEIGSAESLQYEFSTIRAATDDFSDANKLGQG  361

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L  G+ IA+KRLS  SGQG+ EFKNEV +VAKLQH+NLVRL G+C    E+
Sbjct  362   GFGAVYKGTLADGELIAVKRLSTDSGQGDLEFKNEVRLVAKLQHRNLVRLRGFCLDGNER  421

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD FLFD  +   L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  422   LLIYEFVPNASLDQFLFDPVKHAYLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  481

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA++  +DQTQG TSRIVGTYGYM+PEYAM G+FSVKSDVFSFG
Sbjct  482   NILLDAEMNPKISDFGMARLCALDQTQGATSRIVGTYGYMAPEYAMHGQFSVKSDVFSFG  541

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEI+ G+KN + ++     +DLLSYAW  W+DGTP+ ++DP+L ++S T  EV++C+
Sbjct  542   VLLLEILCGQKN-SAFRVGENVEDLLSYAWRNWKDGTPLNLVDPILREASRT--EVMRCI  598

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM  451
             HIGLLCVQE+A +RP M  VVLML+SYS      P EPAF+ + + +  M
Sbjct  599   HIGLLCVQENAAQRPNMASVVLMLTSYSV-TLPLPAEPAFFMHSNTQSDM  647



>gb|KFK23238.1| hypothetical protein AALP_AAs43447U000100 [Arabis alpina]
Length=571

 Score =   440 bits (1131),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 215/349 (62%), Positives = 273/349 (78%), Gaps = 6/349 (2%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGY  1315
             FIA   FL  R  KK+N    +     +I+  +SLQ D+ TIQ  T+ F+  NKIGEGG+
Sbjct  202   FIAGYCFLAKR--KKKNYDTASAFDGDDITTADSLQLDYRTIQSATDNFAESNKIGEGGF  259

Query  1314  GSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKIL  1135
             G VYKG L  G E+A+KRLS+SSGQGE+EFKNEV +VAKLQH+NLVRLLG+C + EE++L
Sbjct  260   GQVYKGTLLDGTEVAVKRLSKSSGQGEREFKNEVVLVAKLQHRNLVRLLGFCLEGEERVL  319

Query  1134  IYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNI  955
             +YE+VPN SLDYF+FD  +Q  L+WS+RYKII GIARG+LYLH+DSRL IIHRDLK SN+
Sbjct  320   VYEYVPNESLDYFVFDPAKQGQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKASNV  379

Query  954   LLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVM  775
             LLD +M+PKIADFGMA+IFGIDQT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV+
Sbjct  380   LLDADMNPKIADFGMARIFGIDQTEQNTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVL  439

Query  774   LLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHI  595
             +LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP +  +    NEV++CVHI
Sbjct  440   VLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGQPLELVDPAIVDNCQR-NEVVRCVHI  497

Query  594   GLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPM  451
             GLLCVQED  ERPT+  +VLML+S +T     PR+P  F+++   K P+
Sbjct  498   GLLCVQEDPVERPTLSSIVLMLTS-NTVTLPVPRQPGLFFQSRPEKDPL  545



>emb|CBI23395.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   432 bits (1111),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/337 (62%), Positives = 266/337 (79%), Gaps = 8/337 (2%)
 Frame = -1

Query  1440  KLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKR  1261
             KL+T D   +I N ESL +DF TI++ TN FS  NK+G+GG+G VYKG L +GQ+IA+KR
Sbjct  15    KLETND-EDDIINVESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGKLSNGQDIAVKR  73

Query  1260  LSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSE  1081
             LS  SGQGE EFKNEV +VAKLQH+NLVRLLG+C    E++LIYEFVPN SLD+F+FD  
Sbjct  74    LSSGSGQGELEFKNEVVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIFDPI  133

Query  1080  RQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKI  901
             R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK SNILLD  M+PKI+DFGMA++
Sbjct  134   RRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGMARL  193

Query  900   FGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTN  721
             F +DQTQGNTSRIVGTYGYM+PEYAM G FSVK+DV+SFGV++LE++SG++N N ++ + 
Sbjct  194   FLVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLVLELVSGQRN-NCFRVSE  252

Query  720   RAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDV  541
               + LLSYAW+ WR+GT   ++DP +  SS  ++E+++C+HIGLLCVQE+  +RPTM  +
Sbjct  253   NIEHLLSYAWKNWREGTATNLIDPTMRISS--ISEIMRCIHIGLLCVQENEADRPTMASI  310

Query  540   VLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLEL  430
              LML+SYS  +   P  PAF+ N S     R++SLEL
Sbjct  311   ALMLNSYSL-SLPLPSHPAFFMNTSMN---RDMSLEL  343



>ref|XP_010057272.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=447

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 283/382 (74%), Gaps = 14/382 (4%)
 Frame = -1

Query  1491  IAVLYFLR----IRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             I VL FL      R  KK    ++  +   E++  ESLQ+D AT+Q  TN FSP+ K+GE
Sbjct  69    IMVLLFLTGCWLRRKGKKTYEVIEAINGANELTTMESLQFDLATMQSATNDFSPEKKLGE  128

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G V++G LP+GQEIA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+C +  E
Sbjct  129   GGFGEVFQGRLPNGQEIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFCLEGAE  188

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             K+L YEFVPN SLD+FLFD E++  L+W  RYKII  IARG+LYLHEDSRLRIIHRDLK 
Sbjct  189   KLLAYEFVPNKSLDHFLFDLEKRRQLDWPTRYKIISRIARGMLYLHEDSRLRIIHRDLKC  248

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD  M+PKI+DFGMA+IFGI+Q Q +T++IVGT+GYMSPEYAM GEFSVKSDV+SF
Sbjct  249   SNILLDNEMNPKISDFGMARIFGINQNQASTNKIVGTFGYMSPEYAMHGEFSVKSDVYSF  308

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             G++LLEII GKKN N Y   +  + L +Y W QWRD  P+E+LDP + + SY+ +EV++C
Sbjct  309   GILLLEIICGKKN-NFYPRLDGGEYLATYVWNQWRDNRPLEVLDPTI-EYSYSRDEVLRC  366

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSG-KVPMREISLE  433
             +H+ LLC+QED   RPTM  VV ML+S S  N   P+ PAF+  R+  G +VPM E+ LE
Sbjct  367   LHMCLLCIQEDPTIRPTMATVVFMLNSNSI-NLPLPQHPAFFIQRSLRGQRVPMEELELE  425

Query  432   LS----VTVSDEASTIGKLCPR  379
              S    + +S    +I +L PR
Sbjct  426   QSTRSTMPLSTNGMSITELDPR  447



>gb|KDP20816.1| hypothetical protein JCGZ_21287 [Jatropha curcas]
Length=670

 Score =   442 bits (1137),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 270/341 (79%), Gaps = 11/341 (3%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             L I    FLR+R  ++          T EI N +SLQ+DF TI++ TN FS +NK+G+GG
Sbjct  293   LVICFCIFLRVRKPRENFE-------TDEIKNVKSLQFDFGTIRVATNNFSEENKLGQGG  345

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G+VYKG L  GQ+IA+KRLS+ SGQG+ EFKNEV +VAKLQH+NLVRLLG+C + +E++
Sbjct  346   FGAVYKGTLSDGQDIAVKRLSKDSGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLEGKERL  405

Query  1137  LIYEFVPNGSLDYFLFDSERQHV-LEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             LIYEFVPN SLD+FLF+  R+   L+W +RYKII GIA+GLLYLHEDSRLRIIHRD+K S
Sbjct  406   LIYEFVPNTSLDHFLFNQNRRRTHLDWHRRYKIIGGIAKGLLYLHEDSRLRIIHRDMKAS  465

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA++F +DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSDVFSFG
Sbjct  466   NILLDAEMNPKISDFGMARLFMVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFG  525

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEI+ G+KN N ++     +DLLSYAW+ WR+GT + ++DP+L ++S + NE+++C+
Sbjct  526   VLLLEIVCGQKNSN-FRDGENVEDLLSYAWKNWREGTYMNLIDPIL-RTSGSTNEMMRCI  583

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQE+  +RP M  VVLMLSSYS      P +PAF+
Sbjct  584   HIGLLCVQENVADRPNMASVVLMLSSYSL-TLPVPSKPAFF  623



>ref|XP_009136831.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 isoform X3 [Brassica rapa]
Length=672

 Score =   442 bits (1136),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/377 (57%), Positives = 282/377 (75%), Gaps = 9/377 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LL +AVL F     +K++ T  +T  +    +I+   SLQ+DF  I+  T+ FS +NK+G
Sbjct  302   LLLVAVLIF----RAKRKTTAYETEPLADGDDIATAGSLQFDFKAIEAATDKFSQENKLG  357

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG  PSG ++A+KRLS +SGQG++EF+NEV VVAKLQH+NLVRLLG+C + E
Sbjct  358   QGGFGQVYKGTFPSGVQVAVKRLSNTSGQGKREFENEVVVVAKLQHRNLVRLLGFCLEGE  417

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SLDYFLFDS  Q+ L+W+KRYKI+ GIARG+LYLH+DSRL IIHRDLK
Sbjct  418   EKILIYEFVPNKSLDYFLFDSTMQNQLDWAKRYKIVGGIARGILYLHQDSRLTIIHRDLK  477

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
               NILLDV+M+PK+ADFGMA+IFGIDQTQ NT R+VGTYGYMSPEYAM G FS+KSDV+S
Sbjct  478   AGNILLDVDMNPKVADFGMARIFGIDQTQANTRRVVGTYGYMSPEYAMYGHFSMKSDVYS  537

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN + Y+    A +L++Y+W  W +G P++++DP   +  Y  NE+ +
Sbjct  538   FGVLILEIISGKKNSSLYEMDGSAGNLVTYSWRLWSNGLPLKLVDPSF-QDDYQTNEITR  596

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLEL  430
             C+HI LLCVQE+A++RPTM  VV ML++ S+   + PR P  F+R+   KV     S   
Sbjct  597   CIHIALLCVQEEAEDRPTMSAVVQMLTT-SSIALAEPRPPGFFFRSRDEKVEKVGPSTHT  655

Query  429   SVTVSDEASTIGKLCPR  379
             S   S + ++I  + PR
Sbjct  656   SALCSVDDASITSVAPR  672



>emb|CDP19430.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   432 bits (1112),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 265/342 (77%), Gaps = 4/342 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I  L FL+ R S+++  ++       EIS  ESLQY    IQ+ TN FS DNKIGEG
Sbjct  36    VLLIIALVFLQ-RRSRRRYVEMALKPTVAEISMAESLQYSLTEIQIATNNFSVDNKIGEG  94

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQE+A KRLSRSSGQG +EFKNE+ VVAKLQH+NLVRLLG+C + EEK
Sbjct  95    GFGRVYKGVLGNGQEVAAKRLSRSSGQGAEEFKNEILVVAKLQHRNLVRLLGFCLEGEEK  154

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD E +  L WS+RY II GIA+GLLYLH+DSRLRI+HRDLK S
Sbjct  155   ILIYEFVPNKSLDYFLFDPENKRSLNWSRRYNIIGGIAKGLLYLHKDSRLRIVHRDLKAS  214

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM PKIADFGMAKI G+DQ++GNT+RI GT+GYM+PEY  +G+FS+KSDVFSFG
Sbjct  215   NILLDGNMSPKIADFGMAKICGVDQSEGNTNRIAGTFGYMAPEYMRRGQFSIKSDVFSFG  274

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LE+++GKKN +++Q +  ++DL+SY W+ WR G  + +LD  +   S+  NEVIQC+
Sbjct  275   VVILEMVTGKKN-SSFQQSEDSEDLVSYVWKHWRRGESLALLDSSIG-DSFAENEVIQCI  332

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYR  475
              +GLLCV+E   +RPT+  VV ML+S S+    TPR PA +R
Sbjct  333   QLGLLCVEEYVSKRPTVASVVNMLNS-SSVTLPTPRRPAVFR  373



>ref|XP_010448769.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 isoform 
X1 [Camelina sativa]
Length=657

 Score =   441 bits (1135),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 268/341 (79%), Gaps = 3/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFIA  Y  R + +KK        DV  +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  289   MLFIAC-YCFRAKRAKKTYETAAAHDVGDDIATAGSLQFDFKVIEAATDKFSESNKLGQG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG  P+G ++A+KRLS++SGQGEKEFKNEV VVAKLQHKNLVRLLG+C +REEK
Sbjct  348   GFGEVYKGTFPNGLQVAVKRLSKTSGQGEKEFKNEVIVVAKLQHKNLVRLLGFCLEREEK  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS  ++ L+W++RYKIIRGIARG+LYLH+DSRL IIHRDLK  
Sbjct  408   ILVYEFVPNKSLDYFLFDSTMKNQLDWTRRYKIIRGIARGILYLHQDSRLTIIHRDLKAG  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  468   NILLDDDMNPKVADFGMARIFKMDQTEANTRRVVGTYGYMSPEYAMYGKFSMKSDVYSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             +++LEIISGKKN  +YQ  +   +L++YAW  W + +P+E++DP   + SY +NE+ +C+
Sbjct  528   ILVLEIISGKKNIGSYQMDSSEGNLVTYAWRVWNNESPMEVVDPSF-QDSYQINEITRCI  586

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQE+A++RPTM  VV ML++ S+   + PR P  +
Sbjct  587   HIALLCVQEEAEDRPTMSTVVQMLTT-SSIALAAPRPPGCF  626



>ref|XP_010439210.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Camelina sativa]
Length=620

 Score =   440 bits (1131),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 212/348 (61%), Positives = 274/348 (79%), Gaps = 6/348 (2%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             +I+  +SLQ D+  IQ  T+ F+  NKIG+GG+G VYKG L  G E+A+KRLS+SSGQGE
Sbjct  276   DITTADSLQLDYRKIQTATDDFAASNKIGQGGFGEVYKGTLTDGTEVAVKRLSKSSGQGE  335

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV VVAKLQH+NLV+LLG+C   EE++L+Y++VPN SLD+FLFD  +Q  L+W++
Sbjct  336   VEFKNEVVVVAKLQHRNLVKLLGFCLDGEERLLVYDYVPNKSLDFFLFDPAKQGQLDWTR  395

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII G+ARG+LYLH+DSRL IIHRDLK SNILLD +M+PKIADFGMA+IFG+DQTQ N
Sbjct  396   RYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTQEN  455

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             TSRIVGTYGYMSPEYAM G++S+KSD++SFGV++LEIISGKKN + YQ T+ A DL+SYA
Sbjct  456   TSRIVGTYGYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKKNSSFYQ-TDGAHDLVSYA  514

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W  W +GTP E++DP +A  S+  NEV++CVHIGLLCVQED  ERPT+  +V+ML+S +T
Sbjct  515   WRLWSNGTPSELVDPAIAD-SFQRNEVVRCVHIGLLCVQEDPAERPTLSSIVMMLTS-NT  572

Query  513   NNWSTPREPA-FYRNGSGKVPM--REISLELSVTVSDEASTIGKLCPR  379
                  PR+P  F+++  GK P+   + S   S+  S + +TI  L PR
Sbjct  573   VTLPVPRQPGLFFQSRIGKDPLDTDQFSTTRSLIGSVDDATITDLYPR  620



>ref|XP_004153962.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like, 
partial [Cucumis sativus]
Length=633

 Score =   440 bits (1132),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/379 (57%), Positives = 288/379 (76%), Gaps = 11/379 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++ +AV ++   R +KK+ + ++   V  E+S  ESLQ+DF TI   TN FS +N++GEG
Sbjct  261   IILVAVGWWFLHRRAKKKYSPVKEDSVIDEMSTAESLQFDFKTINDATNNFSEENRLGEG  320

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L +GQEIA+KRLSR S QG +EFKNEV +VAKLQH+NLV+LLG+C    EK
Sbjct  321   GFGAVYKGRLENGQEIAVKRLSRGSSQGFEEFKNEVMLVAKLQHRNLVKLLGFCLDGGEK  380

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYE++PN SL++FLFD +RQ  L+W KRYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  381   ILIYEYIPNKSLNFFLFDPKRQRELDWLKRYKIIHGIARGMLYLHEDSRLRIIHRDLKAS  440

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFG+A+I  +DQTQGNT+RIVGTYGYM+PEYAM G FS+KSDV+SFG
Sbjct  441   NILLDKNMNPKISDFGLARIVQVDQTQGNTNRIVGTYGYMAPEYAMHGNFSLKSDVYSFG  500

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++ EI+SGKKN NT+  ++ A+D++++AW+ W DGT + +LD  L + SY+  + ++C+
Sbjct  501   VIVFEILSGKKN-NTFYLSDVAEDIMTHAWKLWTDGTSLTLLDASL-RESYSKRQALRCI  558

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF-YRNGSGKVPMREISLELSV  424
             HI LLCVQ D   RP+M  +VLMLSS+ST +   P+EPAF  R+  G +    I  + S 
Sbjct  559   HIALLCVQHDPLCRPSMASIVLMLSSHST-SLPLPKEPAFSMRSKDGGIV---IESDRST  614

Query  423   TVSDEAST----IGKLCPR  379
               SD +ST    + +LCPR
Sbjct  615   RKSDHSSTNEISMSELCPR  633



>ref|XP_006383968.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
 gb|ERP61765.1| hypothetical protein POPTR_0004s02560g [Populus trichocarpa]
Length=621

 Score =   439 bits (1129),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/311 (65%), Positives = 257/311 (83%), Gaps = 4/311 (1%)
 Frame = -1

Query  1398  ESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKN  1219
             ESLQ+DF+TI+  T+ FS +NK+G+GG+GSVYKG L +GQE+A+KRLS+ SGQG+ EFKN
Sbjct  273   ESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDLEFKN  332

Query  1218  EVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKII  1039
             EV +VAKLQH+NLVRL G+C +  E++LIYEFVPN SLD+F+F+  R+  L+W +RYKII
Sbjct  333   EVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFIFNQARRAQLDWERRYKII  392

Query  1038  RGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIV  859
              GIARGLLYLHEDSRLRIIHRDLK SNILLD +M+PKI+DFGMA++F +D+TQGNTSRIV
Sbjct  393   GGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGMARLFVMDETQGNTSRIV  452

Query  858   GTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWR  679
             GTYGYM+PEYAM G+FSVKSDVFSFGV++LEI+SG+KN N ++     +DLLSYAW  WR
Sbjct  453   GTYGYMAPEYAMHGQFSVKSDVFSFGVLILEIVSGQKN-NCFRNGETVEDLLSYAWRNWR  511

Query  678   DGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWST  499
             +GT + ++DP L+  S T  E+++C+HIGLLCVQE+  +RPTM  +VLMLSSYS      
Sbjct  512   EGTGLNVIDPALSTGSRT--EMMRCIHIGLLCVQENIADRPTMASIVLMLSSYSL-TLPV  568

Query  498   PREPAFYRNGS  466
             P +PAF+ N S
Sbjct  569   PSQPAFFMNSS  579



>ref|XP_006605283.1| PREDICTED: serine/threonine kinase-like protein isoform X1 [Glycine 
max]
 ref|XP_006605284.1| PREDICTED: serine/threonine kinase-like protein isoform X2 [Glycine 
max]
Length=636

 Score =   440 bits (1131),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 267/340 (79%), Gaps = 4/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF+  +YFLR R SKK NT  Q + +  ++ + ESLQ+D A ++  T  FS +NKIG+GG
Sbjct  283   LFVVGVYFLRKRASKKYNTFAQDS-IVDDLIDVESLQFDLAMVEAATEGFSDENKIGQGG  341

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+ P+GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C +  EKI
Sbjct  342   FGVVYKGVFPNGQEIAVKRLSVTSLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGWEKI  401

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE++PN SLD+FLFD  +Q  L+WS+RYKII GIARG+LYLHEDS+LRIIHRDLK SN
Sbjct  402   LLYEYIPNKSLDHFLFDHVKQRELDWSRRYKIILGIARGILYLHEDSQLRIIHRDLKASN  461

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM PKI+DFGMAKI   D TQ NT RIVGT+GYMSPEYAM G FSVKSDVFSFGV
Sbjct  462   VLLDENMIPKISDFGMAKIIQEDHTQVNTGRIVGTFGYMSPEYAMHGHFSVKSDVFSFGV  521

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + YQ +N A DLLS+AW+ W + TP+E LDP L + SY+ NEV +C+H
Sbjct  522   LVLEIVSGKKNTDFYQ-SNHADDLLSHAWKNWTEKTPLEFLDPTL-RGSYSRNEVNRCIH  579

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQE+  +RP+M  + LML+SYS    S PR+PA +
Sbjct  580   IGLLCVQENPSDRPSMATIALMLNSYSV-TLSMPRQPASF  618



>emb|CBI35335.3| unnamed protein product [Vitis vinifera]
Length=792

 Score =   445 bits (1144),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 262/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  1422  VTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSG  1243
             V  +I+  +SLQ+DF T++  TN FS DNKIGEGG+G VYKG L SG+EIAIKRLSRSS 
Sbjct  317   VENDITTVQSLQFDFGTLEATTNNFSDDNKIGEGGFGDVYKGTLSSGKEIAIKRLSRSSA  376

Query  1242  QGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLE  1063
             QG  EFKNEV +VAKLQH+NLVRLLG+C + EEKIL+YE+VPN SLD+FLFD ++Q  L+
Sbjct  377   QGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGEEKILVYEYVPNKSLDHFLFDPDKQGQLD  436

Query  1062  WSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQT  883
             WS+RYKII  IARG+LYLHEDS L++IHRDLK SN+LLD +M+PKI+DFGMA+IFG+DQT
Sbjct  437   WSRRYKIIGRIARGILYLHEDSPLKVIHRDLKASNVLLDGDMNPKISDFGMARIFGVDQT  496

Query  882   QGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLL  703
             +G+T R+VGTYGYMSPEYAM G FS KSDV+SFGV++LEIISGKKN   Y+ + + +DLL
Sbjct  497   RGSTKRVVGTYGYMSPEYAMHGHFSAKSDVYSFGVLVLEIISGKKNSCFYE-SGQTEDLL  555

Query  702   SYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSS  523
             SYAW+ WR+GTP+E++DP++   SY  NEVI+C+H+GLLCVQED ++RP+M  VVLMLSS
Sbjct  556   SYAWKLWRNGTPLELMDPIMG-DSYARNEVIRCIHMGLLCVQEDPEDRPSMASVVLMLSS  614

Query  522   YSTNNWSTPREPAF  481
             YS      P++PAF
Sbjct  615   YSVTP-PLPQQPAF  627



>ref|XP_009136929.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica 
rapa]
Length=668

 Score =   441 bits (1133),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 270/342 (79%), Gaps = 7/342 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             LLFIA   FL  R  K  +T   T+   G+ I+  +SLQ D+ +IQ  T  F+  NKIGE
Sbjct  295   LLFIAGYCFLTKRAKKAYHT---TSAFDGDDITTSDSLQLDYRSIQTATADFAESNKIGE  351

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G VYKG L  G E+A+K+LS+SSGQG+ EFKNEV +VAKLQH+NLVRLLG+C + EE
Sbjct  352   GGFGEVYKGTLLDGTEVAVKKLSKSSGQGDVEFKNEVVLVAKLQHRNLVRLLGFCLEGEE  411

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             ++L+YE+VPN SLDYFLFD  +Q  L+WS+RYKII G+ARG+LYLH+DSRL IIHRDLK 
Sbjct  412   RVLVYEYVPNKSLDYFLFDPAKQAQLDWSRRYKIIGGVARGILYLHQDSRLTIIHRDLKA  471

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G++S+KSDV+SF
Sbjct  472   SNILLDGDMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSF  531

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISGKKN + YQ T+ A DL+SYAW  W +GTP++++DPV+  +    NEV++C
Sbjct  532   GVLVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGTPLDLVDPVIVDNCQR-NEVVRC  589

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             VHIGLLCVQED  ERPT+  +VLML+S +T     PR+P  Y
Sbjct  590   VHIGLLCVQEDPVERPTLSTIVLMLTS-NTVTLPVPRQPGLY  630



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score =   441 bits (1135),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 216/337 (64%), Positives = 264/337 (78%), Gaps = 6/337 (2%)
 Frame = -1

Query  1491  IAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYG  1312
             I   Y+LR    +K+  K+    V  EI   ESLQ++  TI   TN FS  NKIGEGG+G
Sbjct  316   ILCYYWLR----RKKKDKVGEEQVGNEIGGVESLQFNLITITAATNNFSDGNKIGEGGFG  371

Query  1311  SVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILI  1132
             SVYKG L +GQEIA+KRLSRSSGQG  EFKNEV +VAKLQH+NLVRLLG+C + +EKILI
Sbjct  372   SVYKGKLSNGQEIAVKRLSRSSGQGAVEFKNEVVLVAKLQHRNLVRLLGFCLEGQEKILI  431

Query  1131  YEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNIL  952
             YEFVPN SLDYFLFD +++  L+W  RYKII GIARGLLYLHEDSRLRIIHRDLK SNIL
Sbjct  432   YEFVPNKSLDYFLFDPDKRACLDWPTRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNIL  491

Query  951   LDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVML  772
             LD +M+PKI+DFGMA+IFG+DQ+Q NT+RIVGTYGYMSPEYAM G+FSVKSDV+SFGV+L
Sbjct  492   LDGDMNPKISDFGMARIFGVDQSQANTNRIVGTYGYMSPEYAMHGQFSVKSDVYSFGVLL  551

Query  771   LEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIG  592
             LEI++G KN +++  +   +DLLSYAW  W +GT +++LDP+L +  Y+ +EV++C HIG
Sbjct  552   LEIVTGHKN-SSFDQSEFGEDLLSYAWRHWNEGTALQMLDPILTE-HYSRDEVMRCTHIG  609

Query  591   LLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF  481
             LLCVQED  +RPTM  +VLML+SYS       R P F
Sbjct  610   LLCVQEDVVDRPTMARIVLMLNSYSVTLELPLRPPRF  646



>ref|XP_006285944.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
 gb|EOA18842.1| hypothetical protein CARUB_v10007464mg [Capsella rubella]
Length=666

 Score =   441 bits (1133),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 215/341 (63%), Positives = 270/341 (79%), Gaps = 5/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFIA   FL  R  K  +T+ Q  D   +I+ EESLQ D+ TIQ  TN +S +NKIG G
Sbjct  295   LLFIAGYCFLAKRAHKNSDTQ-QAFD-GDDITTEESLQLDYRTIQAATNNYSENNKIGRG  352

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +G E+A+KRLS+SSGQG+ EFKNEV VVAKLQH+NLVRLLG+  +REE+
Sbjct  353   GFGEVYKGTLSNGSEVAVKRLSKSSGQGDTEFKNEVVVVAKLQHRNLVRLLGFSLEREER  412

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDYFLFD  +Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK S
Sbjct  413   ILVYEYVPNKSLDYFLFDPTKQAQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAS  472

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI DFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  473   NILLDKDMNPKITDFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQFSMKSDVYSFG  532

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN N++  TN   DLL+YAW  W +G  ++++DP++ ++    +EVI+C+
Sbjct  533   VLVLEIISGKKN-NSFYGTNGTHDLLTYAWRLWSNGPVLDLVDPMIVENCQK-SEVIRCI  590

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED  ERPTM  + +ML+S +T     PR+P F+
Sbjct  591   HIGLLCVQEDPVERPTMPAIFMMLTS-NTVTLQVPRQPGFF  630



>emb|CDP11363.1| unnamed protein product [Coffea canephora]
Length=687

 Score =   441 bits (1134),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 221/382 (58%), Positives = 281/382 (74%), Gaps = 11/382 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQ--TTDVTGEISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +LFI  L FL+ R+ K+     Q   TD   EI   ESLQY    IQ+ TN FS DNKIG
Sbjct  309   VLFIIALVFLKRRSGKRYAAMAQQEATDGVAEIFTAESLQYSLTEIQIATNNFSVDNKIG  368

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             EGG+G VYKG+L +GQE+A+KRLSRSSGQG +EFKNE+ VVAKLQH+NLVRLLG+C + +
Sbjct  369   EGGFGRVYKGILGNGQEVAVKRLSRSSGQGAEEFKNEIVVVAKLQHRNLVRLLGFCLEGD  428

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKILIYEFVPN SLD FLFD E +  L W +RY II GIA+GLLYLHEDSRLRI+HRDLK
Sbjct  429   EKILIYEFVPNKSLDSFLFDPENKRSLNWLRRYNIIGGIAKGLLYLHEDSRLRIVHRDLK  488

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SNILLD NM PKIADFGMAKI G+DQ++GNT+RI GT+GYM+PEY   G+FS+KSDVFS
Sbjct  489   ASNILLDGNMSPKIADFGMAKICGVDQSEGNTNRIAGTFGYMAPEYMRWGQFSIKSDVFS  548

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEI++GKKN +++Q +  ++DL+SY W+ WR G P+ +LD  +   S+  NEVIQ
Sbjct  549   FGVVILEIVTGKKN-SSFQKSEDSEDLVSYVWKHWRRGEPLALLDSSIG-DSFAKNEVIQ  606

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLE--  433
             CV +GLLCV+E   +RPTM  VV ML+S S+    TP  PA +R+   +  + E+ +E  
Sbjct  607   CVQLGLLCVEEYVSKRPTMVSVVNMLNS-SSVTLPTPHRPAVFRSHGSESIVEELEVEQS  665

Query  432   ----LSVTVSDEASTIGKLCPR  379
                 +S+  S   ++I + CPR
Sbjct  666   NTERISIPSSVNEASITEPCPR  687



>gb|KFK28891.1| hypothetical protein AALP_AA7G061600 [Arabis alpina]
Length=529

 Score =   436 bits (1120),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 213/379 (56%), Positives = 277/379 (73%), Gaps = 10/379 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVT---GEISNEESLQYDFATIQLITNVFSPDNKI  1330
             LLFIAV  F   R  +K+ T  +T  +     +I+   SLQ+DF  I+  T+ FS  NK+
Sbjct  156   LLFIAVFIF---RAKRKKRTVYETEPLAEGKDDITTAGSLQFDFKAIEAATDKFSQSNKL  212

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G+GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQHKNLVRLLG+C + 
Sbjct  213   GQGGFGEVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHKNLVRLLGFCLEG  272

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             EEKIL+YEFVPN SLDYFLFDS  Q  L+W +RYKI RGIARG+LYLH+DSRL IIHRDL
Sbjct  273   EEKILVYEFVPNKSLDYFLFDSTMQSQLDWKRRYKIFRGIARGILYLHQDSRLTIIHRDL  332

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLDV+M+PK+ADFGMA+IFGI QT+ NT RIVGTYGYMSPEYAM G+FS+KSDV+
Sbjct  333   KAGNILLDVDMNPKVADFGMARIFGIHQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVY  392

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGKKN + Y   +   +L+SY W  W +G+ +E+ DP   + +Y   E+ 
Sbjct  393   SFGVLVLEIISGKKNSSLYHMDDGVGNLVSYTWRLWNNGSALELADPSFGE-NYQTTEIT  451

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISL  436
             +C+HI LLCVQE+ D+RPTM  +V ML++ S+   S PR P F+       +V    +S 
Sbjct  452   RCIHIALLCVQEEVDDRPTMAAIVQMLTT-SSIALSVPRPPGFFFRSRHEQQVGNAVLSK  510

Query  435   ELSVTVSDEASTIGKLCPR  379
             ++S   S + ++I  + PR
Sbjct  511   DMSALCSVDDASITSVAPR  529



>ref|XP_010433941.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=661

 Score =   440 bits (1132),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 273/346 (79%), Gaps = 4/346 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             +IS  +SLQ D+  IQ  T+ F+  NKIG+GG+G VYKG L  G E+A+KRLS+SSGQGE
Sbjct  319   DISTADSLQLDYKKIQTATDDFAAGNKIGQGGFGEVYKGTLTDGTEVAVKRLSKSSGQGE  378

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV VVAKLQH+NLV+LLG+C   EE++L+YE+VPN SLD+FLFD  +Q  L+W++
Sbjct  379   VEFKNEVVVVAKLQHRNLVKLLGFCLDGEERLLVYEYVPNKSLDFFLFDPAKQGQLDWTR  438

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII G+ARG+LYLH+DSRL IIHRDLK SNILLD +M+PKIADFGMA+IFG+DQTQ N
Sbjct  439   RYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQTQEN  498

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             TSRIVGTYGYMSPEYAM G++S+KSD++SFGV++LEIISGKKN + YQ T+ A DL+SYA
Sbjct  499   TSRIVGTYGYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKKNSSFYQ-TDGAHDLVSYA  557

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W  W +GTP+E++D  +A  ++  +EV++C+HIGLLCVQED  ERPT+  +VLML+S +T
Sbjct  558   WRLWSNGTPLELVDASIA-DNFQRSEVVRCMHIGLLCVQEDPVERPTLSTIVLMLTS-NT  615

Query  513   NNWSTPREPA-FYRNGSGKVPMREISLELSVTVSDEASTIGKLCPR  379
                  PR+P  F+++  GK P+   S   S+  S + +TI  L PR
Sbjct  616   MTLPVPRQPGLFFQSRVGKDPLDTFSTTRSLIGSVDDATITDLYPR  661



