BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25827_g8_i10 len=1418 path=[17673:0-54 11060:55-220 11226:221-263
7395:264-291 7423:292-328 7460:329-330 7462:331-333 7465:334-337
7469:338-344 7476:345-351 5164:352-369 24552:370-372 24555:373-380
24563:381-387 24570:388-402 5215:403-435 23196:436-438 5251:439-445
5258:446-456 5269:457-481 24629:482-482 5295:483-606 5419:607-617
24640:618-630 24653:631-645 5458:646-705 5518:706-729 24705:730-740
5553:741-798 5611:799-857 24739:858-860 5673:861-910 5723:911-918
5731:919-922 5735:923-946 24765:947-966 5779:967-976 24816:977-991
25096:992-1019 24907:1020-1029 5842:1030-1417]

Length=1418
                                                                      Score     E

emb|CAN61169.1|  hypothetical protein VITISV_010446                     515   1e-173   Vitis vinifera
emb|CAN65055.1|  hypothetical protein VITISV_012378                     508   7e-172   Vitis vinifera
emb|CBI30743.3|  unnamed protein product                                505   1e-171   
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...    513   3e-170   
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    515   3e-169   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             516   3e-169   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    514   6e-169   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    512   6e-169   
emb|CBI30748.3|  unnamed protein product                                515   6e-169   
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    513   2e-168   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    514   2e-168   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    513   3e-168   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    512   3e-168   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...    493   4e-168   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    512   7e-168   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    511   9e-168   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    511   1e-167   
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    511   2e-167   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...    500   2e-167   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             510   3e-167   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    509   5e-167   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...    496   1e-166   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    508   3e-166   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    504   3e-166   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    507   5e-166   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    506   1e-165   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             504   1e-165   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    504   3e-165   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...    498   3e-165   
emb|CAN81177.1|  hypothetical protein VITISV_011951                     500   4e-165   Vitis vinifera
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    503   7e-165   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    503   9e-165   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             499   1e-164   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    503   1e-164   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    503   1e-164   
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...    502   1e-164   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    502   1e-164   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    502   2e-164   
ref|XP_007025271.1|  Leucine-rich repeat transmembrane protein ki...    479   3e-164   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...    496   5e-164   
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...    496   1e-163   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             498   2e-163   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             498   3e-163   
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...    498   3e-163   
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...    496   1e-162   
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    496   5e-162   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...    494   7e-162   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    495   9e-162   
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    495   1e-161   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         494   2e-161   
ref|XP_002522279.1|  ATP binding protein, putative                      494   2e-161   Ricinus communis
emb|CBI30745.3|  unnamed protein product                                511   1e-160   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    487   1e-160   
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    491   4e-160   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    491   5e-160   
ref|XP_002528777.1|  ATP binding protein, putative                      490   1e-159   Ricinus communis
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...    483   2e-159   
emb|CDO96888.1|  unnamed protein product                                489   5e-159   
emb|CBI30754.3|  unnamed protein product                                473   2e-158   
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    485   1e-157   
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g            471   2e-157   
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg               465   3e-157   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g            463   3e-157   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...    478   5e-157   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             483   6e-157   Populus trichocarpa [western balsam poplar]
ref|XP_006370931.1|  hypothetical protein POPTR_0019s01880g             463   8e-157   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g             469   1e-156   
emb|CAN66180.1|  hypothetical protein VITISV_025180                     468   2e-156   Vitis vinifera
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g             469   2e-156   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    481   2e-156   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...    481   3e-156   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                     470   6e-156   
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...    479   8e-156   
emb|CBI30750.3|  unnamed protein product                                464   1e-155   
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     473   2e-155   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...    479   2e-155   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910          464   5e-155   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    478   6e-155   
ref|XP_006449568.1|  hypothetical protein CICLE_v10015563mg             457   7e-155   
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    466   1e-154   Glycine max [soybeans]
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    478   1e-154   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    477   1e-154   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...    476   2e-154   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...    469   2e-154   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    466   2e-154   
ref|XP_010313922.1|  PREDICTED: probable LRR receptor-like serine...    474   4e-154   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            462   5e-154   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                     473   5e-154   
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...    473   1e-153   
ref|XP_002305710.2|  hypothetical protein POPTR_0004s06240g             457   1e-153   Populus trichocarpa [western balsam poplar]
ref|XP_011009667.1|  PREDICTED: probable LRR receptor-like serine...    459   1e-153   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1        462   2e-153   
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1        463   2e-153   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg             473   3e-153   
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...    488   3e-153   
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g            462   4e-153   
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...    452   4e-153   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...    468   6e-153   
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g             460   7e-153   Populus trichocarpa [western balsam poplar]
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...    473   7e-153   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...    473   7e-153   
ref|XP_004251900.1|  PREDICTED: probable LRR receptor-like serine...    473   8e-153   
ref|XP_011009666.1|  PREDICTED: probable LRR receptor-like serine...    457   8e-153   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    473   1e-152   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...    465   1e-152   
ref|XP_006377472.1|  hypothetical protein POPTR_0011s06260g             459   1e-152   
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...    480   1e-152   
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g             457   2e-152   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             471   2e-152   Populus trichocarpa [western balsam poplar]
emb|CBI30739.3|  unnamed protein product                                467   2e-152   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g            459   2e-152   
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...    471   3e-152   
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                   471   3e-152   
ref|XP_006358931.1|  PREDICTED: probable LRR receptor-like serine...    471   3e-152   
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g             457   3e-152   
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...    472   4e-152   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g            460   5e-152   Populus trichocarpa [western balsam poplar]
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    470   6e-152   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    470   8e-152   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...    466   9e-152   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             461   9e-152   
ref|XP_006495027.1|  PREDICTED: probable LRR receptor-like serine...    449   1e-151   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    469   1e-151   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    469   1e-151   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...    469   2e-151   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    469   2e-151   Vitis vinifera
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g            462   2e-151   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    468   3e-151   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                         469   3e-151   
ref|XP_006384081.1|  hypothetical protein POPTR_0004s06270g             451   4e-151   
emb|CBI20124.3|  unnamed protein product                                469   5e-151   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg             459   6e-151   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    468   6e-151   
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    468   7e-151   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    468   7e-151   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    468   7e-151   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    468   7e-151   
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g            457   8e-151   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    467   8e-151   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    467   8e-151   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg             459   1e-150   
ref|XP_011014343.1|  PREDICTED: probable LRR receptor-like serine...    464   1e-150   
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...    463   1e-150   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg             468   1e-150   
dbj|BAJ53166.1|  JHL10I11.12                                            465   1e-150   
ref|XP_002532988.1|  conserved hypothetical protein                     465   2e-150   Ricinus communis
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    467   2e-150   
emb|CAN70496.1|  hypothetical protein VITISV_042040                     459   2e-150   Vitis vinifera
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    466   3e-150   
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...    465   3e-150   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    466   3e-150   
ref|XP_010273522.1|  PREDICTED: probable leucine-rich repeat rece...    447   4e-150   
ref|XP_008384519.1|  PREDICTED: TMV resistance protein N-like iso...    463   4e-150   
emb|CBI20136.3|  unnamed protein product                                457   4e-150   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...    467   4e-150   
emb|CBI20153.3|  unnamed protein product                                461   5e-150   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...    466   5e-150   Vitis vinifera
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...    465   5e-150   
emb|CBI20142.3|  unnamed protein product                                466   5e-150   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...    462   6e-150   
ref|XP_009772943.1|  PREDICTED: probable LRR receptor-like serine...    465   6e-150   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...    467   6e-150   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...    466   6e-150   
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...    465   7e-150   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...    465   7e-150   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...    465   7e-150   
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...    464   8e-150   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...    463   9e-150   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...    464   1e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008384518.1|  PREDICTED: TMV resistance protein N-like iso...    462   1e-149   
gb|KCW48008.1|  hypothetical protein EUGRSUZ_K017432                    443   1e-149   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                     462   1e-149   
ref|XP_011002770.1|  PREDICTED: probable LRR receptor-like serine...    464   1e-149   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...    464   1e-149   
ref|XP_006377469.1|  hypothetical protein POPTR_0011s062402g            448   2e-149   
gb|ACN59254.1|  leucine-rich repeat receptor-like protein kinase        460   2e-149   Arabidopsis thaliana [mouse-ear cress]
gb|KDP24894.1|  hypothetical protein JCGZ_25156                         449   2e-149   
gb|KHG04296.1|  hypothetical protein F383_04630                         460   2e-149   
ref|XP_007025276.1|  Receptor-like kinase in flowers 1, putative        462   2e-149   
ref|XP_003634703.1|  PREDICTED: probable leucine-rich repeat rece...    464   2e-149   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...    462   2e-149   
ref|XP_010093471.1|  putative LRR receptor-like serine/threonine-...    462   3e-149   
gb|KHG04295.1|  hypothetical protein F383_04630                         460   3e-149   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...    462   3e-149   
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g             460   4e-149   
gb|AAF75093.1|AC007583_29  Contains similarity to a receptor-like...    449   4e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009619428.1|  PREDICTED: probable LRR receptor-like serine...    463   4e-149   
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...    462   4e-149   
emb|CBI20149.3|  unnamed protein product                                460   4e-149   
ref|XP_006388682.1|  hypothetical protein POPTR_0122s00210g             449   4e-149   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                         464   4e-149   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...    464   5e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...    459   5e-149   
gb|KCW48268.1|  hypothetical protein EUGRSUZ_K020001                    442   5e-149   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase      463   5e-149   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...    462   6e-149   
emb|CDY60204.1|  BnaCnng35830D                                          463   6e-149   
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...    462   7e-149   
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative        462   7e-149   
gb|KFK35729.1|  hypothetical protein AALP_AA4G029100                    463   8e-149   
ref|XP_009144771.1|  PREDICTED: probable LRR receptor-like serine...    463   9e-149   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...    462   9e-149   
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g             450   9e-149   
gb|KHG20508.1|  hypothetical protein F383_03730                         461   9e-149   
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...    461   9e-149   
ref|XP_006389048.1|  hypothetical protein POPTR_0053s00220g             442   1e-148   
gb|KEH38591.1|  LRR receptor-like kinase                                459   1e-148   
ref|XP_010036442.1|  PREDICTED: probable leucine-rich repeat rece...    451   1e-148   
emb|CDY25853.1|  BnaA05g14440D                                          463   1e-148   
ref|XP_004166352.1|  PREDICTED: probable LRR receptor-like serine...    441   1e-148   
gb|KCW67576.1|  hypothetical protein EUGRSUZ_F013322                    441   1e-148   
ref|XP_006392789.1|  hypothetical protein EUTSA_v10011204mg             462   1e-148   
ref|XP_007149532.1|  hypothetical protein PHAVU_005G078100g             452   1e-148   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...    457   2e-148   
emb|CDP06040.1|  unnamed protein product                                461   2e-148   
gb|KCW84087.1|  hypothetical protein EUGRSUZ_B00978                     449   2e-148   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...    461   2e-148   
ref|XP_006304798.1|  hypothetical protein CARUB_v10012394mg             462   2e-148   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...    461   2e-148   
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...    461   3e-148   
gb|KHG25892.1|  putative leucine-rich repeat receptor-like serine...    449   3e-148   
ref|XP_002283578.2|  PREDICTED: probable leucine-rich repeat rece...    461   3e-148   Vitis vinifera
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             462   3e-148   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g            457   3e-148   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...    461   3e-148   
ref|XP_010552133.1|  PREDICTED: probable LRR receptor-like serine...    461   3e-148   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...    460   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010479903.1|  PREDICTED: probable LRR receptor-like serine...    457   4e-148   
gb|KDO77959.1|  hypothetical protein CISIN_1g045835mg                   445   4e-148   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...    458   4e-148   
emb|CBI30752.3|  unnamed protein product                                445   4e-148   
ref|XP_010036440.1|  PREDICTED: probable leucine-rich repeat rece...    452   4e-148   
ref|XP_007213901.1|  hypothetical protein PRUPE_ppa003884mg             446   5e-148   
ref|XP_006384080.1|  hypothetical protein POPTR_0004s06270g             443   5e-148   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g             461   5e-148   Populus trichocarpa [western balsam poplar]
ref|XP_003634705.1|  PREDICTED: probable LRR receptor-like serine...    460   5e-148   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...    456   5e-148   
ref|XP_002316847.1|  receptor-like protein kinase                       460   6e-148   Populus trichocarpa [western balsam poplar]
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...    460   6e-148   
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...    460   6e-148   
gb|KCW84079.1|  hypothetical protein EUGRSUZ_B00960                     447   6e-148   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             459   7e-148   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...    460   8e-148   
ref|XP_002891752.1|  leucine-rich repeat family protein                 460   8e-148   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...    458   8e-148   
ref|XP_010644093.1|  PREDICTED: probable LRR receptor-like serine...    460   8e-148   
gb|KDO42386.1|  hypothetical protein CISIN_1g0041552mg                  444   9e-148   
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...    457   1e-147   
gb|KFK35730.1|  hypothetical protein AALP_AA4G029200                    460   1e-147   
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...    458   1e-147   
ref|NP_175749.1|  putative LRR receptor-like serine/threonine-pro...    460   1e-147   Arabidopsis thaliana [mouse-ear cress]
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                     448   1e-147   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...    459   1e-147   
ref|XP_010644092.1|  PREDICTED: probable LRR receptor-like serine...    460   1e-147   
ref|XP_006370076.1|  hypothetical protein POPTR_0001s39320g             454   1e-147   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...    458   1e-147   
ref|XP_006306238.1|  hypothetical protein CARUB_v10012061mg             460   2e-147   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...    458   2e-147   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...    458   2e-147   
ref|XP_006304589.1|  hypothetical protein CARUB_v10011641mg             459   2e-147   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg             459   2e-147   
ref|XP_008245552.1|  PREDICTED: probable leucine-rich repeat rece...    448   2e-147   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...    459   2e-147   
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                     449   2e-147   
gb|KCW45029.1|  hypothetical protein EUGRSUZ_L013821                    438   2e-147   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              459   2e-147   
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...    460   2e-147   Vitis vinifera
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    459   3e-147   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    459   3e-147   
ref|XP_002283464.2|  PREDICTED: probable LRR receptor-like serine...    459   3e-147   Vitis vinifera
ref|XP_008775550.1|  PREDICTED: probable LRR receptor-like serine...    448   3e-147   
ref|XP_008443633.1|  PREDICTED: probable LRR receptor-like serine...    456   3e-147   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     455   4e-147   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...    458   4e-147   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...    458   4e-147   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g             457   4e-147   
ref|XP_008226374.1|  PREDICTED: probable leucine-rich repeat rece...    442   4e-147   
ref|XP_008443628.1|  PREDICTED: probable LRR receptor-like serine...    456   5e-147   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...    457   5e-147   
ref|XP_008380256.1|  PREDICTED: probable LRR receptor-like serine...    455   5e-147   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...    457   5e-147   
gb|KDP23043.1|  hypothetical protein JCGZ_00508                         444   5e-147   
ref|XP_007214913.1|  hypothetical protein PRUPE_ppa000698mg             458   5e-147   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...    457   6e-147   
ref|XP_003596240.1|  Receptor-like protein kinase                       439   6e-147   
ref|XP_006492254.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    457   7e-147   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...    457   7e-147   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...    457   8e-147   
ref|XP_010462239.1|  PREDICTED: probable LRR receptor-like serine...    457   9e-147   
emb|CAN81779.1|  hypothetical protein VITISV_034284                     456   1e-146   
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...    457   1e-146   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    457   1e-146   
gb|KCW74191.1|  hypothetical protein EUGRSUZ_E02839                     454   1e-146   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...    457   1e-146   
ref|XP_008226378.1|  PREDICTED: probable LRR receptor-like serine...    456   1e-146   
ref|XP_010462235.1|  PREDICTED: probable LRR receptor-like serine...    457   1e-146   
ref|XP_008226377.1|  PREDICTED: probable LRR receptor-like serine...    456   1e-146   
ref|XP_004488999.1|  PREDICTED: probable LRR receptor-like serine...    456   2e-146   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    456   2e-146   
ref|XP_010036439.1|  PREDICTED: probable leucine-rich repeat rece...    451   2e-146   
ref|XP_007213689.1|  hypothetical protein PRUPE_ppa000854mg             455   2e-146   
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...    456   2e-146   
ref|XP_008443627.1|  PREDICTED: probable LRR receptor-like serine...    455   2e-146   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...    454   2e-146   
ref|XP_010479902.1|  PREDICTED: probable LRR receptor-like serine...    457   2e-146   
gb|KCW48028.1|  hypothetical protein EUGRSUZ_K01762                     451   2e-146   
ref|XP_008443626.1|  PREDICTED: probable LRR receptor-like serine...    456   2e-146   
ref|XP_010273497.1|  PREDICTED: probable leucine-rich repeat rece...    455   2e-146   
ref|XP_010057166.1|  PREDICTED: probable LRR receptor-like serine...    455   2e-146   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...    457   3e-146   
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    456   3e-146   
ref|XP_010038877.1|  PREDICTED: probable LRR receptor-like serine...    444   3e-146   
ref|XP_010057167.1|  PREDICTED: probable LRR receptor-like serine...    455   3e-146   
ref|XP_007149537.1|  hypothetical protein PHAVU_005G078500g             455   3e-146   
ref|NP_001238159.1|  receptor-like serine/threonine kinase              462   3e-146   
ref|XP_010500991.1|  PREDICTED: probable LRR receptor-like serine...    456   3e-146   
ref|XP_010522063.1|  PREDICTED: probable LRR receptor-like serine...    455   3e-146   
ref|XP_010273495.1|  PREDICTED: probable leucine-rich repeat rece...    455   3e-146   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    456   3e-146   
emb|CDP06041.1|  unnamed protein product                                455   6e-146   
ref|XP_010273493.1|  PREDICTED: probable leucine-rich repeat rece...    455   6e-146   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...    455   6e-146   
ref|XP_010060736.1|  PREDICTED: probable leucine-rich repeat rece...    444   7e-146   
ref|XP_008358125.1|  PREDICTED: probable leucine-rich repeat rece...    436   7e-146   
ref|XP_002317385.1|  hypothetical protein POPTR_0011s06740g             455   7e-146   
ref|XP_008775549.1|  PREDICTED: probable LRR receptor-like serine...    447   8e-146   
ref|XP_008380254.1|  PREDICTED: probable LRR receptor-like serine...    455   8e-146   
tpg|DAA61113.1|  TPA: putative leucine-rich repeat receptor-like ...    445   9e-146   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...    455   1e-145   
gb|AES66495.2|  LRR receptor-like kinase                                454   1e-145   
ref|XP_010273496.1|  PREDICTED: probable leucine-rich repeat rece...    453   1e-145   
gb|KCW74192.1|  hypothetical protein EUGRSUZ_E02840                     452   1e-145   
ref|XP_011009654.1|  PREDICTED: probable LRR receptor-like serine...    450   1e-145   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg             442   2e-145   
gb|KDP21155.1|  hypothetical protein JCGZ_21626                         445   2e-145   
ref|XP_010093474.1|  putative LRR receptor-like serine/threonine-...    453   2e-145   
gb|KFK43087.1|  hypothetical protein AALP_AA1G077600                    447   2e-145   
ref|NP_001237942.1|  receptor-like protein kinase                       444   2e-145   
ref|XP_002522276.1|  kinase, putative                                   469   2e-145   
ref|XP_004488998.1|  PREDICTED: probable leucine-rich repeat rece...    453   2e-145   
gb|KCW89681.1|  hypothetical protein EUGRSUZ_A01951                     453   3e-145   
ref|XP_010500990.1|  PREDICTED: probable LRR receptor-like serine...    454   3e-145   
ref|XP_010273494.1|  PREDICTED: probable leucine-rich repeat rece...    453   3e-145   
ref|XP_009352711.1|  PREDICTED: probable LRR receptor-like serine...    450   4e-145   
ref|XP_010059064.1|  PREDICTED: probable LRR receptor-like serine...    451   4e-145   
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...    453   4e-145   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...    453   4e-145   
gb|KHG25891.1|  hypothetical protein F383_04348                         452   4e-145   
ref|XP_004491064.1|  PREDICTED: probable leucine-rich repeat rece...    450   4e-145   
ref|XP_007021941.1|  Leucine-rich repeat transmembrane protein ki...    449   4e-145   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...    453   5e-145   
gb|KEH38577.1|  LRR receptor-like kinase                                452   5e-145   
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...    452   5e-145   
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...    444   5e-145   
ref|XP_009352710.1|  PREDICTED: probable LRR receptor-like serine...    450   5e-145   
emb|CBI20145.3|  unnamed protein product                                450   6e-145   
gb|EEC84403.1|  hypothetical protein OsI_30981                          452   7e-145   
ref|XP_011039371.1|  PREDICTED: probable LRR receptor-like serine...    452   7e-145   
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...    452   7e-145   
ref|XP_010053001.1|  PREDICTED: probable LRR receptor-like serine...    452   8e-145   
ref|XP_008449503.1|  PREDICTED: probable LRR receptor-like serine...    452   8e-145   
gb|KCW67586.1|  hypothetical protein EUGRSUZ_F013462                    432   8e-145   
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...    448   8e-145   
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...    452   9e-145   
ref|XP_006377471.1|  hypothetical protein POPTR_0011s06260g             439   9e-145   
ref|XP_007149540.1|  hypothetical protein PHAVU_005G078800g             431   1e-144   
ref|XP_007214614.1|  hypothetical protein PRUPE_ppa001161mg             448   1e-144   
gb|EEE69521.1|  hypothetical protein OsJ_28982                          452   1e-144   
ref|XP_006467584.1|  PREDICTED: probable LRR receptor-like serine...    452   1e-144   
ref|XP_006449567.1|  hypothetical protein CICLE_v10014126mg             452   1e-144   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...    444   1e-144   
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                     441   1e-144   
ref|XP_010916565.1|  PREDICTED: probable LRR receptor-like serine...    451   2e-144   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...    447   2e-144   
gb|KDO49310.1|  hypothetical protein CISIN_1g040908mg                   445   2e-144   
ref|XP_007021942.1|  Leucine-rich repeat transmembrane protein ki...    447   2e-144   
gb|AES66493.2|  LRR receptor-like kinase                                450   2e-144   
ref|XP_009359369.1|  PREDICTED: probable LRR receptor-like serine...    450   2e-144   
ref|XP_004294067.1|  PREDICTED: probable LRR receptor-like serine...    451   2e-144   
ref|XP_008390667.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    434   3e-144   
ref|XP_006575670.1|  PREDICTED: probable LRR receptor-like serine...    448   3e-144   
ref|XP_009352709.1|  PREDICTED: probable LRR receptor-like serine...    450   3e-144   
gb|KCW48041.1|  hypothetical protein EUGRSUZ_K01781                     441   3e-144   
ref|XP_006592942.1|  PREDICTED: probable leucine-rich repeat rece...    449   3e-144   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...    450   3e-144   
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    450   4e-144   
ref|XP_009352708.1|  PREDICTED: probable LRR receptor-like serine...    450   4e-144   
emb|CBI20154.3|  unnamed protein product                                454   4e-144   
ref|XP_010060735.1|  PREDICTED: probable leucine-rich repeat rece...    442   4e-144   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg             447   5e-144   
ref|XP_010038964.1|  PREDICTED: probable LRR receptor-like serine...    442   5e-144   
ref|XP_010064503.1|  PREDICTED: probable leucine-rich repeat rece...    446   5e-144   
ref|XP_009359368.1|  PREDICTED: probable LRR receptor-like serine...    450   5e-144   
ref|XP_009359367.1|  PREDICTED: probable LRR receptor-like serine...    450   5e-144   
ref|XP_009352707.1|  PREDICTED: probable LRR receptor-like serine...    450   6e-144   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...    449   7e-144   
ref|XP_009148012.1|  PREDICTED: probable LRR receptor-like serine...    449   7e-144   
ref|XP_003596245.1|  Receptor-like protein kinase                       446   7e-144   
emb|CDX93632.1|  BnaA06g04160D                                          449   7e-144   
ref|XP_007021938.1|  Leucine-rich repeat transmembrane protein ki...    444   8e-144   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase              454   8e-144   
ref|XP_011009653.1|  PREDICTED: probable LRR receptor-like serine...    449   9e-144   
ref|XP_010273492.1|  PREDICTED: probable leucine-rich repeat rece...    444   1e-143   
gb|KCW84082.1|  hypothetical protein EUGRSUZ_B00963                     447   1e-143   
ref|NP_001237014.1|  receptor-like protein kinase 2-like precursor      449   1e-143   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...    449   1e-143   
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...    450   1e-143   
gb|KHN36922.1|  Putative leucine-rich repeat receptor-like serine...    448   1e-143   
ref|XP_011009652.1|  PREDICTED: probable LRR receptor-like serine...    449   1e-143   
ref|XP_010057163.1|  PREDICTED: probable LRR receptor-like serine...    445   1e-143   
ref|XP_010045768.1|  PREDICTED: probable LRR receptor-like serine...    449   1e-143   
ref|XP_007149541.1|  hypothetical protein PHAVU_005G078900g             448   1e-143   
ref|XP_009396547.1|  PREDICTED: probable LRR receptor-like serine...    449   2e-143   
gb|ABF70100.1|  protein kinase, putative                                449   2e-143   
ref|XP_006595488.1|  PREDICTED: receptor-like protein kinase isof...    449   2e-143   
emb|CAN81226.1|  hypothetical protein VITISV_038168                     445   2e-143   
ref|XP_010112411.1|  putative LRR receptor-like serine/threonine-...    448   2e-143   
ref|XP_010040667.1|  PREDICTED: probable leucine-rich repeat rece...    437   2e-143   
ref|XP_010316863.1|  PREDICTED: probable LRR receptor-like serine...    448   2e-143   
ref|XP_010316862.1|  PREDICTED: probable LRR receptor-like serine...    448   2e-143   
ref|XP_004172595.1|  PREDICTED: probable leucine-rich repeat rece...    438   2e-143   
ref|XP_010316864.1|  PREDICTED: probable LRR receptor-like serine...    447   2e-143   
ref|XP_004146084.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-143   
gb|AEO14875.1|  rfls6 protein                                           449   2e-143   
ref|XP_003519558.1|  PREDICTED: probable LRR receptor-like serine...    448   2e-143   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    448   2e-143   
ref|XP_002892411.1|  hypothetical protein ARALYDRAFT_470791             448   2e-143   
ref|NP_001184930.1|  leucine-rich repeat transmembrane protein ki...    448   3e-143   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase      448   3e-143   
ref|XP_010057165.1|  PREDICTED: probable LRR receptor-like serine...    448   3e-143   
ref|XP_010273491.1|  PREDICTED: probable leucine-rich repeat rece...    444   3e-143   
ref|XP_007021940.1|  Leucine-rich repeat transmembrane protein ki...    448   3e-143   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                     442   3e-143   
ref|XP_006442368.1|  hypothetical protein CICLE_v10018771mg             445   4e-143   
ref|XP_004167668.1|  PREDICTED: probable LRR receptor-like serine...    446   4e-143   
ref|XP_010916513.1|  PREDICTED: probable LRR receptor-like serine...    446   4e-143   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...    443   4e-143   
ref|XP_010475531.1|  PREDICTED: probable LRR receptor-like serine...    444   5e-143   
gb|KCW74195.1|  hypothetical protein EUGRSUZ_E02843                     446   5e-143   
gb|KHN19488.1|  Putative leucine-rich repeat receptor-like serine...    444   5e-143   
emb|CDP06039.1|  unnamed protein product                                447   6e-143   
emb|CAN78284.1|  hypothetical protein VITISV_000422                     445   6e-143   
ref|XP_010038874.1|  PREDICTED: probable leucine-rich repeat rece...    437   6e-143   
ref|XP_010045761.1|  PREDICTED: probable LRR receptor-like serine...    447   6e-143   
gb|KCW48003.1|  hypothetical protein EUGRSUZ_K01737                     436   6e-143   
ref|XP_004140247.1|  PREDICTED: probable LRR receptor-like serine...    447   6e-143   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...    447   7e-143   
ref|XP_004491355.1|  PREDICTED: probable LRR receptor-like serine...    445   7e-143   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...    447   8e-143   
emb|CAN60698.1|  hypothetical protein VITISV_022626                     445   9e-143   
gb|KEH38570.1|  cysteine-rich RLK (receptor-like kinase) protein        440   9e-143   
gb|KEH28415.1|  LRR receptor-like kinase                                443   1e-142   
emb|CAN73789.1|  hypothetical protein VITISV_025000                     436   1e-142   
ref|XP_010246505.1|  PREDICTED: probable LRR receptor-like serine...    446   1e-142   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...    446   1e-142   
ref|XP_010916505.1|  PREDICTED: probable LRR receptor-like serine...    446   1e-142   
gb|KCW67574.1|  hypothetical protein EUGRSUZ_F013302                    437   1e-142   
ref|XP_010655570.1|  PREDICTED: probable LRR receptor-like serine...    441   1e-142   
ref|XP_006358079.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
ref|XP_010248399.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
ref|XP_006417781.1|  hypothetical protein EUTSA_v10006761mg             442   2e-142   
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...    445   2e-142   
gb|ABF72021.1|  protein kinase family protein                           433   2e-142   
ref|XP_010655573.1|  PREDICTED: probable LRR receptor-like serine...    445   2e-142   
ref|XP_010246504.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
ref|XP_011002053.1|  PREDICTED: probable LRR receptor-like serine...    445   2e-142   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
ref|XP_010057164.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...    445   2e-142   
gb|KEH28414.1|  LRR receptor-like kinase                                443   2e-142   
ref|XP_010916533.1|  PREDICTED: probable LRR receptor-like serine...    446   2e-142   
gb|AES66496.2|  LRR receptor-like kinase                                446   2e-142   
ref|XP_008371516.1|  PREDICTED: probable LRR receptor-like serine...    424   2e-142   
ref|XP_007211339.1|  hypothetical protein PRUPE_ppa001122mg             442   2e-142   
ref|XP_002305716.2|  hypothetical protein POPTR_0004s06180g             447   2e-142   
ref|XP_007132111.1|  hypothetical protein PHAVU_011G067400g             445   3e-142   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...    444   3e-142   
ref|XP_010242178.1|  PREDICTED: probable LRR receptor-like serine...    444   3e-142   
gb|KCW75321.1|  hypothetical protein EUGRSUZ_E04067                     434   3e-142   
gb|KEH19394.1|  LRR receptor-like kinase                                442   3e-142   
emb|CDX95138.1|  BnaC05g05330D                                          445   3e-142   
ref|XP_006477833.1|  PREDICTED: probable leucine-rich repeat rece...    444   3e-142   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...    447   4e-142   
ref|XP_011002052.1|  PREDICTED: probable LRR receptor-like serine...    445   4e-142   
gb|KCW67560.1|  hypothetical protein EUGRSUZ_F013102                    444   4e-142   
ref|XP_006442357.1|  hypothetical protein CICLE_v10018686mg             444   4e-142   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...    441   4e-142   
ref|XP_006377511.1|  hypothetical protein POPTR_0011s065701g            432   5e-142   
emb|CDP18745.1|  unnamed protein product                                445   5e-142   
gb|KHG04404.1|  putative LRR receptor-like serine/threonine-prote...    440   5e-142   
ref|XP_010916525.1|  PREDICTED: probable LRR receptor-like serine...    445   5e-142   
ref|XP_002524514.1|  ATP binding protein, putative                      444   5e-142   
ref|XP_010060737.1|  PREDICTED: probable leucine-rich repeat rece...    444   5e-142   
ref|XP_010057162.1|  PREDICTED: probable LRR receptor-like serine...    444   5e-142   
gb|KEH28296.1|  LRR receptor-like kinase                                441   5e-142   
ref|XP_011085314.1|  PREDICTED: probable LRR receptor-like serine...    444   6e-142   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...    444   6e-142   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...    441   7e-142   
ref|XP_010242177.1|  PREDICTED: probable LRR receptor-like serine...    444   7e-142   
gb|KCW67558.1|  hypothetical protein EUGRSUZ_F01308                     434   8e-142   