>emb|CDP04899.1| unnamed protein product [Coffea canephora]
Length=644

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 267/340 (79%), Gaps = 3/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             + + V+ F   R SKK +  +  T    EIS  ESLQY+ + IQ  TN F+  N+IGEGG
Sbjct  268   IVLLVVGFCIARRSKKTHGAIIETTGASEISTAESLQYNLSDIQAATNNFAVGNRIGEGG  327

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L +GQEIA+KRLSRSS QG +EFKNE+ +VA+LQH+NLVRLLG+C + EE+I
Sbjct  328   FGPVYKGTLHNGQEIAVKRLSRSSAQGTEEFKNEIALVARLQHRNLVRLLGFCLEGEERI  387

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFV N SLDYF+FD E+Q +L+WS+R KII GIARG+LYLHEDSRLRIIHRDLK SN
Sbjct  388   LIYEFVTNKSLDYFVFDPEKQPLLDWSRRCKIIGGIARGVLYLHEDSRLRIIHRDLKASN  447

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM+PKIADFGMA++FG+DQ++GNTS++ GTYGYM+PEYA+ G FSVKSDVFSFGV
Sbjct  448   VLLDRNMNPKIADFGMARLFGVDQSEGNTSKVAGTYGYMAPEYALHGLFSVKSDVFSFGV  507

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + +   +   DL SYAW QWRDGTP+ ++DP +   +Y+ NEVIQ +H
Sbjct  508   LILEILSGKKN-SQFNQAHGGDDLPSYAWRQWRDGTPLALVDPTIG-DAYSRNEVIQSIH  565

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +GLLCVQ++ ++RPTM  VVLML+S S      P  PA++
Sbjct  566   VGLLCVQDEIEQRPTMASVVLMLNSISI-TLPAPNPPAYF  604



>ref|XP_011004252.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Populus euphratica]
Length=667

 Score =   440 bits (1131),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 269/345 (78%), Gaps = 10/345 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+   +  +LRIR  K+   K +T D   E    ESLQ+DF+TI+  T+ FS +NK+G+G
Sbjct  291   LMISCICLYLRIRKPKE---KAETGD---ETITPESLQFDFSTIRAATDNFSEENKLGQG  344

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSVYKG L +GQE+A+KRLS+ SGQG+ EFKNEV +VAKLQH+NLVRL G+C +  E+
Sbjct  345   GFGSVYKGTLSNGQEVAVKRLSKDSGQGDLEFKNEVLLVAKLQHRNLVRLQGFCLQGIER  404

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+F+F+  R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  405   LLIYEFVPNASLDHFVFNQARRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  464

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMAK+F +D+TQGNTSRIVGTYGYM+PEYAM G+FSVKSDVFSFG
Sbjct  465   NILLDADMNPKISDFGMAKLFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFG  524

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG+KN N ++     +DLLSYAW  WR+GT + ++DP L+    T  E+++C+
Sbjct  525   VLILEIVSGQKN-NCFRNGETVEDLLSYAWRNWREGTGLNVIDPALSTGPRT--EMMRCI  581

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS  466
              IGLLCVQE+  +RPTM  +VLMLSSYS      P +PAF  N S
Sbjct  582   QIGLLCVQENIADRPTMASIVLMLSSYSL-TLPVPSQPAFSMNSS  625



>gb|KEH43944.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=659

 Score =   440 bits (1131),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 268/335 (80%), Gaps = 3/335 (1%)
 Frame = -1

Query  1473  LRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGM  1294
             L +  +KK+       +   E  N ESL++DFATI++ TN+FS D+KIG GGYG VYKG 
Sbjct  295   LLLIKAKKRRRASHRENFVLEFKNSESLEFDFATIEIATNMFSEDSKIGRGGYGQVYKGT  354

Query  1293  LPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPN  1114
             LPSGQEIA+KRLS++SGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKIL+YE+VPN
Sbjct  355   LPSGQEIAVKRLSKTSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILVYEYVPN  414

Query  1113  GSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMD  934
              SLD+FLFDS +Q  L W +RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM+
Sbjct  415   KSLDHFLFDSRKQKQLTWPERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNMN  474

Query  933   PKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISG  754
             PKI+DFGMA++  I+Q QG+T+R+VGTYGYMSPEYAM G+FS KSDVFSFGVM+LEIISG
Sbjct  475   PKISDFGMARMVAIEQVQGHTNRVVGTYGYMSPEYAMHGQFSEKSDVFSFGVMVLEIISG  534

Query  753   KKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQE  574
             KKN  +++ + R  DLLS+AW QW+D +P ++LDP++ + SY+ NEV +CV IGLLCVQE
Sbjct  535   KKNSCSFE-SRRIDDLLSHAWNQWKDESPFQMLDPIM-QESYSPNEVEKCVQIGLLCVQE  592

Query  573   DADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             + D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  593   NPDDRPTMGTVVSYLNNVSI-EMPFPMEPAFFMHG  626



>gb|KEH43945.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=658

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 268/335 (80%), Gaps = 3/335 (1%)
 Frame = -1

Query  1473  LRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGM  1294
             L +  +KK+       +   E  N ESL++DFATI++ TN+FS D+KIG GGYG VYKG 
Sbjct  295   LLLIKAKKRRRASHRENFVLEFKNSESLEFDFATIEIATNMFSEDSKIGRGGYGQVYKGT  354

Query  1293  LPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPN  1114
             LPSGQEIA+KRLS++SGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKIL+YE+VPN
Sbjct  355   LPSGQEIAVKRLSKTSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILVYEYVPN  414

Query  1113  GSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMD  934
              SLD+FLFDS +Q  L W +RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM+
Sbjct  415   KSLDHFLFDSRKQKQLTWPERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNMN  474

Query  933   PKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISG  754
             PKI+DFGMA++  I+Q QG+T+R+VGTYGYMSPEYAM G+FS KSDVFSFGVM+LEIISG
Sbjct  475   PKISDFGMARMVAIEQVQGHTNRVVGTYGYMSPEYAMHGQFSEKSDVFSFGVMVLEIISG  534

Query  753   KKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQE  574
             KKN  +++ + R  DLLS+AW QW+D +P ++LDP++ + SY+ NEV +CV IGLLCVQE
Sbjct  535   KKNSCSFE-SRRIDDLLSHAWNQWKDESPFQMLDPIM-QESYSPNEVEKCVQIGLLCVQE  592

Query  573   DADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             + D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  593   NPDDRPTMGTVVSYLNNVSI-EMPFPMEPAFFMHG  626



>ref|XP_010059122.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=409

 Score =   431 bits (1107),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 268/352 (76%), Gaps = 10/352 (3%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             E++  ESLQ+D ATIQ  TN FSP+NK+GEGG+G V++G L  GQ+IA+KRLSRSS QG+
Sbjct  61    ELTTVESLQFDLATIQAATNDFSPENKLGEGGFGEVFQGRLLDGQQIAVKRLSRSSRQGD  120

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEV +VAKLQH+NLVRLLG+C + +EK+L YEFVPN SLDY LFD ++   L W  
Sbjct  121   EEFKNEVLLVAKLQHRNLVRLLGFCLEGDEKLLTYEFVPNKSLDYLLFDPQKNGQLNWPL  180

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARGLLYLHEDSRLRIIHRDLK SNILLD  M PKI+DFGMA+IFG++QTQ +
Sbjct  181   RYKIIYGIARGLLYLHEDSRLRIIHRDLKCSNILLDSEMIPKISDFGMARIFGVNQTQAS  240

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T++IVGT+GYMSPEYAM GEFSVKSDV+SFG++LLEI+ GK+N N Y   +  + L SYA
Sbjct  241   TNKIVGTFGYMSPEYAMHGEFSVKSDVYSFGILLLEIVCGKRN-NYYHQLDGGEYLASYA  299

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W QWRD  P+E+LDP +   SY+ +E ++CVHI LLC+QED   RPTM  VVLMLSS S 
Sbjct  300   WNQWRDNKPLEVLDPAIM-DSYSRDEALRCVHICLLCIQEDPAVRPTMATVVLMLSSNSI  358

Query  513   NNWSTPREPAFY---RNGSGKVPMREISLELSVTVSDEASTIG----KLCPR  379
                S P+ PAF+   R     +PM+E+ L+ S   +  +ST G    +L PR
Sbjct  359   TPPS-PQHPAFFVRSRMQRLIIPMKELELDQSPRRAMPSSTNGMSVTELYPR  409



>ref|XP_002877439.1| hypothetical protein ARALYDRAFT_484965 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53698.1| hypothetical protein ARALYDRAFT_484965 [Arabidopsis lyrata subsp. 
lyrata]
Length=678

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 283/381 (74%), Gaps = 13/381 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE---ISNEESLQYDFATIQLITNVFSPDNKI  1330
             ++F+AV  F     +KK NT  +   +T E   I+   SLQ+DF  I+  TN F   NK+
Sbjct  304   IIFVAVFCF----RAKKTNTTFEREPLTEESDDITTAGSLQFDFKAIEAATNKFCETNKL  359

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G+GG+G VYKG+ PSG ++A+KRLS++SGQGE+EF NEV VVAKLQH+NLVRLLG+C +R
Sbjct  360   GQGGFGEVYKGIFPSGAQVAVKRLSKTSGQGEREFANEVVVVAKLQHRNLVRLLGFCLER  419

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             +E+IL+YEFVPN SLDYF+FDS  Q +L+W++RYKII GIARG+LYLH+DSRL IIHRDL
Sbjct  420   DERILVYEFVPNKSLDYFIFDSTMQSLLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDL  479

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLD +M+ KIADFGMA+IFG+DQT+ NT RIVGTYGYMSPEYAM G+FS+KSDV+
Sbjct  480   KAGNILLDADMNAKIADFGMARIFGMDQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVY  539

Query  789   SFGVMLLEIISGKKNRNTYQ-TTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEV  613
             SFGV++LEIISGKKN N YQ  +  A +L++Y W  W +G+P+E++DP     +Y +NEV
Sbjct  540   SFGVLVLEIISGKKNSNVYQFDSASAGNLVTYTWRLWSNGSPLELVDPSF-HDNYRINEV  598

Query  612   IQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVP---MREI  442
              +C+HI LLCVQE+A++RPTM  +V ML++ S+   + P+ P F+   S       +  +
Sbjct  599   TRCIHIALLCVQEEAEDRPTMSAIVQMLTT-SSMALAVPQRPGFFFRSSKHEQVGLVDRL  657

Query  441   SLELSVTVSDEASTIGKLCPR  379
             S+  S   S + ++I  + PR
Sbjct  658   SINTSALYSVDDASITNVTPR  678



>gb|AAN60348.1| unknown [Arabidopsis thaliana]
Length=658

 Score =   439 bits (1129),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 282/374 (75%), Gaps = 6/374 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFIA   FL  R  K   T   +     +I+  +SLQ D+ TIQ  T+ F   NKIG+GG
Sbjct  290   LFIAGYCFLTRRARKSYYTP--SAFAGDDITTADSLQLDYRTIQTATDDFVESNKIGQGG  347

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQGE EFKNEV +VAKLQH+NLVRLLG+C   EE++
Sbjct  348   FGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERV  407

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYFLFD  ++  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK SN
Sbjct  408   LVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASN  467

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKIADFGMA+IFG+DQT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV
Sbjct  468   ILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGV  527

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP + ++    NEV++CVH
Sbjct  528   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQR-NEVVRCVH  585

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSVT  421
             IGLLCVQED  ERPT+  +VLML+S +T     PR+P  F+++  GK P+   +   S+ 
Sbjct  586   IGLLCVQEDPAERPTLSTIVLMLTS-NTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLL  644

Query  420   VSDEASTIGKLCPR  379
              S + ++I  + PR
Sbjct  645   GSVDDASITDIHPR  658



>gb|KEH43943.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=663

 Score =   439 bits (1130),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 207/335 (62%), Positives = 268/335 (80%), Gaps = 3/335 (1%)
 Frame = -1

Query  1473  LRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGM  1294
             L +  +KK+       +   E  N ESL++DFATI++ TN+FS D+KIG GGYG VYKG 
Sbjct  295   LLLIKAKKRRRASHRENFVLEFKNSESLEFDFATIEIATNMFSEDSKIGRGGYGQVYKGT  354

Query  1293  LPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPN  1114
             LPSGQEIA+KRLS++SGQG +EFKNEV ++AKLQH+NLVRL+G+C + +EKIL+YE+VPN
Sbjct  355   LPSGQEIAVKRLSKTSGQGAEEFKNEVMLIAKLQHRNLVRLIGFCLEDQEKILVYEYVPN  414

Query  1113  GSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMD  934
              SLD+FLFDS +Q  L W +RY II+GIARG+LYLHEDSRL+IIHRD+K SN+LLD NM+
Sbjct  415   KSLDHFLFDSRKQKQLTWPERYNIIKGIARGILYLHEDSRLKIIHRDIKPSNVLLDNNMN  474

Query  933   PKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISG  754
             PKI+DFGMA++  I+Q QG+T+R+VGTYGYMSPEYAM G+FS KSDVFSFGVM+LEIISG
Sbjct  475   PKISDFGMARMVAIEQVQGHTNRVVGTYGYMSPEYAMHGQFSEKSDVFSFGVMVLEIISG  534

Query  753   KKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQE  574
             KKN  +++ + R  DLLS+AW QW+D +P ++LDP++ + SY+ NEV +CV IGLLCVQE
Sbjct  535   KKNSCSFE-SRRIDDLLSHAWNQWKDESPFQMLDPIM-QESYSPNEVEKCVQIGLLCVQE  592

Query  573   DADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             + D+RPTM  VV  L++ S      P EPAF+ +G
Sbjct  593   NPDDRPTMGTVVSYLNNVSI-EMPFPMEPAFFMHG  626



>ref|XP_003592434.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=801

 Score =   444 bits (1141),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 259/312 (83%), Gaps = 3/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             EIS  E LQ+DF TI   TN FS DNK+GEGG+G VYKGML +GQEIA+KRLSRSSGQG 
Sbjct  323   EISRVEFLQFDFDTIATATNNFSGDNKLGEGGFGEVYKGMLFNGQEIAVKRLSRSSGQGI  382

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEV +VAKLQH+NLVR+LG+C   EEK+LIYEF+PN SLDYFLFD E+ H + W +
Sbjct  383   EEFKNEVVLVAKLQHRNLVRILGFCLDGEEKMLIYEFMPNKSLDYFLFDPEKAHQINWPR  442

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARG+LYLHEDSRLRIIHRDLK SNILLD N++PKI+DFGMA+IFG+DQT+G 
Sbjct  443   RYKIIEGIARGMLYLHEDSRLRIIHRDLKASNILLDENLNPKISDFGMARIFGVDQTRGI  502

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T+R+VGT GYMSPEYAM GEFS+K+DV+SFGV++LEII+GKK   +++ +  A+DLLSYA
Sbjct  503   TNRVVGTLGYMSPEYAMHGEFSIKTDVYSFGVLVLEIITGKK-ITSFRESGYAEDLLSYA  561

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W++W DGTP+E+LD  L + SYT  EV +C+H+GL CVQED D+RP+M+ VVL+LSS+S 
Sbjct  562   WKKWNDGTPLELLDMTL-RDSYTSVEVTRCIHVGLCCVQEDPDQRPSMQTVVLLLSSHSV  620

Query  513   NNWSTPREPAFY  478
                  P+ PA Y
Sbjct  621   -TLEPPQRPAGY  631



>gb|KDO75602.1| hypothetical protein CISIN_1g006155mg [Citrus sinensis]
Length=658

 Score =   439 bits (1128),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 270/342 (79%), Gaps = 7/342 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG-EISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             +L I + +FLR +   + N+K+++    G EI+  ESLQ+DF TI++ T+ FS  NK+G+
Sbjct  277   ILIIFICFFLRRK--PRDNSKVKSEAAAGDEINRAESLQFDFNTIRVATDNFSDANKLGQ  334

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G+VYKG L  G EIA+KRLSR SGQG+ EFKNEV +VA LQH+NLVRLLG+  +  E
Sbjct  335   GGFGAVYKGRLYDGAEIAVKRLSRDSGQGDLEFKNEVLLVANLQHRNLVRLLGFSLEGNE  394

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             ++LIYEFVPN SLD+F+FD  R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLKT
Sbjct  395   RLLIYEFVPNTSLDHFIFDPTRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKT  454

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SN+LLD  M PKIADFGMA++F +D+TQGNTSRIVGTYGYM+PEYAM G++SVKSDVFSF
Sbjct  455   SNVLLDAEMTPKIADFGMARLFEMDETQGNTSRIVGTYGYMAPEYAMHGQYSVKSDVFSF  514

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISG++N N ++     +DLLS AW+ WR+GT + I+DP L  SS ++ E+I+C
Sbjct  515   GVLVLEIISGQRN-NCFRNGETVEDLLSSAWKNWREGTTVNIIDPTL--SSGSITEMIRC  571

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +HIGLLCVQE+   RPTM  VVLML+SYS      P EPAF+
Sbjct  572   IHIGLLCVQENVASRPTMASVVLMLNSYSL-TLPVPSEPAFF  612



>emb|CDY41246.1| BnaA01g12930D [Brassica napus]
Length=668

 Score =   439 bits (1129),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 269/341 (79%), Gaps = 7/341 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LFIA   FL  R  K  +T   T+   G+ I+  +SLQ D+ +IQ  T  F+  NKIGEG
Sbjct  296   LFIAGYCFLTKRAKKAYHT---TSAFDGDDITTSDSLQLDYRSIQTATADFAESNKIGEG  352

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L  G E+A+K+LS+SSGQG+ EFKNEV +VAKLQH+NLVRLLG+C + EE+
Sbjct  353   GFGEVYKGTLLDGTEVAVKKLSKSSGQGDVEFKNEVVLVAKLQHRNLVRLLGFCLEGEER  412

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YE+VPN SLDYFLFD  +Q  L+WS+RYKII G+ARG+LYLH+DSRL IIHRDLK S
Sbjct  413   VLVYEYVPNKSLDYFLFDPAKQAQLDWSRRYKIIGGVARGILYLHQDSRLTIIHRDLKAS  472

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFG
Sbjct  473   NILLDGDMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFG  532

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ T+ A DL+SYAW  W +GTP++++DPV+  +    NEV++CV
Sbjct  533   VLVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGTPLDLVDPVIVDNCQR-NEVVRCV  590

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED  ERPT+  +VLML+S +T     PR+P  Y
Sbjct  591   HIGLLCVQEDPVERPTLSTIVLMLTS-NTVTLPVPRQPGLY  630



>ref|XP_003556004.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform 1 [Glycine max]
Length=687

 Score =   439 bits (1130),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 213/346 (62%), Positives = 270/346 (78%), Gaps = 6/346 (2%)
 Frame = -1

Query  1488  AVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGS  1309
              +  +LR R ++K N  ++  DV  EI   ESLQ++F TIQ+ T  FS  NK+G+GG+G+
Sbjct  310   CLCLYLRRRKARK-NLVVKENDVEDEIKIAESLQFNFNTIQVATEDFSDSNKLGQGGFGA  368

Query  1308  VYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIY  1129
             VY+G L +GQ IA+KRLSR SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +R E++L+Y
Sbjct  369   VYRGRLSTGQMIAVKRLSRDSGQGDTEFKNEVLLVAKLQHRNLVRLLGFCLERNERLLVY  428

Query  1128  EFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILL  949
             EFVPN SLDYF+FD   +  L+W+ RYKIIRGIARGLLYLHEDSRLRIIHRDLK SNILL
Sbjct  429   EFVPNKSLDYFIFDPNMKAQLDWNSRYKIIRGIARGLLYLHEDSRLRIIHRDLKASNILL  488

Query  948   DVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLL  769
             D  M PKIADFGMA++  +DQTQ NTSRIVGTYGYM+PEYAM G+FSVKSDVFSFGV++L
Sbjct  489   DEEMSPKIADFGMARLVLVDQTQTNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVL  548

Query  768   EIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGL  589
             EI+SG+KN   +   N  +DLLS+AW  W++GT I I+DP L  +S   NE+++C+HIGL
Sbjct  549   EILSGQKNSGFHHGEN-VEDLLSFAWRSWKEGTAINIVDPSLNNNSR--NEMMRCIHIGL  605

Query  588   LCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG-SGKVP  454
             LCVQE+  +RPTM  ++LML+SYS  +   P +PAFY N  +G +P
Sbjct  606   LCVQENLADRPTMATIMLMLNSYSL-SLPIPAKPAFYMNSRTGSLP  650



>ref|NP_567679.2| cysteine-rich receptor-like protein kinase 10 [Arabidopsis thaliana]
 sp|Q8GYA4.3|CRK10_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 10; 
Short=Cysteine-rich RLK10; AltName: Full=Receptor-like protein 
kinase 4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAC42412.1| putative receptor-like protein kinase 4 RLK4 [Arabidopsis thaliana]
 gb|AAO64889.1| At4g23180 [Arabidopsis thaliana]
 gb|AEE84719.1| cysteine-rich receptor-like protein kinase 10 [Arabidopsis thaliana]
Length=669

 Score =   439 bits (1128),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 282/374 (75%), Gaps = 6/374 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFIA   FL  R  K   T   +     +I+  +SLQ D+ TIQ  T+ F   NKIG+GG
Sbjct  301   LFIAGYCFLTRRARKSYYTP--SAFAGDDITTADSLQLDYRTIQTATDDFVESNKIGQGG  358

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQGE EFKNEV +VAKLQH+NLVRLLG+C   EE++
Sbjct  359   FGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERV  418

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYFLFD  ++  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK SN
Sbjct  419   LVYEYVPNKSLDYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASN  478

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKIADFGMA+IFG+DQT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV
Sbjct  479   ILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGV  538

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP + ++    NEV++CVH
Sbjct  539   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQR-NEVVRCVH  596

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSVT  421
             IGLLCVQED  ERPT+  +VLML+S +T     PR+P  F+++  GK P+   +   S+ 
Sbjct  597   IGLLCVQEDPAERPTLSTIVLMLTS-NTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLL  655

Query  420   VSDEASTIGKLCPR  379
              S + ++I  + PR
Sbjct  656   GSVDDASITDIHPR  669



>emb|CAA18465.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
 emb|CAB79273.1| serine/threonine kinase-like protein [Arabidopsis thaliana]
Length=633

 Score =   437 bits (1125),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 212/350 (61%), Positives = 275/350 (79%), Gaps = 5/350 (1%)
 Frame = -1

Query  1422  VTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSS  1246
             VTG+ I+  +SLQ D+ TIQ  T+ F   NKIG+GG+G VYKG L  G E+A+KRLS+SS
Sbjct  287   VTGDDITTADSLQLDYRTIQTATDDFVESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSS  346

Query  1245  GQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVL  1066
             GQGE EFKNEV +VAKLQH+NLVRLLG+C   EE++L+YE+VPN SLDYFLFD  ++  L
Sbjct  347   GQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERVLVYEYVPNKSLDYFLFDPAKKGQL  406

Query  1065  EWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQ  886
             +W++RYKII G+ARG+LYLH+DSRL IIHRDLK SNILLD +M+PKIADFGMA+IFG+DQ
Sbjct  407   DWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKIADFGMARIFGLDQ  466

Query  885   TQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDL  706
             T+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV++LEIISGKKN + YQ T+ A DL
Sbjct  467   TEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQ-TDGAHDL  525

Query  705   LSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLS  526
             +SYAW  W +G P+E++DP + ++    NEV++CVHIGLLCVQED  ERPT+  +VLML+
Sbjct  526   VSYAWGLWSNGRPLELVDPAIVENCQR-NEVVRCVHIGLLCVQEDPAERPTLSTIVLMLT  584

Query  525   SYSTNNWSTPREPA-FYRNGSGKVPMREISLELSVTVSDEASTIGKLCPR  379
             S +T     PR+P  F+++  GK P+   +   S+  S + ++I  + PR
Sbjct  585   S-NTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLLGSVDDASITDIHPR  633



>ref|XP_004496761.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
[Cicer arietinum]
Length=669

 Score =   439 bits (1128),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 219/384 (57%), Positives = 287/384 (75%), Gaps = 13/384 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+ +  L+   I +  K+      T+ + +IS  E LQ+DF TI   T+ FS +NK+GEG
Sbjct  289   LVLLLTLFVYWILSEGKRKNYNSVTEESVQISRVEFLQFDFDTIAAATDNFSNENKLGEG  348

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKGML +GQEIA+KRLSRSSGQG +EFKNEV +VAKLQH+NLVR+LG+C   +EK
Sbjct  349   GFGEVYKGMLFNGQEIAVKRLSRSSGQGIEEFKNEVVLVAKLQHRNLVRILGFCLDGDEK  408

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEF+PN SLDYFLFDSE+ H + W +RYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  409   MLIYEFMPNKSLDYFLFDSEKSHQINWLRRYKIIEGIARGILYLHEDSRLRIIHRDLKAS  468

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD N++PKI+DFGMA+IFG+DQT+G T+R+VGT+GYMSPEYAM GEFS+K+DV+SFG
Sbjct  469   NILLDENLNPKISDFGMARIFGVDQTRGITNRVVGTFGYMSPEYAMHGEFSIKTDVYSFG  528

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII+GKK   +++ +  A+DLLSYAW++W+DG  +E+LD  L + SY+ +EV +C+
Sbjct  529   VLVLEIITGKK-ITSFRESGYAEDLLSYAWKKWKDGAALELLDITL-RDSYSRDEVRRCI  586

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG---KVPMREI----  442
             H+GL CVQED  ERP+M+ +VL+LSS S      P++PA Y N        P RE     
Sbjct  587   HVGLSCVQEDPVERPSMQTIVLLLSSQSV-TLEAPKQPAGYINSKSDQQSYPTREFENSD  645

Query  441   ---SLELSVTVSDEASTIGKLCPR  379
                +   SVT S +  +I  + PR
Sbjct  646   KSTTKTQSVTASVDEESITHVYPR  669



>ref|XP_003635675.2| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=363

 Score =   428 bits (1100),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 206/337 (61%), Positives = 265/337 (79%), Gaps = 8/337 (2%)
 Frame = -1

Query  1440  KLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKR  1261
             KL+T D   EI+N ESL +DF TI++ TN FS  NK+G+GG+G VYKG L +GQ +A+KR
Sbjct  3     KLETHD-EDEITNVESLHFDFDTIRVATNNFSDSNKLGQGGFGPVYKGRLSNGQYVAVKR  61

Query  1260  LSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSE  1081
             LS  S QGE EFKNE  +VAKLQH+NLVRLLG+C    E++LIYEFVPN SLD+F+FD  
Sbjct  62    LSSGSAQGELEFKNEAVLVAKLQHRNLVRLLGFCLDGAERLLIYEFVPNTSLDHFIFDLI  121

Query  1080  RQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKI  901
             R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK SNILLD  M+PKI+DFGMA++
Sbjct  122   RRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLDAEMNPKISDFGMARL  181

Query  900   FGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTN  721
             F +DQTQGNT+RIVGTYGYM+PEYAM G FSVK+DV+SFGV++LE++SG++N N ++ + 
Sbjct  182   FLVDQTQGNTNRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLVLELVSGQRN-NCFRVSE  240

Query  720   RAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDV  541
               +DLLSYAW+ WR+GT   ++D  +  SS  ++E+++C+HIGLLCVQE+  +RPTM  +
Sbjct  241   NIEDLLSYAWKNWREGTTTNLIDSTMRISS--ISEIMRCIHIGLLCVQENEADRPTMASI  298

Query  540   VLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLEL  430
             VLML+SYS  +   P  PAF+ N S     R++SLEL
Sbjct  299   VLMLNSYSL-SLPVPSHPAFFMNTSMN---RDMSLEL  331



>ref|XP_006283283.1| hypothetical protein CARUB_v10004319mg [Capsella rubella]
 gb|EOA16181.1| hypothetical protein CARUB_v10004319mg [Capsella rubella]
Length=660

 Score =   437 bits (1125),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 200/342 (58%), Positives = 270/342 (79%), Gaps = 3/342 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             +L  AVL    + N  K+  +    D  G+ I+   SLQ+DF  ++  TN FS  NK+G+
Sbjct  286   ILLFAVLSSFHLINRAKKTYETAAADEDGDDITTAGSLQFDFNAVEAATNKFSESNKLGQ  345

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G VYKG+ P+G ++A+KRLS++SGQGE+EFKNEV VVAKLQHKNLV+LLG+C +REE
Sbjct  346   GGFGQVYKGVFPNGLQVAVKRLSKTSGQGEREFKNEVLVVAKLQHKNLVKLLGFCYEREE  405

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             KIL+YEFVPN  LDYFLFDS  +  LEW++RY+II+GIARG+LYLH+DSRL IIHRDLK 
Sbjct  406   KILVYEFVPNKGLDYFLFDSTLKSQLEWTRRYEIIKGIARGVLYLHQDSRLTIIHRDLKA  465

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD +M+PK+ADFGMA+IFG+DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SF
Sbjct  466   SNILLDDDMNPKVADFGMARIFGMDQTEANTKRVVGTYGYMSPEYAMYGQFSMKSDVYSF  525

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISG+KN + YQ  + A +L++Y W  W +G+P+E++DP   + +Y VN++ +C
Sbjct  526   GVLVLEIISGRKNNSLYQMKDSAGNLVTYTWRLWSNGSPLELVDPSF-QENYQVNDITRC  584

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +HI LLCVQE+A++RPTM  +  ML++ S+   +TP+ P F+
Sbjct  585   IHIALLCVQEEAEDRPTMSAINQMLTT-SSIALATPQPPGFF  625



>ref|XP_008446411.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Cucumis 
melo]
Length=1250

 Score =   453 bits (1166),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 291/377 (77%), Gaps = 7/377 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+    FLR R +KK+++ ++   V  E++  +SLQ+DF TI+  TN FS +N++GEG
Sbjct  878   LLFVMGCCFLRQR-AKKRDSAVKEDSVVDEMTTSDSLQFDFKTIEAATNKFSEENRLGEG  936

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+V+KG L +GQEIA+KRLSR S QG +EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  937   GFGAVFKGRLDNGQEIAVKRLSRGSLQGSEEFKNEVMLVAKLQHRNLVRLLGFCLEGEEK  996

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEF+PN SLD+FLFD E Q  L+W KRYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  997   ILIYEFIPNKSLDFFLFDQEGQKQLDWLKRYKIINGIARGILYLHEDSRLRIIHRDLKAS  1056

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGN-TSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             NILLD +M+ KI+DFGMA+I  +DQ+QGN TSRIVGTYGYMSPEYAM G FS+KSD++SF
Sbjct  1057  NILLDGDMNAKISDFGMARIIQMDQSQGNYTSRIVGTYGYMSPEYAMHGNFSMKSDIYSF  1116

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISG+KN NT+  ++ A+D+L+YAW  W+DG P+E+LDP+L K +Y+ NEV++C
Sbjct  1117  GVLVLEIISGRKN-NTFYLSDLAEDILTYAWALWKDGIPLELLDPML-KDNYSRNEVLRC  1174

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISLEL  430
             +HI LLCVQED + RP+M  +VLML+SYS      P+EPA +     +G     + S   
Sbjct  1175  IHIALLCVQEDPNSRPSMASIVLMLNSYSV-TLPIPKEPALFVRSKDNGNTIGSDHSSNK  1233

Query  429   SVTVSDEASTIGKLCPR  379
             S   S   +++ +L PR
Sbjct  1234  STKCSVNETSLSELHPR  1250


 Score =   417 bits (1071),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 213/354 (60%), Positives = 273/354 (77%), Gaps = 14/354 (4%)
 Frame = -1

Query  1497  LFIAVLY-----FLRIRNSKKQNTKLQTTDVT--GEISNEESLQYDFATIQLITNVFSPD  1339
             LFI +L      F+R R +KK++T L+  D T   E ++ ESLQYDF TI   T+ FS D
Sbjct  162   LFIPLLVRGYKCFIR-RGAKKKHTTLKKEDSTFVTEFTSIESLQYDFNTIDAATSNFSAD  220

Query  1338  NKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYC  1159
             NK+GEGG+G+VYKGML +GQEIA+KRLSR S QG +EFKNEV VV+KLQH+NLVRLLG+C
Sbjct  221   NKLGEGGFGAVYKGMLDNGQEIAVKRLSRRSLQGSEEFKNEVMVVSKLQHRNLVRLLGFC  280

Query  1158  SKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIH  979
              + EEKILIYE++PN SLDYFLFDS+R+  L+W  RYKII GIAR +LYLHEDSRLRIIH
Sbjct  281   LEGEEKILIYEYIPNKSLDYFLFDSKRRQELDWLSRYKIINGIAREILYLHEDSRLRIIH  340

Query  978   RDLKTSNILLDVNMDPKIADFGMAKIFGI-DQ-TQGN-TSRIVGTYGYMSPEYAMQGEFS  808
             RDLK SN+LLD NM PKI+DFG+A+I  + DQ  Q N T+RIVGTYGYMSPEYAM G FS
Sbjct  341   RDLKASNVLLDDNMHPKISDFGIARIIQVADQNNQANITNRIVGTYGYMSPEYAMYGNFS  400