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score =   515 bits (1327),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 243/332 (73%), Positives = 286/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  305   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  364

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + QL +D
Sbjct  365   GNREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGQVEYQLNLD  424

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  425   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  484

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+Y CLLDW
Sbjct  485   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDW  544

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG++F K++A++M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  545   AFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  604

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             I EY  N      E  F+A+   Y++M + SS
Sbjct  605   IQEYPLNPSIYGDEFGFEALRGQYDQMQLQSS  636



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score =   508 bits (1308),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 281/341 (82%), Gaps = 13/341 (4%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYK-------------GTLLDGT  361
             ELR LDL TG FT  QIKAATNNFD ANK+GEGGFGSVYK             GTLLDGT
Sbjct  201   ELRGLDLQTGFFTLRQIKAATNNFDAANKLGEGGFGSVYKTLDLKHARNFPIQGTLLDGT  260

Query  362   VIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLAN  541
             +IAVKQLSSKS QGNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA 
Sbjct  261   IIAVKQLSSKSKQGNREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLAR  320

Query  542   ALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKIS  721
             ALFG E+ QLK+DW TRQRICVGIAKGLAFLHEES +K+VHRDIKT N+LLD++LNPKIS
Sbjct  321   ALFGREEFQLKLDWPTRQRICVGIAKGLAFLHEESALKIVHRDIKTNNILLDRDLNPKIS  380

Query  722   DFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMK  901
             DFGLAKLD++E +HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK
Sbjct  381   DFGLAKLDEEENTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  440

Query  902   FRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPS  1081
             +RP+E+Y  LLDWA  LQ+KGNLMEL+DP+L SDF+KE+ L+M++++LLCTNPSP LRP+
Sbjct  441   YRPNEDYFSLLDWAFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPT  500

Query  1082  MSTVVSMLEGNGDILEYKSNIRELNFQAV*VHYEEMSIGSS  1204
             MS VV+MLEG   + E+  N      +A+   Y +M    S
Sbjct  501   MSAVVNMLEGRAPVQEFPLNPIIFGDEALRSQYSQMHFHRS  541



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   505 bits (1301),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 238/333 (71%), Positives = 283/333 (85%), Gaps = 4/333 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  170   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  229

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G+REF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + +L +D
Sbjct  230   GSREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGKVEYRLNLD  289