Query  807   VKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSY  628
              KSDV+SFGV++LEIISGKKN +T+  +  A+D+L+YAW+ W++   +E+ DP L ++ Y
Sbjct  401   TKSDVYSFGVLILEIISGKKN-STFYLSELAEDILTYAWKLWKEEMALELSDPSL-ETRY  458

Query  627   TVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS  466
             + +EV++C+HIGLLCVQ+D   RP+M  +VLML++YS      P EP  + + +
Sbjct  459   SKDEVLRCIHIGLLCVQDDPSRRPSMASIVLMLNTYSV-PLPLPEEPTIFMHNT  511



>ref|XP_004496792.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Cicer arietinum]
Length=664

 Score =   437 bits (1123),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/372 (60%), Positives = 285/372 (77%), Gaps = 14/372 (4%)
 Frame = -1

Query  1500  LLFIAVLYFL-RIRNSKKQNTKLQTTDVT--GEISNEESLQYDFATIQLITNVFSPDNKI  1330
             L  I  L+ L R +N  K N+ +Q +      ++S+ + LQ+DFA ++  TN FS  NKI
Sbjct  286   LFIIGCLFLLKREKNKYKYNSFIQGSSSIRREDLSDVDCLQFDFAAVEAATNCFSNKNKI  345

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             GEGG+G VYKG+LP+G EIA+KRLS +S QG  EF+NE  +VAKLQH+NLVRLLG+C + 
Sbjct  346   GEGGFGVVYKGILPNGHEIAVKRLSATSLQGVIEFRNEASLVAKLQHRNLVRLLGFCLEG  405

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
              EK+L+YE++PN SLD +LFD   Q  L+WS+RYKII GIARG+LYLHEDS+LRIIHRDL
Sbjct  406   REKMLVYEYIPNKSLDRYLFDPAMQRELDWSRRYKIIVGIARGILYLHEDSQLRIIHRDL  465

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K SN+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKSDVF
Sbjct  466   KASNVLLDENMNPKISDFGMAKIFQADQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDVF  525

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEI+SGKKN +  Q  N A DLLSYAW++W + TP+E+LDP L + S + NEVI
Sbjct  526   SFGVLVLEIVSGKKNTDLNQWNN-ADDLLSYAWKKWSEQTPLELLDPTL-RGSCSRNEVI  583

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPRE-PAFYRNGSGKVPMREISLE  433
             +C+H+GLLCVQE+ ++RP+ME + LML+SYS    S PR+ P+F R   G+ P R I+  
Sbjct  584   RCIHMGLLCVQENPNDRPSMETIALMLNSYSV-TLSLPRQPPSFLR---GRTPDR-ITQG  638

Query  432   LSVTVSDEASTI  397
             L+   SD++ST 
Sbjct  639   LN---SDQSSTC  647



>ref|XP_002869784.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46043.1| hypothetical protein ARALYDRAFT_492546 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   436 bits (1122),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/375 (58%), Positives = 282/375 (75%), Gaps = 8/375 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LFI    F+  R  K  +T   T+   G+ I+  +SLQ D+  IQ  T+ F+  NKIG+G
Sbjct  294   LFIVGYCFIAKRAKKTYDT---TSAFDGDDITTADSLQLDYRKIQTATDDFAESNKIGQG  350

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L  G E+A+KRLS+ SGQGE EFKNEV +VAKLQH+NLVRLLG+C   EE+
Sbjct  351   GFGEVYKGTLSDGTEVAVKRLSKLSGQGEAEFKNEVVLVAKLQHRNLVRLLGFCLDGEER  410

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YE+VPN SLDYFLFD  +Q  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK S
Sbjct  411   VLVYEYVPNKSLDYFLFDPAKQSQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKAS  470

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFG
Sbjct  471   NILLDADMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFG  530

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP +  +    +EV++CV
Sbjct  531   VLVLEIISGKKNSSFYQ-TDGAHDLVSYAWGLWSNGRPLELVDPAIVDNCQR-SEVVRCV  588

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSV  424
             HIGLLCVQED  ERPT+  +VLML+S +T     PR+P  F+++  GK P+   +   S+
Sbjct  589   HIGLLCVQEDPAERPTLSTIVLMLTS-NTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSL  647

Query  423   TVSDEASTIGKLCPR  379
               S + ++I  + PR
Sbjct  648   LGSVDDASITDVYPR  662



>ref|XP_010448768.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 [Camelina 
sativa]
Length=661

 Score =   436 bits (1122),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 280/376 (74%), Gaps = 8/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV  F   +  KK +      D   +I+   SLQ+DF  ++  T+ F+  NK+G+G
Sbjct  292   LLFVAVFSFYVTKRVKKPHDTAAEKDERDDITTAGSLQFDFKVVEAATDKFAICNKLGQG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+G ++A+KRLS++SGQGEKEFKNEV VVAKLQH+NLV+LLG+C +REEK
Sbjct  352   GFGEVYKGILPNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS +Q  L+W+ RY+II GIARG+LYLH+DSRL IIHRDLK  
Sbjct  412   ILVYEFVPNKSLDYFLFDSNKQSQLDWTTRYRIIGGIARGILYLHQDSRLTIIHRDLKAG  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT RIVGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  472   NILLDADMNPKVADFGMARIFELDQTEDNTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + YQ      +L++Y W+ W +G+P++++D    + +Y  NE+I+C+
Sbjct  532   VLVLEIISGRKNSSLYQMDASFGNLVTYTWKLWSNGSPLDLVDSSF-RENYQSNEIIRCI  590

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISLELS  427
             HI LLCVQED + RPTM  +V ML++ S+   + P+ P F+   N     P    S++ S
Sbjct  591   HIALLCVQEDTENRPTMSAIVQMLTT-SSIALAVPQPPGFFFRSNHEQAGP----SMDKS  645

Query  426   VTVSDEASTIGKLCPR  379
                S +A++I  L PR
Sbjct  646   SLCSIDAASITTLVPR  661



>ref|XP_002518561.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43948.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   435 bits (1119),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 276/357 (77%), Gaps = 10/357 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +  I+   FLR R  +K+   ++      E+ + ES Q DF T+++ T+ FS +NK+G+G
Sbjct  284   IFIISFCIFLRKRRPRKKAETVE------EMESPESFQLDFGTVRVATDNFSEENKLGQG  337

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L +GQ+IA+KRLS++S QG+ EFKNE+ +VAKLQH+NLVRLLG+C +R E+
Sbjct  338   GFGAVYKGTLYNGQDIAVKRLSKNSEQGDLEFKNEILLVAKLQHRNLVRLLGFCLERNER  397

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEF+PN SLD+FLFD  +   L+W +RYKII GIARGLLYLHEDS++RIIHRDLKTS
Sbjct  398   LLIYEFMPNTSLDHFLFDQTKHESLDWERRYKIICGIARGLLYLHEDSQIRIIHRDLKTS  457

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD++M+PKIADFGMA++F IDQTQGNTSRIVGTYGYM+PEYAM G+FS+KSDVFSFG
Sbjct  458   NILLDMDMNPKIADFGMARLFVIDQTQGNTSRIVGTYGYMAPEYAMHGQFSIKSDVFSFG  517

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEI+SGKKN +++    R +DLLSYAW  WR+GT + ++DP L   S +  E+++C+
Sbjct  518   VLLLEILSGKKN-SSFHNGERIEDLLSYAWRNWREGTSMNVIDPSLKSGSSS--EMMRCI  574

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLEL  430
              IGLLCVQE+  +RPTM  VVLML+SYS      P  PAF+ +    + +  + ++L
Sbjct  575   QIGLLCVQENVADRPTMATVVLMLNSYSL-TLPVPLRPAFFMHTGIHLDVSSVGMKL  630



>ref|XP_009136817.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
23 isoform X1 [Brassica rapa]
Length=772

 Score =   440 bits (1131),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 210/377 (56%), Positives = 282/377 (75%), Gaps = 9/377 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LL +AV  F     +K++ T  +T       +I+   SLQ+DF  I+  T+ FS  NK+G
Sbjct  402   LLLVAVFIF----RAKRKTTAYETEPPADGDDITTAGSLQFDFRAIEAATDKFSESNKLG  457

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLVRLLG+C + E
Sbjct  458   QGGFGQVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGFCLEGE  517

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EKIL+YEFVPN SLDYFLFDS  Q  L+W KR KII GIARG+LYLH+DSRL IIHRDLK
Sbjct  518   EKILVYEFVPNKSLDYFLFDSTMQSQLDWKKRCKIIAGIARGILYLHQDSRLTIIHRDLK  577

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
               NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+S
Sbjct  578   AGNILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYS  637

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISGKKN + YQ  + A +L++Y W  W +G+P+E++DP   + +Y  NE+ +
Sbjct  638   FGVLVLEIISGKKNSSLYQMDDSAGNLVTYTWRLWSNGSPLELVDPSF-QDNYQTNEITR  696

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLEL  430
             C+HI LLCVQE+A++RPTM  ++ ML++ S+   + PR P  F+R+   +V   + S+ +
Sbjct  697   CIHIALLCVQEEAEDRPTMSAILQMLTT-SSIALAVPRPPGFFFRSRHEQVGRADPSMHM  755

Query  429   SVTVSDEASTIGKLCPR  379
             S   S + ++I  + PR
Sbjct  756   SALCSVDDASITSVAPR  772



>ref|XP_010052297.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=662

 Score =   436 bits (1122),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 284/378 (75%), Gaps = 8/378 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+A   F + + +K  N           I+  ESLQYD AT+Q  T+ FS  NK+GEG
Sbjct  289   LLFLACC-FSQSKATKTYNAVQGDQSSVNGITKAESLQYDLATVQAATDNFSHQNKLGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP+GQ+IA+KRLS+SS QG  EFKNEV +V+KLQH+NLVRLLG+C   +EK
Sbjct  348   GFGEVFQGRLPNGQKIAVKRLSKSSRQGIGEFKNEVVLVSKLQHRNLVRLLGFCLDGQEK  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLDYFLF+ +++  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  408   LLIYEFVPNKSLDYFLFEPDKRGKLDWSRRYKIISGIARGMLYLHEDSRLRIIHRDLKPS  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMA+IFG+DQT+ NT +IVGT+GY+SPEYAM+G+ S KSDV+SFG
Sbjct  468   NILLDNDMNPKISDFGMARIFGVDQTRANTKKIVGTFGYLSPEYAMRGQISAKSDVYSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG KN  ++Q  +  ++L SYAW+ WR GTP+E+LDP +   SY+++EV++C+
Sbjct  528   VLILEIISGMKNNCSFQ-LDEGENLASYAWKHWRAGTPLEVLDPFIG-DSYSIDEVVRCL  585

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMRE----ISLE  433
             HIGLL VQED   RPTM  +VLMLSS+S      PR PAF+   S +  ++E     S  
Sbjct  586   HIGLLGVQEDPAYRPTMASIVLMLSSHSV-KLPQPRRPAFFLRRSTERQLKEHESDQSAS  644

Query  432   LSVTVSDEASTIGKLCPR  379
              S+++S    +I +L PR
Sbjct  645   RSMSLSTNEMSITELYPR  662



>gb|KCW75006.1| hypothetical protein EUGRSUZ_E03770 [Eucalyptus grandis]
Length=687

 Score =   437 bits (1123),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 285/403 (71%), Gaps = 33/403 (8%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L   +   LR R  KK +  ++  D   E++  ESLQ+D ATIQ+ TN FSP+NK+GEG
Sbjct  289   VLVFLICCLLR-RKGKKTHEVVKGKDGANELTTVESLQFDLATIQVATNDFSPENKLGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V+KG LP  Q+IA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+C + +EK
Sbjct  348   GFGEVFKGRLPDVQQIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFCLEGDEK  407

Query  1140  ILIYEFVPNGSLDYFLF----------------------DSERQHVLEWSKRYKIIRGIA  1027
             +L YEFVPN SLDYFLF                      D ++   L WS RYKI+ GIA
Sbjct  408   LLTYEFVPNRSLDYFLFGMLQFNLLMYICFKSNFWCNNADPQKSSQLNWSLRYKIVSGIA  467

Query  1026  RGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYG  847
             RG+LYLHEDSRLRIIHRDLK SN+LLD  M+PKI+DFGMA+IFG+DQTQ +T++IVGT+G
Sbjct  468   RGMLYLHEDSRLRIIHRDLKCSNVLLDSEMNPKISDFGMARIFGVDQTQASTNKIVGTFG  527

Query  846   YMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTP  667
             YMSPEYAM G+FSVKSDV+SFG++L+EII GKKN N Y   +  + L SY W +WRDGT 
Sbjct  528   YMSPEYAMHGKFSVKSDVYSFGILLIEIICGKKN-NFYHQLDGGEYLASYVWNKWRDGTA  586

Query  666   IEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREP  487
              ++LDP +   SY+ +EV++C+HIGLLC+QED   RPTM  VVL LSS   N+   PR P
Sbjct  587   FKVLDPAIV-DSYSRDEVLRCLHIGLLCIQEDPAIRPTMATVVLRLSSNHFNS-PLPRHP  644

Query  486   AFY---RNGSGKVPMREISLELSVTVSDEAST----IGKLCPR  379
             AF+   R+G   +PM+E+ L  S   +  +ST    + +L PR
Sbjct  645   AFFIRSRSGGPSIPMKELGLNQSTNRTMPSSTNDMSVTELYPR  687



>gb|KCW75009.1| hypothetical protein EUGRSUZ_E037791, partial [Eucalyptus grandis]
Length=408

 Score =   427 bits (1098),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 275/370 (74%), Gaps = 7/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L + +   LR R  KK +  ++  D   E +  ESLQ+D AT+Q  TN FS +NK+GEG
Sbjct  32    VLVVYICCLLR-RKRKKTHEVVKGKDGANEFTTVESLQFDLATMQAATNDFSSENKLGEG  90

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP GQ+IA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+  + EEK
Sbjct  91    GFGEVFQGRLPDGQQIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFYLEGEEK  150

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLDYFLFD ++   L WS RYKI+ GIARG+LYLHEDS LRIIHRDLK S
Sbjct  151   LLAYEFVPNKSLDYFLFDPQKSSQLNWSVRYKIVSGIARGMLYLHEDSHLRIIHRDLKCS  210

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQ   +T++IVGT+GYMSPEYAM GEFSVKSDV+SFG
Sbjct  211   NILLDNEMNPKISDFGMARIFGVDQIHASTNKIVGTFGYMSPEYAMYGEFSVKSDVYSFG  270

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EII GKKN N Y   +  + L SY W +W++GTP+++LDPV+   SY+ +EV+ C+
Sbjct  271   VLLIEIICGKKN-NFYHQLDGGEYLASYVWNKWKNGTPLKVLDPVIL-DSYSRDEVLCCL  328

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLC+QED   RPTM  +V ML+  +  N  +P+ PAF    R+G    PM+E+    
Sbjct  329   HIGLLCIQEDPVIRPTMATIVFMLNR-NYFNPPSPQHPAFCIQSRSGGWSTPMKELGSNQ  387

Query  429   SVTVSDEAST  400
             S + +  +ST
Sbjct  388   STSKTVPSST  397



>gb|AAK28315.1|AF224705_1 receptor-like protein kinase 4 [Arabidopsis thaliana]
Length=658

 Score =   436 bits (1121),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 216/374 (58%), Positives = 281/374 (75%), Gaps = 6/374 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFIA   FL  R  K  +T   +     +I+  +SLQ D+ TIQ  T+ F   NKIG+GG
Sbjct  290   LFIAGYCFLTRRARKSYSTP--SAFAGDDITTADSLQLDYRTIQTATDDFVESNKIGQGG  347

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQGE EFKNEV +VAKLQH+NLVRLLG+C   EE++
Sbjct  348   FGEVYKGTLSDGTEVAVKRLSKSSGQGEVEFKNEVVLVAKLQHRNLVRLLGFCLDGEERV  407

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYFLFD  ++   +W++RYKII G+ARG+LYLH+DSRL IIHRDLK S 
Sbjct  408   LVYEYVPNKSLDYFLFDPAKKGQXDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKAST  467

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKIADFGMA+IFG+DQT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV
Sbjct  468   ILLDADMNPKIADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGV  527

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +G P+E++DP + ++    NEV++CVH
Sbjct  528   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQR-NEVVRCVH  585

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSVT  421
             IGLLCVQED  ERPT+  +VLML+S +T     PR+P  F+++  GK P+   +   S+ 
Sbjct  586   IGLLCVQEDPAERPTLSTIVLMLTS-NTVTLPVPRQPGLFFQSRIGKDPLDTDTTSKSLL  644

Query  420   VSDEASTIGKLCPR  379
              S + ++I  + PR
Sbjct  645   GSVDDASITDIHPR  658



>ref|XP_006283285.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
 gb|EOA16183.1| hypothetical protein CARUB_v10004321mg [Capsella rubella]
Length=660

 Score =   436 bits (1121),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 282/370 (76%), Gaps = 7/370 (2%)
 Frame = -1

Query  1479  YFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYK  1300
             Y    R +KK        D   +I+  +SLQ D+ TIQ  T+ F+  NKIGEGG+G VYK
Sbjct  295   YCFLARRAKKSYGTTSAFD-GDDITTADSLQLDYRTIQTATDDFAVSNKIGEGGFGEVYK  353

Query  1299  GMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFV  1120
             G+L  G E+A+KRLS+SSGQGE EFKNEV +VAKLQH+NLVRLLG+C    E++L+YE+V
Sbjct  354   GILSDGTEVAVKRLSQSSGQGEAEFKNEVVLVAKLQHRNLVRLLGFCLDGVERVLVYEYV  413

Query  1119  PNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVN  940
             PN SLDYFLFD  +Q  L+W++RYKII G+ARG+LYLH+DSRL IIHRDLK SNILLD +
Sbjct  414   PNKSLDYFLFDPAKQGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDAD  473

Query  939   MDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEII  760
             M+PKIADFGMA+IFG+DQT+ NT+RIVGTYGYMSPEYAM G++S+KSD++SFGV++LEII
Sbjct  474   MNPKIADFGMARIFGLDQTEENTNRIVGTYGYMSPEYAMHGQYSMKSDIYSFGVLVLEII  533

Query  759   SGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCV  580
             SGKK  N++  T+ A DL+SYAW+ W +GTP+E++DP +A  ++  NEV++CVHIGLLCV
Sbjct  534   SGKK-INSFYRTDGAHDLVSYAWKLWSNGTPLELVDPAIAD-NFQRNEVVRCVHIGLLCV  591

Query  579   QEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPM--REISLELSVTVSDE  409
             QED  ERPTM  +VLML+S +T     PR+P  F+++  GK P+   + S   S+  S +
Sbjct  592   QEDPVERPTMSTIVLMLTS-NTVTLPVPRQPGLFFQSRLGKDPLDTDQFSTTKSLIGSVD  650

Query  408   ASTIGKLCPR  379
              ++I  + PR
Sbjct  651   DASITDIYPR  660



>emb|CDX79132.1| BnaA01g11990D [Brassica napus]
Length=646

 Score =   435 bits (1118),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 210/378 (56%), Positives = 285/378 (75%), Gaps = 10/378 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG--EISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LL +AV  F     +K++ T  +T  +    +I    SLQ+DF  I+  T+ FS  NK+G
Sbjct  275   LLLVAVFSF----RAKRKGTVYETEPLADRDDIRTAGSLQFDFKAIEAATDNFSEGNKLG  330

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG  PSG ++A+KRLS+ SGQGE+EF+NEV VVAKLQH+NLVRL G+C + E
Sbjct  331   QGGFGQVYKGTFPSGVQVAVKRLSKISGQGEREFENEVVVVAKLQHRNLVRLFGFCLEAE  390

Query  1146  EKILIYEFVPNGSLDYFLF-DSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             EKIL+YEFVPN SLDYFLF DS  Q  L+W+KRYKII GIARG+LYLH+DSRL IIHRDL
Sbjct  391   EKILVYEFVPNKSLDYFLFVDSTMQSQLDWTKRYKIIGGIARGILYLHQDSRLTIIHRDL  450

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+
Sbjct  451   KAGNILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVY  510

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGK+N + +Q    A +L++YAW  W +G+ +E++DP   + +Y  NE+ 
Sbjct  511   SFGVLVLEIISGKRNSSLFQMDGTAGNLVTYAWRLWSNGSRLELMDPSF-QDNYETNEIT  569

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLE  433
             +C+HI LLCVQE+A++RPTM ++V ML++ S+ + + PR P  F+R+   +V     S++
Sbjct  570   RCIHIALLCVQEEAEDRPTMSEIVQMLTT-SSISLAVPRPPGFFFRSRHEQVGRAGPSID  628

Query  432   LSVTVSDEASTIGKLCPR  379
             +S   SD+ ++I ++ PR
Sbjct  629   MSALCSDDNASITRVDPR  646



>gb|KCW74362.1| hypothetical protein EUGRSUZ_E03041 [Eucalyptus grandis]
Length=673

 Score =   436 bits (1120),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 283/382 (74%), Gaps = 14/382 (4%)
 Frame = -1

Query  1491  IAVLYFLR----IRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             I VL FL      R  KK    ++  +   E++  ESLQ+D AT+Q  TN FSP+ K+GE
Sbjct  295   IMVLLFLTGCWLRRKGKKTYEVIEAINGANELTTMESLQFDLATMQSATNDFSPEKKLGE  354

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G V++G LP+GQEIA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+C +  E
Sbjct  355   GGFGEVFQGRLPNGQEIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFCLEGAE  414

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             K+L YEFVPN SLD+FLFD E++  L+W  RYKII  IARG+LYLHEDSRLRIIHRDLK 
Sbjct  415   KLLAYEFVPNKSLDHFLFDLEKRRQLDWPTRYKIISRIARGMLYLHEDSRLRIIHRDLKC  474

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD  M+PKI+DFGMA+IFGI+Q Q +T++IVGT+GYMSPEYAM GEFSVKSDV+SF
Sbjct  475   SNILLDNEMNPKISDFGMARIFGINQNQASTNKIVGTFGYMSPEYAMHGEFSVKSDVYSF  534

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             G++LLEII GKKN N Y   +  + L +Y W QWRD  P+E+LDP + + SY+ +EV++C
Sbjct  535   GILLLEIICGKKN-NFYPRLDGGEYLATYVWNQWRDNRPLEVLDPTI-EYSYSRDEVLRC  592

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSG-KVPMREISLE  433
             +H+ LLC+QED   RPTM  VV ML+S S  N   P+ PAF+  R+  G +VPM E+ LE
Sbjct  593   LHMCLLCIQEDPTIRPTMATVVFMLNSNSI-NLPLPQHPAFFIQRSLRGQRVPMEELELE  651

Query  432   LS----VTVSDEASTIGKLCPR  379
              S    + +S    +I +L PR
Sbjct  652   QSTRSTMPLSTNGMSITELDPR  673



>ref|XP_007025946.1| Cysteine-rich protein, putative [Theobroma cacao]
 gb|EOY28568.1| Cysteine-rich protein, putative [Theobroma cacao]
Length=664

 Score =   435 bits (1119),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 264/327 (81%), Gaps = 4/327 (1%)
 Frame = -1

Query  1458  SKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQ  1279
             SKK N  L    V  E +  ESL+++ ATI+  TN FS DNKIGEGG+G VYKG L +GQ
Sbjct  302   SKKYNA-LPEDKVAEETTASESLKFNLATIEAATNNFSSDNKIGEGGFGEVYKGKLSNGQ  360

Query  1278  EIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDY  1099
             E+A+KRLS+SS QG ++FKNEV ++AKL+H+NLVRLLG+C   EEK+LIYE+VPN SLDY
Sbjct  361   EVAVKRLSKSSVQGAEQFKNEVVLLAKLEHRNLVRLLGFCLDGEEKLLIYEYVPNKSLDY  420

Query  1098  FLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIAD  919
             FLFD E+Q  L+WS+RYKII GIARGLLYLHEDSRLRIIHRDLK  N+LLD +M+ KI+D
Sbjct  421   FLFDPEKQGNLDWSRRYKIIGGIARGLLYLHEDSRLRIIHRDLKAGNVLLDEDMNAKISD  480

Query  918   FGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRN  739
             FG A+IFG+DQTQ NT RIVGT+GYMSPEYAM+G+FS+KSDVFSFGV++LEIISG+KN +
Sbjct  481   FGTARIFGVDQTQANTRRIVGTFGYMSPEYAMRGKFSMKSDVFSFGVLILEIISGRKNSS  540

Query  738   TYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADER  559
              YQ ++ A DLLSY+W+ W + TP+E+LD  L +++ + NEV++C+HIGLLCVQED   R
Sbjct  541   FYQ-SDGADDLLSYSWKHWTNETPLELLDSNL-RANCSRNEVVRCIHIGLLCVQEDPANR  598

Query  558   PTMEDVVLMLSSYSTNNWSTPREPAFY  478
             PTM  V LML SYS  +   P++PAF+
Sbjct  599   PTMTRVGLMLDSYSV-SLPLPQKPAFF  624



>ref|XP_010686956.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Beta 
vulgaris subsp. vulgaris]
Length=652

 Score =   435 bits (1118),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 265/341 (78%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I  +Y   I+   K    + T     + +  ESLQYD  T+Q  TN FS +NK+GEG
Sbjct  283   VLAILAIYVCFIKKRAKHCDSVPT-GYGEDFTKVESLQYDLLTLQTATNNFSDENKLGEG  341

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V+KG L +GQEIA+KRLS++SGQG +EFKNEV +VAKLQH+NLVRLLG+C   EEK
Sbjct  342   GFGGVFKGTLSNGQEIAVKRLSKNSGQGVQEFKNEVLLVAKLQHRNLVRLLGFCIAGEEK  401

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YE+VPN SLD FLFD  +Q  L+W +RYKII G+ARG+LYLH+DSRLRIIHRDLK S
Sbjct  402   LLVYEYVPNKSLDQFLFDPVKQGQLDWGRRYKIIGGVARGMLYLHQDSRLRIIHRDLKVS  461

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+ K++DFGMA+IFG+DQTQGNTS++VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  462   NVLLDSEMNAKVSDFGMARIFGVDQTQGNTSKVVGTYGYMSPEYAMHGQFSIKSDVYSFG  521

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LE ISGKKN + YQ +  A+DLLS+AW++WRDG P+E +D  + K S  +NEV++C+
Sbjct  522   VLVLETISGKKNSSFYQ-SGYAEDLLSFAWKRWRDGMPLEFVDESI-KDSCPINEVMRCM  579

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             H+GLLCVQE  D+RPTM   VLML S+S      P++P F+
Sbjct  580   HLGLLCVQESIDDRPTMATAVLMLDSHSI-TLPMPQQPGFF  619



>gb|KEH43947.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=669

 Score =   435 bits (1119),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 270/342 (79%), Gaps = 8/342 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKK---QNTKLQ--TTDVTGEISNEESLQYDFATIQLITNVFSPDNK  1333
             L I   YFLR R  KK    NT +Q  ++    ++++ + LQ+DF+TI+  TN FS +NK
Sbjct  290   LLIVGFYFLRKRAIKKYEYSNTFVQDPSSIRREDLTDIDCLQFDFSTIEAATNCFSDENK  349

Query  1332  IGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSK  1153
             IG+GG+G VYKG+LP+G EIA+KRLS +S QG  EF+NE  +VAKLQH+NLVR+ G+C +
Sbjct  350   IGQGGFGVVYKGVLPNGLEIAVKRLSITSLQGAIEFRNEASLVAKLQHRNLVRMFGFCLE  409

Query  1152  REEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRD  973
               EK+L+YE++PN SLD+FLFDS +Q  L+WS R+KII GIARG+LYLHEDS+LRIIHRD
Sbjct  410   GREKMLVYEYIPNKSLDHFLFDSAKQRELDWSSRHKIIVGIARGILYLHEDSQLRIIHRD  469

Query  972   LKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDV  793
             LK SN+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+FSVKSDV
Sbjct  470   LKASNVLLDENMNPKISDFGMAKIFQPDQTQVNTGRIVGTYGYMSPEYAMRGQFSVKSDV  529

Query  792   FSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEV  613
             FSFGV++LEI+SGKKN +  Q  N   DLLSYAW++W + TP+E+LDP L + SY+ NEV
Sbjct  530   FSFGVLVLEIVSGKKNTDLNQ-RNHTDDLLSYAWKKWSEQTPLELLDPTL-RDSYSRNEV  587

Query  612   IQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREP  487
             ++C+HIGLLCVQE   +RP+ME + LML+SYS    S PR+P
Sbjct  588   MRCIHIGLLCVQESPYDRPSMETIALMLNSYSV-TLSLPRQP  628



>ref|XP_006606026.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X2 [Glycine max]
Length=615

 Score =   433 bits (1114),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 260/320 (81%), Gaps = 3/320 (1%)
 Frame = -1

Query  1428  TDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRS  1249
             + V  ++++ ESLQ+D ATI+  TN FS +NKIG+GG+G VYKG+LP+ QEIA+KRLS +
Sbjct  264   SSVVDDLTDVESLQFDLATIEAATNGFSDENKIGQGGFGVVYKGILPNRQEIAVKRLSVT  323

Query  1248  SGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHV  1069
             S QG  EF+NE  +VAKLQH+NLVRLLG+C +  EKILIYE++ N SLD+FLFD  +Q  
Sbjct  324   SLQGAVEFRNEAALVAKLQHRNLVRLLGFCLEGREKILIYEYITNKSLDHFLFDPVKQRE  383

Query  1068  LEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGID  889
             L+WS+RY II GIARG+LYLHEDS+LRIIHRDLK SN+LLD NM+PKI+DFGMAKIF  D
Sbjct  384   LDWSRRYNIIVGIARGILYLHEDSQLRIIHRDLKASNVLLDENMNPKISDFGMAKIFQAD  443

Query  888   QTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQD  709
             QTQ NT RIVGT+GYMSPEYAM+G+FSVKSDVFSFGV++LEI+SGKKN + YQ  N+A D
Sbjct  444   QTQVNTGRIVGTFGYMSPEYAMRGQFSVKSDVFSFGVLVLEIVSGKKNTDFYQ-PNQADD  502

Query  708   LLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLML  529
             LLSYAW+ W + TP+++LDP L + SY+ NEV +C+HIGLLCVQE+  +RP+M  + LML
Sbjct  503   LLSYAWKNWTEQTPLQLLDPTL-RGSYSRNEVNRCIHIGLLCVQENPSDRPSMATIALML  561

Query  528   SSYSTNNWSTPREPAFYRNG  469
             +SYS    S PR+PA +  G
Sbjct  562   NSYSV-TLSMPRQPASFLRG  580



>gb|KFK30803.1| hypothetical protein AALP_AA6G028000 [Arabis alpina]
Length=591

 Score =   432 bits (1112),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/341 (58%), Positives = 265/341 (78%), Gaps = 2/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV      + +KK   K   +D   E++   SLQ+DF  ++  T+ FS  NK+G+G
Sbjct  222   LLFVAVFSICLTKRAKKTYDKTAESDDRNEMTTAGSLQFDFKVVEAATDNFSMCNKLGQG  281

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V+KG LP+G ++A+KRLS++S QGE EFKNEV VVAKLQH+NLVRLLG+C ++EEK
Sbjct  282   GFGQVFKGTLPNGLQVAVKRLSKTSEQGENEFKNEVIVVAKLQHRNLVRLLGFCLEKEEK  341

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS +Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK+ 
Sbjct  342   ILVYEFVPNKSLDYFLFDSRKQSQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKSG  401

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  402   NILLDADMNPKVADFGMARIFEMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  461

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + Y       +L++Y W  W +G+P+E++DP   + +Y  NE+ +C+
Sbjct  462   VLVLEIISGKKNSSIYHMDGSVGNLVTYTWRLWSNGSPLELVDPSF-QDNYQRNEISRCI  520

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQE+A++RPTM  +V ML++ S+   + PR P F+
Sbjct  521   HIALLCVQEEAEDRPTMSVIVQMLTT-SSIALAVPRPPGFF  560



>ref|XP_011004253.1| PREDICTED: cysteine-rich receptor-like protein kinase 29 isoform 
X2 [Populus euphratica]
Length=665

 Score =   434 bits (1117),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/345 (61%), Positives = 268/345 (78%), Gaps = 12/345 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+   +  +LRIR  K+   K +T D   E    ESLQ+DF+TI+  T+ FS +NK+G+G
Sbjct  291   LMISCICLYLRIRKPKE---KAETGD---ETITPESLQFDFSTIRAATDNFSEENKLGQG  344

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSVYKG L +GQE+A+KRLS+ SGQG+ EFKNEV +VAKLQH+NLVRL G+C +  E+
Sbjct  345   GFGSVYKGTLSNGQEVAVKRLSKDSGQGDLEFKNEVLLVAKLQHRNLVRLQGFCLQGIER  404

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+F+F   R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  405   LLIYEFVPNASLDHFVF--TRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  462

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFGMAK+F +D+TQGNTSRIVGTYGYM+PEYAM G+FSVKSDVFSFG
Sbjct  463   NILLDADMNPKISDFGMAKLFVMDETQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFG  522