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  290   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  349

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+Y CLLDW
Sbjct  350   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDW  409

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP LG++F KE+A++M++VALLCTN SP LRP+MS VVSML+G   
Sbjct  410   AFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTV  469

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSSD  1207
             + EY  N      E  F+A+   +++  + SS 
Sbjct  470   VQEYPLNPSIYGDEFGFEALRGQHDQTQLQSSS  502



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score =   513 bits (1322),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 246/332 (74%), Positives = 285/332 (86%), Gaps = 5/332 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTLLDGT+IAVKQLSSKSSQ
Sbjct  499   ELRGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSSQ  558

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENN LA ALFG  + QL++D
Sbjct  559   GNREFVNEIGMISGLQHPNLVRLYGCCIEGNQLLLVYEYMENNCLARALFGGGEIQLQLD  618

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  NVLLD+ELNPKISDFGLAKLD++  +
Sbjct  619   WPTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNVLLDRELNPKISDFGLAKLDEEGNT  678

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK++P+E+YVCLLDW
Sbjct  679   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDW  738

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG+D +KE+A  M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  739   AFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  798

Query  1121  -----ILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  I++  S    L F A+   Y++M + S
Sbjct  799   VPEVLIMDPSSYSDHLKFNALRGQYDQMQLES  830



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   515 bits (1327),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 281/328 (86%), Gaps = 0/328 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANK+GEGGFGSVYKGTLLDGT+IAVKQLSSKS Q
Sbjct  645   ELRGLDLQTGFFTLRQIKAATNNFDAANKLGEGGFGSVYKGTLLDGTIIAVKQLSSKSKQ  704

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+D
Sbjct  705   GNREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGREEFQLKLD  764

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIAKGLAFLHEES +K+VHRDIKT N+LLD++LNPKISDFGLAKLD++E +
Sbjct  765   WPTRQRICVGIAKGLAFLHEESALKIVHRDIKTNNILLDRDLNPKISDFGLAKLDEEENT  824

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+E+Y  LLDW
Sbjct  825   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEDYFSLLDW  884

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A  LQ+KGNLMEL+DP+L SDF+KE+ L+M++++LLCTNPSP LRP+MS VV+MLEG   
Sbjct  885   AFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAP  944

Query  1121  ILEYKSNIRELNFQAV*VHYEEMSIGSS  1204
             + E+  N      +A+   Y +M    S
Sbjct  945   VQEFPLNPIIFGDEALRSQYSQMHFHRS  972



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   516 bits (1328),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 239/302 (79%), Positives = 276/302 (91%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR+LDL TG FTF QIKAATNNFD+ NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  654   LRELDLQTGFFTFRQIKAATNNFDLKNKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  713

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG E+  LK+DW
Sbjct  714   NREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDW  773

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GLAFLHEES +KVVHRDIKT N+LLD +L+PKISDFGLAKLD++E +H
Sbjct  774   PTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTH  833

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  834   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  893

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLM+L+DPRLGS+F KE+A++M++VALLCTNP+P LRPSMS+VVSMLEG   +
Sbjct  894   LVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPSMSSVVSMLEGKTAV  953

Query  1124  LE  1129
              E
Sbjct  954   HE  955



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   514 bits (1324),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 248/327 (76%), Positives = 286/327 (87%), Gaps = 4/327 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKS Q
Sbjct  644   ELRGLDLLTGVFTIRQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFGS++ +L+I+
Sbjct  704   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLALALFGSDEHRLQIE  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ IC+GIAKGLAFLHEES++K+VHRD+K  NVLLDK+LNPKISDFGLAKLDD++K+
Sbjct  764   WPTRQNICIGIAKGLAFLHEESSLKIVHRDMKATNVLLDKKLNPKISDFGLAKLDDEDKT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+E +VCLLDW
Sbjct  824   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEKFVCLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+ G LMEL+D  L SDF K++AL+M+ VALLCTNPSP LRP+MS VVS+LE + D
Sbjct  884   ALVLQKHGKLMELVDETLNSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLD  943

Query  1121  I----LEYKSNIRELNFQAV*VHYEEM  1189
             +    LE +S+  EL FQ +   Y+EM
Sbjct  944   LPEFNLESRSHDDELKFQGLRDKYDEM  970



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score =   512 bits (1319),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 243/334 (73%), Positives = 288/334 (86%), Gaps = 4/334 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  573   ELRGLDLQTGIFTFRQIKAATSNFDAANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  632

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L HPNLV+LYGCCVER  LLLVYEYMENN+L++ LFG ED Q K+D
Sbjct  633   GNREFVNEIGMMSGLHHPNLVRLYGCCVERNQLLLVYEYMENNNLSHVLFGPEDCQPKLD  692

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGLA+LHEES +K++HRDIK  NVLLDK+LNPKISDFGLAKL D+EK+
Sbjct  693   WPTRQKICVGIAKGLAYLHEESPLKMIHRDIKGTNVLLDKDLNPKISDFGLAKLHDEEKT  752

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             H++TRVAGTIGY APEYALWGYLT K D+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  753   HVTTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDW  812

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+KG  +EL+DPRLGS++DK++AL+M++VAL CTNPSPVLRP+MS VV+MLEG  +
Sbjct  813   ALVLQKKGKFLELVDPRLGSNYDKKEALRMIKVALRCTNPSPVLRPNMSAVVNMLEGRLN  872

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             I E   +      ELNFQ +   Y+EM + SS++
Sbjct  873   IDESNFDSSGYGDELNFQGLRDKYDEMQVTSSEN  906



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   515 bits (1326),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 281/328 (86%), Gaps = 0/328 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANK+GEGGFGSVYKGTLLDGT+IAVKQLSSKS Q
Sbjct  656   ELRGLDLQTGFFTLRQIKAATNNFDAANKLGEGGFGSVYKGTLLDGTIIAVKQLSSKSKQ  715

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+D
Sbjct  716   GNREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGREEFQLKLD  775

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIAKGLAFLHEES +K+VHRDIKT N+LLD++LNPKISDFGLAKLD++E +
Sbjct  776   WPTRQRICVGIAKGLAFLHEESALKIVHRDIKTNNILLDRDLNPKISDFGLAKLDEEENT  835

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+E+Y  LLDW
Sbjct  836   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEDYFSLLDW  895

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A  LQ+KGNLMEL+DP+L SDF+KE+ L+M++++LLCTNPSP LRP+MS VV+MLEG   
Sbjct  896   AFFLQQKGNLMELVDPKLESDFNKEEVLRMIKISLLCTNPSPALRPTMSAVVNMLEGRAP  955

Query  1121  ILEYKSNIRELNFQAV*VHYEEMSIGSS  1204
             + E+  N      +A+   Y +M    S
Sbjct  956   VQEFPLNPIIFGDEALRSQYSQMHFHRS  983



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   513 bits (1320),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/332 (74%), Positives = 285/332 (86%), Gaps = 5/332 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTLLDGT+IAVKQLSSKSSQ
Sbjct  621   ELRGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSSQ  680

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENN LA ALFG  + QL++D
Sbjct  681   GNREFVNEIGMISGLQHPNLVRLYGCCIEGNQLLLVYEYMENNCLARALFGGGEIQLQLD  740

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  NVLLD+ELNPKISDFGLAKLD++  +
Sbjct  741   WPTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNVLLDRELNPKISDFGLAKLDEEGNT  800

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK++P+E+YVCLLDW
Sbjct  801   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDW  860

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG+D +KE+A  M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  861   AFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  920

Query  1121  -----ILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  I++  S    L F A+   Y++M + S
Sbjct  921   VPEVLIMDPSSYSDHLKFNALRGQYDQMQLES  952



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   514 bits (1323),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/330 (75%), Positives = 283/330 (86%), Gaps = 7/330 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKS Q
Sbjct  671   ELRGLDLLTGVFTIRQIKAATNNFDAANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSKQ  730

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L+ID
Sbjct  731   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLALALFGPEEHRLQID  790

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++K+
Sbjct  791   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDKT  850

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+E +VCLLDW
Sbjct  851   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNEKFVCLLDW  910

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+ G LMEL+D  L SDF K++AL+M+ VALLCTNPSP LRP+MS VVS+LE + D
Sbjct  911   ALVLQKHGKLMELVDETLSSDFKKDEALRMINVALLCTNPSPALRPTMSAVVSILEDHLD  970

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEM  1189
             + E+    R       EL FQ +   Y+EM
Sbjct  971   LPEFNLESRSHDDDDDELKFQGLRDKYDEM  1000



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   513 bits (1321),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/302 (78%), Positives = 276/302 (91%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR+LDL TG FTF QIKAATNNFD+ NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  654   LRELDLQTGFFTFRQIKAATNNFDLKNKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  713

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG E+  LK+DW
Sbjct  714   NREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDW  773

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GLAFLHEES +KVVHRDIKT N+LLD +L+PKISDFGLAKLD++E +H
Sbjct  774   PTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTH  833

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  834   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  893

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLM+L+DPRLGS+F +E+A++M++VALLCTNP+P LRP+MS+VVSMLEG   +
Sbjct  894   LVLQQKGNLMDLVDPRLGSNFSEEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTV  953

Query  1124  LE  1129
              E
Sbjct  954   HE  955



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   512 bits (1318),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/332 (74%), Positives = 285/332 (86%), Gaps = 5/332 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTLLDGT+IAVKQLSSKSSQ
Sbjct  620   ELRGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSSQ  679

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENN LA ALFG  + QL++D
Sbjct  680   GNREFVNEIGMISGLQHPNLVRLYGCCIEGNQLLLVYEYMENNCLARALFGGGEIQLQLD  739

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  NVLLD+ELNPKISDFGLAKLD++  +
Sbjct  740   WPTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNVLLDRELNPKISDFGLAKLDEEGNT  799

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK++P+E+YVCLLDW
Sbjct  800   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDW  859

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG+D +KE+A  M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  860   AFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  919

Query  1121  -----ILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  I++  S    L F A+   Y++M + S
Sbjct  920   VPEVLIMDPSSYSDHLKFNALRGQYDQMQLES  951



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score =   493 bits (1268),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 237/338 (70%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIK AT+NFD ANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKS Q
Sbjct  67    ELRGLDLLTGVFTIRQIKVATDNFDAANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSKQ  126

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +LKID
Sbjct  127   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLKID  186

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  N+LLD +LNPKISDFGLAKLDD++ +
Sbjct  187   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNILLDNKLNPKISDFGLAKLDDEDNT  246

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  247   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  306

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A+VLQ +G LM+L+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS V+ +LE + D
Sbjct  307   AVVLQRQGKLMDLVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVIRILEDHLD  366

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y  M   S   P
Sbjct  367   LPEFNVESRFYDDCDDHLNFQGLRDKYGPMLSSSQSQP  404



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   512 bits (1318),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 246/332 (74%), Positives = 285/332 (86%), Gaps = 5/332 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTLLDGT+IAVKQLSSKSSQ
Sbjct  643   ELRGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSSQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENN LA ALFG  + QL++D
Sbjct  703   GNREFVNEIGMISGLQHPNLVRLYGCCIEGNQLLLVYEYMENNCLARALFGGGEIQLQLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  NVLLD+ELNPKISDFGLAKLD++  +
Sbjct  763   WPTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNVLLDRELNPKISDFGLAKLDEEGNT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK++P+E+YVCLLDW
Sbjct  823   HISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG+D +KE+A  M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  883   AFVLQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  942

Query  1121  -----ILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  I++  S    L F A+   Y++M + S
Sbjct  943   VPEVLIMDPSSYSDHLKFNALRGQYDQMQLES  974



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   511 bits (1316),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 245/336 (73%), Positives = 288/336 (86%), Gaps = 8/336 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  643   ELRGLDLQTGIFTFRQIKAATSNFDSANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L HPNLV+LYGCCVER  LLLVYEYMENN+L++ LFG ED Q K+D
Sbjct  703   GNREFVNEIGMMSGLHHPNLVRLYGCCVERNQLLLVYEYMENNNLSHVLFGPEDCQPKLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGLA+LHEES +K++HRDIK  NVLLDK+LNPKISDFGLAKL D+EK+
Sbjct  763   WPTRQKICVGIAKGLAYLHEESPLKMIHRDIKGTNVLLDKDLNPKISDFGLAKLHDEEKT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             H++TRVAGTIGY APEYALWGYLT KAD+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  823   HVTTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMKYHPDENYVCLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+KG  +EL+DPRLGS +DKE+AL+M++VAL CTNPSP LRP+MS VV+MLEG  +
Sbjct  883   ALVLQKKGKFLELVDPRLGSYYDKEEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLN  942

Query  1121  ILEYKSNI------RELNFQAV*VHYEEMSIGSSDS  1210
             + E  SNI       E NFQ +   Y+EM + SS++
Sbjct  943   VDE--SNIDSSGYDDEFNFQGLRDKYDEMQVTSSEN  976



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   511 bits (1315),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 242/332 (73%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  641   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  700

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + QL +D
Sbjct  701   GNREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGQVEYQLNLD  760

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  761   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  820

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+  CLLDW
Sbjct  821   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDW  880

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG++F K++A++M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  881   AFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  940

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             I EY  N      E  F+A+   Y++M + SS
Sbjct  941   IQEYPLNPSIYGDEFGFEALRGQYDQMQLQSS  972



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   511 bits (1315),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 242/332 (73%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  647   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  706

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + QL +D
Sbjct  707   GNREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGQVEYQLNLD  766

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  767   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  826

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+  CLLDW
Sbjct  827   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDW  886

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG++F K++A++M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  887   AFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  946

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             I EY  N      E  F+A+   Y++M + SS
Sbjct  947   IQEYPLNPSIYGDEFGFEALRGQYDQMQLQSS  978



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score =   500 bits (1287),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 232/296 (78%), Positives = 267/296 (90%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  307   LRGLDLQTGFFTFRQIKAATNNFDPENKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  366

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS L HPNLV+LYGCC+E   LLLVYEYMENNSLA+ LFG E+  LK+DW
Sbjct  367   NREFVNEIGMISALHHPNLVRLYGCCIESNQLLLVYEYMENNSLAHTLFGLEEGPLKLDW  426

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
             +TRQ+IC+GIA+GLAFLHEES +KVVHRDIK  N+LLD++LN KISDFGLAKLD++E +H
Sbjct  427   STRQKICIGIARGLAFLHEESPLKVVHRDIKATNILLDQDLNAKISDFGLAKLDEEENTH  486

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  487   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  546

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             LVLQ+KGNL+EL+DPRLGSDF+ E+ + M++VALLC NP+P LRP+MS VVSMLEG
Sbjct  547   LVLQQKGNLIELVDPRLGSDFEVEEVITMVKVALLCINPAPALRPTMSAVVSMLEG  602



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   510 bits (1314),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 236/302 (78%), Positives = 275/302 (91%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR+LDL TG FTF QIKAATNNFD+ NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  654   LRELDLQTGFFTFRQIKAATNNFDLKNKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  713

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG E+  LK+DW
Sbjct  714   NREFVNEIGMISGLQHPNLVRLYGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDW  773

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GLAFLHEES +KVVHRDIKT N+LLD +L+PKISDFGLAKLD++E +H
Sbjct  774   PTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTH  833

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  834   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  893

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+K NLM+L+DPRLGS+F KE+A++M++VALLCTNP+P LRP+MS+V+SMLEG   +
Sbjct  894   LVLQQKWNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVLSMLEGKTAV  953

Query  1124  LE  1129
              E
Sbjct  954   HE  955



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   509 bits (1312),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 236/302 (78%), Positives = 274/302 (91%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR+LDL TG FTF QIKAATNNFD+ NKIGEGGFGSVYKG LLDG +IAVKQLSSKS QG
Sbjct  654   LRELDLQTGFFTFRQIKAATNNFDLKNKIGEGGFGSVYKGILLDGNIIAVKQLSSKSKQG  713

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+L GCC+E   LLLVYEYMENNSLA ALFG E+  LK+DW
Sbjct  714   NREFVNEIGMISGLQHPNLVRLIGCCIEANQLLLVYEYMENNSLARALFGPEEGPLKLDW  773

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GLAFLHEES +KVVHRDIKT N+LLD +L+PKISDFGLAKLD++E +H
Sbjct  774   PTRQKICLGIARGLAFLHEESALKVVHRDIKTTNILLDHDLSPKISDFGLAKLDEEENTH  833

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  834   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  893

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLM+L+DPRLGS+F KE+A++M++VALLCTNP+P LRP+MS+VVSMLEG   +
Sbjct  894   LVLQQKGNLMDLVDPRLGSNFSKEEAIRMVKVALLCTNPAPALRPTMSSVVSMLEGKTTV  953

Query  1124  LE  1129
              E
Sbjct  954   HE  955



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 229/296 (77%), Positives = 266/296 (90%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             L+ LDL TG FTF QIKAATNNFD ANK+GEGGFGSVYKG LLDGT+IAVKQLSS+S QG
Sbjct  268   LKGLDLQTGFFTFRQIKAATNNFDAANKLGEGGFGSVYKGVLLDGTIIAVKQLSSRSKQG  327

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLVKL+GCC+E K LLLVYEYMENN+LA +LFG +D QLK+DW
Sbjct  328   NREFVNEIGMISALQHPNLVKLHGCCIEGKQLLLVYEYMENNNLALSLFGPKDGQLKLDW  387

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+ICVG+A+GLAFLHEES +K+VHRDIK  N+LLD++LNPKISDFGLAKLD++E +H
Sbjct  388   PTRQKICVGVARGLAFLHEESPLKIVHRDIKATNILLDRDLNPKISDFGLAKLDEEENTH  447

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             I+TRVAGTIGY APEYALWGYLTFKADVYSFG+VALE+V+G +N KF PDE+YVCLLDWA
Sbjct  448   ITTRVAGTIGYMAPEYALWGYLTFKADVYSFGIVALELVAGISNTKFGPDEDYVCLLDWA  507

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             LV Q+KG LM L+DPRLGSDF+ E+A +M++VAL CTNPSP LRP+MS VVSMLEG
Sbjct  508   LVSQQKGKLMRLVDPRLGSDFNTEEAARMIKVALQCTNPSPALRPTMSAVVSMLEG  563



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   508 bits (1307),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 244/336 (73%), Positives = 286/336 (85%), Gaps = 8/336 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  643   ELRGLDLQTGIFTFRQIKAATSNFDAANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L+HPNLV+LYGCCVER  LLLVYEYMENN L++ LFG E+   K+D
Sbjct  703   GNREFVNEIGMMSGLRHPNLVRLYGCCVERNQLLLVYEYMENNCLSHVLFGPEECPPKLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGL +LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKL D+EK+
Sbjct  763   WPTRQKICVGIAKGLFYLHEESPLKIVHRDIKGTNVLLDKDLNAKISDFGLAKLHDEEKT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TRVAGTIGY APEYALWGYLT KAD+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  823   HITTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMKYNPDENYVCLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ KG  +EL+DPRLGS+++K++AL+M++VALLCTNPSP LRP+MSTVV MLEG  D
Sbjct  883   ALVLQRKGKFLELVDPRLGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLD  942

Query  1121  ILEYKSNI------RELNFQAV*VHYEEMSIGSSDS  1210
             + E  SNI       E NFQ +   Y+EM + SS++
Sbjct  943   VNE--SNIDSSAYDDEFNFQGLRDKYDEMQVNSSEN  976



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   504 bits (1297),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 285/336 (85%), Gaps = 8/336 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  524   ELRGLDLQTGIFTFRQIKAATSNFDTANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  583

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L HPNLV+LYGCCVER  LLLVYEYMENN+L + LFG ED Q K+D
Sbjct  584   GNREFVNEIGMMSGLHHPNLVRLYGCCVERNELLLVYEYMENNNLTHVLFGPEDCQPKLD  643

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGLA+LHEES +K++HRDIK  NVLLDK+LNPKISDFGLAKL D+EK+
Sbjct  644   WPTRQKICVGIAKGLAYLHEESPLKMIHRDIKGTNVLLDKDLNPKISDFGLAKLHDEEKT  703

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             H++TRVAGTIGY APEYALWGYLT K D+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  704   HVTTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDW  763

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+K   +EL+DPRLGS++DK++AL+M++VAL CTNPSP LRP+MS VV+MLEG  +
Sbjct  764   ALVLQKKAKFLELVDPRLGSNYDKKEALRMIKVALRCTNPSPALRPNMSAVVNMLEGRLN  823

Query  1121  ILEYKSNI------RELNFQAV*VHYEEMSIGSSDS  1210
             + E  SN        ELNF  +   Y+EM + SS++
Sbjct  824   VDE--SNFDSSGYGDELNFLGLRDKYDEMQVTSSEN  857



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   507 bits (1305),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 244/336 (73%), Positives = 286/336 (85%), Gaps = 8/336 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  643   ELRGLDLQTGIFTFRQIKAATSNFDAANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L+HPNLV+LYGCCVER  LLLVYEYMENN L++ LFG E+   K+D
Sbjct  703   GNREFVNEIGMMSGLRHPNLVRLYGCCVERNQLLLVYEYMENNCLSHVLFGPEECPPKLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGL +LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKL D+EK+
Sbjct  763   WPTRQKICVGIAKGLFYLHEESPLKIVHRDIKGTNVLLDKDLNAKISDFGLAKLHDEEKT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TRVAGTIGY APEYALWGYLT KAD+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  823   HITTRVAGTIGYMAPEYALWGYLTHKADLYSFGVVVLELVAGKNNMKYNPDENYVCLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ KG  +EL+DPRLGS+++K++AL+M++VALLCTNPSP LRP+MSTVV MLEG  D
Sbjct  883   ALVLQRKGKFLELVDPRLGSNYNKKEALRMIKVALLCTNPSPALRPNMSTVVKMLEGRLD  942

Query  1121  ILEYKSNI------RELNFQAV*VHYEEMSIGSSDS  1210
             + E  SNI       E NFQ +   Y+EM + SS++
Sbjct  943   VNE--SNIDSSAYDDEFNFQGLRDKYDEMQVNSSEN  976



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   506 bits (1302),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 241/336 (72%), Positives = 285/336 (85%), Gaps = 8/336 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FTF QIKAAT+NFD ANK+GEGGFGSVYKGTL DGT+IAVKQLSSKS Q
Sbjct  643   ELRGLDLQTGIFTFRQIKAATSNFDTANKLGEGGFGSVYKGTLADGTIIAVKQLSSKSRQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG++S L HPNLV+LYGCCVER  LLLVYEYMENN+L + LFG ED Q K+D
Sbjct  703   GNREFVNEIGMMSGLHHPNLVRLYGCCVERNELLLVYEYMENNNLTHVLFGPEDCQPKLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGLA+LHEES +K++HRDIK  NVLLDK+LNPKISDFGLAKL D+EK+
Sbjct  763   WPTRQKICVGIAKGLAYLHEESPLKMIHRDIKGTNVLLDKDLNPKISDFGLAKLHDEEKT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             H++TRVAGTIGY APEYALWGYLT K D+YSFGVV LE+V+GKNNMK+ PDENYVCLLDW
Sbjct  823   HVTTRVAGTIGYMAPEYALWGYLTHKVDLYSFGVVVLELVAGKNNMKYHPDENYVCLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+K   +EL+DPRLGS++DK++AL+M++VAL CTNPSP LRP+MS VV+MLEG  +
Sbjct  883   ALVLQKKAKFLELVDPRLGSNYDKKEALRMIKVALQCTNPSPALRPNMSAVVNMLEGRLN  942