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG+KN N ++     +DLLSYAW  WR+GT + ++DP L+    T  E+++C+
Sbjct  523   VLILEIVSGQKN-NCFRNGETVEDLLSYAWRNWREGTGLNVIDPALSTGPRT--EMMRCI  579

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS  466
              IGLLCVQE+  +RPTM  +VLMLSSYS      P +PAF  N S
Sbjct  580   QIGLLCVQENIADRPTMASIVLMLSSYSL-TLPVPSQPAFSMNSS  623



>emb|CBI39033.3| unnamed protein product [Vitis vinifera]
Length=615

 Score =   433 bits (1113),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 257/310 (83%), Gaps = 3/310 (1%)
 Frame = -1

Query  1407  SNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKE  1228
             S  +SL +D  T++  TN FS  NKIGEGG+G+VYKG+L SG EIAIKRLSR+SGQG +E
Sbjct  285   STMDSLLFDLKTLRAATNNFSDANKIGEGGFGAVYKGLLSSGLEIAIKRLSRNSGQGTEE  344

Query  1227  FKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRY  1048
             FKNE+ ++AKLQH+NLVRLLG+C + +EKIL+YEFVPN SLDYFLFD+++Q  L+W  R+
Sbjct  345   FKNEIALLAKLQHRNLVRLLGFCLEAKEKILVYEFVPNKSLDYFLFDTDKQSQLDWPTRH  404

Query  1047  KIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTS  868
             KII GIARGLLYLHE+SRL+IIHRDLK SNILLD  ++PKI+DFGMA+IF ++Q+Q NT+
Sbjct  405   KIIVGIARGLLYLHEESRLKIIHRDLKASNILLDSKLNPKISDFGMARIFFMEQSQANTT  464

Query  867   RIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWE  688
             RIVGTYGYMSPEYAM G+FSVKSDVFSFGV+LLEI+SGKKN + +  +  +QDLLSYAW 
Sbjct  465   RIVGTYGYMSPEYAMHGQFSVKSDVFSFGVLLLEILSGKKN-SCFNNSECSQDLLSYAWR  523

Query  687   QWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNN  508
             QW+D T +E++DP++    Y+ +EV++C+HIGLLCVQEDA +RPTM  V LML+SYS   
Sbjct  524   QWKDRTALELIDPIVG-GEYSRSEVMRCIHIGLLCVQEDAADRPTMASVALMLNSYSV-T  581

Query  507   WSTPREPAFY  478
                P +PAF+
Sbjct  582   LPLPSKPAFF  591



>ref|XP_008377958.1| PREDICTED: LOW QUALITY PROTEIN: cysteine-rich receptor-like protein 
kinase 10 [Malus domestica]
Length=364

 Score =   424 bits (1090),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 265/341 (78%), Gaps = 7/341 (2%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             EI + ESLQ+DF TI++ T+ FS  NK G+GG+GSVYKG L +GQEIA+KRLS +SGQG+
Sbjct  9     EIGSAESLQFDFDTIRIATDDFSEANKPGQGGFGSVYKGRLYNGQEIAVKRLSITSGQGD  68

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV +VAKLQH+NLVRLLG+C +  E++LIYEFVPN SLD+ +FD  ++  L+W +
Sbjct  69    LEFKNEVLLVAKLQHRNLVRLLGFCLEGVERLLIYEFVPNASLDHIIFDPIKRAQLDWDR  128

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GI RGL+YLHEDSRLRIIHRDLK SNIL+D  M PKI+DFGMAK+FG+DQTQGN
Sbjct  129   RYKIIVGITRGLIYLHEDSRLRIIHRDLKASNILIDEEMTPKISDFGMAKLFGVDQTQGN  188

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T RIVGTYGYM+PEYAM G FSVKSDV+SFGV++LEI+SG+KN N+++     +DLLSYA
Sbjct  189   TIRIVGTYGYMAPEYAMHGHFSVKSDVYSFGVLVLEIVSGQKN-NSFRHGENVEDLLSYA  247

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W+ WR+GT   ++DP L   S   NE+++C+HIGLLCVQE+   RPTM  +VLML+SYS 
Sbjct  248   WKCWREGTASNLIDPALTXGSR--NEIMRCIHIGLLCVQENIAHRPTMMXIVLMLNSYSV  305

Query  513   NNWSTPREPAFYRN---GSGKVPMREISLELSVTVSDEAST  400
                  P +PAF+R+   GS      + S E+  T SD++ +
Sbjct  306   -TLLVPSQPAFFRDSNVGSDMTLGWKNSSEVITTGSDQSKS  345



>emb|CDY10872.1| BnaC01g14870D [Brassica napus]
Length=602

 Score =   432 bits (1112),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 212/375 (57%), Positives = 276/375 (74%), Gaps = 12/375 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+A+     +R  KK      TT    E   E SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  239   LLFVALF---TVRAKKK------TTVYEMEPPTEGSLQFDFKAIEAATDKFSLANKLGQG  289

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG   +G ++A+KRLS++SGQGE+EF+NEV  VAKLQH+NLVRLLG+C + EEK
Sbjct  290   GFGQVYKGTFSNGAQVAVKRLSKTSGQGEREFENEVVGVAKLQHRNLVRLLGFCLEGEEK  349

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFDS  Q  L+W +RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  350   ILIYEFVPNKSLDYFLFDSTMQKQLDWKRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  409

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  410   NILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  469

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ    A +L++Y W  W +G+P+E++DP   + +Y  NE+ +C+
Sbjct  470   VLVLEIISGKKNSSLYQMDGSAGNLVTYTWRLWSNGSPLELVDPSF-QDNYQTNEITRCI  528

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSV  424
             HI LLCVQE+A++RPTM  +V ML+S S+   + PR P  F+R+   +V     S+  S 
Sbjct  529   HIALLCVQEEAEDRPTMSVIVQMLAS-SSIALAVPRPPGFFFRSRDEEVGRAGPSMHTSA  587

Query  423   TVSDEASTIGKLCPR  379
               S + ++I  + PR
Sbjct  588   LCSVDDASITSVAPR  602



>gb|KCW75430.1| hypothetical protein EUGRSUZ_E041921, partial [Eucalyptus grandis]
Length=390

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 205/341 (60%), Positives = 260/341 (76%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFI   +  R R  KK     +   VT EI + +SLQ+D+ T+   TN FS +NK+GEG
Sbjct  15    LLFIGCCWLRRRRAQKKYEAAKEECGVT-EIPSLKSLQFDWDTLLSATNNFSQENKLGEG  73

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP+G++IA+KRLS +SGQG +EFKNE+ +VAKLQH+NLVRLLG+C +  EK
Sbjct  74    GFGEVFQGRLPNGRDIAVKRLSHTSGQGGEEFKNEIMLVAKLQHRNLVRLLGFCLEGGEK  133

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLDYF FD  +   L+W  RYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  134   LLVYEFVPNKSLDYFFFDPMKSKQLDWPIRYKIISGIARGMLYLHEDSRLRVIHRDLKAS  193

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M PKI+DFGMA+IF +DQ+  +T RIVGTYGYMSPEYAM G+FS KSDV+SFG
Sbjct  194   NILLDNDMSPKISDFGMARIFRVDQSNASTKRIVGTYGYMSPEYAMHGQFSQKSDVYSFG  253

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEII GK+N N Y  +NR +DL SYAW+ WR   P++ILDP L + SY+ ++V++C+
Sbjct  254   VLLLEIICGKRN-NYYYQSNRGEDLTSYAWKHWRSDAPLDILDPALGE-SYSRSQVLKCI  311

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI  LCVQED   RPTM ++VL LS   T +   PREPAF+
Sbjct  312   HISFLCVQEDPANRPTMANIVLALSG-QTLSLPVPREPAFF  351



>ref|XP_010439212.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 [Camelina 
sativa]
Length=661

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 264/341 (77%), Gaps = 3/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFIA  Y  R + +KK        D   +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  293   MLFIAC-YCFRAKRAKKTYETAAAHDDGDDITTAGSLQFDFKVIEAATDKFSESNKLGQG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG  P+G ++A+KRLS++SGQGEKEFKNEV VVAKLQHKNLVRLLG+C +REEK
Sbjct  352   GFGEVYKGTFPNGLQVAVKRLSKTSGQGEKEFKNEVLVVAKLQHKNLVRLLGFCLEREEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS  +  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  412   ILVYEFVPNKSLDYFLFDSTMKSQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  472   NILLDDDMNPKVADFGMARIFKMDQTEANTRRVVGTYGYMSPEYAMYGKFSMKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             +++LEIISGKKN  TYQ  +   +L++Y W  W + +P+E++DP   + SY +NE+ +C+
Sbjct  532   ILVLEIISGKKNIGTYQMDSSEGNLVTYTWRVWNNESPMEVVDPSF-QDSYQINEITRCI  590

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQE+A++RPTM  VV ML++ S+   + PR P  +
Sbjct  591   HIALLCVQEEAEDRPTMSTVVQMLTT-SSIALAAPRPPGCF  630



>ref|XP_010655874.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=661

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 272/343 (79%), Gaps = 6/343 (2%)
 Frame = -1

Query  1407  SNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKE  1228
             S  +SL +D  T++  TN FS  NKIGEGG+G+VYKG+L SG EIAIKRLSR+SGQG +E
Sbjct  325   STMDSLLFDLKTLRAATNNFSDANKIGEGGFGAVYKGLLSSGLEIAIKRLSRNSGQGTEE  384

Query  1227  FKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRY  1048
             FKNE+ ++AKLQH+NLVRLLG+C + +EKIL+YEFVPN SLDYFLFD+++Q  L+W  R+
Sbjct  385   FKNEIALLAKLQHRNLVRLLGFCLEAKEKILVYEFVPNKSLDYFLFDTDKQSQLDWPTRH  444

Query  1047  KIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTS  868
             KII GIARGLLYLHE+SRL+IIHRDLK SNILLD  ++PKI+DFGMA+IF ++Q+Q NT+
Sbjct  445   KIIVGIARGLLYLHEESRLKIIHRDLKASNILLDSKLNPKISDFGMARIFFMEQSQANTT  504

Query  867   RIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWE  688
             RIVGTYGYMSPEYAM G+FSVKSDVFSFGV+LLEI+SGKKN + +  +  +QDLLSYAW 
Sbjct  505   RIVGTYGYMSPEYAMHGQFSVKSDVFSFGVLLLEILSGKKN-SCFNNSECSQDLLSYAWR  563

Query  687   QWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNN  508
             QW+D T +E++DP++    Y+ +EV++C+HIGLLCVQEDA +RPTM  V LML+SYS   
Sbjct  564   QWKDRTALELIDPIVG-GEYSRSEVMRCIHIGLLCVQEDAADRPTMASVALMLNSYSV-T  621

Query  507   WSTPREPAFYRNGSGKVPMREISLELSVTVSDEASTIGKLCPR  379
                P +PAF+ +   +      S   SV++S +  +I ++ PR
Sbjct  622   LPLPSKPAFFLHSKKE---SNPSTSKSVSMSVDEGSITEVYPR  661



>gb|KCW75425.1| hypothetical protein EUGRSUZ_E04185 [Eucalyptus grandis]
Length=651

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 269/351 (77%), Gaps = 10/351 (3%)
 Frame = -1

Query  1410  ISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEK  1231
             ++  ESLQ+D ATIQ  TN FSP+NK+GEGG+G V++G LP+GQ+IA+KRLSR S QG +
Sbjct  304   LTTVESLQFDLATIQAATNYFSPENKLGEGGFGEVFQGRLPNGQQIAVKRLSRRSRQGVE  363

Query  1230  EFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKR  1051
             EFKNE+ +VAKLQH+NLVRLLG+C + +EK+L YEFVPN SLDYFLFD E++  L+W  R
Sbjct  364   EFKNEILLVAKLQHRNLVRLLGFCLEGDEKLLAYEFVPNKSLDYFLFDLEKRRQLDWPLR  423

Query  1050  YKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNT  871
             +KI+ GIARG+LYLHEDSRLR+IHRDLK SNILLD  M+PKI+DFGMA+IFG+DQTQ +T
Sbjct  424   HKIVFGIARGMLYLHEDSRLRVIHRDLKCSNILLDSEMNPKISDFGMARIFGVDQTQAST  483

Query  870   SRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAW  691
             ++IVGT+GYMSPEYAM GEFS+KSDV+SFG++LLEI+ GKKN N Y   +  + L SY W
Sbjct  484   NKIVGTFGYMSPEYAMHGEFSLKSDVYSFGIILLEIVCGKKN-NYYHQLDEGEYLTSYVW  542

Query  690   EQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTN  511
              QWRDG P+E+LDP +   SY+ + V++C+HI LLC+QED   RPTM  VVLMLS+ S  
Sbjct  543   NQWRDGKPLEVLDPAIM-DSYSRDGVLRCLHICLLCIQEDPTIRPTMATVVLMLSNNSF-  600

Query  510   NWSTPREPAFYRNGSGKVP---MREISLELSVTVSDEASTIG----KLCPR  379
                +P+ PAF+   S   P   M E+ L  S   +  +ST G    +LCP+
Sbjct  601   TLPSPQHPAFFVQSSLSGPSIQMEELKLNQSPRRTMPSSTNGMSVTELCPQ  651



>ref|XP_010540876.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Tarenaya 
hassleriana]
Length=649

 Score =   434 bits (1115),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/370 (56%), Positives = 277/370 (75%), Gaps = 10/370 (3%)
 Frame = -1

Query  1482  LYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVY  1303
             +YF+R R ++K        D   +I+ E SLQ+DF  I+  T+ FS  N++G+GG+G VY
Sbjct  278   VYFVRSRRARKTYDTTIAGDSGDDITTEGSLQFDFKAIEAATDKFSESNRLGQGGFGEVY  337

Query  1302  KGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEF  1123
             KG LP G E+A+KRLS++SGQGEKEFKNEV +VA+LQH+NLVRLLG+C + EEKIL++EF
Sbjct  338   KGALPCGTEVAVKRLSKTSGQGEKEFKNEVVLVARLQHRNLVRLLGFCLEGEEKILVFEF  397

Query  1122  VPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDV  943
             VPN SLDYFLFD  +Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK SNILLD 
Sbjct  398   VPNKSLDYFLFDPSKQGELDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKASNILLDA  457

Query  942   NMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEI  763
             +M+PKIADFGMA++FG+DQT+ NT R+VGTYGYMSPEYAM G FS+KSDV+SFGV++LEI
Sbjct  458   DMNPKIADFGMARLFGMDQTEANTGRVVGTYGYMSPEYAMYGYFSMKSDVYSFGVLVLEI  517

Query  762   ISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLC  583
             ISGK+N + ++  +   +L++YAW  W +G+P+E++DP   + SY  N+VI+C+HI LLC
Sbjct  518   ISGKRNSSFHEMDDTFGNLVTYAWRLWSNGSPLELVDPANGE-SYQSNDVIRCIHISLLC  576

Query  582   VQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRN-------GSGKVPMREISLELS  427
             VQED  +RPT   ++ ML++ S+     PR P  FYRN       G  +V  +  S  + 
Sbjct  577   VQEDPVDRPTSSTIIQMLTT-SSIALPVPRPPGFFYRNRRVADAQGDRRVSAQSASNSVP  635

Query  426   VTVSDEASTI  397
              +V DE+ T+
Sbjct  636   WSVDDESITV  645



>ref|XP_002271125.3| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Vitis 
vinifera]
Length=692

 Score =   435 bits (1119),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 214/369 (58%), Positives = 276/369 (75%), Gaps = 10/369 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++ I  +  L  R   +++   Q  D   EI N ESLQ+DFATI++ TN FS  NK+G+G
Sbjct  314   VMLITFICCLLKRRRTRESVGTQDED---EIGNTESLQFDFATIRVATNNFSDANKLGQG  370

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +GQEIA+KRLS  SGQGE EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  371   GFGPVYKGRLSNGQEIAVKRLSSGSGQGELEFKNEVILVAKLQHRNLVRLLGFCLEGIER  430

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVP  SLD F+FD  ++  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  431   LLIYEFVPKTSLDNFIFDPIKRAQLDWDRRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  490

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA++F +DQTQGNTSRIVGTYGYM+PEYAM G FSVK+DV+SFG
Sbjct  491   NILLDTEMNPKISDFGMARLFVVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFG  550

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG++N N        +DLLSYAW+ WR+G    ++DP +   S   +E+++C+
Sbjct  551   VLVLEIVSGQRN-NCIHIGENVEDLLSYAWKNWREGKATNVMDPTMGIGS--TSEIMRCI  607

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG--SGKVPMREISLELS  427
             HIGLLCVQE+  +RPTM  +VLML+SYS  +   P +PAF+ N   +G +P+ E+    S
Sbjct  608   HIGLLCVQENEADRPTMASIVLMLNSYSL-SLPLPSQPAFFMNSGMNGDLPL-ELEDNSS  665

Query  426   VTVSDEAST  400
             VT SD + +
Sbjct  666   VTKSDHSQS  674



>gb|KDP20815.1| hypothetical protein JCGZ_21286 [Jatropha curcas]
Length=661

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/340 (61%), Positives = 266/340 (78%), Gaps = 7/340 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             L   +++ +  R  +K N K +T D   +I   ESLQ DF T++  TN FS +NK+G+GG
Sbjct  283   LLAIIIFCIFFRTRRKPNEKAETVD---DIETAESLQLDFETVKAATNNFSDENKLGQGG  339

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G+VYKG L +GQ IA+KRLS+ SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E++
Sbjct  340   FGAVYKGTLYNGQTIAVKRLSKDSGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLEGNERL  399

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFVPN SLD+FLFD  ++  L+W  RYKII GIARGL+YLHEDSRLRIIHRD+K SN
Sbjct  400   LIYEFVPNTSLDHFLFDRTKREELDWETRYKIICGIARGLVYLHEDSRLRIIHRDMKASN  459

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD +M+PKI+DFGMA++F +DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSDVFSFGV
Sbjct  460   ILLDADMNPKISDFGMARLFVMDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGV  519

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SG++N N ++     +DLLSYAW  +R+GT + ++DP L   S T  E+++CVH
Sbjct  520   LILEILSGQRN-NGFRNGENIEDLLSYAWRNFREGTSMNLIDPTLRSGSRT--EMMRCVH  576

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLCVQE+  +RP M  VVLML+SYST     P EPAF+
Sbjct  577   IGLLCVQENVVDRPNMALVVLMLNSYST-TLPLPLEPAFF  615



>ref|XP_010247622.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=675

 Score =   434 bits (1117),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 218/339 (64%), Positives = 260/339 (77%), Gaps = 7/339 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             L I++L    +R  K        + V  EI + ESLQ++ +TI  +TN FS +NKIGEGG
Sbjct  299   LLISILSCCCLRRKKMD----IISQVGNEIGDVESLQFNLSTIIEVTNNFSDENKIGEGG  354

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +GSVYKG L  GQEIA+KRLSRSSGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEKI
Sbjct  355   FGSVYKGKLSGGQEIAVKRLSRSSGQGAVEFKNEVILVAKLQHRNLVRLLGFCLEGEEKI  414

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFVPN SLD+FLFD      L+W  RYKII GIARGLLYLHEDSRLRIIHRDLK SN
Sbjct  415   LVYEFVPNKSLDFFLFDPNECARLDWPTRYKIIGGIARGLLYLHEDSRLRIIHRDLKPSN  474

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD NM+PKI+DFGMA+IFG +Q+Q NT+RIVGTYGYMSPEYAM G+FSVKSDVFSFGV
Sbjct  475   ILLDGNMNPKISDFGMARIFGAEQSQANTNRIVGTYGYMSPEYAMHGQFSVKSDVFSFGV  534

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             +LLEII+GKKN   YQ +   +DLLS  W  W +GT +++LDP+L +  Y+ +EV +C H
Sbjct  535   LLLEIITGKKNSPFYQ-SEYGEDLLSSVWRHWNEGTALDLLDPIL-RDHYSKDEVTRCFH  592

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF  481
             IGLLCVQE   +RPTM  VVLML+SYS      P +PAF
Sbjct  593   IGLLCVQESVADRPTMGTVVLMLNSYSV-TLEMPLQPAF  630



>ref|XP_010059679.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=634

 Score =   433 bits (1113),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 210/351 (60%), Positives = 269/351 (77%), Gaps = 10/351 (3%)
 Frame = -1

Query  1410  ISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEK  1231
             ++  ESLQ+D ATIQ  TN FSP+NK+GEGG+G V++G LP+GQ+IA+KRLSR S QG +
Sbjct  287   LTTVESLQFDLATIQAATNYFSPENKLGEGGFGEVFQGRLPNGQQIAVKRLSRRSRQGVE  346

Query  1230  EFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKR  1051
             EFKNE+ +VAKLQH+NLVRLLG+C + +EK+L YEFVPN SLDYFLFD E++  L+W  R
Sbjct  347   EFKNEILLVAKLQHRNLVRLLGFCLEGDEKLLAYEFVPNKSLDYFLFDLEKRRQLDWPLR  406

Query  1050  YKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNT  871
             +KI+ GIARG+LYLHEDSRLR+IHRDLK SNILLD  M+PKI+DFGMA+IFG+DQTQ +T
Sbjct  407   HKIVFGIARGMLYLHEDSRLRVIHRDLKCSNILLDSEMNPKISDFGMARIFGVDQTQAST  466

Query  870   SRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAW  691
             ++IVGT+GYMSPEYAM GEFS+KSDV+SFG++LLEI+ GKKN N Y   +  + L SY W
Sbjct  467   NKIVGTFGYMSPEYAMHGEFSLKSDVYSFGIILLEIVCGKKN-NYYHQLDEGEYLTSYVW  525

Query  690   EQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTN  511
              QWRDG P+E+LDP +   SY+ + V++C+HI LLC+QED   RPTM  VVLMLS+ S  
Sbjct  526   NQWRDGKPLEVLDPAIM-DSYSRDGVLRCLHICLLCIQEDPTIRPTMATVVLMLSNNSF-  583

Query  510   NWSTPREPAFYRNGSGKVP---MREISLELSVTVSDEASTIG----KLCPR  379
                +P+ PAF+   S   P   M E+ L  S   +  +ST G    +LCP+
Sbjct  584   TLPSPQHPAFFVQSSLSGPSIQMEELKLNQSPRRTMPSSTNGMSVTELCPQ  634



>ref|XP_010529370.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Tarenaya 
hassleriana]
Length=675

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 261/343 (76%), Gaps = 6/343 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQT---TDVTGEISNEESLQYDFATIQLITNVFSPDNKI  1330
             LL +   Y L  R  ++   +L++        +IS  ESLQ+ F TI+  TN FS  NK+
Sbjct  296   LLLLIGAYCLLARRRRRSKMQLRSEPEKKDGDDISTAESLQFQFRTIEAATNKFSDSNKL  355

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G GG+G V+ G LPSGQEIA+KRLSR S QG +EFKNEV +VAKLQH+NL RLLGYC + 
Sbjct  356   GHGGFGEVFMGRLPSGQEIAVKRLSRGSTQGAREFKNEVVLVAKLQHRNLARLLGYCLEG  415

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             EEKILIYEF+ N SLDYFLFD E++  L+W +RYKII GIARG+LYLH DSRL IIHRDL
Sbjct  416   EEKILIYEFIANKSLDYFLFDPEKRRYLDWRRRYKIIEGIARGVLYLHRDSRLMIIHRDL  475

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K SNILLD + +PKI+DFGMA+IFGIDQTQ NT RIVGTYGYMSPEYA+ G +SVKSD++
Sbjct  476   KVSNILLDADFNPKISDFGMARIFGIDQTQANTGRIVGTYGYMSPEYAIHGHYSVKSDIY  535

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGKKN + Y+    A DL+SYAW  W D +P+E++DP + +  Y  NEVI
Sbjct  536   SFGVLILEIISGKKNSSFYERDGNA-DLVSYAWRLWGDNSPLELVDPSMGR-DYQTNEVI  593

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF  481
             +C+HIGLLCVQ+D  +RPTME++++ML+S+ T     P++P F
Sbjct  594   RCIHIGLLCVQDDLSDRPTMENILIMLNSF-TVTLPVPQQPGF  635



>ref|XP_010059687.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=355

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 250/312 (80%), Gaps = 3/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             ++   ESLQ+  + I+  TN F+  NK+GEGG+G VY+G LP+GQEIA+KRLS+SS QG 
Sbjct  6     DVKTAESLQFKISEIRAATNSFAEGNKLGEGGFGKVYRGRLPNGQEIAVKRLSQSSRQGL  65

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNE+ +VAKLQH+NLVRLLG+C +  EK+L+YE +PN SLDYF+FD E+   L+W +
Sbjct  66    QEFKNEIVLVAKLQHRNLVRLLGFCFEEGEKLLVYELMPNKSLDYFMFDPEKSKQLDWPR  125

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RY II GIARG+LYLHEDSRLRIIHRDLK SNILLD NM+PKI+DFGMA+IFG+DQT  +
Sbjct  126   RYNIISGIARGMLYLHEDSRLRIIHRDLKASNILLDNNMNPKISDFGMARIFGVDQTNAS  185

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T RIVGTYGYMSPEYA+ G+FS KSDV+SFGV+LLEII GK+N + Y  ++  + L SYA
Sbjct  186   TRRIVGTYGYMSPEYAINGQFSQKSDVYSFGVLLLEIICGKRN-DYYCQSDGGEALASYA  244

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W+ WRD  P EILDPVL K SY+ ++V++C+HIG LCVQED  +RPTM  +VLMLSS  T
Sbjct  245   WKHWRDNVPWEILDPVLGK-SYSRSQVLRCIHIGFLCVQEDPADRPTMASIVLMLSS-QT  302

Query  513   NNWSTPREPAFY  478
              +   PREPAF+
Sbjct  303   LSLPVPREPAFF  314



>ref|XP_011004254.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X3 [Populus euphratica]
Length=625

 Score =   432 bits (1112),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 254/311 (82%), Gaps = 4/311 (1%)
 Frame = -1

Query  1398  ESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKN  1219
             ESLQ+DF+TI+  T+ FS +NK+G+GG+GSVYKG L +GQE+A+KRLS+ SGQG+ EFKN
Sbjct  277   ESLQFDFSTIRAATDNFSEENKLGQGGFGSVYKGTLSNGQEVAVKRLSKDSGQGDLEFKN  336

Query  1218  EVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKII  1039
             EV +VAKLQH+NLVRL G+C +  E++LIYEFVPN SLD+F+F+  R+  L+W +RYKII
Sbjct  337   EVLLVAKLQHRNLVRLQGFCLQGIERLLIYEFVPNASLDHFVFNQARRAQLDWERRYKII  396

Query  1038  RGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIV  859
              GIARGLLYLHEDSRLRIIHRDLK SNILLD +M+PKI+DFGMAK+F +D+TQGNTSRIV
Sbjct  397   GGIARGLLYLHEDSRLRIIHRDLKASNILLDADMNPKISDFGMAKLFVMDETQGNTSRIV  456

Query  858   GTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWR  679
             GTYGYM+PEYAM G+FSVKSDVFSFGV++LEI+SG+KN N ++     +DLLSYAW  WR
Sbjct  457   GTYGYMAPEYAMHGQFSVKSDVFSFGVLILEIVSGQKN-NCFRNGETVEDLLSYAWRNWR  515

Query  678   DGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWST  499
             +GT + ++DP L+    T  E+++C+ IGLLCVQE+  +RPTM  +VLMLSSYS      
Sbjct  516   EGTGLNVIDPALSTGPRT--EMMRCIQIGLLCVQENIADRPTMASIVLMLSSYSL-TLPV  572

Query  498   PREPAFYRNGS  466
             P +PAF  N S
Sbjct  573   PSQPAFSMNSS  583



>ref|XP_009135684.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
20 [Brassica rapa]
Length=645

 Score =   433 bits (1113),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/376 (56%), Positives = 282/376 (75%), Gaps = 7/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTK-LQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             LL +AV  F   R      T+ L   D   +I+   SLQ+DF  I+  T+ FS  NK+G+
Sbjct  275   LLLVAVFSFRAKRKGAVYETEPLADRD---DITTAGSLQFDFKAIEAATDNFSEGNKLGQ  331

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G VYKG  PSG ++A+KRLS +SGQG++EF+NEV VVAKLQ +NLVRL G+C + EE
Sbjct  332   GGFGQVYKGTFPSGVQVAVKRLSNTSGQGKREFENEVVVVAKLQPRNLVRLFGFCLEAEE  391

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             KIL+YEFVPN SLDYFLFDS  Q  L+W+KRYKII GIARG+LYLH+DSRL IIHRDLK 
Sbjct  392   KILVYEFVPNKSLDYFLFDSTMQSQLDWTKRYKIIGGIARGILYLHQDSRLTIIHRDLKA  451

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
              NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SF
Sbjct  452   GNILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSF  511

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISGK+N + +Q    A +L++YAW  W +G+ +E++DP   + +Y  NE+ +C
Sbjct  512   GVLVLEIISGKRNSSLFQMDGTAGNLVTYAWRLWSNGSRLELMDPSF-QDNYETNEITRC  570

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELS  427
             +HI LLCVQE+A++RPTM ++V ML++ S+ + + PR P  F+R+   +V     S+++S
Sbjct  571   IHIALLCVQEEAEDRPTMSEIVQMLTT-SSISLAVPRPPGFFFRSRHEQVGRAGPSIDMS  629

Query  426   VTVSDEASTIGKLCPR  379
                SD+ ++I ++ PR
Sbjct  630   ALCSDDNASITRVDPR  645



>emb|CDY67333.1| BnaAnng24050D, partial [Brassica napus]
Length=788

 Score =   437 bits (1125),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 281/378 (74%), Gaps = 6/378 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTK-LQTTDVTGE-ISNEESLQYDFATIQLITNVFSPDNKIG  1327
             LL +AV  F   R +    T+ L      G+ I+   SLQ+DF  I+  T+ FS  NK+G
Sbjct  413   LLLVAVFIFRAKRKTTAYETEPLAVVSTDGDDITTAGSLQFDFRAIEAATDKFSESNKLG  472

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLVRLLG+C + E
Sbjct  473   QGGFGQVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGFCLEGE  532

Query  1146  EKILIYEFVPNGSLDYFLF-DSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             EKIL+YE+VPN SLDYFLF DS  Q  L+W KRYKI+ GIARG+LYLH+DSRL IIHRDL
Sbjct  533   EKILVYEYVPNKSLDYFLFADSTMQSQLDWKKRYKIVEGIARGILYLHQDSRLTIIHRDL  592

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLD +M+PK+ADFGMA+IFGIDQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+
Sbjct  593   KAGNILLDADMNPKVADFGMARIFGIDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVY  652

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGKKN N YQ    A +L++Y W  W +G+P+E++DP   + +Y  NE+ 
Sbjct  653   SFGVLVLEIISGKKNSNLYQMDGSAANLVTYTWRLWSNGSPLELVDPSF-QENYQTNEIT  711

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLE  433
             +C+HI LLCVQE+A++RPTM  ++ ML++ S+ + + PR P  F+R+   +    + +++
Sbjct  712   RCIHIALLCVQEEAEDRPTMSAILQMLTT-SSISLAVPRPPGFFFRSRHEQAGRADPAMD  770

Query  432   LSVTVSDEASTIGKLCPR  379
             +S   S   ++I  + PR
Sbjct  771   MSALFSVNDASITSVAPR  788



>ref|XP_007011084.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
 gb|EOY19894.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 25, putative 
[Theobroma cacao]
Length=655

 Score =   433 bits (1114),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/341 (59%), Positives = 267/341 (78%), Gaps = 8/341 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I V  FL++R +++Q+ +    ++       ESLQYDF TI+  TN F+ +N++G+G
Sbjct  279   ILIICVYIFLKMRKTREQDVESDDENII----TAESLQYDFDTIKAATNNFADENRLGQG  334

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L +GQ+IA+KRLS+ SGQG+ EFKNEV ++AKLQH+NLVRLLG+  +R E+
Sbjct  335   GFGAVYKGRLSTGQDIAVKRLSKDSGQGDLEFKNEVLLLAKLQHRNLVRLLGFSLERTER  394

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD F+FD +R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  395   LLIYEFVPNSSLDRFIFDPKRREQLDWEQRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  454

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA++F +DQTQGNTSRIVGTYGYM+PEYAM G+FSVKSD+FSFG
Sbjct  455   NILLDTDMNPKIADFGMARLFAVDQTQGNTSRIVGTYGYMAPEYAMHGQFSVKSDIFSFG  514

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++G++N   +   +  +DLLSYAW+ WR+GT + ++DP L  SS    E+ +C+
Sbjct  515   VLILEIVNGQRNI-CFHDRDNVEDLLSYAWKNWREGTTLNLIDPSLKVSSKA--EITRCI  571

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQE+  +RPTM  V +ML+SYS      P  PAF+
Sbjct  572   HIALLCVQENVVDRPTMASVAIMLNSYSV-TLPVPSHPAFF  611



>ref|XP_009137321.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Brassica 
rapa]
Length=662

 Score =   433 bits (1113),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 262/322 (81%), Gaps = 4/322 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             +I+  ESLQ D+ +IQ  TN FS  NKIG+GG+G VYKG L  G E+A+KRLS+SSGQG+
Sbjct  318   DITTAESLQLDYRSIQTATNGFSESNKIGQGGFGEVYKGTLSDGTEVAVKRLSKSSGQGD  377

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV +VAKLQH+NLVRLLG+C + EE++L+YE+VPN SLDYF+FD  +Q  L+WS+
Sbjct  378   AEFKNEVILVAKLQHRNLVRLLGFCLEGEERVLVYEYVPNESLDYFIFDLAKQTQLDWSR  437

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARG+LYLH+DSRL IIHRDLK SN+LLD +M+PKIADFGMA+IFG++QT+ N
Sbjct  438   RYKIIGGIARGILYLHQDSRLTIIHRDLKASNVLLDSDMNPKIADFGMARIFGMNQTEEN  497

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             TSRIVGTYGYMSPEYAM G++S+KSDV+SFGV++LEIISGKKN + YQ T+ A DL+SYA
Sbjct  498   TSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKNSSFYQ-TDGAHDLVSYA  556

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W  W +GTP++++DP++  +    NEV++CVHIGLLCVQED  ERP    +VLMLSS +T
Sbjct  557   WRLWSNGTPLDLVDPIIVDNCQR-NEVVRCVHIGLLCVQEDPVERPPFSTIVLMLSS-NT  614

Query  513   NNWSTPREPA-FYRNGSGKVPM  451
                  PR+P  F+++  GK P+
Sbjct  615   VTLPVPRQPGLFFQSRLGKDPL  636



>ref|XP_003635466.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Vitis 
vinifera]
Length=675

 Score =   433 bits (1113),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 210/352 (60%), Positives = 273/352 (78%), Gaps = 11/352 (3%)
 Frame = -1

Query  1485  VLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSV  1306
             + +F R R+S +   KL+T D   EI+N ESL +DF TI++ TN FS  NK+G+GG+G V
Sbjct  303   ICFFSRKRSSME---KLETHD-EDEITNVESLHFDFDTIRVATNNFSDSNKLGQGGFGPV  358

Query  1305  YKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYE  1126
             YKG L +GQ +A+KRLS  S QGE EFKNEV +VAKLQH+NLVRLLG+C    E++LIYE
Sbjct  359   YKGKLSNGQNVAVKRLSSGSAQGELEFKNEVVLVAKLQHRNLVRLLGFCLDGAERLLIYE  418

Query  1125  FVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLD  946
             FVPN SLD+F+FD  R+  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK SNILLD
Sbjct  419   FVPNTSLDHFIFDLIRRAQLDWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKASNILLD  478

Query  945   VNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLE  766
               M+PKI+DFGMA++F +DQTQG+TSRIVGTYGYM+PEYAM G FSVK+DV+SFGV++LE
Sbjct  479   AEMNPKISDFGMARLFLVDQTQGSTSRIVGTYGYMAPEYAMHGHFSVKTDVYSFGVLVLE  538

Query  765   IISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLL  586
             ++SG++N N ++ +   + LLSYAW+ WR+GT   ++DP +  SS  ++E+++C+HIGLL
Sbjct  539   LVSGQRN-NCFRVSENIEHLLSYAWKNWREGTATNLIDPTMRISS--ISEIMRCIHIGLL  595

Query  585   CVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLEL  430
             CVQE+  +RPTM  + LML+SYS  +   P  PAF+ N S     R++SLEL
Sbjct  596   CVQENEADRPTMASIALMLNSYSL-SLPVPSHPAFFMNTSMN---RDMSLEL  643



>ref|XP_006287218.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
 gb|EOA20116.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
Length=669

 Score =   432 bits (1112),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 200/345 (58%), Positives = 269/345 (78%), Gaps = 2/345 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F+A+L    I   ++Q+ K    +   +I++  SLQ+DF T++  T+ FS +NK+G+G
Sbjct  295   VIFVALLVLGLIALKRRQSYKALNLETNDDITSPHSLQFDFKTLEAATDKFSVNNKVGQG  354

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+G E+A+KRLS++SGQG +EFKNEV +VAKLQH+NLVRLLG+C + +E+
Sbjct  355   GFGEVYKGTLPNGTEVAVKRLSKNSGQGSQEFKNEVVLVAKLQHRNLVRLLGFCLEGDEQ  414

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFD  +Q +L+WS+RY II GIARG+LYLH+DSRL+IIHRDLK S
Sbjct  415   ILVYEFVPNKSLDYFLFDPTKQPLLDWSRRYHIIGGIARGILYLHQDSRLKIIHRDLKAS  474

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFGI+QT  NTS+I GT+GYM+PEY M G+FS+KSDV+SFG
Sbjct  475   NILLDDDMNPKIADFGMARIFGIEQTGANTSKIAGTFGYMAPEYVMHGQFSMKSDVYSFG  534

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGK N + +QT   A +L+++AW  WR G+P+E+LDP  A  +Y  +EV +C+
Sbjct  535   VLVLEIISGKMNSSFHQTDGSAGNLVTHAWRLWRKGSPLELLDPAFA-GNYQSDEVTRCI  593

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS  466
             HI LLCVQE  + RP M  ++LML+S ST     PR PAF+   S
Sbjct  594   HIALLCVQEKPETRPMMSTLILMLTS-STITLQVPRAPAFFLQSS  637



>ref|NP_190172.1| cysteine-rich receptor-like protein kinase 4 [Arabidopsis thaliana]
 sp|Q9LZU4.1|CRK4_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 4; Short=Cysteine-rich 
RLK4; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82810.1| protein kinase-like [Arabidopsis thaliana]
 gb|AEE78083.1| cysteine-rich receptor-like protein kinase 4 [Arabidopsis thaliana]
Length=676

 Score =   433 bits (1113),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 282/378 (75%), Gaps = 7/378 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+A  + LR + ++    +   T+ + +I+   SLQ+DF  I+  TN F   NK+G+G
Sbjct  302   LLFVA-FFSLRAKKTRTNYEREPLTEESDDITTAGSLQFDFKAIEAATNKFCETNKLGQG  360

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+ PSG ++A+KRLS++SGQGE+EF NEV VVAKLQH+NLVRLLG+C +R+E+
Sbjct  361   GFGEVYKGIFPSGVQVAVKRLSKTSGQGEREFANEVIVVAKLQHRNLVRLLGFCLERDER  420

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FDS  Q +L+W++RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  421   ILVYEFVPNKSLDYFIFDSTMQSLLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  480

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILL  +M+ KIADFGMA+IFG+DQT+ NT RIVGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  481   NILLGDDMNAKIADFGMARIFGMDQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFG  540

Query  780   VMLLEIISGKKNRNTYQTT-NRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             V++LEIISGKKN N YQ     A +L++Y W  W +G+P+E++DP   + +Y +NEV +C
Sbjct  541   VLVLEIISGKKNSNVYQMDGTSAGNLVTYTWRLWSNGSPLELVDPSF-RDNYRINEVSRC  599

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVP---MREISLE  433
             +HI LLCVQE+A++RPTM  +V ML++ S+   + P+ P F+   S       +  +S+ 
Sbjct  600   IHIALLCVQEEAEDRPTMSAIVQMLTT-SSIALAVPQRPGFFFRSSKHEQVGLVDRLSIN  658

Query  432   LSVTVSDEASTIGKLCPR  379
              S   S + ++I  + PR
Sbjct  659   TSALCSVDDASITNVTPR  676



>emb|CDX76348.1| BnaA08g10520D [Brassica napus]
Length=672

 Score =   432 bits (1112),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 215/374 (57%), Positives = 284/374 (76%), Gaps = 12/374 (3%)
 Frame = -1

Query  1479  YFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYK  1300
             Y L  R +  Q T+ +      +IS   S QYDF TI++ TN FS  NK+GEGG+G VYK
Sbjct  304   YVLCRRRNSYQRTQFEND---SDISTTNSSQYDFKTIEVATNNFSSSNKLGEGGFGEVYK  360

Query  1299  GMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFV  1120
             G L +G E+A+KRLS+ SGQG +EF+NE  +V+KLQH+NLVRLLG+C + EEKILIYEFV
Sbjct  361   GTLSTGTEVAVKRLSKMSGQGTREFRNEAVLVSKLQHRNLVRLLGFCLEGEEKILIYEFV  420

Query  1119  PNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVN  940
             PN SLDYFLFD E+Q  L+WS+RYKII GIARG+LYLH+DS+L IIHRDLKTSNILLD +
Sbjct  421   PNKSLDYFLFDPEKQGQLDWSQRYKIIGGIARGILYLHQDSQLTIIHRDLKTSNILLDAD  480

Query  939   MDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEII  760
             M+PKI+DFG++ IFGIDQTQGNT+RI GTY YMSPEYA+QG+FS+KSDV+SFGV++LEII
Sbjct  481   MNPKISDFGLSTIFGIDQTQGNTNRIAGTYAYMSPEYALQGQFSMKSDVYSFGVLVLEII  540

Query  759   SGKKNRNTYQT--TNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLL  586
             SGKKN N YQ   T+ A +L++ AW  WR+G+P+E+LDP + +++ + NEV +C+HI LL
Sbjct  541   SGKKNSNVYQMDETSTAGNLVNNAWRLWRNGSPLELLDPSIGRNNQS-NEVTRCIHIALL  599

Query  585   CVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLELSVTVS  415
             CVQ++ ++RP +  ++LML+S +T +   P+ P+F+   R    +V M E S     +VS
Sbjct  600   CVQDNPEDRPMLSTIILMLTS-NTISLPVPQLPSFFPRSRPEFEQVSMSESSQSTVKSVS  658

Query  414   DEA--STIGKLCPR  379
             D    +TI +L PR
Sbjct  659   DSICDTTITELEPR  672



>gb|KCW76230.1| hypothetical protein EUGRSUZ_D00611 [Eucalyptus grandis]
Length=682

 Score =   433 bits (1113),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 276/360 (77%), Gaps = 7/360 (2%)
 Frame = -1

Query  1446  NTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAI  1267
             N ++        I+  ESLQYD AT+Q  T+ FS  NK+GEGG+G V++G LP+GQ+IA+
Sbjct  326   NDEIVKAGCVNGITKAESLQYDLATVQAATDNFSHQNKLGEGGFGEVFQGRLPNGQKIAV  385

Query  1266  KRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFD  1087
             KRLS+SS QG  EFKNEV +V+KLQH+NLVRLLG+C   +EK+LIYEFVPN SLDYFLF+
Sbjct  386   KRLSKSSRQGIGEFKNEVVLVSKLQHRNLVRLLGFCLDGQEKLLIYEFVPNKSLDYFLFE  445

Query  1086  SERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMA  907
              +++  L+WS+RYKII GIARG+LYLHEDSRLRIIHRDLK SNILLD +M+PKI+DFGMA
Sbjct  446   PDKRGKLDWSRRYKIISGIARGMLYLHEDSRLRIIHRDLKPSNILLDNDMNPKISDFGMA  505

Query  906   KIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQT  727
             +IFG+DQT+ NT +IVGT+GY+SPEYAM+G+ S KSDV+SFGV++LEIISG KN  ++Q 
Sbjct  506   RIFGVDQTRANTKKIVGTFGYLSPEYAMRGQISAKSDVYSFGVLILEIISGMKNNCSFQ-  564

Query  726   TNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTME  547
              +  ++L SYAW+ WR GTP+E+LDP +   SY+++EV++C+HIGLL VQED   RPTM 
Sbjct  565   LDEGENLASYAWKHWRAGTPLEVLDPFIG-DSYSIDEVVRCLHIGLLGVQEDPAYRPTMA  623

Query  546   DVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMRE----ISLELSVTVSDEASTIGKLCPR  379
              +VLMLSS+S      PR PAF+   S +  ++E     S   S+++S    +I +L PR
Sbjct  624   SIVLMLSSHSV-KLPQPRRPAFFLRRSTERQLKEHESDQSASRSMSLSTNEMSITELYPR  682



>ref|XP_002867728.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43987.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   432 bits (1112),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 201/341 (59%), Positives = 264/341 (77%), Gaps = 2/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV  F   +  KK N      +   +IS   SLQ+ F  ++  TN FS  NK+G+G
Sbjct  302   LLFVAVFTFRLTKRVKKTNDTAVADEDGDDISTAGSLQFCFKVVEAATNKFSICNKLGQG  361

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+G ++A+KRLS++SGQGEKEFKNEV VVAKLQH+NLV+LLG+C +REEK
Sbjct  362   GFGQVYKGTLPNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEK  421

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFDS++Q  L+W+ RYKII GI+RG+LYLH+DSRL IIHRDLK  
Sbjct  422   ILVYEFVSNKSLDYFLFDSKKQSQLDWTTRYKIIGGISRGILYLHQDSRLTIIHRDLKAG  481

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  482   NILLDADMNPKIADFGMARIFEMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  541

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + YQ      +L++Y W  W + TP+E++D    +++Y  NE+I+C+
Sbjct  542   VLVLEIISGRKNSSLYQMDACLGNLVTYTWRLWTNETPLELVDSSF-RTNYQRNEIIRCI  600

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQED ++RPTM  +V ML++ S+ + + PR P F+
Sbjct  601   HIALLCVQEDTEDRPTMSMIVQMLTT-SSISLAAPRPPGFF  640



>ref|XP_010426013.1| PREDICTED: cysteine-rich receptor-like protein kinase 4 isoform 
X1 [Camelina sativa]
Length=662

 Score =   432 bits (1111),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/375 (55%), Positives = 277/375 (74%), Gaps = 4/375 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L +AV  F R + ++    +  +T     I+   SLQ+DF  I+  TN F   NK+G+G
Sbjct  291   ILSVAVFNF-RAKKTRTTYEREPSTQERATITIAGSLQFDFKEIEAATNKFCETNKLGQG  349

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+ PS   +A+KRLS++SGQGE+EF NEV VVAKLQH+NLVRLLG+C +R+E+
Sbjct  350   GFGEVYKGIFPSRVHVAVKRLSKTSGQGEREFANEVVVVAKLQHRNLVRLLGFCLERDER  409

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FD   Q+ L+W++RYKII GIARG+LYLH+DSRL IIHRDLK S
Sbjct  410   ILVYEFVPNKSLDYFIFDPTMQNQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAS  469

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKIADFGMA+IFG+DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  470   NILLDANMNPKIADFGMARIFGMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  529

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN N YQ      +L++Y W  W +G+ +E++DP      Y ++EV +C+
Sbjct  530   VLVLEIISGKKNSNLYQMDTGPGNLVTYTWRLWSNGSSLELVDPSF-HDKYRISEVSRCI  588

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLELSV  424
             HI LLCVQE+A++RPTM  VV ML++ S+N    P+ P  F+R+   +  + ++S+  S 
Sbjct  589   HIALLCVQEEAEDRPTMSAVVQMLTT-SSNALPVPQRPGFFFRSRLEQARLVDLSINTSA  647

Query  423   TVSDEASTIGKLCPR  379
               S +  T+  + PR
Sbjct  648   LCSVDDGTMTPVTPR  662



>ref|XP_010059683.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=703

 Score =   433 bits (1114),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 262/340 (77%), Gaps = 3/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LF+ ++  +     ++++  L  +    E+   ESLQ+  + I+  TN F+  NK+GEGG
Sbjct  326   LFVVIIVSVCCLIRRRRSNPLMVSSAKDEVKTAESLQFKISEIRAATNSFAEGNKLGEGG  385

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VY+G LP+GQEIA+KRLS+SS QG +EFKNE+ +VAKLQH+NLVRLLG+C +  EK+
Sbjct  386   FGKVYRGRLPNGQEIAVKRLSQSSRQGLQEFKNEIVLVAKLQHRNLVRLLGFCFEEGEKL  445

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYE +PN SLDYF+FD E+   L+W +RY II GIARG+LYLHEDSRLRIIHRDLK SN
Sbjct  446   LIYELMPNKSLDYFMFDPEKSKQLDWPRRYNIISGIARGMLYLHEDSRLRIIHRDLKASN  505

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD NM+PKI+DFGMA+IFG+DQT  +T RIVGTYGYMSPEYAM G+FS KSDV+SFGV
Sbjct  506   ILLDNNMNPKISDFGMARIFGVDQTNASTRRIVGTYGYMSPEYAMHGQFSQKSDVYSFGV  565

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             +LLEII GK+N + Y  ++  + L SYAW+ WRD  P EILDPVL K SY+ ++V++C+H
Sbjct  566   LLLEIICGKRN-DYYCQSDGGEALASYAWKHWRDNVPWEILDPVLGK-SYSRSQVLRCIH  623

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IG LCVQED  +RPTM  +VLMLSS  T +   PREPAF+
Sbjct  624   IGFLCVQEDPADRPTMASIVLMLSS-QTLSLPMPREPAFF  662



>emb|CDX94167.1| BnaC07g38010D [Brassica napus]
Length=653

 Score =   432 bits (1110),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 211/350 (60%), Positives = 270/350 (77%), Gaps = 6/350 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFIA   FL  R  K   T   +     +I+  ESLQ D+ TIQ  TN F+  NKIG+GG
Sbjct  283   LFIACYCFLAKRAKKTFGTA--SAFDGDDITTAESLQLDYRTIQTATNDFAESNKIGQGG  340

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L  G E+A+KRLS+SSGQG+ EFKNEV +VAKL H+NLVRLLG+C + EE++
Sbjct  341   FGEVYKGTLSDGTEVAVKRLSKSSGQGDAEFKNEVILVAKLLHRNLVRLLGFCLEGEERV  400

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPN SLDYF+FD  +Q  L+WS+RYKII GIARG+LYLH+DSRL IIHRDLK SN
Sbjct  401   LVYEYVPNESLDYFIFDPVKQCQLDWSRRYKIISGIARGILYLHQDSRLTIIHRDLKASN  460

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD +M+PKIADFGMA+IFG++QT+ NTSRIVGTYGYMSPEYAM G++S+KSDV+SFGV
Sbjct  461   VLLDADMNPKIADFGMARIFGMNQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGV  520

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISGKKN + YQ T+ A DL+SYAW  W +GTP++++DP +   ++  NEV +C+H
Sbjct  521   LVLEIISGKKNSSFYQ-TDGAHDLVSYAWRLWSNGTPLDLVDPSIVD-NFQRNEVFRCIH  578

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPM  451
             IGLLCVQED  ERP +  +VLML+S  T     PR+P  F+++  GK P+
Sbjct  579   IGLLCVQEDPVERPPLSTIVLMLTSI-TMTLPIPRQPGLFFQSILGKDPL  627



>ref|XP_009137317.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 [Brassica 
rapa]
Length=657

 Score =   432 bits (1110),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 208/374 (56%), Positives = 274/374 (73%), Gaps = 4/374 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L  +AV  +   +  KK +      D   +I+   SLQ+DF  I+  T+ FS  NK+GEG
Sbjct  288   LFLVAVSSYQVTKKVKKTDNTTAADDEGDDITTAGSLQFDFKVIEAATDKFSICNKLGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+G  +A+KRLS++SGQGEKEFKNEV +VAKLQH+NLV+LLGYC +REEK
Sbjct  348   GFGKVYKGTLPNGLRVAVKRLSKTSGQGEKEFKNEVVLVAKLQHRNLVKLLGYCFEREEK  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS  Q  L+WS+RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  408   ILVYEFVPNKSLDYFLFDSRMQSQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  468   NILLDADMNPKVADFGMARIFEMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + ++      +L++Y W  W +G P+E++D    + SY  NE+I+C+
Sbjct  528   VLVLEIISGRKNSSLHEMDGSLGNLVTYTWRVWNNGLPLELVDSSF-RESYQSNEIIRCI  586

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HI LLCVQED ++RPTM  +V ML++ S+ + + PR P F+     K      S++ S  
Sbjct  587   HIALLCVQEDTEDRPTMLAIVQMLTT-SSISLAVPRPPGFFFR--SKKDQACSSVDKSSL  643

Query  420   VSDEASTIGKLCPR  379
              S + ++I  L PR
Sbjct  644   FSIDQASITSLAPR  657



>ref|XP_010529574.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Tarenaya hassleriana]
Length=672

 Score =   432 bits (1111),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/356 (57%), Positives = 273/356 (77%), Gaps = 10/356 (3%)
 Frame = -1

Query  1425  DVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSS  1246
             D   +I+   SLQ+DF TI+  T+ FS  N++G+GG+G V+KG LP+G ++A+KRLS++S
Sbjct  320   DGGDDITTSGSLQFDFRTIEAATDHFSKSNRLGQGGFGEVFKGTLPNGTQVAVKRLSKTS  379

Query  1245  GQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVL  1066
              QGE EFKNEV +VAKLQH+NLVRLLG+C++ EEKIL++EFVPN SLDYFLFD+ RQ  L
Sbjct  380   NQGEDEFKNEVVLVAKLQHRNLVRLLGFCTEGEEKILVFEFVPNKSLDYFLFDTTRQSQL  439

Query  1065  EWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQ  886
             +W  RYKII GI RG+LYLH+DSRL IIHRDLK SNIL+D +M+PKIADFGMA+IFG+DQ
Sbjct  440   DWRTRYKIIGGITRGILYLHQDSRLTIIHRDLKASNILIDADMNPKIADFGMARIFGMDQ  499

Query  885   TQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDL  706
             T+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFGV++LEIISGKKN N YQ  +   +L
Sbjct  500   TEANTKRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKKNSNFYQMDDTVDNL  559

Query  705   LSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLS  526
             ++YAW QW  G+P+E++DP++ + +Y   E I+C+H+GLLCVQED  +RPT+  +  ML+
Sbjct  560   VTYAWRQWSSGSPLELVDPIIGE-NYPKEEAIRCIHLGLLCVQEDPAKRPTLSTIHQMLT  618

Query  525   SYSTNNWSTPREPAFYRNGSGKVPMR-------EISLELSVTVSDEASTIGKLCPR  379
             ++S      P+EP F+  GS +VP R       + S   S+  S + ++I +L PR
Sbjct  619   NFSI-CLPMPQEPGFFF-GSRQVPDRAANGPGTDKSANNSILCSIDGASITELGPR  672



>ref|XP_010529575.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Tarenaya hassleriana]
Length=670

 Score =   432 bits (1111),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/356 (57%), Positives = 273/356 (77%), Gaps = 10/356 (3%)
 Frame = -1

Query  1425  DVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSS  1246
             D   +I+   SLQ+DF TI+  T+ FS  N++G+GG+G V+KG LP+G ++A+KRLS++S
Sbjct  318   DGGDDITTSGSLQFDFRTIEAATDHFSKSNRLGQGGFGEVFKGTLPNGTQVAVKRLSKTS  377

Query  1245  GQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVL  1066
              QGE EFKNEV +VAKLQH+NLVRLLG+C++ EEKIL++EFVPN SLDYFLFD+ RQ  L
Sbjct  378   NQGEDEFKNEVVLVAKLQHRNLVRLLGFCTEGEEKILVFEFVPNKSLDYFLFDTTRQSQL  437

Query  1065  EWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQ  886
             +W  RYKII GI RG+LYLH+DSRL IIHRDLK SNIL+D +M+PKIADFGMA+IFG+DQ
Sbjct  438   DWRTRYKIIGGITRGILYLHQDSRLTIIHRDLKASNILIDADMNPKIADFGMARIFGMDQ  497

Query  885   TQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDL  706
             T+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFGV++LEIISGKKN N YQ  +   +L
Sbjct  498   TEANTKRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKKNSNFYQMDDTVDNL  557

Query  705   LSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLS  526
             ++YAW QW  G+P+E++DP++ + +Y   E I+C+H+GLLCVQED  +RPT+  +  ML+
Sbjct  558   VTYAWRQWSSGSPLELVDPIIGE-NYPKEEAIRCIHLGLLCVQEDPAKRPTLSTIHQMLT  616

Query  525   SYSTNNWSTPREPAFYRNGSGKVPMR-------EISLELSVTVSDEASTIGKLCPR  379
             ++S      P+EP F+  GS +VP R       + S   S+  S + ++I +L PR
Sbjct  617   NFSI-CLPMPQEPGFFF-GSRQVPDRAANGPGTDKSANNSILCSIDGASITELGPR  670



>ref|XP_003637975.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 ref|XP_003638034.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
Length=676

 Score =   432 bits (1112),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/349 (61%), Positives = 268/349 (77%), Gaps = 15/349 (4%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKK---QNTKLQTTDVT---------GEISNEESLQYDFATIQLITN  1354
             L I   YFLR R  KK    NT +Q               ++++ + LQ+DF+TI+  TN
Sbjct  290   LLIVGFYFLRKRAIKKYEYSNTFVQDPSSIYCTLYAVRREDLTDIDCLQFDFSTIEAATN  349

Query  1353  VFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVR  1174
              FS +NKIG+GG+G VYKG+LP+G EIA+KRLS +S QG  EF+NE  +VAKLQH+NLVR
Sbjct  350   CFSDENKIGQGGFGVVYKGVLPNGLEIAVKRLSITSLQGAIEFRNEASLVAKLQHRNLVR  409

Query  1173  LLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSR  994
             + G+C +  EK+L+YE++PN SLD+FLFDS +Q  L+WS R+KII GIARG+LYLHEDS+
Sbjct  410   MFGFCLEGREKMLVYEYIPNKSLDHFLFDSAKQRELDWSSRHKIIVGIARGILYLHEDSQ  469

Query  993   LRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGE  814
             LRIIHRDLK SN+LLD NM+PKI+DFGMAKIF  DQTQ NT RIVGTYGYMSPEYAM+G+
Sbjct  470   LRIIHRDLKASNVLLDENMNPKISDFGMAKIFQPDQTQVNTGRIVGTYGYMSPEYAMRGQ  529

Query  813   FSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKS  634
             FSVKSDVFSFGV++LEI+SGKKN +  Q  N   DLLSYAW++W + TP+E+LDP L + 
Sbjct  530   FSVKSDVFSFGVLVLEIVSGKKNTDLNQ-RNHTDDLLSYAWKKWSEQTPLELLDPTL-RD  587

Query  633   SYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREP  487
             SY+ NEV++C+HIGLLCVQE   +RP+ME + LML+SYS    S PR+P
Sbjct  588   SYSRNEVMRCIHIGLLCVQESPYDRPSMETIALMLNSYSV-TLSLPRQP  635



>emb|CDP04752.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   432 bits (1112),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 274/359 (76%), Gaps = 10/359 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++ + ++ F  +R SKK +  +       EI   ESLQY+ + IQ  TN F+  N++GEG
Sbjct  307   IIILFIMGFCIVRRSKKTHDAISERTGATEILTIESLQYNLSEIQAATNNFAIGNRVGEG  366

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +GQEIA+KRLSRSS QG +EFKNE+ +VA+LQH+NLVRLLG+C + EE+
Sbjct  367   GFGPVYKGTLSNGQEIAVKRLSRSSAQGTEEFKNEIALVARLQHRNLVRLLGFCLEGEER  426

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEF+ N SLDYF+FDS++Q +L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  427   ILIYEFITNKSLDYFVFDSKKQQLLDWLRRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  486

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGT------YGYMSPEYAMQGEFSVKS  799
             N+LLD NM+PKIADFGMA++F +DQ++GNTS+I GT      +GYM+PEYA+ G FSVKS
Sbjct  487   NVLLDGNMNPKIADFGMARLFEVDQSEGNTSKIAGTLQVLAPFGYMAPEYALHGLFSVKS  546

Query  798   DVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVN  619
             DVFSFGV++LEI+SGKKN   YQ T+   DLLSYAW QWRDGTP+ ++DP +   SY  N
Sbjct  547   DVFSFGVLVLEIVSGKKNNQFYQ-THGGDDLLSYAWRQWRDGTPLALMDPKMG-DSYERN  604

Query  618   EVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGSGKVPMRE  445
             EVI+ +H+ LLCVQ++ ++RPTM  VVLML+S S      P  PA++ R+ +  +P+ +
Sbjct  605   EVIKSIHVALLCVQDEIEQRPTMASVVLMLNSNSV-TLPVPNPPAYFGRSRTQNLPIDQ  662



>ref|XP_010059522.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=645

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 205/349 (59%), Positives = 266/349 (76%), Gaps = 3/349 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++ + ++  L  R  KK +  ++      E++  ESLQ+D ATIQ  TN FS + K+GEG
Sbjct  288   IVLVFLICCLLQRKGKKTHEVVKGKAGANELTTVESLQFDLATIQGATNDFSLEKKLGEG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP GQ+IA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+C + +E+
Sbjct  348   GFGEVFQGRLPDGQQIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFCLEGDER  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLDYFLFD ++   L WS RYKI+ GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  408   LLAYEFVPNKSLDYFLFDPQKSSQLNWSLRYKIVSGIARGMLYLHEDSRLRIIHRDLKCS  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFG A+IFG+DQTQ +T++IVGT+GYMSPEYAM GEFSVKSDV+SFG
Sbjct  468   NILLDSEMNPKISDFGTARIFGVDQTQASTNKIVGTFGYMSPEYAMHGEFSVKSDVYSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             ++L+EII GKKN N +   +  + L SY W +WRDG P+E+LDP +   SY+ +EV++C+
Sbjct  528   ILLIEIICGKKN-NFHHQLDGGEYLASYVWNKWRDGMPLEVLDPAIV-DSYSRDEVLRCL  585

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVP  454
             HIGLLC+QED   RPTM  V+LMLS+ +  N   PR PA +     +VP
Sbjct  586   HIGLLCIQEDPAIRPTMATVILMLSN-NYFNTPLPRHPALFVRKPRRVP  633



>ref|XP_010089690.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis]
 gb|EXB38213.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis]
Length=367

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 196/312 (63%), Positives = 252/312 (81%), Gaps = 3/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             EI + ESLQY+F TI++ T+ FS  NK+G+GG+GSVY+G L  G+EIA+KRLSR SGQG+
Sbjct  16    EIESAESLQYNFDTIKVATDNFSEANKLGQGGFGSVYRGRLSDGEEIAVKRLSRGSGQGD  75

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV +VAKLQH+NLVRLLG+C +  E++L+YEFVPN SLD+F+FD  ++  L W +
Sbjct  76    LEFKNEVLLVAKLQHRNLVRLLGFCLEGNERLLVYEFVPNASLDHFIFDPSKRAHLNWER  135

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII G++RGLLYLHEDSRLRIIHRDLK SNILLD  M+PKI+DFGMA++F +DQTQGN
Sbjct  136   RYKIIGGVSRGLLYLHEDSRLRIIHRDLKASNILLDEEMNPKISDFGMARLFLVDQTQGN  195

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             TSRIVGTYGYM+PEY M G+FSVKSD+FSFGV+LLEI+SG+KN N ++     +DLLSYA
Sbjct  196   TSRIVGTYGYMAPEYVMHGQFSVKSDIFSFGVLLLEIVSGQKN-NCFRHGEHVEDLLSYA  254

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W  WR+GT + + DP++ + S + +E+ +C+HI LLCVQ +  +RPTM  VVLML+S S 
Sbjct  255   WRNWREGTALNVADPLMRQIS-SGSEITRCIHIALLCVQVNVADRPTMNTVVLMLNSNSL  313

Query  513   NNWSTPREPAFY  478
              +   P EPAF+
Sbjct  314   -SLPVPSEPAFF  324



>ref|XP_009124034.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Brassica rapa]
Length=674

 Score =   432 bits (1110),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/376 (56%), Positives = 283/376 (75%), Gaps = 6/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL IA   FL  R  +   T+L T +   +I+  +SLQ D+ TIQ  TN +S DNKIG G
Sbjct  303   LLLIAGYCFLAKRAKRTNETEL-TFNNADDITTIDSLQLDYRTIQAATNDYSEDNKIGRG  361

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+  +G E+A+KRLS+SS QG+ EFKNEV +VAKLQH+NLVRLLG+  +REE+
Sbjct  362   GFGEVYKGIFSNGTEVAVKRLSKSSEQGDTEFKNEVVLVAKLQHRNLVRLLGFSLEREER  421

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SL+YFLFD  ++  L+W++RY II GIARG+LYLH+DSRL IIHRDLK S
Sbjct  422   ILVYEYVPNKSLNYFLFDPVKRGQLDWTRRYNIIGGIARGVLYLHQDSRLTIIHRDLKAS  481

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD NM+PKIADFGMA+IFG+DQTQ NTSRIVGTYGYMSPEYAM+G+FS+KSDV+SFG
Sbjct  482   NVLLDENMNPKIADFGMARIFGLDQTQENTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFG  541

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN  ++  TN + DL++YAW  W +GT ++++DP++  +    +EV++C+
Sbjct  542   VLVLEIISGRKN-TSFDETNNSHDLVTYAWRLWNNGTAVDLVDPIIVDNC-NKSEVVRCI  599

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPM--REISLELS  427
             HIGLLCVQED  +RP +  +++M +S +T     PR P F+ +   K P+   + +   S
Sbjct  600   HIGLLCVQEDPIDRPALSTILVMFTS-NTMTLPVPRRPGFFDHTRPKDPLDSDQSTASKS  658