Query  1121  ILEYKSNI------RELNFQAV*VHYEEMSIGSSDS  1210
             + E  SN        E NFQ +   Y+EM + SS++
Sbjct  943   VDE--SNFDSSGYDDEFNFQGLRDKYDEMQVTSSEN  976



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   504 bits (1298),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 239/318 (75%), Positives = 277/318 (87%), Gaps = 4/318 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR  DL TG F F QIKAATNNFD ANK+GEGGFG+VYKG LLDGT+IAVKQLSSKS QG
Sbjct  604   LRGFDLQTGFFRFKQIKAATNNFDAANKLGEGGFGAVYKGELLDGTIIAVKQLSSKSKQG  663

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYM NNSLA+ LFG E+   K+DW
Sbjct  664   NREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMANNSLAHTLFGPEEGLKKLDW  723

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+ICVGIA+GLA+LHEES +K+VHRDIKT N+LLD++LNPKISDFGLAKLD++EK+H
Sbjct  724   HTRQKICVGIARGLAYLHEESALKIVHRDIKTNNILLDEDLNPKISDFGLAKLDEEEKTH  783

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGVVALE++SGKNN+K+RP+EN+VCLLDWA
Sbjct  784   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWA  843

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLMEL+DP+LGS F+KE+A++M++VALLC NPSP LRP+MS VVSMLEG   +
Sbjct  844   LVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIV  903

Query  1124  LEYKSNIR----ELNFQA  1165
              E K N      EL F+A
Sbjct  904   HEVKINPSIYGDELGFKA  921



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   504 bits (1299),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 237/303 (78%), Positives = 273/303 (90%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATNNFD ANK+GEGGFGSVYKG LLDGT IAVKQLSS+S Q
Sbjct  635   ELRGLDLKTGIFTLRQIKAATNNFDAANKLGEGGFGSVYKGILLDGTTIAVKQLSSRSRQ  694

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPN+V+LYGCC E   LLLVYEYMENNSLA+ALFG+ + QL +D
Sbjct  695   GNREFVNEIGMISGLQHPNVVRLYGCCAEGNQLLLVYEYMENNSLAHALFGTGEVQLILD  754

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W  R RIC+GIAKGLAFLH+ES +K+VHRDIKTANVLLDK++NPKISDFGLA+LD++E +
Sbjct  755   WPKRLRICIGIAKGLAFLHDESALKIVHRDIKTANVLLDKDINPKISDFGLARLDEEENT  814

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMKFRP+ENYVCLLDW
Sbjct  815   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKFRPNENYVCLLDW  874

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+KGNLMEL+D +LGS F+KE+A++++ VALLCTNPSP LRP+MST VSMLEG+  
Sbjct  875   ALVLQQKGNLMELLDTKLGSKFNKEEAMRIIRVALLCTNPSPALRPTMSTAVSMLEGHTA  934

Query  1121  ILE  1129
             + E
Sbjct  935   VHE  937



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score =   498 bits (1282),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 230/302 (76%), Positives = 268/302 (89%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNF+  NKIGEGGFGSVYKGTLLDGT+IAVKQLSSKS QG
Sbjct  419   LRGLDLQTGFFTFRQIKAATNNFNPKNKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSKQG  478

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS L HPNLV+LYGCC+E   LLLVYEYMENNSLA+ LFG ED  L +DW
Sbjct  479   NREFVNEIGMISGLHHPNLVRLYGCCIESNQLLLVYEYMENNSLAHTLFGPEDGPLNMDW  538

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GL+FLHEEST+K+VHRDIK  N+LLD++LNPKISDFGLAKLD++E +H
Sbjct  539   PTRQKICIGIARGLSFLHEESTLKIVHRDIKATNILLDRDLNPKISDFGLAKLDEEENTH  598

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGT+GY APEYALWGYLT KADVYSFGVVALEIV+GKNN K+RP++N+VCL+DWA
Sbjct  599   ISTRVAGTVGYMAPEYALWGYLTDKADVYSFGVVALEIVAGKNNXKYRPNQNFVCLVDWA  658

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLM+L+DPRLGS F KE+A++M++VALLCTNP+P L P+MS VV MLEG   +
Sbjct  659   LVLQQKGNLMDLVDPRLGSQFSKEEAIRMVKVALLCTNPAPALXPTMSAVVRMLEGETAV  718

Query  1124  LE  1129
              E
Sbjct  719   HE  720



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score =   500 bits (1288),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 245/345 (71%), Positives = 284/345 (82%), Gaps = 18/345 (5%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYK-------------GTLLDGT  361
             ELR LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYK             GTLLDGT
Sbjct  490   ELRGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKTYDSRITCTMPIQGTLLDGT  549

Query  362   VIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLAN  541
             +IAVKQLSSKSSQGNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENN LA 
Sbjct  550   IIAVKQLSSKSSQGNREFVNEIGMISGLQHPNLVRLYGCCIEGNQLLLVYEYMENNCLAR  609

Query  542   ALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKIS  721
             ALFG  + QL++DW TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  NVLLD+ELNPKIS
Sbjct  610   ALFGGGEIQLQLDWPTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNVLLDRELNPKIS  669

Query  722   DFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMK  901
             DFGLAKLD++  +HISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK
Sbjct  670   DFGLAKLDEEGNTHISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMK  729

Query  902   FRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPS  1081
             ++P+E+YVCLLDWA V Q+KGNLMEL+DP+LG+D +KE+A  M++VALLCTNPSP LRP+
Sbjct  730   YKPNEDYVCLLDWAFVXQQKGNLMELVDPKLGADLNKEEAKIMIKVALLCTNPSPALRPT  789

Query  1082  MSTVVSMLEGNGD-----ILEYKSNIRELNFQAV*VHYEEMSIGS  1201
             MS VVSML+G        I++  S    L F A+   Y++M + S
Sbjct  790   MSAVVSMLKGQTVVPEVLIMDPSSYSDHLKFNALRGQYDQMQLES  834



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   503 bits (1296),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 238/318 (75%), Positives = 277/318 (87%), Gaps = 4/318 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR  DL TG + F QIKAATNNFD ANK+GEGGFG+VYKG LLDGT+IAVKQLSSKS QG
Sbjct  641   LRGFDLQTGFYRFKQIKAATNNFDAANKLGEGGFGAVYKGELLDGTIIAVKQLSSKSKQG  700

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYM NNSLA+ LFG E+   K+DW
Sbjct  701   NREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMANNSLAHTLFGPEEGLKKLDW  760

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+ICVGIA+GLA+LHEES +K+VHRDIKT N+LLD++LNPKISDFGLAKLD++EK+H
Sbjct  761   RTRQKICVGIARGLAYLHEESALKIVHRDIKTNNILLDEDLNPKISDFGLAKLDEEEKTH  820

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGVVALE++SGKNN+K+RP+EN+VCLLDWA
Sbjct  821   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWA  880

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLMEL+DP+LGS F+KE+A++M++VALLC NPSP LRP+MS VVSMLEG   +
Sbjct  881   LVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIV  940

Query  1124  LEYKSNIR----ELNFQA  1165
              E K N      EL F+A
Sbjct  941   HEVKINPSIYGDELGFKA  958



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   503 bits (1295),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 238/318 (75%), Positives = 277/318 (87%), Gaps = 4/318 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR  DL TG + F QIKAATNNFD ANK+GEGGFG+VYKG LLDGT+IAVKQLSSKS QG
Sbjct  638   LRGFDLQTGFYRFKQIKAATNNFDAANKLGEGGFGAVYKGELLDGTIIAVKQLSSKSKQG  697

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYM NNSLA+ LFG E+   K+DW
Sbjct  698   NREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMANNSLAHTLFGPEEGLKKLDW  757

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+ICVGIA+GLA+LHEES +K+VHRDIKT N+LLD++LNPKISDFGLAKLD++EK+H
Sbjct  758   RTRQKICVGIARGLAYLHEESALKIVHRDIKTNNILLDEDLNPKISDFGLAKLDEEEKTH  817

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGVVALE++SGKNN+K+RP+EN+VCLLDWA
Sbjct  818   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALELLSGKNNIKYRPNENFVCLLDWA  877

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLMEL+DP+LGS F+KE+A++M++VALLC NPSP LRP+MS VVSMLEG   +
Sbjct  878   LVLQQKGNLMELVDPKLGSQFNKEEAMRMIKVALLCANPSPALRPTMSAVVSMLEGQTIV  937

Query  1124  LEYKSNIR----ELNFQA  1165
              E K N      EL F+A
Sbjct  938   HEVKINPSIYGDELGFKA  955



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   499 bits (1286),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 233/307 (76%), Positives = 274/307 (89%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG F F QIKAATNNFD ANK+GEGGFG+VYKG LLDGT+IAVKQLSSKS Q
Sbjct  567   DLRGLDLQTGFFRFKQIKAATNNFDAANKLGEGGFGAVYKGELLDGTIIAVKQLSSKSKQ  626

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLV+LYGCC+E   LLLVYEYMENNSLA++LFG E   LK+D
Sbjct  627   GNREFVNEIGMISALKHPNLVRLYGCCIEGNQLLLVYEYMENNSLAHSLFGQEKGILKLD  686

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC GIA+GLAF+HEEST+K+VHRDIK+ N+LLD++LNPKISDFGLAKL+++EKS
Sbjct  687   WHTRQKICGGIARGLAFMHEESTLKIVHRDIKSTNILLDRDLNPKISDFGLAKLNEEEKS  746

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWG+LT K DVYSFGVVALE+VSGKNN+K+RP+ENYVCLLDW
Sbjct  747   HISTRVAGTIGYMAPEYALWGHLTDKVDVYSFGVVALELVSGKNNIKYRPNENYVCLLDW  806

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+D +LGS+F+KE+A++M++VALLCTNPSP LRP+MS VVSMLEG   
Sbjct  807   AFVLQQKGNLMELVDLKLGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGQAI  866

Query  1121  ILEYKSN  1141
             + E   N
Sbjct  867   VHELNIN  873



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score =   503 bits (1294),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 238/332 (72%), Positives = 283/332 (85%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  616   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  675

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G+REF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + +L +D
Sbjct  676   GSREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGKVEYRLNLD  735

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  736   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  795

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+Y CLLDW
Sbjct  796   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDW  855

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP LG++F KE+A++M++VALLCTN SP LRP+MS VVSML+G   
Sbjct  856   AFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTV  915

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             + EY  N      E  F+A+   +++  + SS
Sbjct  916   VQEYPLNPSIYGDEFGFEALRGQHDQTQLQSS  947



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   503 bits (1294),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 238/332 (72%), Positives = 283/332 (85%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  616   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  675

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G+REF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + +L +D
Sbjct  676   GSREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGKVEYRLNLD  735

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  736   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  795

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+Y CLLDW
Sbjct  796   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDW  855

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP LG++F KE+A++M++VALLCTN SP LRP+MS VVSML+G   
Sbjct  856   AFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTV  915