Query  426   VTVSDEASTIGKLCPR  379
              TVS + ++I  L PR
Sbjct  659   FTVSTDDASITSLYPR  674



>ref|XP_009367024.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Pyrus x bretschneideri]
Length=709

 Score =   432 bits (1112),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/347 (61%), Positives = 273/347 (79%), Gaps = 11/347 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNE----ESLQYDFATIQLITNVFSPDNK  1333
             +L + V   LR+R +KK   KLQ+  + GE ++E    ESLQ++F TI++ T+ FS  NK
Sbjct  303   VLLMLVGICLRVRKAKK---KLQSNLIPGEDADEIGSAESLQFNFDTIRVATDGFSEANK  359

Query  1332  IGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSK  1153
             +G+GG+GSVYKG L +G+EIA+KRLS +SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +
Sbjct  360   LGQGGFGSVYKGGLLNGEEIAVKRLSVNSGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLE  419

Query  1152  REEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRD  973
               E++LIYEFVPN SLD+ +FD  ++  L+W +RYKII GI RGL+YLHEDSRLRIIHRD
Sbjct  420   GVERLLIYEFVPNASLDHIIFDPIKRAQLDWDRRYKIIVGITRGLIYLHEDSRLRIIHRD  479

Query  972   LKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDV  793
             LK SNIL+D  M PKI+DFGMAK+FG+DQTQGNTSRIVGTYGYM+PEYAM G FSVKSDV
Sbjct  480   LKASNILIDEEMSPKISDFGMAKLFGVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKSDV  539

Query  792   FSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEV  613
             +SFGV++LEI+SG+KN N ++     +DLLSYAW+ WR+GT   ++DP L   S   NE+
Sbjct  540   YSFGVLVLEIVSGQKN-NFFRHGENVEDLLSYAWKCWREGTASNLIDPTLTNGSR--NEI  596

Query  612   IQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRN  472
             ++C+HIGLLCVQE+  +RPTM  +VLML+SYS      P +PAF+R+
Sbjct  597   MRCIHIGLLCVQENIVDRPTMNAIVLMLNSYSV-TLPIPSQPAFFRD  642



>gb|KHN01543.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=549

 Score =   427 bits (1099),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/343 (61%), Positives = 258/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVT-GEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
              I    +LR R S+KQN   +  D    EI+  ESLQ+DF TI++ TN F+  NKIG+GG
Sbjct  169   LILFCIYLRARKSRKQNESEKREDNNEDEITFAESLQFDFDTIRVATNEFADCNKIGQGG  228

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G+VY+G L +GQEIA+KRLSR SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E++
Sbjct  229   FGAVYRGQLSNGQEIAVKRLSRDSGQGDMEFKNEVLLVAKLQHRNLVRLLGFCLEGTERL  288

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFVPN SLDYF+FD  ++  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK S+
Sbjct  289   LVYEFVPNKSLDYFIFDPIKKAQLDWQRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASS  348

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD  M PKI+DFGMA++  +DQTQ NTSRIVGTYGYM+PEYA+ G+FS KSDVFSFGV
Sbjct  349   ILLDEEMHPKISDFGMARLVHMDQTQENTSRIVGTYGYMAPEYAIYGQFSAKSDVFSFGV  408

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISG KN    +  N  +DLL +AW  WRDGT   I+DP L       NE+++C+H
Sbjct  409   LVLEIISGHKNSGVRRGEN-VEDLLCFAWRNWRDGTTTNIVDPTLTDG--LRNEIMRCIH  465

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             IGLLCVQE+   RPTM  V LML+SYS      P EPAF  +G
Sbjct  466   IGLLCVQENVAARPTMASVALMLNSYSL-TLPVPSEPAFVGDG  507



>ref|XP_010059516.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=625

 Score =   430 bits (1105),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 275/370 (74%), Gaps = 7/370 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L + +   LR R  KK +  ++  D   E +  ESLQ+D AT+Q  TN FS +NK+GEG
Sbjct  249   VLVVYICCLLR-RKRKKTHEVVKGKDGANEFTTVESLQFDLATMQAATNDFSSENKLGEG  307

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP GQ+IA+KRLSRSS QG++EFKNEV +VAKLQH+NLVRLLG+  + EEK
Sbjct  308   GFGEVFQGRLPDGQQIAVKRLSRSSRQGDEEFKNEVLLVAKLQHRNLVRLLGFYLEGEEK  367

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLDYFLFD ++   L WS RYKI+ GIARG+LYLHEDS LRIIHRDLK S
Sbjct  368   LLAYEFVPNKSLDYFLFDPQKSSQLNWSVRYKIVSGIARGMLYLHEDSHLRIIHRDLKCS  427

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQ   +T++IVGT+GYMSPEYAM GEFSVKSDV+SFG
Sbjct  428   NILLDNEMNPKISDFGMARIFGVDQIHASTNKIVGTFGYMSPEYAMYGEFSVKSDVYSFG  487

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+L+EII GKKN N Y   +  + L SY W +W++GTP+++LDPV+   SY+ +EV+ C+
Sbjct  488   VLLIEIICGKKN-NFYHQLDGGEYLASYVWNKWKNGTPLKVLDPVIL-DSYSRDEVLCCL  545

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLC+QED   RPTM  +V ML+  +  N  +P+ PAF    R+G    PM+E+    
Sbjct  546   HIGLLCIQEDPVIRPTMATIVFMLNR-NYFNPPSPQHPAFCIQSRSGGWSTPMKELGSNQ  604

Query  429   SVTVSDEAST  400
             S + +  +ST
Sbjct  605   STSKTVPSST  614



>ref|XP_010267893.1| PREDICTED: uncharacterized protein LOC104604997 [Nelumbo nucifera]
Length=1361

 Score =   449 bits (1155),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 224/366 (61%), Positives = 279/366 (76%), Gaps = 7/366 (2%)
 Frame = -1

Query  1491  IAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYG  1312
             IAVL    +R   +   K +T +   +I+N ESLQ++F+ +   TN FS DNKIG+GG+G
Sbjct  268   IAVLLLSVLRWCWRSRKKEETINDGNDITNVESLQFNFSIVIAATNNFSDDNKIGQGGFG  327

Query  1311  SVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILI  1132
              VYKG+L +GQEIA+KRLSRSS QG +EFKNE  +VAKLQH+NLVRLLG+C + EEKILI
Sbjct  328   CVYKGILSNGQEIAVKRLSRSSRQGAEEFKNEAVLVAKLQHRNLVRLLGFCLEGEEKILI  387

Query  1131  YEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNIL  952
             YEFVPN SLDY LFD +    L+W  RYKII GIARGLLYLHEDS+LRIIHRDLK SNIL
Sbjct  388   YEFVPNKSLDYLLFDPDGSECLDWPTRYKIIVGIARGLLYLHEDSQLRIIHRDLKASNIL  447

Query  951   LDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVML  772
             LD NMDPKI+DFGMA+IF +DQ Q NT+R+VGT+GYMSPEY M+G+FSVKSDV+SFGV+L
Sbjct  448   LDGNMDPKISDFGMARIFCVDQNQANTNRVVGTFGYMSPEYVMRGQFSVKSDVYSFGVLL  507

Query  771   LEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIG  592
             LEII+GKKN N++     A+ LLS+AW  W++G  +E+LDP+L +  Y+ +EV++C+HIG
Sbjct  508   LEIITGKKN-NSFYRAESAEYLLSFAWRNWKEGKALELLDPIL-REFYSRDEVMRCIHIG  565

Query  591   LLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF--YRNGSGKVPMREISLELSVTV  418
             LLCVQ++   RPTME VVLMLSSYS      P+ PAF  YR    K P REI  E   T 
Sbjct  566   LLCVQDNVARRPTMETVVLMLSSYSV-TLEVPQPPAFLGYRKMEPKKPTREI--EEQSTE  622

Query  417   SDEAST  400
             SD +++
Sbjct  623   SDRSTS  628


 Score =   442 bits (1137),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 271/340 (80%), Gaps = 6/340 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L +++L +  +  +KK+   +  TD   +I+N ESLQ++ +T+   TN FS DNKIG+G
Sbjct  988   VLLLSILSWCWL--TKKKEKLISGTD-ENDITNAESLQFNLSTVIAATNNFSDDNKIGQG  1044

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +GQEIA+KRLSRSSGQG KEFKNEV +VAKL+H+NLVRLLG+C + EEK
Sbjct  1045  GFGCVYKGKLSNGQEIAVKRLSRSSGQGAKEFKNEVVLVAKLEHRNLVRLLGFCLEGEEK  1104

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD +    L+W  RYKII GIARGLLYLHEDSRL+IIHRDLK S
Sbjct  1105  ILIYEFVPNKSLDYFLFDPDEGARLDWPTRYKIIGGIARGLLYLHEDSRLKIIHRDLKAS  1164

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFGMA+IFG+DQTQ NTSR+VGT+GYM PEY + G FSVKSDVFSFG
Sbjct  1165  NILLDGNMNPKISDFGMARIFGVDQTQANTSRVVGTFGYMPPEYVIHGLFSVKSDVFSFG  1224

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEII+GKKN +++  +  ++DLLS+AW  W +G  +++LDP+L+K  Y+  EV +C+
Sbjct  1225  VLLLEIITGKKN-SSFNQSEFSEDLLSFAWRNWNEGNALDLLDPILSK-FYSREEVRRCI  1282

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF  481
             HIGLLCVQ+D  +RPTM  VVLML+SYS      P++PAF
Sbjct  1283  HIGLLCVQDDVAQRPTMATVVLMLNSYSV-TLEPPQQPAF  1321



>ref|XP_008370321.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 [Malus 
domestica]
Length=678

 Score =   431 bits (1109),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 216/341 (63%), Positives = 271/341 (79%), Gaps = 4/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL +    F R R  KK N  +Q  +V  +I+  ESLQ++F TI+  TN FS  NK+G+G
Sbjct  302   LLSLVGCLFFRRRAMKKYNV-IQEQNVGKKINAVESLQFNFGTIEAATNKFSVHNKLGQG  360

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP GQ++A+KRLSR SGQG +EFKNEV ++AKLQH+NLVR+LG+CS+  EK
Sbjct  361   GFGEVYKGTLPDGQQVAMKRLSRGSGQGREEFKNEVVLIAKLQHRNLVRILGFCSEGAEK  420

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFV N SLD+FL+DSE Q  L+W  RYKII GIARG+LYLH DSRL+IIHRDLK S
Sbjct  421   ILIYEFVQNKSLDHFLYDSENQVNLDWPSRYKIINGIARGILYLHHDSRLKIIHRDLKAS  480

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD  M+PKIADFGMA+IF +DQTQGNT RIVGTYGYM+PEYAM G FSVKSDV+SFG
Sbjct  481   NVLLDGEMNPKIADFGMARIFRVDQTQGNTRRIVGTYGYMAPEYAMHGLFSVKSDVYSFG  540

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKKN N Y + N  + L+S+ W  WRDGTP+E+LD V  + SY+ +EVI+C+
Sbjct  541   VLILEIVTGKKNTNFYNSDN-GEYLVSHVWRHWRDGTPLELLD-VNLRDSYSRSEVIRCI  598

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HIGLLCVQED D+RP M+ ++LMLSSYS +  S P++PAF+
Sbjct  599   HIGLLCVQEDPDKRPKMQKILLMLSSYSLSMPS-PQKPAFF  638



>ref|XP_010451243.1| PREDICTED: cysteine-rich receptor-like protein kinase 8 [Camelina 
sativa]
Length=400

 Score =   422 bits (1084),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 276/377 (73%), Gaps = 8/377 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLFIA   FL  R  K   T   +     +I+  +SLQ D+ TIQ+ TN FS  NKIG G
Sbjct  29    LLFIAGYCFLAKRAKKSYETA--SVFDGDDITTADSLQLDYRTIQIATNGFSERNKIGRG  86

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG   +G E+A+KRLS++SGQGE EFKNEV VVAKLQH+NLVRL G+C + EE+
Sbjct  87    GFGEVYKGTFSNGTEVAVKRLSKTSGQGEAEFKNEVVVVAKLQHRNLVRLQGFCLQNEER  146

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPN SLDY +FD  ++  L+W++RY II G ARG+LYLH+DSRL +IHRDLK S
Sbjct  147   ILVYEYVPNQSLDYIIFDPTKKRQLDWTQRYNIIGGTARGILYLHQDSRLTVIHRDLKAS  206

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMAKIFG+DQ+  NTS+IVGTYGYMSPEYAM G+ S+KSDV+SFG
Sbjct  207   NILLDADMNPKIADFGMAKIFGLDQSHENTSKIVGTYGYMSPEYAMCGQLSMKSDVYSFG  266

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN +++  TN AQDL+++ W  W +GT  +++DP++     T +EV++C+
Sbjct  267   VLVLEIISGRKN-SSFVKTNGAQDLVTHTWRLWSNGTAFDLVDPIILDKCQT-SEVVRCI  324

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLCVQED  ERPT+  + +ML+S +T   S PR+P F+   R     +   + +   
Sbjct  325   HIGLLCVQEDPIERPTLSTIFVMLTS-NTMTLSVPRQPGFFIQSRPRKDPLDSDQTTSTR  383

Query  429   SVTVSDEASTIGKLCPR  379
             SV  SD+ ++I  L PR
Sbjct  384   SVPGSDDDTSISDLYPR  400



>ref|XP_010433932.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 [Camelina 
sativa]
Length=656

 Score =   431 bits (1107),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 202/341 (59%), Positives = 263/341 (77%), Gaps = 3/341 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LFIA  Y  R + +KK        D   +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  288   MLFIAC-YCFRAKRAKKTYETAAAHDDGDDITTAGSLQFDFKVIEAATDKFSESNKLGQG  346

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG  P+G ++A+KRLS++SGQGEKEFKNEV VVAKLQHKNLVRLLG+C +REEK
Sbjct  347   GFGEVYKGTFPNGLQVAVKRLSKTSGQGEKEFKNEVIVVAKLQHKNLVRLLGFCLEREEK  406

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFDS  ++ L+W +RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  407   ILVYEFVPNKSLDYFLFDSTMKNQLDWKRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  466

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  467   NILLDDDMNPKVADFGMARIFKMDQTEANTRRVVGTYGYMSPEYAMYGKFSMKSDVYSFG  526

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             +++LEIISGKKN  +YQ  +   +L++Y W  W +  P+E++DP   + SY +NE+ +C+
Sbjct  527   ILVLEIISGKKNIGSYQMDSSEGNLVTYTWRVWNNELPMEVVDPSF-QDSYQINEITRCI  585

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             HI LLCVQE+A++RPTM  VV ML++ S+   + PR P  +
Sbjct  586   HIALLCVQEEAEDRPTMSTVVQMLTT-SSIALAAPRPPGCF  625



>gb|KDP20807.1| hypothetical protein JCGZ_21278 [Jatropha curcas]
Length=859

 Score =   437 bits (1123),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 214/346 (62%), Positives = 267/346 (77%), Gaps = 5/346 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F  V  F R +  KK+++++       + SN ESLQ+  +T++  TN FSPDNK+GEG
Sbjct  450   VVFSIVFCFFRRKRLKKRSSRIDELLDRSKFSNIESLQFSLSTVKAATNNFSPDNKLGEG  509

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG LP+GQEIA KRLS+ SGQG +EFKNE+E V KLQH+NLVRLLG C + EEK
Sbjct  510   GFGAVYKGTLPNGQEIAAKRLSKCSGQGAEEFKNEIESVTKLQHRNLVRLLGLCFEGEEK  569

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDY LFD+ ++  L+WS+RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  570   ILVYEFVPNRSLDYILFDAGKKDQLDWSRRYKIIVGIARGLLYLHEDSRLRIIHRDLKAS  629

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD +M+P+I+DFG A+IFG+DQ +G+T RIVGTYGYMSPEY   G FSVKSDVFSFG
Sbjct  630   NVLLDGDMNPRISDFGTARIFGVDQIEGSTKRIVGTYGYMSPEYVTFGNFSVKSDVFSFG  689

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIIS K+N ++     R   LL  AW QW  GTP+E++DP L K S +VNEVI+ V
Sbjct  690   VLVLEIISSKRNSSSKIECGRG--LLDTAWRQWSQGTPVELMDPAL-KESCSVNEVIRGV  746

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSG  463
             HIGLLCVQED ++RPTM  VV ML+S  T +   P++PAF  N SG
Sbjct  747   HIGLLCVQEDMEDRPTMARVVAMLTS-DTTSLPMPQQPAF-TNSSG  790



>ref|XP_003555319.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
[Glycine max]
Length=658

 Score =   431 bits (1107),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 279/375 (74%), Gaps = 6/375 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I +  +LR R ++K N  ++  ++  EI   ESLQ++F TIQ+ T  FS  NK+G+G
Sbjct  289   VLLICLCLYLRRRKARK-NLVVKEDEIEDEIKIAESLQFNFNTIQVATEDFSDSNKLGQG  347

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VY+G L +GQ IA+KRLSR SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  348   GFGAVYRGRLSNGQMIAVKRLSRDSGQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGNER  407

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YE+VPN SLDYF+FD   +  L+W  RYKIIRGI RGLLYLHEDSRLR+IHRDLK S
Sbjct  408   LLVYEYVPNKSLDYFIFDPNMKAQLDWESRYKIIRGITRGLLYLHEDSRLRVIHRDLKAS  467

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKIADFGMA++F +DQT  NT+RIVGT GYM+PEYAM G+FSVKSDVFSFG
Sbjct  468   NILLDEEMHPKIADFGMARLFLVDQTHANTTRIVGTCGYMAPEYAMHGQFSVKSDVFSFG  527

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG+KN   +   N  +DLLS+AW  W++ T I I+DP L  +S   NE+++C+
Sbjct  528   VLVLEILSGQKNSGIHHGEN-VEDLLSFAWRSWKEQTAINIVDPSLNNNSR--NEMMRCI  584

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGK-VPMREISLELSV  424
             HIGLLCVQE+  +RPTM  ++LML+SYS  +   P +PAFY+N   + +P    S+  S 
Sbjct  585   HIGLLCVQENLADRPTMATIMLMLNSYSL-SLPIPTKPAFYKNSRNRSLPGSSESMIKSA  643

Query  423   TVSDEASTIGKLCPR  379
               S+  ++I +L  R
Sbjct  644   QESENEASITELYAR  658



>ref|XP_010052442.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=363

 Score =   420 bits (1079),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 247/312 (79%), Gaps = 2/312 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             EIS   SLQ+D + I+  T  FS  NK+GEGG+G VY G LP G+ IA KRLS+SS QG 
Sbjct  10    EISELHSLQFDVSAIEAATGYFSDQNKLGEGGFGPVYWGTLPCGRNIAAKRLSQSSKQGT  69

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEVE+VAKLQH+NLVRLLG+  +REE IL+YE VPNGSLD  LFD ++   L WS 
Sbjct  70    QEFKNEVELVAKLQHRNLVRLLGFAMEREETILVYEHVPNGSLDQLLFDPQQSIQLNWSA  129

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             R+KI+ G+ARGLLYLHEDSRLRIIHRDLK SNILLD NM+PKI+DFGMA+IFG +QTQG 
Sbjct  130   RHKIMVGVARGLLYLHEDSRLRIIHRDLKASNILLDDNMNPKISDFGMARIFGAEQTQGR  189

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T+RIVGTYGYMSPEYAM G+FSVKSDVFSFGV++LEII+GKKN+ +Y + + A  LL Y 
Sbjct  190   TNRIVGTYGYMSPEYAMYGQFSVKSDVFSFGVLMLEIITGKKNQYSYISDDDA-SLLDYV  248

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             WE WR G P+ I+DP++++ S +V EVI+C+HIGLLC+Q D + RP M+ +VLMLSS  +
Sbjct  249   WEHWRRGAPLGIVDPIISE-SISVTEVIRCIHIGLLCIQNDKEARPAMDTIVLMLSSADS  307

Query  513   NNWSTPREPAFY  478
                  P +PAF+
Sbjct  308   VCLPVPEQPAFF  319



>ref|XP_004496793.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like 
isoform X1 [Cicer arietinum]
Length=639

 Score =   429 bits (1104),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 209/350 (60%), Positives = 272/350 (78%), Gaps = 10/350 (3%)
 Frame = -1

Query  1491  IAVLYFL-RIRNSKKQNTKLQTTDV--TGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             I  L+ L R R   K N  +Q++    + ++++ +  Q+DFAT++  TN FS +NKIG+G
Sbjct  289   IGCLFLLKRARKKYKYNAFIQSSSSIRSEDLTDVDCFQFDFATVEAATNCFSYENKIGQG  348

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +GQEIA+KRLS +S QG  EF+NE  +VAKLQH+NL RL G+C +  EK
Sbjct  349   GFGIVYKGILSNGQEIAVKRLSVTSLQGALEFRNEASLVAKLQHRNLTRLFGFCMEGCEK  408

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYE++PN SLD+FLFD  +Q  L+WS+RYKII GIARG+LYLHEDS+LRIIHRDLK S
Sbjct  409   MLIYEYIPNKSLDHFLFDHAKQRELDWSRRYKIIVGIARGILYLHEDSQLRIIHRDLKAS  468

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             N+LLD NM+PKI+DFGMA+IF  D TQ NT RIVGTYGYMSPE AM+G+FSVKSDVFSFG
Sbjct  469   NVLLDENMNPKISDFGMARIFQADHTQVNTGRIVGTYGYMSPESAMRGQFSVKSDVFSFG  528

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SGKKN +  Q  N A+DLLSYAW++W + TP+E+LDP L + S + NEVI+C+
Sbjct  529   VLVLEIVSGKKNTDLNQRNN-AEDLLSYAWKKWSEQTPLELLDPTL-QGSCSRNEVIRCI  586

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPRE-PAFYRNGSGKVP  454
             H+GLLCVQE+ ++RP ME + LML+SYS    S PR+ P+F R   G+ P
Sbjct  587   HMGLLCVQENPNDRPFMETIALMLNSYSV-TLSLPRQPPSFLR---GRTP  632



>ref|XP_011076612.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Sesamum 
indicum]
Length=683

 Score =   431 bits (1108),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 205/343 (60%), Positives = 273/343 (80%), Gaps = 5/343 (1%)
 Frame = -1

Query  1500  LLFIAVLYFL--RIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIG  1327
             +L ++V  FL  RI+   K +  +++ +V  +IS  ESLQ+ F+TI+  TN FS +NK+G
Sbjct  308   ILVVSVGIFLIKRIKQKPKDSDHIES-EVVDDISTPESLQFAFSTIRDATNNFSDNNKLG  366

Query  1326  EGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKRE  1147
             +GG+G+VYKG   +GQEIA+KRLS++SGQG+ EFKNEV ++A+LQH+NLV+LLG+  + E
Sbjct  367   QGGFGTVYKGKFLNGQEIAVKRLSKNSGQGDLEFKNEVLLLARLQHRNLVKLLGFSLQGE  426

Query  1146  EKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLK  967
             EK+L+YEFV N SLD F+FD      L+W +R+KII GIARG+LYLHEDSRLRIIHRDLK
Sbjct  427   EKLLVYEFVQNASLDLFIFDPINHSYLDWERRHKIIGGIARGILYLHEDSRLRIIHRDLK  486

Query  966   TSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFS  787
              SN+LLD NM+PKIADFGMA++ G D+TQGNT+RIVGTYGYM+PEYA+ G+FSVKSDVFS
Sbjct  487   ASNVLLDGNMNPKIADFGMARLCGHDETQGNTNRIVGTYGYMAPEYAIHGQFSVKSDVFS  546

Query  786   FGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             FGV++LEIISG+KN N +++    +DLLS+AW+ WR+GT   ++DPVL   + ++ E+++
Sbjct  547   FGVLVLEIISGQKN-NCFRSGENVEDLLSFAWKNWREGTAANVVDPVLRSGAGSMTEMLR  605

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             C+HIGLLCVQE+A +RPTM  VVLMLSS+S      P EPAFY
Sbjct  606   CIHIGLLCVQENASDRPTMASVVLMLSSFSL-TLGVPSEPAFY  647



>ref|XP_006606016.1| PREDICTED: cysteine-rich receptor-like protein kinase 29-like 
[Glycine max]
Length=667

 Score =   431 bits (1107),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/343 (62%), Positives = 258/343 (75%), Gaps = 5/343 (1%)
 Frame = -1

Query  1494  FIAVLYFLRIRNSKKQNTKLQTTDVT-GEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
              I    +LR R S+KQN   +  D    EIS  ESLQ+DF TI++ TN F+  NKIG+GG
Sbjct  287   LILFCIYLRARKSRKQNESEKREDNNEDEISFAESLQFDFDTIRVATNEFADCNKIGQGG  346

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G+VY+G L +GQEIA+KRLSR SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E++
Sbjct  347   FGAVYRGQLSNGQEIAVKRLSRDSGQGDMEFKNEVLLVAKLQHRNLVRLLGFCLEGTERL  406

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YEFVPN SLDYF+FD  ++  L+W +RYKII GIARGLLYLHEDSRLRIIHRDLK SN
Sbjct  407   LVYEFVPNKSLDYFIFDPIKKAQLDWQRRYKIIGGIARGLLYLHEDSRLRIIHRDLKASN  466

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD  M PKI+DFGMA++  +DQTQ NTSRIVGTYGYM+PEYA+ G+FS KSDVFSFGV
Sbjct  467   ILLDEEMHPKISDFGMARLVHMDQTQENTSRIVGTYGYMAPEYAIYGQFSAKSDVFSFGV  526

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEIISG KN    +  N  +DLL +AW  WRDGT   I+DP L       NE+++C+H
Sbjct  527   LVLEIISGHKNSGVRRGEN-VEDLLCFAWRNWRDGTTTNIVDPTLTDG--LRNEIMRCIH  583

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             IGLLCVQE+   RPTM  V LML+SYS      P EPAF  +G
Sbjct  584   IGLLCVQENVAARPTMASVALMLNSYSL-TLPVPSEPAFVGDG  625



>gb|KCW61422.1| hypothetical protein EUGRSUZ_H04149 [Eucalyptus grandis]
Length=484

 Score =   424 bits (1090),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 269/345 (78%), Gaps = 9/345 (3%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             E++  ESLQ+D ATIQ+ TN FS +NK+GEGG+G V++G LP+GQ++A+KRLS+ S QG+
Sbjct  149   ELTAVESLQFDLATIQVATNYFSHENKLGEGGFGEVFQGRLPNGQQVAVKRLSQRSKQGD  208

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNE+ +VAKLQH NLVRLLG+C + EEK+L+YEFVPN SLDYFLFD +++  L+W  
Sbjct  209   GEFKNEILLVAKLQHINLVRLLGFCLEGEEKLLVYEFVPNKSLDYFLFDPQKRRQLDWPL  268

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKII GIARG+LYLHEDSRLRIIHRDLK SNILLD  ++PKI+DFGMA+IFG++QTQ +
Sbjct  269   RYKIIFGIARGMLYLHEDSRLRIIHRDLKCSNILLDSEINPKISDFGMARIFGVNQTQAS  328

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T++IVGT+GYMSPEYAM GEFSVKSDV+SFG++LLEII GKKN N YQ     + L  YA
Sbjct  329   TNKIVGTFGYMSPEYAMHGEFSVKSDVYSFGILLLEIICGKKN-NLYQD----EYLAGYA  383

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W QWRDGTP+++LDP +  S+ + ++V++C+HI LLC+QED   RPTM  VVL+LS+ S 
Sbjct  384   WNQWRDGTPLKVLDPAIVDSN-SRDQVLRCLHICLLCIQEDPAIRPTMTTVVLLLSNNSI  442

Query  513   NNWSTPREPAFYRNGSGKVPMREISLELSVTVSDEASTIGKLCPR  379
                S P+ PAF+    G     + S   ++ +S    ++ +LCPR
Sbjct  443   TPPS-PQHPAFFVQMKGL--ESDQSTRRTMPLSINGVSLTELCPR  484



>ref|XP_010433930.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 isoform 
X1 [Camelina sativa]
Length=661

 Score =   430 bits (1106),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 208/376 (55%), Positives = 277/376 (74%), Gaps = 8/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV  F   + +KK +      D   +I+   SLQ+DF  ++  T+ FS  NK+G+G
Sbjct  292   LLFLAVFSFYVTKRAKKPHDTAAEKDEGDDITTAGSLQFDFKVVEAATDKFSICNKLGQG  351

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+LP+G ++A+KRLS++SGQGEKEFKNEV VVAKLQH+NLV+LLG+C +REEK
Sbjct  352   GFGQVYKGVLPNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEK  411

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFDS +Q  L+W+ RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  412   ILVYEFVRNKSLDYFLFDSNKQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  471

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT RIVGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  472   NILLDADMNPKVADFGMARIFELDQTEDNTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFG  531

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + Y       +L++Y W+ W +G+P+E++D    + +Y   E+I+C+
Sbjct  532   VLVLEIISGRKNSSLYHMDASFGNLVTYTWKLWSNGSPLELVDSSF-RENYQRIEIIRCI  590

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISLELS  427
             HI LLCVQED + RPTM  +V ML++ S+     P+ P F+   N     P    S++ S
Sbjct  591   HIALLCVQEDTENRPTMSAIVQMLTT-SSIALDVPQPPGFFFRSNHEQAGP----SMDKS  645

Query  426   VTVSDEASTIGKLCPR  379
                S +A++I  L PR
Sbjct  646   SLCSIDAASITTLVPR  661



>gb|KCW75014.1| hypothetical protein EUGRSUZ_E03789 [Eucalyptus grandis]
Length=462

 Score =   423 bits (1088),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 202/315 (64%), Positives = 252/315 (80%), Gaps = 4/315 (1%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             E++  ESLQ+D ATIQ  TN FS + K+GEGG+G V++G LP GQ+IA+KRLSRSS QG+
Sbjct  131   ELTTVESLQFDLATIQGATNDFSLEKKLGEGGFGEVFQGRLPDGQQIAVKRLSRSSRQGD  190

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
             +EFKNEV +VAKLQH+NLVRLLG+C + +E++L YEFVPN SLDYFLFD ++   L WS 
Sbjct  191   EEFKNEVLLVAKLQHRNLVRLLGFCLEGDERLLAYEFVPNKSLDYFLFDPQKSSQLNWSL  250

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKI+ GIARG+LYLHEDSRLRIIHRDLK SNILLD  M+PKI+DFG A+IFG+DQTQ +
Sbjct  251   RYKIVSGIARGMLYLHEDSRLRIIHRDLKCSNILLDSEMNPKISDFGTARIFGVDQTQAS  310

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T++IVGT+GYMSPEYAM GEFSVKSDV+SFG++L+EII GKKN N +   +  + L SY 
Sbjct  311   TNKIVGTFGYMSPEYAMHGEFSVKSDVYSFGILLIEIICGKKN-NFHHQLDGGEYLASYV  369

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W +WRDG P+E+LDP +   SY+ +EV++C+HIGLLC+QED   RPTM  V+LMLS+   
Sbjct  370   WNKWRDGMPLEVLDPAIV-DSYSRDEVLRCLHIGLLCIQEDPAIRPTMATVILMLSNNYF  428

Query  513   NNWSTPREPA-FYRN  472
             N    PR PA F RN
Sbjct  429   NT-PLPRHPALFVRN  442



>ref|XP_006373159.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
 gb|ERP50956.1| hypothetical protein POPTR_0017s09230g [Populus trichocarpa]
Length=334

 Score =   418 bits (1075),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 200/295 (68%), Positives = 240/295 (81%), Gaps = 3/295 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +LF     FL  R +K      Q  DV  EI+N ESLQ+D ++IQ  TN FS DNK+GEG
Sbjct  43    VLFCLGFCFLS-RRAKSNKNSAQENDVGNEITNVESLQFDLSSIQDATNHFSADNKLGEG  101

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQ IA+KRLS+ SGQG  EFKNEV +VAKLQH+NLVRLLG+C + EEK
Sbjct  102   GFGEVYKGTLPNGQAIAVKRLSKGSGQGAAEFKNEVILVAKLQHRNLVRLLGFCLEGEEK  161

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYF+FD E+Q +L+WSKRYKII GIARG+LYLHEDSRLR+IHRDLK S
Sbjct  162   ILVYEFVPNKSLDYFVFDPEKQGLLDWSKRYKIIGGIARGILYLHEDSRLRVIHRDLKAS  221

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+ K++DFGMA+IFG+DQTQG T+RIVGTYGYMSPEYAM G+FSVKSD +SFG
Sbjct  222   NILLDGDMNAKVSDFGMARIFGVDQTQGCTNRIVGTYGYMSPEYAMHGQFSVKSDAYSFG  281

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNE  616
             V++LEIISGKKN + YQT   A DL SYAW+ WRDGTP+E++DP LA  +Y+ NE
Sbjct  282   VLILEIISGKKNSSFYQTGG-AADLASYAWKHWRDGTPLEVMDPTLA-DTYSRNE  334



>emb|CDP04893.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   426 bits (1096),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 205/340 (60%), Positives = 263/340 (77%), Gaps = 4/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             + + V+ F   R  +K    +  T    EIS  ESLQY+ + IQ  TN F+  N+IGEGG
Sbjct  181   IVLLVVGFCIARRPRKPYFAIMETSGASEISFTESLQYNLSDIQAATNNFAVGNRIGEGG  240

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG L +GQEIA+KRLSRSS QG +EFKNE+ +VA+LQH+NLVRLLG+C + EE+I
Sbjct  241   FGPVYKGTLHNGQEIAVKRLSRSSAQGTEEFKNEIALVARLQHRNLVRLLGFCLEGEERI  300

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFV N SLDYFLFD E+Q +L+WS+R+KII GIA+GLLYLHEDSRLRIIHRDLK SN
Sbjct  301   LIYEFVTNKSLDYFLFDPEKQPLLDWSRRFKIIGGIAKGLLYLHEDSRLRIIHRDLKASN  360

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             +LLD NM+PKIADFG+A++FG+DQ++GNTS+I GTYGYM+PEY + G FSVKSDVFSFGV
Sbjct  361   VLLDRNMNPKIADFGLARLFGVDQSEGNTSKIAGTYGYMAPEY-LHGLFSVKSDVFSFGV  419

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI+SGKKN + +   +   DL SYAW QWRDGTP+ ++DP +   +Y  NEVI+ +H
Sbjct  420   LILEILSGKKN-SQFNQAHGGDDLPSYAWRQWRDGTPLALVDPTIG-DTYARNEVIRSIH  477

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
              GLLCVQ++ ++RPTM  +VLML+S S      P  PA++
Sbjct  478   AGLLCVQDEIEQRPTMASIVLMLNSNSI-TLLAPNPPAYF  516



>ref|XP_003635656.2| PREDICTED: cysteine-rich receptor-like protein kinase 10, partial 
[Vitis vinifera]
Length=367

 Score =   419 bits (1078),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 268/358 (75%), Gaps = 11/358 (3%)
 Frame = -1

Query  1431  TTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSR  1252
             + +   EI + ESLQ++   I+  TN FS  NK+G+GG+G+VYKG L +GQ+IA+KRLS+
Sbjct  14    SCEAEDEILSVESLQFNLGPIRNATNNFSDSNKLGQGGFGAVYKGTLSNGQDIAVKRLSK  73

Query  1251  SSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQH  1072
              SGQGE EFKNEV +VAKLQH+NLVRLLG+C +  E++LIYEFVPN SLD+FLFD  ++ 
Sbjct  74    GSGQGELEFKNEVLLVAKLQHRNLVRLLGFCLEGIERLLIYEFVPNASLDHFLFDPIKRS  133

Query  1071  VLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGI  892
              L W  RYKII GIARGLLYLHEDSRLRIIHRDLK SN+LLD  M+PKIADFGMA++F +
Sbjct  134   QLHWKIRYKIIVGIARGLLYLHEDSRLRIIHRDLKASNVLLDEEMNPKIADFGMARLFSL  193

Query  891   DQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQ  712
             DQTQG+TSRIVGTYGYM+PEYAM G FSVKSDVFSFGV++LEIISG+KN   ++     +
Sbjct  194   DQTQGDTSRIVGTYGYMAPEYAMHGNFSVKSDVFSFGVLVLEIISGQKNF-CFRNGENVE  252

Query  711   DLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLM  532
             DL+S+AW  WRDG+   ++DP ++  S +  E+++C+HIGLLCVQE+  +RPTM  VVLM
Sbjct  253   DLISFAWRSWRDGSASNLIDPSVSSGSRS--EIMRCMHIGLLCVQENVADRPTMASVVLM  310

Query  531   LSSYSTNNWSTPREPAFYRNGS--GKVPMREISLELSVTVSDEA-----STIGKLCPR  379
             LSSYS      P +P F+ + S   + P+ + S   +   SD A     ++I +L PR
Sbjct  311   LSSYSI-TLPLPSQPPFFMHSSMDTEAPLLQDSDSGATRSSDNALSVNDASISELHPR  367



>ref|XP_010052444.1| PREDICTED: cysteine-rich receptor-like protein kinase 19 [Eucalyptus 
grandis]
Length=665

 Score =   430 bits (1105),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 209/342 (61%), Positives = 266/342 (78%), Gaps = 6/342 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG-EISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             +L  AVL F+R R   KQN + +  D  G EIS   SLQ+D   I++ T  FS  NK+GE
Sbjct  285   MLLCAVLCFIRKR---KQNKRNRDKDPIGSEISELHSLQFDVCAIEVATAYFSNHNKLGE  341

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G VY G LP G++IA KRLS+SS QG +EFKNEVE+VAKLQH+NLVRLLG+  +REE
Sbjct  342   GGFGPVYMGTLPCGRKIAAKRLSQSSKQGVQEFKNEVELVAKLQHRNLVRLLGFAMEREE  401

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
              IL+YE+VPNGSLD  LFD  +   L+WS R+KI+ G+ARGLLYLHEDSRLRIIHRDLK 
Sbjct  402   TILVYEYVPNGSLDQLLFDPRQSVQLDWSARHKIMVGVARGLLYLHEDSRLRIIHRDLKA  461

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILL+ +M+PKI+DFGMA+IFG  QTQG+T+RIVGTYGYMSPEYAM G+FSVKSDVFSF
Sbjct  462   SNILLNDDMNPKISDFGMARIFGAKQTQGSTNRIVGTYGYMSPEYAMYGQFSVKSDVFSF  521

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEII+GKK+  +Y  +++   L+ Y WE WR G P+EI+DP L++S +  NEVI+C
Sbjct  522   GVLMLEIITGKKSHYSY-ISDQDASLVDYVWEHWRIGAPLEIVDPALSESIFA-NEVIKC  579

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +HIGLLCVQ + + RPTM+ VVLML+S ++ +   P +P F+
Sbjct  580   IHIGLLCVQNNREARPTMDTVVLMLNSANSVSLPVPEQPTFF  621



>ref|XP_010089688.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
 gb|EXB38211.1| Cysteine-rich receptor-like protein kinase 29 [Morus notabilis]
Length=679

 Score =   430 bits (1106),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 206/345 (60%), Positives = 268/345 (78%), Gaps = 4/345 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I+V  FL+ R ++K +      +   EI + ESLQY F T ++ T+ FS  NK+G+G
Sbjct  297   VLIISVCVFLKKRGARKIDQTHPVNEPVEEIESVESLQYSFETTRVATDNFSEANKLGQG  356

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSVY+G LP+GQ+IA+KRLSR+S QG+ EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  357   GFGSVYRGKLPNGQDIAVKRLSRNSNQGDLEFKNEVLLVAKLQHRNLVRLLGFCLEGSER  416

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L+YEFVPN SLD+F+FD  ++  L+W +RYKII GIARGLLYLHEDSRLR+IHRDLK S
Sbjct  417   LLVYEFVPNASLDHFIFDPSKRANLDWERRYKIIGGIARGLLYLHEDSRLRVIHRDLKAS  476

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M PKI+DFGMA++F +DQTQGNT+RIVGTYGYM+PEYAM G FSV++DVFSFG
Sbjct  477   NILLDKEMHPKISDFGMARLFVVDQTQGNTNRIVGTYGYMAPEYAMHGHFSVRTDVFSFG  536

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V+LLEI+SG+KN N ++     +DLLSYAW  WRD T   I+DP++  +S  V+E+++ +
Sbjct  537   VLLLEIVSGQKN-NCFRHGEHVEDLLSYAWRNWRDRTASNIIDPLVRVNS--VSEIMRYI  593

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS  466
             HIGLLCVQE+   RPTM  VVLML+S S  +   P EPAF+ N +
Sbjct  594   HIGLLCVQENVAHRPTMNTVVLMLNSNSL-SLPVPTEPAFFMNSN  637



>ref|XP_010448770.1| PREDICTED: cysteine-rich receptor-like protein kinase 5 isoform 
X2 [Camelina sativa]
Length=611

 Score =   428 bits (1100),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 256/315 (81%), Gaps = 2/315 (1%)
 Frame = -1

Query  1422  VTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSG  1243
             V  +I+   SLQ+DF  I+  T+ FS  NK+G+GG+G VYKG  P+G ++A+KRLS++SG
Sbjct  268   VGDDIATAGSLQFDFKVIEAATDKFSESNKLGQGGFGEVYKGTFPNGLQVAVKRLSKTSG  327

Query  1242  QGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLE  1063
             QGEKEFKNEV VVAKLQHKNLVRLLG+C +REEKIL+YEFVPN SLDYFLFDS  ++ L+
Sbjct  328   QGEKEFKNEVIVVAKLQHKNLVRLLGFCLEREEKILVYEFVPNKSLDYFLFDSTMKNQLD  387

Query  1062  WSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQT  883
             W++RYKIIRGIARG+LYLH+DSRL IIHRDLK  NILLD +M+PK+ADFGMA+IF +DQT
Sbjct  388   WTRRYKIIRGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKVADFGMARIFKMDQT  447

Query  882   QGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLL  703
             + NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG+++LEIISGKKN  +YQ  +   +L+
Sbjct  448   EANTRRVVGTYGYMSPEYAMYGKFSMKSDVYSFGILVLEIISGKKNIGSYQMDSSEGNLV  507

Query  702   SYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSS  523
             +YAW  W + +P+E++DP   + SY +NE+ +C+HI LLCVQE+A++RPTM  VV ML++
Sbjct  508   TYAWRVWNNESPMEVVDPSF-QDSYQINEITRCIHIALLCVQEEAEDRPTMSTVVQMLTT  566

Query  522   YSTNNWSTPREPAFY  478
              S+   + PR P  +
Sbjct  567   -SSIALAAPRPPGCF  580



>ref|XP_006413576.1| hypothetical protein EUTSA_v10024603mg [Eutrema salsugineum]
 gb|ESQ55029.1| hypothetical protein EUTSA_v10024603mg [Eutrema salsugineum]
Length=672

 Score =   430 bits (1106),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 208/375 (55%), Positives = 275/375 (73%), Gaps = 6/375 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV  F   R  KK        D   +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  303   LLFVAVFSFRVTRRVKKTYDTAAADDEGDDITTAGSLQFDFKAIEAATDKFSICNKLGQG  362

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG LP+G ++A+KRLS++SGQGEKEFKNEV +VAKLQH+NLV+LLG+C +REEK
Sbjct  363   GFGAVYKGTLPNGLQVAVKRLSKTSGQGEKEFKNEVILVAKLQHRNLVKLLGFCLEREEK  422

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFDS  Q  L+W+ RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  423   ILVYEFVSNKSLDYFLFDSRMQSRLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  482

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  483   NILLDADMNPKVADFGMARIFKMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  542

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + Y+      +L++Y W  W +G+P E++D    + +Y  NE+ +C+
Sbjct  543   VLVLEIISGRKNSSLYEMNGSFGNLVTYTWRLWNNGSPQELVDSSF-QENYQRNEISRCI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREP-AFYRNGSGKVPMREISLELSV  424
             HI LLCVQED ++RPTM  +V ML++ S+   + PR P  F+R+   K      S++ S 
Sbjct  602   HIALLCVQEDTEDRPTMSAIVQMLTT-SSIALAVPRPPGCFFRS---KHEQAGSSMDKSA  657

Query  423   TVSDEASTIGKLCPR  379
               S + ++I  L PR
Sbjct  658   LCSIDEASITSLAPR  672



>emb|CDP20316.1| unnamed protein product [Coffea canephora]
Length=670

 Score =   430 bits (1105),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 200/291 (69%), Positives = 241/291 (83%), Gaps = 2/291 (1%)
 Frame = -1

Query  1398  ESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKN  1219
             ESLQY  + I++ TN FS DNKIG+GG+G VYKG LP GQ+IA+KRLSR SGQG +EFKN
Sbjct  333   ESLQYSLSAIRIATNDFSVDNKIGQGGFGPVYKGKLPDGQDIAVKRLSRRSGQGAQEFKN  392

Query  1218  EVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKII  1039
             E+ VVAKLQH+NLVRLLG+C +  EK+LIYEFVPN SLDYFLFD E+Q +L+WSKRYKII
Sbjct  393   EIAVVAKLQHRNLVRLLGFCLEAGEKLLIYEFVPNKSLDYFLFDPEKQQLLDWSKRYKII  452

Query  1038  RGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIV  859
              GIARGLLYLHEDSRLRI+HRDLK  NILLD  M+PKIADFGMAKI G+D+ +GNT+RI 
Sbjct  453   TGIARGLLYLHEDSRLRIVHRDLKAGNILLDERMNPKIADFGMAKICGVDEFEGNTNRIA  512

Query  858   GTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWR  679
             GT GYM+PEY   G+FSVKSDVFSFGV++LEII+GKKN + Y + + ++DLLSY+WEQWR
Sbjct  513   GTIGYMAPEYTTSGQFSVKSDVFSFGVVILEIIAGKKNSSFYLSED-SRDLLSYSWEQWR  571

Query  678   DGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLS  526
              GTP+ +LDP +  S   + EV++C+ IGLLCV+EDAD RP M  VV MLS
Sbjct  572   HGTPLALLDPTIVDSCVEI-EVLKCIQIGLLCVEEDADRRPMMSSVVYMLS  621



>ref|XP_006413566.1| hypothetical protein EUTSA_v10024631mg [Eutrema salsugineum]
 gb|ESQ55019.1| hypothetical protein EUTSA_v10024631mg [Eutrema salsugineum]
Length=657

 Score =   429 bits (1104),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 197/344 (57%), Positives = 271/344 (79%), Gaps = 8/344 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVT---GEISNEESLQYDFATIQLITNVFSPDNKI  1330
             LL +AV     +R +KK+ T  +T  +T    +I+   SLQ+DF  I+  T+ FS  NK+
Sbjct  285   LLSVAVFI---VRRAKKKKTIYETEPLTEGKDDITTAGSLQFDFKAIEAATDKFSESNKL  341

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G+GG+G+VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQ++NLVRLLG+C + 
Sbjct  342   GQGGFGAVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQYRNLVRLLGFCLEG  401

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             +EK+L+YEFVPN SLDYFLFDS  Q  L+W+ RYKII GIARG+LYLH+DSRL IIHRDL
Sbjct  402   QEKVLVYEFVPNKSLDYFLFDSTMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDL  461

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  N+LLD +M+PK+ADFGMA+IFG+DQT+ NT+R+VGTYGYMSPEYAM G+FS KSDV+
Sbjct  462   KAGNVLLDADMNPKVADFGMARIFGMDQTEANTNRVVGTYGYMSPEYAMYGQFSTKSDVY  521

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGKKN + YQ    + +L++Y W  W +G+P+E++DP   + +Y  +E+ 
Sbjct  522   SFGVLVLEIISGKKNSSLYQMDGHSGNLVTYTWRLWSNGSPLELVDPSF-QENYQTDEIT  580

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             +C+HI LLCVQE+A++RPTM  +V ML++ S+ + + P++P F+
Sbjct  581   RCIHIALLCVQEEAEDRPTMSAIVQMLTT-SSISLAVPQQPGFF  623



>ref|NP_849425.1| cysteine-rich receptor-like protein kinase 5 [Arabidopsis thaliana]
 gb|AAN13047.1| putative protein kinase [Arabidopsis thaliana]
 gb|AEE84713.1| cysteine-rich receptor-like protein kinase 5 [Arabidopsis thaliana]
Length=663

 Score =   429 bits (1104),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 209/376 (56%), Positives = 275/376 (73%), Gaps = 8/376 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+ +AV  F   + +KK        D   +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  294   LICVAVFSFHASKRAKKTYDTPGANDEEDDITTAGSLQFDFKVIEAATDKFSMCNKLGQG  353

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+G ++A+KRLS++SGQGEKEFKNEV VVAKLQH+NLV+LLG+C +REEK
Sbjct  354   GFGQVYKGTLPNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEK  413

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFDS  Q  L+W+ RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  414   ILVYEFVSNKSLDYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  473

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF IDQT+ +T R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  474   NILLDADMNPKVADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  533

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + YQ      +L++Y W  W DG+P++++D    + SY  NE+I+C+
Sbjct  534   VLVLEIISGRKNSSLYQMDASFGNLVTYTWRLWSDGSPLDLVDSSF-RDSYQRNEIIRCI  592

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY--RNGSGKVPMREISLELS  427
             HI LLCVQED + RPTM  +V ML++ S+   + P+ P F+   N     P    S++ S
Sbjct  593   HIALLCVQEDTENRPTMSAIVQMLTT-SSIALAVPQPPGFFFRSNHEQAGP----SMDKS  647

Query  426   VTVSDEASTIGKLCPR  379
                S +A++I  L PR
Sbjct  648   SLCSIDAASITILAPR  663



>ref|XP_010059677.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=672

 Score =   430 bits (1105),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 214/382 (56%), Positives = 280/382 (73%), Gaps = 13/382 (3%)
 Frame = -1

Query  1494  FIAVLY---FLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             FI +L+   ++  R  K+ +   +      E++  ESLQ+D ATIQ  TN FSP+NK+GE
Sbjct  294   FIIILFLTCWMLRRKGKRMHEVFKVKGDENELTTVESLQFDLATIQSATNDFSPENKLGE  353

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G V++G LP+GQ+IA+KRLS+SS QG+ EFKNEV +VAKLQHKNLVRLLG+C + +E
Sbjct  354   GGFGEVFQGKLPNGQQIAVKRLSQSSRQGDDEFKNEVLLVAKLQHKNLVRLLGFCLEGDE  413

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             K+L YEFVPN SLDYFLFD ++   L W  RYKI+ GIARG+LYLHE+SRLRIIHRDLK 
Sbjct  414   KLLAYEFVPNKSLDYFLFDPQKSDKLNWPLRYKIVYGIARGMLYLHEESRLRIIHRDLKC  473

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
              NILLD  M+PKI+DFGMA+IFG+DQTQ +T++IVGT+GYMSPEYAM G FSVKSDV+SF
Sbjct  474   GNILLDSEMNPKISDFGMARIFGVDQTQASTNKIVGTFGYMSPEYAMHGRFSVKSDVYSF  533

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             G++LLEII GKKN   Y   +  + L  YAW QWRDGTP+++LDP +  S+ + ++V++C
Sbjct  534   GILLLEIICGKKN-GFYDQFDGGEYLARYAWNQWRDGTPLKVLDPAIVDSN-SRDQVLRC  591

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGK---VPMREISLE  433
             +HI LLC+QED   RPTM  VVLMLSS S    S PR PAF+     +   +PM  +  +
Sbjct  592   LHICLLCIQEDPAIRPTMATVVLMLSSNSITPPS-PRHPAFFVQSKARGLGIPMEGLGSD  650

Query  432   LSVT----VSDEASTIGKLCPR  379
              S +    +S+   ++ +L PR
Sbjct  651   QSTSRIKLLSNNNLSLTELYPR  672



>ref|XP_006283286.1| hypothetical protein CARUB_v10004325mg [Capsella rubella]
 gb|EOA16184.1| hypothetical protein CARUB_v10004325mg [Capsella rubella]
Length=654

 Score =   429 bits (1103),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 218/377 (58%), Positives = 279/377 (74%), Gaps = 11/377 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL IA   F+    SKK + K    D   E +  +SL+ D+ TIQ  TN FS  NKIG G
Sbjct  286   LLLIACYRFI----SKKAHHKAPAFD-GDEGATADSLKLDYKTIQAATNGFSESNKIGRG  340

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG   +G  +A+KRLS++SGQGE EFKNEV VVAKLQH+NLVRLLG+C + EE+
Sbjct  341   GFGEVYKGTFSNGTVVAVKRLSKTSGQGEVEFKNEVVVVAKLQHRNLVRLLGFCLEGEER  400

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLD FLFD  +Q  L+W++RYKII GIARG+LYLH+DS+L IIHRDLK S
Sbjct  401   ILVYEFVPNKSLDSFLFDPSKQGELDWTRRYKIIGGIARGILYLHQDSQLTIIHRDLKAS  460

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+D +  NT+RIVGTYGYM+PEYAMQG++S+KSDV+SFG
Sbjct  461   NILLDADMNPKIADFGMARIFGMDHSAENTNRIVGTYGYMAPEYAMQGQYSIKSDVYSFG  520

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V +LEIISGKKN + YQ T+ A DLLSYAW  WR+GTP++++DPV+  +    +E+++C+
Sbjct  521   VSVLEIISGKKNSSFYQ-TDGAHDLLSYAWRLWRNGTPLDLVDPVIIHNCQR-DELVRCI  578

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY---RNGSGKVPMREISLEL  430
             HIGLLCVQED  +RPT+  +VLML+S +T     P+EP  +   R+  G +   +     
Sbjct  579   HIGLLCVQEDPVDRPTLSAIVLMLTS-NTVTLPVPKEPGLFFQSRSKEGLINSEQSFKSR  637

Query  429   SVTVSDEASTIGKLCPR  379
             SV  S + STI  L PR
Sbjct  638   SVPWSVDDSTITDLYPR  654



>ref|XP_008371138.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=692

 Score =   430 bits (1106),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/374 (58%), Positives = 284/374 (76%), Gaps = 16/374 (4%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNE----ESLQYDFATIQLITNVFSPDNK  1333
             ++F+ +   LR+R +KK   KLQ+  + GE ++E    ESLQ++F TI++ T+ FS  NK
Sbjct  309   VMFMGIC--LRVRKAKK---KLQSNLIPGEDADEIGSAESLQFNFDTIRMATDDFSEANK  363

Query  1332  IGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSK  1153
             +G+GG+GSVYKG L +GQEIA+KRLS +SGQG+ EFKNEV +VA LQH+NLVRLLG+C +
Sbjct  364   LGQGGFGSVYKGRLFNGQEIAVKRLSVNSGQGDLEFKNEVLLVAXLQHRNLVRLLGFCLE  423

Query  1152  REEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRD  973
               E++LIYEFV N SLD+ +FD  ++  L+W +RYKII GI RGL+YLHEDSRLRIIHRD
Sbjct  424   GVERLLIYEFVXNASLDHIIFDPIKRAQLDWDRRYKIIVGITRGLIYLHEDSRLRIIHRD  483

Query  972   LKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDV  793
             LK SNIL+D  M PKI+DFGMAK+FG+DQTQGNTSRIVGTYGYM+PEYAM G FSVKSDV
Sbjct  484   LKASNILIDEEMXPKISDFGMAKLFGVDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKSDV  543

Query  792   FSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEV  613
             +SFGV++LEI+SG+KN N+++     +DLLSYAW+ WR+GT   ++DP L   S   NE+
Sbjct  544   YSFGVLVLEIVSGQKN-NSFRHGENVEDLLSYAWKCWREGTASNLIDPALINGSR--NEI  600

Query  612   IQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRN---GSGKVPMREI  442
             ++C+HIGLLCVQE+  +RPTM  +VLML+SYS      P +PAF+R+   GS      + 
Sbjct  601   MRCIHIGLLCVQENIADRPTMNAIVLMLNSYSV-TLPVPSQPAFFRDSNVGSDMTSGWKN  659

Query  441   SLELSVTVSDEAST  400
             S E+  T SD + +
Sbjct  660   SSEVITTGSDRSKS  673



>ref|XP_007213610.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
 gb|EMJ14809.1| hypothetical protein PRUPE_ppa002309mg [Prunus persica]
Length=689

 Score =   430 bits (1106),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/390 (55%), Positives = 284/390 (73%), Gaps = 20/390 (5%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I++  +LR+R +KK+ T     +   EI + ESLQ+DF TI++ T+ FS  NK+G+G
Sbjct  304   VLIISIGIWLRVRKTKKKLTIPPAGEDADEIRSAESLQFDFDTIRIATDDFSEANKLGQG  363

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSVYKG L +G++IA+KRLS +SGQG+ EFKNEV +VA+LQH+NLVRLLG+C +  E+
Sbjct  364   GFGSVYKGRLFNGEDIAVKRLSTNSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLEGIER  423

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+ +FD  ++  L+W  RYKII GI RG++YLHEDSRLRIIHRDLK S
Sbjct  424   LLIYEFVPNSSLDHIIFDPIKRTQLDWDSRYKIIVGITRGIIYLHEDSRLRIIHRDLKAS  483

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NIL+D  M+PKI+DFGMAK+F +DQTQGNTSRIVGTYGYM+PEYAM G FSVKSDV+SFG
Sbjct  484   NILIDAEMNPKISDFGMAKLFVLDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKSDVYSFG  543

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG+KN N ++     +DLLSYAW+ WR+GT   ++DP L   S    E+++C+
Sbjct  544   VLILEIVSGQKN-NCFRRGENVEDLLSYAWKSWREGTASNVIDPTLRTGSRA--EIMRCI  600

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYR--------------NGSG  463
             HIGLLCVQE+  +RPTM  +VLML+SYS      P +PAF+R              N SG
Sbjct  601   HIGLLCVQENIADRPTMASIVLMLNSYSV-TLPVPSQPAFFRHSSVGSDMSSSGWTNNSG  659

Query  462   KVPMREISLELSVTVS--DEASTIGKLCPR  379
                  + S   SV  +  DE S I ++ PR
Sbjct  660   LTAGSDRSKSNSVVKAPEDEVSMITEVYPR  689



>ref|XP_010052446.1| PREDICTED: cysteine-rich receptor-like protein kinase 25 isoform 
X2 [Eucalyptus grandis]
Length=659

 Score =   429 bits (1103),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 214/367 (58%), Positives = 278/367 (76%), Gaps = 7/367 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L ++ V + LR R   K+  + ++  V  +IS   SLQ+D  TI+  T+ FS +NK+GEG
Sbjct  272   LFYMIVWHILRGR---KRIPRRESKSVRRQISGLHSLQFDLQTIEAATDNFSNNNKLGEG  328

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG LP+GQEIA KRLSRSSGQG +EFK EVE+VAKLQH+NLVRLLG+  +R+E 
Sbjct  329   GFGPVYKGTLPNGQEIAAKRLSRSSGQGVEEFKTEVELVAKLQHRNLVRLLGFSMERDET  388

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YE+VPNGSLD  LFD E    L+WS RYK++ G+ARGLLYLHEDSRLRIIHRDLK S
Sbjct  389   ILVYEYVPNGSLDRLLFDPELSGQLDWSTRYKVMVGVARGLLYLHEDSRLRIIHRDLKAS  448

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKI+DFG+A+IFG DQTQ +T+RIVGTYGYMSPEY M G FSVKSDVFS+G
Sbjct  449   NILLDADMNPKISDFGLARIFGNDQTQASTNRIVGTYGYMSPEYLMFGHFSVKSDVFSYG  508

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEII+GKKN + +      + LL Y W+ W +GT  EI DPVL+ ++Y+VNEVI+C+
Sbjct  509   VLMLEIITGKKN-SQFSALYCDEGLLGYVWKHWSNGTSSEIADPVLS-NAYSVNEVIRCM  566

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREI-SLELSV  424
             HIGLLCVQ+D ++RPTM+ VVLML+S S  N   P+ P F+ +     P   + + +LS 
Sbjct  567   HIGLLCVQDDTEDRPTMDSVVLMLNSESI-NIPVPQRPTFFFSSKKNKPAPSVPNSDLST  625

Query  423   TVSDEAS  403
             +  D+++
Sbjct  626   SKVDQSN  632



>ref|XP_010448725.1| PREDICTED: cysteine-rich receptor-like protein kinase 19 isoform 
X2 [Camelina sativa]
Length=671

 Score =   429 bits (1103),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/347 (58%), Positives = 265/347 (76%), Gaps = 9/347 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVT---GEISNEESLQYDFATIQLITNVFSPDNKI  1330
             LLF+AV    R+R +K++ T  +T  +     +I+   SLQ+D   I+  T+ F P NK+
Sbjct  300   LLFVAVF---RVR-AKRKKTVYETEPLAEDGDDITTAGSLQFDLKAIEAATSNFLPSNKL  355

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G+GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLVRLLG+C   
Sbjct  356   GQGGFGEVYKGTFPSGVQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGFCLGG  415

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             EEKIL+YEFVPN SLDYFLFDS  Q  L+W++RYKII GIARG+LYLH+DSRL IIHRDL
Sbjct  416   EEKILVYEFVPNKSLDYFLFDSTMQRQLDWARRYKIIGGIARGILYLHQDSRLTIIHRDL  475

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLD +M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+
Sbjct  476   KAGNILLDTDMNPKVADFGMARIFEMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVY  535

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISG KN + YQ      +L++Y W  W +G+P+E++DP     +Y  NE+ 
Sbjct  536   SFGVLVLEIISGMKNSSLYQLDGSVGNLVTYTWRLWSNGSPLELVDPSFG-DNYQTNEIT  594

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNG  469
             +C+HI LLCVQED D+RPTM  ++ ML++ S+   + PR+P F+  G
Sbjct  595   RCIHIALLCVQEDVDDRPTMSAILQMLTT-SSIALAVPRQPGFFFRG  640



>ref|XP_010503062.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Camelina 
sativa]
Length=486

 Score =   423 bits (1087),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 260/340 (76%), Gaps = 12/340 (4%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV ++   R+ +  +         G  S++ SLQ+DF TI+  TN FS  N++G+G
Sbjct  127   LLFVAVQFYFLKRSKRSYD---------GSASDDGSLQFDFKTIEAATNKFSDSNRLGQG  177

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VY+GMLP+G E+A+KRLS+SS QG  EFKNE  +VAKLQH+NLVRLLG+C + EEK
Sbjct  178   GFGDVYEGMLPNGTEVAVKRLSKSSEQGVDEFKNEATLVAKLQHRNLVRLLGFCVEGEEK  237

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLDYFLFD  ++  L W  R+KII GIARG+LYLH+DSRLRIIHRDLK S
Sbjct  238   ILVYEFVPNKSLDYFLFDPSKRSELSWKTRHKIIGGIARGVLYLHQDSRLRIIHRDLKAS  297

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQTQ NTSRIVGT+GYMSPEYAM G+FS+KSDV+SFG
Sbjct  298   NILLDADMNPKIADFGMARIFGMDQTQSNTSRIVGTFGYMSPEYAMHGQFSMKSDVYSFG  357

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             +++LEII+GK+N N +  T+   DL SY+W  W++G   E+ DP + + S   +EVI+C+
Sbjct  358   IIVLEIITGKRN-NNFNQTDGDSDLASYSWRIWKEGVAEELADPAI-RESCEKDEVIRCI  415

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF  481
             HIGLLCVQED  +RPTM  +V+ML S  T +   P +P +
Sbjct  416   HIGLLCVQEDPADRPTMGTIVMMLCS-RTMSLPDPHQPGY  454



>emb|CDY10928.1| BnaA03g45870D [Brassica napus]
Length=660

 Score =   429 bits (1102),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 208/378 (55%), Positives = 276/378 (73%), Gaps = 10/378 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVT---GEISNEESLQYDFATIQLITNVFSPDNKI  1330
             LLF+AV     +  +KK  T  +T  +     +I+   SLQ++F  I+  T+ FS  NK+
Sbjct  289   LLFVAVF----LVRAKKTRTVYETEPLAQGNDDITASGSLQFEFKAIEAATDKFSLSNKL  344

Query  1329  GEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKR  1150
             G+GG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLVRLLG+C + 
Sbjct  345   GQGGFGQVYKGTFPSGIQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVRLLGFCLEG  404

Query  1149  EEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDL  970
             +EKIL+YEFVPN SLDYFLFDS  Q  L+W KRYKII GIARG+LYLH+DSRL IIHRDL
Sbjct  405   DEKILVYEFVPNKSLDYFLFDSTMQGQLDWKKRYKIIGGIARGILYLHQDSRLTIIHRDL  464

Query  969   KTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVF  790
             K  NILLD  M+PK+ADFGMA+IF +DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+
Sbjct  465   KAGNILLDAGMNPKVADFGMARIFEMDQTEANTKRVVGTYGYMSPEYAMYGQFSMKSDVY  524

Query  789   SFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVI  610
             SFGV++LEIISGKKN + YQ      +L++Y W  W +G+P+E++DP   + +Y  NE+I
Sbjct  525   SFGVLVLEIISGKKNSSLYQMDGSVGNLVTYTWRLWSNGSPLELMDPSF-RDNYLTNEII  583

Query  609   QCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPA-FYRNGSGKVPMREISLE  433
             +C+HI LLCVQED ++RPTM  +V ML++ S+   + PR P  F+R+   +        +
Sbjct  584   RCIHIALLCVQEDVEDRPTMSAIVQMLTT-SSIALAAPRPPGFFFRSRHEQAGRAGPCTD  642

Query  432   LSVTVSDEASTIGKLCPR  379
              S   S + ++I  L PR
Sbjct  643   ASALCSIDDASITSLAPR  660



>ref|XP_002867729.1| cysteine-rich rlk5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43988.1| cysteine-rich rlk5 [Arabidopsis lyrata subsp. lyrata]
Length=664

 Score =   429 bits (1102),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/374 (56%), Positives = 275/374 (74%), Gaps = 3/374 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+AV  F   + +KK +      D   +I+   SLQ+DF  I+  T+ FS  NK+G+G
Sbjct  294   LLFVAVFSFHVRKRAKKPSDTEVANDGEDDITTAGSLQFDFKVIEAATDKFSMCNKLGQG  353