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             + EY  N      E  F+A+   +++  + SS
Sbjct  916   VQEYPLNPSIYGDEFGFEALRGQHDQTQLQSS  947



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score =   502 bits (1293),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/302 (77%), Positives = 271/302 (90%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  NKIGEGGFGSV+KG LLDGT+IAVKQLS+KS QG
Sbjct  616   LRGLDLQTGFFTFKQIKAATNNFDPVNKIGEGGFGSVFKGILLDGTIIAVKQLSAKSKQG  675

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPN+V+LYGCC+E   LLLVYEYMENNSLA+ALFG E   LK+DW
Sbjct  676   NREFVNEIGMISGLQHPNVVRLYGCCIEANQLLLVYEYMENNSLAHALFGPERGPLKLDW  735

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIAKGLAFLH+ES +KVVHRDIK +NVLLD++LN KISDFGLAKLD+++ +H
Sbjct  736   PTRQKICIGIAKGLAFLHDESALKVVHRDIKASNVLLDQDLNAKISDFGLAKLDEEDNTH  795

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV GKNNMKFR DEN+VC++DWA
Sbjct  796   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVVGKNNMKFRADENFVCVVDWA  855

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KG LMEL+DPRLGSDF++E+A++M++VALLCTNP+P LRP+MS VVSMLEG   +
Sbjct  856   LVLQQKGKLMELVDPRLGSDFNQEEAIRMVKVALLCTNPAPALRPTMSAVVSMLEGRSVV  915

Query  1124  LE  1129
              E
Sbjct  916   HE  917



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   502 bits (1293),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/307 (76%), Positives = 271/307 (88%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG F F QIKAATNNFD ANK+GEGGFG+VYKG L DGT+IAVKQLSSKS Q
Sbjct  620   DLKGLDLQTGFFGFKQIKAATNNFDAANKLGEGGFGAVYKGELSDGTIIAVKQLSSKSKQ  679

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NE+G+IS L+HPNLV+LYGCC+ER  LLLVYEYMENNSLA++LFG E+   K+D
Sbjct  680   GNREFVNEVGMISALRHPNLVRLYGCCIERNELLLVYEYMENNSLAHSLFGPEESLKKLD  739

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKGLAF+HEEST+K+VHRDIKT N+LLDK+LNPKISDFGLAKLD++EK+
Sbjct  740   WNTRQKICVGIAKGLAFMHEESTLKIVHRDIKTTNILLDKDLNPKISDFGLAKLDEEEKT  799

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWG+LT K DVYSFGVVALE+ SGKNN+KFRP ENYVCLLDW
Sbjct  800   HISTRVAGTIGYMAPEYALWGHLTDKVDVYSFGVVALELXSGKNNIKFRPYENYVCLLDW  859

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+ GNLMEL DP LGSDF+KEQA++M++VA+LCTNP+P LRP+MS VVSMLEG   
Sbjct  860   AFVLQQTGNLMELXDPXLGSDFNKEQAMRMIKVAILCTNPAPALRPTMSAVVSMLEGRAI  919

Query  1121  ILEYKSN  1141
             + E   N
Sbjct  920   VHELNIN  926



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   502 bits (1293),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 238/332 (72%), Positives = 283/332 (85%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  638   ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G+REF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + +L +D
Sbjct  698   GSREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGKVEYRLNLD  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  758   WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+Y CLLDW
Sbjct  818   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDYFCLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP LG++F KE+A++M++VALLCTN SP LRP+MS VVSML+G   
Sbjct  878   AFVLQQKGNLMELVDPNLGTEFKKEEAIRMIKVALLCTNASPALRPTMSAVVSMLKGQTV  937

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             + EY  N      E  F+A+   +++  + SS
Sbjct  938   VQEYPLNPSIYGDEFGFEALRGQHDQTQLQSS  969



>ref|XP_007025271.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27893.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=346

 Score =   479 bits (1234),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 220/287 (77%), Positives = 260/287 (91%), Gaps = 0/287 (0%)
 Frame = +2

Query  269   IKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQ  448
             +KAATNNFD ANK+GEGGFGSVYKG LLDGT+IA+KQLSSKS QG+REFLNE+G+IS LQ
Sbjct  1     MKAATNNFDAANKVGEGGFGSVYKGLLLDGTIIAIKQLSSKSRQGDREFLNELGMISGLQ  60

Query  449   HPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLA  628
             HPNLV+LYGCC+E   LLLVYEYMENNSLA ALFG ++ QLK+DW  RQRIC+GIAKGLA
Sbjct  61    HPNLVRLYGCCIEGSQLLLVYEYMENNSLARALFGPKESQLKLDWPARQRICLGIAKGLA  120

Query  629   FLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPE  808
             FLHEES++K+VHRDIKT NVLLDK+LN KISDFGLAK D++E +HISTRVAGTIGY APE
Sbjct  121   FLHEESSLKIVHRDIKTTNVLLDKDLNAKISDFGLAKFDEEENTHISTRVAGTIGYMAPE  180

Query  809   YALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDP  988
             YALWGYLT+KADVYSFG+VALEIV+GKNN K+RP+E++VCL DWALVLQ+KGNLMEL+DP
Sbjct  181   YALWGYLTYKADVYSFGIVALEIVAGKNNTKYRPEEDFVCLQDWALVLQQKGNLMELVDP  240

Query  989   RLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDILE  1129
             RLGS+F++E+A++M++VALLCTN SP LRP MS V++MLEG   + E
Sbjct  241   RLGSEFNEEEAIRMIKVALLCTNSSPALRPIMSEVLNMLEGRALVPE  287



>ref|XP_009600352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X6 [Nicotiana tomentosiformis]
Length=812

 Score =   496 bits (1276),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT+NFD ANKIGEGGFGSVYKGTLLDG VIAVKQLSSKS Q
Sbjct  457   ELRGLDLLTGVFTIRQIKAATDNFDAANKIGEGGFGSVYKGTLLDGKVIAVKQLSSKSKQ  516

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L ID
Sbjct  517   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLNID  576

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++ +
Sbjct  577   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDNT  636

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  637   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  696

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ +G L+EL+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS VVS+LE   D
Sbjct  697   ALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLD  756

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y E    S   P
Sbjct  757   LPEFNMESRFYDDYDDHLNFQGLRDKYGEKFSSSQSQP  794



>ref|XP_009600351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Nicotiana tomentosiformis]
Length=856

 Score =   496 bits (1277),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT+NFD ANKIGEGGFGSVYKGTLLDG VIAVKQLSSKS Q
Sbjct  501   ELRGLDLLTGVFTIRQIKAATDNFDAANKIGEGGFGSVYKGTLLDGKVIAVKQLSSKSKQ  560

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L ID
Sbjct  561   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLNID  620

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++ +
Sbjct  621   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDNT  680

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  681   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  740

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ +G L+EL+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS VVS+LE   D
Sbjct  741   ALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLD  800

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y E    S   P
Sbjct  801   LPEFNMESRFYDDYDDHLNFQGLRDKYGEKFSSSQSQP  838



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   498 bits (1282),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/302 (76%), Positives = 270/302 (89%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR+LDL TG FTF QIKAATNNFD  NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  580   LRELDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGLLLDGTIIAVKQLSSKSKQG  639

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS L+HPNLV+LYGCCVE   LLLVYEYMENNSLA ALF  E+  LK+DW
Sbjct  640   NREFVNEIGMISGLRHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDW  699

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
             +TRQ+IC+GIA+GLAFLHEES +K+VHRDIKT N+LLD++LN KISDFGLAKLD++E +H
Sbjct  700   STRQKICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTH  759

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTR+AGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  760   ISTRIAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  819

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KG L+EL+DPRLGSD  +E+A++M++VALLC N +P LRP+MS VVSMLEG   +
Sbjct  820   LVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAV  879

Query  1124  LE  1129
              E
Sbjct  880   HE  881



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   498 bits (1282),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 233/302 (77%), Positives = 267/302 (88%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  569   LRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  628

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCCVE   LLLVYEYMENNSLA ALF  E+  LK+DW
Sbjct  629   NREFVNEIGMISGLQHPNLVRLYGCCVESNQLLLVYEYMENNSLARALFVPEESPLKLDW  688

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ IC+GIA+GLAFLHEES +K+VHRDIKT N+LLD++LN KISDFGLAKLD++E +H
Sbjct  689   PTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTH  748

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  749   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  808

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KG L+EL+DPRLGSD  +E+A++M++VALLC N +P LRP+MS VVSMLEG   +
Sbjct  809   LVLQQKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAV  868

Query  1124  LE  1129
              E
Sbjct  869   HE  870



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score =   498 bits (1282),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 235/328 (72%), Positives = 280/328 (85%), Gaps = 4/328 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FTF QIKAATNNFD  NKIGEGGFGSV+KG LLDG++IAVKQLSSKS Q
Sbjct  560   ELRGLDLQTGFFTFRQIKAATNNFDPINKIGEGGFGSVFKGILLDGSIIAVKQLSSKSRQ  619

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L HPNLV+LYGCC+E   L LVYEYMENNSLA ALFG +D +L +D
Sbjct  620   GNREFVNEIGMISGLHHPNLVRLYGCCIEGNQLFLVYEYMENNSLARALFGPDDGRLNLD  679

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIAKGLAFLHEEST++VVHRDIKT N+LLDK+LNPKISDFGLAKLD++E +
Sbjct  680   WPTRHKICVGIAKGLAFLHEESTLRVVHRDIKTTNILLDKDLNPKISDFGLAKLDEEENT  739

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADV+SF VVALEI++G +NMK+RP+ENYVCL+DW
Sbjct  740   HISTRIAGTIGYMAPEYALWGYLTYKADVFSFAVVALEILAGTSNMKYRPNENYVCLVDW  799

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ++GNLMEL+DP LGSDF+KE+A++M+++A+LCTN SP LRP MS VVSMLEG   
Sbjct  800   ALVLQQQGNLMELVDPNLGSDFNKEEAVRMIKIAILCTNQSPALRPIMSAVVSMLEGRTA  859

Query  1121  ----ILEYKSNIRELNFQAV*VHYEEMS  1192
                 I++      EL F A+   +++M+
Sbjct  860   VHDLIMDPSIYGDELRFTALRKQFDQMA  887



>ref|XP_009600350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Nicotiana tomentosiformis]
Length=911

 Score =   496 bits (1276),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT+NFD ANKIGEGGFGSVYKGTLLDG VIAVKQLSSKS Q
Sbjct  556   ELRGLDLLTGVFTIRQIKAATDNFDAANKIGEGGFGSVYKGTLLDGKVIAVKQLSSKSKQ  615

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L ID
Sbjct  616   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLNID  675

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++ +
Sbjct  676   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDNT  735

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  736   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  795

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ +G L+EL+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS VVS+LE   D
Sbjct  796   ALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLD  855

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y E    S   P
Sbjct  856   LPEFNMESRFYDDYDDHLNFQGLRDKYGEKFSSSQSQP  893



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   496 bits (1278),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 230/296 (78%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  644   LRGLDLQTGFFTFRQIKAATNNFDPENKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  703

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+ S L HPNLV+LYGCC+E   LLLVYEYMENNSLA+ LFG E+  LK+DW
Sbjct  704   NREFVNEIGMXSALHHPNLVRLYGCCIESNQLLLVYEYMENNSLAHTLFGXEEGPLKLDW  763

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
             +TR +IC+GIA+GLAFLHEES +KVVHRDIK  N+LLD++LN KISDFGLAKLD++E +H
Sbjct  764   STRXKICIGIARGLAFLHEESPLKVVHRDIKATNILLDQDLNAKISDFGLAKLDEEENTH  823