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG+L +G ++A+KRLS++SGQGEKEFKNEV VVAKLQH+NLV+LLG+C +REEK
Sbjct  354   GFGQVYKGILSNGVQVAVKRLSKTSGQGEKEFKNEVVVVAKLQHRNLVKLLGFCLEREEK  413

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFV N SLDYFLFDS  Q  L+W+ RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  414   ILVYEFVSNKSLDYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  473

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PK+ADFGMA+IF +DQT+ +T R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  474   NILLDADMNPKVADFGMARIFEMDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  533

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISGKKN + YQ      +L++Y W  W DG+P+E++D    + +Y  NEVI+C+
Sbjct  534   VLVLEIISGKKNSSLYQMDASFGNLVTYTWRLWSDGSPLELVDSSFLE-NYQRNEVIRCI  592

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HI LLCVQED + RPTM  +V MLS+ S+     P+ P F+     +     I  + S+ 
Sbjct  593   HIALLCVQEDTENRPTMSAIVQMLST-SSIALDVPQPPGFFFRSKHEEAGPSID-KSSLC  650

Query  420   VSDEASTIGKLCPR  379
              S +A++I  + PR
Sbjct  651   CSIDAASITIVAPR  664



>gb|KCW75423.1| hypothetical protein EUGRSUZ_E04183 [Eucalyptus grandis]
Length=626

 Score =   427 bits (1099),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 209/352 (59%), Positives = 268/352 (76%), Gaps = 10/352 (3%)
 Frame = -1

Query  1413  EISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGE  1234
             E++  ESLQ+D ATIQ  TN FSP+NK+GEGG+G V++G LP+GQ+IA+KRLS+SS QG+
Sbjct  278   ELTTVESLQFDLATIQSATNDFSPENKLGEGGFGEVFQGKLPNGQQIAVKRLSQSSRQGD  337

Query  1233  KEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSK  1054
              EFKNEV +VAKLQHKNLVRLLG+C + +EK+L YEFVPN SLDYFLFD ++   L W  
Sbjct  338   DEFKNEVLLVAKLQHKNLVRLLGFCLEGDEKLLAYEFVPNKSLDYFLFDPQKSDKLNWPL  397

Query  1053  RYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGN  874
             RYKI+ GIARG+LYLHE+SRLRIIHRDLK  NILLD  M+PKI+DFGMA+IFG+DQTQ +
Sbjct  398   RYKIVYGIARGMLYLHEESRLRIIHRDLKCGNILLDSEMNPKISDFGMARIFGVDQTQAS  457

Query  873   TSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYA  694
             T++IVGT+GYMSPEYAM G FSVKSDV+SFG++LLEII GKKN   Y   +  + L  YA
Sbjct  458   TNKIVGTFGYMSPEYAMHGRFSVKSDVYSFGILLLEIICGKKN-GFYDQFDGGEYLARYA  516

Query  693   WEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYST  514
             W QWRDGTP+++LDP +  S+ + ++V++C+HI LLC+QED   RPTM  VVLMLSS S 
Sbjct  517   WNQWRDGTPLKVLDPAIVDSN-SRDQVLRCLHICLLCIQEDPAIRPTMATVVLMLSSNSI  575

Query  513   NNWSTPREPAFYRNGSGK---VPMREISLELSVT----VSDEASTIGKLCPR  379
                S PR PAF+     +   +PM  +  + S +    +S+   ++ +L PR
Sbjct  576   TPPS-PRHPAFFVQSKARGLGIPMEGLGSDQSTSRIKLLSNNNLSLTELYPR  626



>emb|CDP16211.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   429 bits (1103),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 267/359 (74%), Gaps = 4/359 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             LFI  L FL+ R S+K    +       EI   ESLQY    IQ+ TN FS DNKIGEGG
Sbjct  306   LFIMALVFLK-RRSRKSYVSMPLEATVAEILTAESLQYSLTEIQIATNNFSVDNKIGEGG  364

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VYKG+L +GQEIA+KRLSRSSGQG +EF+NE+ VVAKLQH+NLVRLLG+C + EEKI
Sbjct  365   FGRVYKGVLGNGQEIAVKRLSRSSGQGAEEFRNEIVVVAKLQHRNLVRLLGFCLEGEEKI  424

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             LIYEFVPN SLDYFLFD E +  L WS+RY II GIA+GLLYLHEDSRLRI+HRDLK SN
Sbjct  425   LIYEFVPNKSLDYFLFDPENKRSLNWSRRYNIIGGIAKGLLYLHEDSRLRIVHRDLKVSN  484

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD NM PKIADFGMAKI G+DQ +GNT+RI GT GYM+PEY   G+FS+KSDVFSFGV
Sbjct  485   ILLDGNMSPKIADFGMAKICGVDQYEGNTNRIAGTVGYMAPEYTRWGQFSLKSDVFSFGV  544

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEI++GKK+ + +Q+ + ++DLLSYAW  WR G  + +LD  +   SY  NEVIQC+ 
Sbjct  545   VILEIVTGKKSSDFHQSRD-SEDLLSYAWNHWRRGQTLALLDSSIGD-SYARNEVIQCIQ  602

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             +GLLCV+E   +RPTM  VV ML+  S+    TP  PA +R+   +  + ++ ++ S T
Sbjct  603   VGLLCVEEYVIKRPTMASVVSMLNP-SSVPLRTPHCPAVFRSCGSESRVDDLKVDQSNT  660



>ref|XP_010057979.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
 gb|KCW75404.1| hypothetical protein EUGRSUZ_E04159 [Eucalyptus grandis]
Length=674

 Score =   429 bits (1103),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 213/356 (60%), Positives = 271/356 (76%), Gaps = 9/356 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LLF+  L  LR R  KK+   ++      E+   ESLQYD ATIQ  TN FS ++K+GEG
Sbjct  300   LLFLTCL--LR-RRGKKKYEVIKGKSGANELITMESLQYDLATIQAATNDFSHESKLGEG  356

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G V++G LP+GQ IA+KRLS+SS QG+ EFKNEV +VAKLQHKNLVRLLG+C +  EK
Sbjct  357   GFGEVFQGGLPNGQTIAVKRLSQSSRQGDDEFKNEVLLVAKLQHKNLVRLLGFCLEGNEK  416

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +L YEFVPN SLD FLFD E++  L+W  RYKI+ GIARG+LYLHEDSRLRIIHRDLK S
Sbjct  417   LLAYEFVPNKSLDCFLFDLEKRGQLDWPLRYKIVFGIARGMLYLHEDSRLRIIHRDLKCS  476

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA+IFG+DQTQ NT++IVGT+GYM+PEYAM GEFSVKSDV+S+G
Sbjct  477   NILLDSEMNPKISDFGMARIFGVDQTQANTNKIVGTFGYMAPEYAMHGEFSVKSDVYSYG  536

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             ++LLEII GK+N N +      + L SYAW QWR+GTP+++LDP +   SY+ ++V++C+
Sbjct  537   IILLEIICGKRN-NYHHQLGGGEYLASYAWNQWREGTPLKVLDPAIV-DSYSRDQVLRCL  594

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGK---VPMREI  442
             HI LLC+QED   RPTM  VVLMLSS S     +P+ PAF+     +   +P+RE+
Sbjct  595   HICLLCIQEDPAIRPTMATVVLMLSSNSI-TLPSPQHPAFFIRSISQGLNIPIREL  649



>gb|KEH40076.1| cysteine-rich receptor-kinase-like protein [Medicago truncatula]
Length=678

 Score =   429 bits (1102),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 216/360 (60%), Positives = 270/360 (75%), Gaps = 8/360 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQ-NTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             L+FI +   LR+R  +K+   +    D   EI   ESLQ+ F TI+  T+ F+  NK+G+
Sbjct  308   LIFICIC--LRVRKPRKKFKIQEGEEDEDVEIEISESLQFTFDTIRDATDDFAASNKLGQ  365

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G+VYKG LP+GQEI +KRLSR SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E
Sbjct  366   GGFGTVYKGRLPNGQEIGVKRLSRDSGQGDLEFKNEVVLVAKLQHRNLVRLLGFCIEGRE  425

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             ++L+YEFV N SLDYFLFD  ++  L W++RYKII G ARG+LYLHEDSRLRIIHRDLK 
Sbjct  426   RLLVYEFVQNKSLDYFLFDQTKRTQLNWNRRYKIIVGTARGILYLHEDSRLRIIHRDLKA  485

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD  M+PKIADFGMA++F +DQTQ NT+RIVGTYGYM+PEYAM G+FSVKSDVFSF
Sbjct  486   SNILLDEEMNPKIADFGMARLFDVDQTQENTNRIVGTYGYMAPEYAMHGQFSVKSDVFSF  545

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQC  604
             GV++LEIISG KN      T+  + LLS+ W  WRDG+P  ++DP L   S  VNE+++C
Sbjct  546   GVLILEIISGHKNSGIRHGTS-TEYLLSFVWRNWRDGSPTNVIDPTLNNDS--VNEIMRC  602

Query  603   VHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY-RNGSGKVPMREISLELS  427
             +HIGLLCVQE+A  RPTM  +VLML+S+S    S P EPAFY  +G+G       SLE S
Sbjct  603   IHIGLLCVQENAASRPTMASIVLMLNSHSL-TLSRPSEPAFYVDSGAGDFQDMMQSLESS  661



>ref|XP_010646639.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Vitis vinifera]
Length=681

 Score =   429 bits (1102),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 219/381 (57%), Positives = 282/381 (74%), Gaps = 17/381 (4%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L   +  FL+ R S++    + T D   EI + ESLQ++   I+  TN FS  NK+G+G
Sbjct  311   MLITFICCFLKRRQSRE---SVSTED---EILSVESLQFNLGPIRNATNNFSDSNKLGQG  364

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG L +GQ+IA+KRLS+ SGQGE EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  365   GFGAVYKGTLSNGQDIAVKRLSKGSGQGELEFKNEVLLVAKLQHRNLVRLLGFCLEGIER  424

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+FLFD  ++  L W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  425   LLIYEFVPNTSLDHFLFDPIKRLQLYWERRYKIIVGIARGLLYLHEDSRLRIIHRDLKAS  484

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKIADFGMAKIF +DQTQG+TSRIVGTYGYM+PEYAM G FSVKSDVFSFG
Sbjct  485   NILLDKEMNPKIADFGMAKIFSLDQTQGDTSRIVGTYGYMAPEYAMHGNFSVKSDVFSFG  544

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG+KN + ++     +DL+S+AW  WRDG+   ++DP ++  S +  E+++C+
Sbjct  545   VLVLEIISGQKN-SCFRNGENVEDLISFAWRSWRDGSAPNVIDPSVSSGSRS--EIMRCI  601

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS--GKVPMREISLELS  427
             HIGLLCVQE+  +RPTM  VVLMLSSYS      P +PAF+ + S   + P+ + S   +
Sbjct  602   HIGLLCVQENVADRPTMASVVLMLSSYSI-TLPLPSQPAFFMHSSMDTEAPLLQDSDSGA  660

Query  426   VTVSDEA-----STIGKLCPR  379
                SD A     ++I +L PR
Sbjct  661   TRSSDNALSVNDASITELHPR  681



>ref|NP_194058.2| cysteine-rich receptor-like protein kinase 19 [Arabidopsis thaliana]
 sp|Q8GWJ7.2|CRK19_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 19; 
Short=Cysteine-rich RLK19; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE84731.1| cysteine-rich receptor-like protein kinase 19 [Arabidopsis thaliana]
Length=645

 Score =   427 bits (1099),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 275/374 (74%), Gaps = 5/374 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             LL +AV + +R +N +  N K    +   +I+   SLQ+DF  I+  TN F P NK+G+G
Sbjct  277   LLLVAV-FSVRAKNKRTLNEKEPVAEDGNDITTAGSLQFDFKAIEAATNCFLPINKLGQG  335

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L SG ++A+KRLS++SGQGEKEF+NEV VVAKLQH+NLV+LLGYC + EEK
Sbjct  336   GFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEK  395

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             IL+YEFVPN SLD+FLFDS  +  L+W++RYKII GIARG+LYLH+DSRL IIHRDLK  
Sbjct  396   ILVYEFVPNKSLDHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAG  455

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD +M+PKIADFGMA+IFG+DQT+  T R+VGTYGYMSPEYAM G+FS+KSDV+SFG
Sbjct  456   NILLDDDMNPKIADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFG  515

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEIISG KN + YQ      +L++Y W  W +G+P E++DP     +Y  +E+ +C+
Sbjct  516   VLVLEIISGMKNSSLYQMDESVGNLVTYTWRLWSNGSPSELVDPSFG-DNYQTSEITRCI  574

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVT  421
             HI LLCVQEDA++RPTM  +V ML++ S    + PR P F+     K      S++ S  
Sbjct  575   HIALLCVQEDAEDRPTMSSIVQMLTT-SLIALAEPRPPGFFFR--SKQEQAGPSIDSSTH  631

Query  420   VSDEASTIGKLCPR  379
              S + ++I ++ PR
Sbjct  632   CSVDEASITRVTPR  645



>ref|XP_010451228.1| PREDICTED: cysteine-rich receptor-like protein kinase 19 [Camelina 
sativa]
Length=679

 Score =   429 bits (1102),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/385 (54%), Positives = 278/385 (72%), Gaps = 17/385 (4%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTG----------EISNEESLQYDFATIQLITNV  1351
             LLFIAV  F     +K++ T   T  + G          +++   SLQ+DF  I+  TN 
Sbjct  301   LLFIAVFCF----RTKRKRTIYGTEPLAGAVEIVSTDRDDLTTAGSLQFDFKVIEATTNK  356

Query  1350  FSPDNKIGEGGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRL  1171
             FS  NK+GEGG+G VYKG  PSG ++A+KRLS++SGQGE+EF+NEV VVAKLQH+NLV+L
Sbjct  357   FSQSNKLGEGGFGEVYKGTFPSGLQVAVKRLSKTSGQGEREFENEVVVVAKLQHRNLVKL  416

Query  1170  LGYCSKREEKILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRL  991
             LGYC + +EKIL+YEFVPN SLDYFLFDS  Q  L+W++RYKII GIARG+LYLH+DSRL
Sbjct  417   LGYCLEGDEKILVYEFVPNKSLDYFLFDSTMQSQLDWTRRYKIIGGIARGILYLHQDSRL  476

Query  990   RIIHRDLKTSNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEF  811
              IIHRDLK  NILLD +M+PK+ADFGMA+IF +DQ + NT ++VGTYGYMSPEYAM G+F
Sbjct  477   TIIHRDLKAGNILLDADMNPKVADFGMARIFEMDQIEANTRKVVGTYGYMSPEYAMYGQF  536

Query  810   SVKSDVFSFGVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSS  631
             S+KSDV+SFG+++LEIISGKKN + YQ    A +L++Y W  WR+G P+E++DP     +
Sbjct  537   SMKSDVYSFGILVLEIISGKKNSSLYQMDGNAGNLVTYTWRLWRNGAPLELVDPSFG-DN  595

Query  630   YTVNEVIQCVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAF-YRNGSGKVP  454
             +   E+ +C+HI LLCVQED ++RPTM  +V ML++ S+   + PR P F +++   +  
Sbjct  596   FQTKEITRCIHIALLCVQEDVEDRPTMSTIVQMLTT-SSIALAMPRPPGFLFQSKHEQAE  654

Query  453   MREISLELSVTVSDEASTIGKLCPR  379
                  ++ S   S + ++I +L PR
Sbjct  655   RAGPYMDTSALCSVDEASITRLDPR  679



>ref|XP_008377957.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At4g00960 [Malus domestica]
Length=610

 Score =   426 bits (1095),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 267/343 (78%), Gaps = 12/343 (3%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             ++F+ +   LR+R +KK   K Q  D   EI + ESLQ+ F TI++ T  FS  NK+G+G
Sbjct  234   IMFMCIC--LRVRKAKK---KFQNAD---EIESAESLQFSFDTIRIATVDFSEANKLGQG  285

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+GSVYKG L +G+EIA+KRLS +SGQG+ EFKNEV +VAKLQH+NLVRLLG+C +  E+
Sbjct  286   GFGSVYKGRLLNGEEIAVKRLSVNSGQGDLEFKNEVLLVAKLQHRNLVRLLGFCLEGVER  345

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+ +FD  ++  L+W +RYKII GI RGL+YLHEDSRLRIIHRD K S
Sbjct  346   LLIYEFVPNASLDHIIFDPIKRAQLDWDRRYKIIVGITRGLIYLHEDSRLRIIHRDXKAS  405

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NIL+D  M PKI+DFGMAK FG+DQTQGNTSRIVGTYGYM+PEYAM G FSVKSDV+SFG
Sbjct  406   NILIDEEMXPKISDFGMAKXFGLDQTQGNTSRIVGTYGYMAPEYAMHGHFSVKSDVYSFG  465

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI+SG+KN N+++     +DLLSYAW+ W++GT   ++DP L   S   NE+++C+
Sbjct  466   VLVLEIVSGQKN-NSFRHGENMEDLLSYAWKCWKEGTASNLIDPALTNGSR--NEIMRCI  522

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRN  472
             HIGLLCVQE+  +RPTM  +VLML+SYS      P +PAF+R+
Sbjct  523   HIGLLCVQENIPDRPTMNAIVLMLNSYSV-TLPVPSQPAFFRD  564



>gb|KCW76436.1| hypothetical protein EUGRSUZ_D00827 [Eucalyptus grandis]
Length=652

 Score =   427 bits (1099),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/340 (61%), Positives = 261/340 (77%), Gaps = 2/340 (1%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             L   +L+F   R   K+N   +   V  +IS   SLQ+D  TI+  T+ FS  NK+GEGG
Sbjct  271   LLCVMLWFTLKRERSKRNNVEEDLIVGSKISELHSLQFDVGTIEAATDYFSNRNKLGEGG  330

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G VY+G LP G +IA KRLS+SS QG +EFKNEVE+VAKLQH+NLVRLLG+  +REE I
Sbjct  331   FGPVYRGTLPCGGKIAAKRLSQSSKQGVREFKNEVELVAKLQHRNLVRLLGFAMEREETI  390

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L+YE+VPNGSLD  LF+  +   L+WS R+KI+ G+ARG+LYLHEDSRLRIIHRDLK SN
Sbjct  391   LVYEYVPNGSLDQLLFNPPQSIRLDWSARHKIMVGVARGILYLHEDSRLRIIHRDLKASN  450

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             ILLD N++PKI+DFGMA+IF  +QTQG+T+RIVGTYGYMSPEYAM G FSVKS+VFSFGV
Sbjct  451   ILLDENLNPKISDFGMARIFCTEQTQGSTNRIVGTYGYMSPEYAMYGRFSVKSNVFSFGV  510

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKNR +Y  ++  + LL+Y WEQWR G P+EI+DP + K SY+ NEVI+C+H
Sbjct  511   LMLEIITGKKNRYSY-ISDDHEGLLNYVWEQWRIGEPLEIVDPTIVK-SYSENEVIRCIH  568

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             IGLLC+Q D + RP M+ VVLMLSS    +   P +P F+
Sbjct  569   IGLLCIQNDKEARPAMDTVVLMLSSADFVSLPLPEQPTFF  608



>ref|XP_009631896.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nicotiana tomentosiformis]
Length=673

 Score =   428 bits (1101),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 216/376 (57%), Positives = 278/376 (74%), Gaps = 5/376 (1%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTD-VTGEISNEESLQYDFATIQLITNVFSPDNKIGE  1324
             LLF  +    R R  K +  K++ +D +   I   ESLQYDF+TI+  TN FS  N+IG+
Sbjct  301   LLFSGIFLLRRWRMKKSKAPKMELSDDLLSGIVTAESLQYDFSTIETATNCFSAQNEIGK  360

Query  1323  GGYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREE  1144
             GG+G VYKG L +GQEIA+KRLSR S QG +EFKNEV +VAKLQH+NLVRLLG+C + EE
Sbjct  361   GGFGDVYKGELITGQEIAVKRLSRRSSQGVEEFKNEVVLVAKLQHRNLVRLLGFCLEGEE  420

Query  1143  KILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKT  964
             KILIYEFVPN SLDYFLFD+++Q +L WS R KIIRGI RGL+YLHEDSR RIIHRDLK 
Sbjct  421   KILIYEFVPNKSLDYFLFDTKKQALLNWSVRDKIIRGIVRGLVYLHEDSRPRIIHRDLKA  480

Query  963   SNILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSF  784
             SNILLD +M+PKI+DFGMA+IFG+DQT+G+T+ IVGTYGYMSPEYAM G+FSVKSDVFSF
Sbjct  481   SNILLDKDMNPKISDFGMARIFGVDQTEGSTNIIVGTYGYMSPEYAMHGQFSVKSDVFSF  540

Query  783   GVMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKS-SYTVNEVIQ  607
             GV+LLEIISGK  R  YQ  +   DLL++AW+ W+D   +E +DP L    S +++EV++
Sbjct  541   GVLLLEIISGKTIRTLYQ-EDGLHDLLTHAWKLWKDDRAMEFVDPTLINGDSKSLSEVVK  599

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELS  427
             C+HIGLLCVQ + DERPT   +  +LS+ S      P  P  ++  +G   + +++ + S
Sbjct  600   CLHIGLLCVQNEVDERPTTALIAHILSTDSA-TLPEPNPPTSFKAYAGMKTINQLTNK-S  657

Query  426   VTVSDEASTIGKLCPR  379
             + +     +I +LCPR
Sbjct  658   IPLPILQESITELCPR  673



>ref|XP_002316621.2| hypothetical protein POPTR_0011s03270g [Populus trichocarpa]
 gb|EEE97233.2| hypothetical protein POPTR_0011s03270g [Populus trichocarpa]
Length=682

 Score =   428 bits (1100),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 222/387 (57%), Positives = 288/387 (74%), Gaps = 22/387 (6%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             +L I +  F+R R  +++  +++T D   EI + ESLQ+ F+TI+  T  FS  NK+G+G
Sbjct  305   ILVICMCLFIRTR-KQREKERIETGD---EIESAESLQFAFSTIRDATEDFSEKNKLGQG  360

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G+VYKG LPSGQEIA+KRLS+ SGQG+ EFKNEV +VA+LQH+NLVRLLG+C +  E+
Sbjct  361   GFGAVYKGALPSGQEIAVKRLSKDSGQGDLEFKNEVLLVARLQHRNLVRLLGFCLQGIER  420

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             +LIYEFVPN SLD+F+FD  ++  L W +RYKII GIARGLLYLHEDSRLRIIHRDLK S
Sbjct  421   LLIYEFVPNASLDHFIFDPIKRVHLNWERRYKIIGGIARGLLYLHEDSRLRIIHRDLKAS  480

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD  M+PKI+DFGMA++F +DQTQGNTSRIVGTYGYM+PEYAMQG FSVKSDVFSFG
Sbjct  481   NILLDEEMNPKISDFGMARLFVVDQTQGNTSRIVGTYGYMAPEYAMQGHFSVKSDVFSFG  540

Query  780   VMLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCV  601
             V++LEI++GKK  N+++  N  + LLS+AW  WR+GT  +I+DPVL+  S T  E+++C+
Sbjct  541   VLVLEIVTGKK--NSFRNGNDIEHLLSHAWRNWREGTAQDIIDPVLSSGSAT--EMLRCI  596

Query  600   HIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGS-------------GK  460
             HIGLLCVQE+  ERPTM  VVLMLSS S      P +PAF+ N S              +
Sbjct  597   HIGLLCVQENVAERPTMASVVLMLSSSSLTL-QIPSQPAFFMNSSTYQSDLSSSMEHNSR  655

Query  459   VPMREISLELSVTVSDEASTIGKLCPR  379
             V    +S  +++ +S    +I +L PR
Sbjct  656   VTESSLSESVAIPLSKNEVSITELYPR  682



>ref|XP_006413570.1| hypothetical protein EUTSA_v10024606mg [Eutrema salsugineum]
 gb|ESQ55023.1| hypothetical protein EUTSA_v10024606mg [Eutrema salsugineum]
Length=670

 Score =   427 bits (1099),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/343 (58%), Positives = 266/343 (78%), Gaps = 7/343 (2%)
 Frame = -1

Query  1500  LLFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEG  1321
             L+ + + +FL  R    Q T+ ++     +IS E S QYDF TI+  TN FS  NK+GEG
Sbjct  302   LILLVLCFFLFRRRKPYQRTENESD---SDISTEHSSQYDFKTIEAATNKFSMSNKLGEG  358

Query  1320  GYGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEK  1141
             G+G VYKG L +G E+A+KRLS+ SGQG +EF+NE  +V+KLQH+NLVRLLG+C +REEK
Sbjct  359   GFGEVYKGKLSNGTEVAVKRLSKKSGQGAREFRNEAVLVSKLQHRNLVRLLGFCLEREEK  418

Query  1140  ILIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTS  961
             ILIYEFVPN SLDYFLFD E+Q  ++W++RY II GIARG+LYLH+DS+L IIHRDLK S
Sbjct  419   ILIYEFVPNKSLDYFLFDPEKQAQVDWTRRYNIIGGIARGILYLHQDSQLTIIHRDLKAS  478

Query  960   NILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFG  781
             NILLD NM+PKI+DFG++ IFG++QT+GNTSRI GTY YMSPEYAM G+FS+KSDV+SFG
Sbjct  479   NILLDANMNPKISDFGLSTIFGMEQTRGNTSRIAGTYAYMSPEYAMHGQFSMKSDVYSFG  538

Query  780   VMLLEIISGKKNRNTYQT--TNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQ  607
             V++LEIISGKKN   YQ   T+ A +L++YAW  WR+ +P+E++DP + + +Y  NEV +
Sbjct  539   VLVLEIISGKKNSGVYQMDETSTAGNLVTYAWRLWRNESPLELVDPAIGR-NYQSNEVTK  597

Query  606   CVHIGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             C+HI LLCVQ++ ++RP +  ++LML+S +T     PR P F+
Sbjct  598   CIHIALLCVQDNPEDRPMLSTIILMLNS-NTMTLPVPRLPEFF  639



>ref|XP_010529555.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Tarenaya 
hassleriana]
Length=667

 Score =   427 bits (1099),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 206/373 (55%), Positives = 279/373 (75%), Gaps = 6/373 (2%)
 Frame = -1

Query  1497  LFIAVLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGG  1318
             +FIA   F+  R  K  +T     D   +I+   SLQ+DF TI+  T  FS  N++G+GG
Sbjct  301   VFIAGYCFVAKRGRKTYDTA-PADDDGDDITAVGSLQFDFKTIEAATYKFSQRNRLGQGG  359

Query  1317  YGSVYKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKI  1138
             +G V+KG LP+G E+A+KRLS++S QGE EFKNEV +VAKLQH+NLVRLLG+C + EEKI
Sbjct  360   FGEVFKGTLPNGTEVAVKRLSKTSDQGENEFKNEVVLVAKLQHRNLVRLLGFCVEGEEKI  419

Query  1137  LIYEFVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSN  958
             L++EFVPN SLDYFLFD+ RQ  L+W  RYKII GI RG+LYLH+DSRL IIHRDLK SN
Sbjct  420   LVFEFVPNKSLDYFLFDTTRQGQLDWRTRYKIIGGITRGILYLHQDSRLTIIHRDLKASN  479

Query  957   ILLDVNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGV  778
             IL+D NM+PKIADFGMA+IFG+DQT+ NT R+VGTYGYMSPEYAM G+FS+KSDV+SFGV
Sbjct  480   ILIDSNMNPKIADFGMARIFGMDQTEANTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGV  539

Query  777   MLLEIISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVH  598
             ++LEII+GKKN + Y+  +   +L++YAW QW +G+P+E++D ++ +  Y   EVI+C+H
Sbjct  540   LVLEIITGKKNSSFYRMDDTVDNLVTYAWRQWSNGSPLELVDAIIGE-DYQKEEVIRCIH  598

Query  597   IGLLCVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRNGSGKVPMREISLELSVTV  418
             IGLLCVQED  +RPT+  +  ML+++S  N   P+ P F+  G+G   +R  +  +  ++
Sbjct  599   IGLLCVQEDPAKRPTLSTIHQMLTNFSI-NLPDPQTPGFFF-GNGVGTIRSTNNSILCSI  656

Query  417   SDEASTIGKLCPR  379
             +D  +T+ +  PR
Sbjct  657   ND--ATVTEFGPR  667



>gb|KHN01547.1| Cysteine-rich receptor-like protein kinase 29 [Glycine soja]
Length=672

 Score =   427 bits (1099),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/338 (61%), Positives = 260/338 (77%), Gaps = 4/338 (1%)
 Frame = -1

Query  1485  VLYFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSV  1306
              LY  R +  K    K +  +V  EI   ESLQ++F TIQ+ T  FS  NK+G+GG+G+V
Sbjct  295   CLYLRRRKARKNLVGKFKEDEVEDEIKIAESLQFNFNTIQVATEDFSDSNKLGQGGFGAV  354

Query  1305  YKGMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYE  1126
             Y+G L +GQ IA+K+LSR S QG+ +FKNEV +VAKLQH+NLVRLLG+C +  E++L+YE
Sbjct  355   YRGRLSNGQMIAVKKLSRDSCQGDTKFKNEVLLVAKLQHRNLVRLLGFCLEGNERLLVYE  414

Query  1125  FVPNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLD  946
             +VPN SLDYF+FD   +  L+W  RYKIIRGIARGLLYLHEDSRLRIIHRDLK SNILLD
Sbjct  415   YVPNKSLDYFIFDPNMKAQLDWKSRYKIIRGIARGLLYLHEDSRLRIIHRDLKASNILLD  474

Query  945   VNMDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLE  766
               M PKIADFGMA++  +DQTQ NTSRIVGTYGYM+PEYAM G+FSVKSDVFSFGV++LE
Sbjct  475   EEMSPKIADFGMARLVLVDQTQANTSRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLE  534

Query  765   IISGKKNRNTYQTTNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLL  586
             I+SG+KN   +   N  +DLLS+AW  W++GT I ILDP L  +S   NE+++C+HIGLL
Sbjct  535   ILSGQKNSGIHHGEN-VEDLLSFAWRSWKEGTAINILDPSLNNNSR--NEMMRCIHIGLL  591

Query  585   CVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFYRN  472
             CVQE+  +RPTM +++LML+SYS  +   P +PAFY N
Sbjct  592   CVQENLADRPTMANIMLMLNSYSL-SLPIPAKPAFYMN  628



>ref|XP_009108591.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Brassica 
rapa]
Length=672

 Score =   427 bits (1098),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/336 (60%), Positives = 267/336 (79%), Gaps = 7/336 (2%)
 Frame = -1

Query  1479  YFLRIRNSKKQNTKLQTTDVTGEISNEESLQYDFATIQLITNVFSPDNKIGEGGYGSVYK  1300
             Y L  R +  Q T+ +      +IS   S QYDF TI++ TN FS  NK+GEGG+G VYK
Sbjct  304   YVLCRRRNSYQRTQFEND---SDISTTNSSQYDFKTIEVATNNFSSSNKLGEGGFGEVYK  360

Query  1299  GMLPSGQEIAIKRLSRSSGQGEKEFKNEVEVVAKLQHKNLVRLLGYCSKREEKILIYEFV  1120
             G L +G E+A+KRLS+ SGQG +EF+NE  +V+KLQH+NLVRLLG+C + EEKILIYEFV
Sbjct  361   GTLSTGTEVAVKRLSKMSGQGTREFRNEAVLVSKLQHRNLVRLLGFCLEGEEKILIYEFV  420

Query  1119  PNGSLDYFLFDSERQHVLEWSKRYKIIRGIARGLLYLHEDSRLRIIHRDLKTSNILLDVN  940
             PN SLDYFLFD E+Q  L+WS+RYKII GIARG+LYLH+DS+L IIHRDLKTSNILLD +
Sbjct  421   PNKSLDYFLFDPEKQGQLDWSQRYKIIGGIARGILYLHQDSQLTIIHRDLKTSNILLDAD  480

Query  939   MDPKIADFGMAKIFGIDQTQGNTSRIVGTYGYMSPEYAMQGEFSVKSDVFSFGVMLLEII  760
             M+PKI+DFG++ IFGIDQTQGNT+RI GTY YMSPEYA+QG+FS+KSDV+SFGV++LEII
Sbjct  481   MNPKISDFGLSTIFGIDQTQGNTNRIAGTYAYMSPEYALQGQFSMKSDVYSFGVLVLEII  540

Query  759   SGKKNRNTYQT--TNRAQDLLSYAWEQWRDGTPIEILDPVLAKSSYTVNEVIQCVHIGLL  586
             SGKKN N YQ   T+ A +L++ AW  WR+G+P+E+LDP + +++ + NEV +C+HI LL
Sbjct  541   SGKKNSNVYQMDETSTAGNLVNNAWRLWRNGSPLELLDPSIGRNNQS-NEVTRCIHIALL  599

Query  585   CVQEDADERPTMEDVVLMLSSYSTNNWSTPREPAFY  478
             CVQ++ ++RP +  ++LML+S +T +   P+ P+F+
Sbjct  600   CVQDNPEDRPMLSTIILMLTS-NTISLPVPQLPSFF  634



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5728754161476