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIV+GKNNMK+RP+EN+VCL+DWA
Sbjct  824   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVAGKNNMKYRPNENFVCLVDWA  883

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             LVLQ+KGNL+EL+DPRLGSDF+ E+ + M++VALLC NP+P LRP+MS VVSMLEG
Sbjct  884   LVLQQKGNLIELVDPRLGSDFEVEEVITMVKVALLCINPAPALRPTMSAVVSMLEG  939



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score =   494 bits (1271),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 233/302 (77%), Positives = 269/302 (89%), Gaps = 2/302 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             +R LDL TG FTF QIKAATNNFD ANKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  569   MRGLDLQTGFFTFRQIKAATNNFDAANKIGEGGFGSVYKGVLLDGTIIAVKQLSSKSKQG  628

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLVKL+GCC+E K LLLVYEYMENNSLA++LFG  +  LK+DW
Sbjct  629   NREFVNEIGMISALQHPNLVKLHGCCIEGKQLLLVYEYMENNSLAHSLFG--EGGLKLDW  686

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQRIC+GIAKGLAFLHEEST+K+VHRDIK  N+LLD  LNPKISDFGLAKL+++E +H
Sbjct  687   KTRQRICIGIAKGLAFLHEESTLKIVHRDIKATNILLDGNLNPKISDFGLAKLNEEENTH  746

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGV+ALEIV+GKNNM++RP+EN+VCLLDWA
Sbjct  747   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVLALEIVAGKNNMRYRPNENFVCLLDWA  806

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             + LQ+KGNLM+L+DP+ GS+F+KE+A +M++VALLCTNPS  LRP MS VVSMLEG   +
Sbjct  807   IFLQQKGNLMDLVDPKSGSEFNKEEANRMIKVALLCTNPSQALRPGMSEVVSMLEGRTAV  866

Query  1124  LE  1129
              E
Sbjct  867   HE  868



>ref|XP_009600349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Nicotiana tomentosiformis]
Length=993

 Score =   495 bits (1275),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT+NFD ANKIGEGGFGSVYKGTLLDG VIAVKQLSSKS Q
Sbjct  638   ELRGLDLLTGVFTIRQIKAATDNFDAANKIGEGGFGSVYKGTLLDGKVIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L ID
Sbjct  698   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLNID  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++ +
Sbjct  758   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDNT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  818   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ +G L+EL+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS VVS+LE   D
Sbjct  878   ALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLD  937

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y E    S   P
Sbjct  938   LPEFNMESRFYDDYDDHLNFQGLRDKYGEKFSSSQSQP  975



>ref|XP_009600348.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Nicotiana tomentosiformis]
Length=993

 Score =   495 bits (1274),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 241/338 (71%), Positives = 276/338 (82%), Gaps = 7/338 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT+NFD ANKIGEGGFGSVYKGTLLDG VIAVKQLSSKS Q
Sbjct  638   ELRGLDLLTGVFTIRQIKAATDNFDAANKIGEGGFGSVYKGTLLDGKVIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC E   LLLVYEY+ENNSLA ALFG E+ +L ID
Sbjct  698   GNREFVNEIGMISGLQHPNLVKLYGCCAEGNQLLLVYEYLENNSLARALFGPEEHRLNID  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIAKGLAFLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLAKLDD++ +
Sbjct  758   WPTRQKICIGIAKGLAFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLAKLDDEDNT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEI +GK+ M +RP+E +VCLLDW
Sbjct  818   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIAAGKSIMTYRPNEKFVCLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ +G L+EL+D  LGSD  +++AL+M+ VALLCTNPSP LRP+MS VVS+LE   D
Sbjct  878   ALVLQRQGKLVELVDETLGSDLKQDEALRMINVALLCTNPSPALRPTMSAVVSILENQLD  937

Query  1121  ILEYKSNIR-------ELNFQAV*VHYEEMSIGSSDSP  1213
             + E+    R        LNFQ +   Y E    S   P
Sbjct  938   LPEFNMESRFYDDYDDHLNFQGLRDKYGEKFSSSQSQP  975



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score =   494 bits (1272),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 239/335 (71%), Positives = 278/335 (83%), Gaps = 4/335 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FT+ QIKAATNNF+  N++G GGFG+VYKGTL DGT+IAVKQLSS+S Q
Sbjct  597   ELLGLDLHTGVFTYRQIKAATNNFNPTNELGAGGFGTVYKGTLSDGTLIAVKQLSSRSKQ  656

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLV+LYGCCVE   LLLVYEYMENNSL +ALF +E+ + K+D
Sbjct  657   GNREFLNEIGMISVLQHPNLVRLYGCCVEGNQLLLVYEYMENNSLEHALFETEETESKLD  716

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQR C+GIAKGLAFLHEES +K+VHRDIKTAN+LLD ELN KISDFGLAKLD+DE +
Sbjct  717   WPTRQRSCIGIAKGLAFLHEESALKIVHRDIKTANILLDGELNAKISDFGLAKLDEDENT  776

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSGKNNMK+RPDE++VCLLDW
Sbjct  777   HISTRVAGTIGYMAPEYALWGYLTQKADVYSFGVVALEIVSGKNNMKYRPDEDFVCLLDW  836

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLM+L+DPRLGS F KE+ ++M +VALLCTN SP LRP+MS VV MLEG   
Sbjct  837   AFVLQQKGNLMDLVDPRLGSKFKKEEVIRMAKVALLCTNTSPALRPTMSEVVGMLEGRTP  896

Query  1121  ILEYKSNI----RELNFQAV*VHYEEMSIGSSDSP  1213
             + E          EL  + +   Y+++S+ SS  P
Sbjct  897   VRELVMGSGFYGDELRSKVLSNQYDQISLHSSSDP  931



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   494 bits (1273),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/342 (71%), Positives = 286/342 (84%), Gaps = 8/342 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TGMFTF QIKAATN+FD ANKIGEGGFG VYKG L DGT++AVKQLSSKS Q
Sbjct  622   ELVGLDLQTGMFTFRQIKAATNDFDPANKIGEGGFGPVYKGILSDGTIVAVKQLSSKSKQ  681

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+L+GCCVE + LLLVYEYMENNSLA+ LFG ++ QL +D
Sbjct  682   GNREFVNEIGMISALQHPNLVRLFGCCVEGRQLLLVYEYMENNSLAHVLFGKKEGQLNLD  741

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIAKGLAFLHEES IK+VHRDIKT NVLLD ELNPKISDFGLAKLD++  +
Sbjct  742   WPTRHRICVGIAKGLAFLHEESAIKIVHRDIKTTNVLLDAELNPKISDFGLAKLDEEANT  801

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWG+LT+KADVYSFGVVALEIVSGKNNMK RPD+++VCLLDW
Sbjct  802   HISTRIAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIVSGKNNMKRRPDDDFVCLLDW  861

Query  941   ALVLQEKGNLMELIDPR--LGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             ALVL + GNLMEL+DPR  L S F+KE  L+++EVALLCTNPSP +RP+MSTVVSMLEG 
Sbjct  862   ALVLHQDGNLMELVDPRLDLKSKFEKE-VLRVIEVALLCTNPSPAVRPAMSTVVSMLEGR  920

Query  1115  GDILEYKSNIR----ELNFQAV*VHYEEMSI-GSSDSPNKVD  1225
             G+I     +      E  F+A+   Y+++ + GS ++ + V+
Sbjct  921   GEIHNLAIDPSLYGDEFRFKAMRKQYDQILVEGSRETQSLVN  962



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   511 bits (1315),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/332 (73%), Positives = 285/332 (86%), Gaps = 4/332 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAATN+FD ANKIGEGGFGSVYKGTLLDGT+IAVKQLS+KS Q
Sbjct  1545  ELRGLDLQTGLFTLRQIKAATNSFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSTKSKQ  1604

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCCVE   L+LVYEYMENNSLA ALFG  + QL +D
Sbjct  1605  GNREFVNEIGMISALQHPNLVRLYGCCVEGNQLILVYEYMENNSLARALFGQVEYQLNLD  1664

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQRICVGIA+GLAFLHE ST+K+VHRDIK  N+LLD  LNPKISDFGLAKLD+++ +
Sbjct  1665  WSTRQRICVGIARGLAFLHEGSTLKIVHRDIKANNILLDTNLNPKISDFGLAKLDEEDNT  1724

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALE+V+GKNNMK+RP+E+  CLLDW
Sbjct  1725  HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALELVAGKNNMKYRPNEDCFCLLDW  1784

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LG++F K++A++M++VALLCTNPSP LRP+MS VVSML+G   
Sbjct  1785  AFVLQQKGNLMELVDPKLGTEFKKDEAIRMIKVALLCTNPSPALRPTMSAVVSMLKGQTV  1844

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSS  1204
             I EY  N      E  F+A+   Y++M + SS
Sbjct  1845  IQEYPLNPSIYGDEFGFEALRGQYDQMQLQSS  1876



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score =   487 bits (1254),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/326 (71%), Positives = 276/326 (85%), Gaps = 4/326 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL  G FT+ QIKAATNNFD ANKIGEGGFGSVY+GTLLDG +IAVKQL++KS QG
Sbjct  456   LRGLDLHAGFFTYRQIKAATNNFDAANKIGEGGFGSVYRGTLLDGAIIAVKQLAAKSKQG  515

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             N EF+NEIG++S LQHPNLVKLYGCC+E   LLLVYEYMENN+LA ALFG E+ QL++DW
Sbjct  516   NHEFVNEIGLLSGLQHPNLVKLYGCCIEGSQLLLVYEYMENNNLARALFGPEEYQLEMDW  575

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
               RQ ICVG+AKGLAFLHEEST+K++HRDIKT NVLLDK+LNPKISDFGLAKL ++E +H
Sbjct  576   PRRQNICVGVAKGLAFLHEESTLKIIHRDIKTNNVLLDKDLNPKISDFGLAKLVEEENTH  635

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             I T +AGT GY APEY LWG+LT KADVYSFGVVALEIV+GK+NMKF P EN+ CLLDWA
Sbjct  636   IITTIAGTKGYIAPEYVLWGHLTHKADVYSFGVVALEIVAGKSNMKFSPSENFFCLLDWA  695

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KG+LMEL+DPRLGS+F+K +A K++ VALLCT+P+P LRP+MS VVSMLEG+ +I
Sbjct  696   LVLQKKGSLMELVDPRLGSNFNKNEAEKIIRVALLCTSPAPTLRPAMSEVVSMLEGHVNI  755

Query  1124  LEYKSNIR----ELNFQAV*VHYEEM  1189
              E+  + R    EL  QA+   Y+E+
Sbjct  756   QEFNMDSRIHDSELKLQALREKYDEL  781



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   491 bits (1264),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 234/334 (70%), Positives = 280/334 (84%), Gaps = 4/334 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L   DL TG F F Q+KAATNNFD ANK+GEGGFG+VYKG LLDGT IAVKQLSSKS Q
Sbjct  638   DLMGFDLQTGFFKFKQLKAATNNFDAANKLGEGGFGAVYKGELLDGTFIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   L LVYEYMENNSLA+ LFG E+   K++
Sbjct  698   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLFLVYEYMENNSLAHVLFGPEEGLKKLN  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIA+GLAFLHEEST+K+VHRD+KT+NVLLD++LNPKISDFGLAKLD++EK+
Sbjct  758   WNTRHKICLGIARGLAFLHEESTLKIVHRDVKTSNVLLDQDLNPKISDFGLAKLDEEEKT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVVALE++SGKNN+K+RP+EN+VCLLDW
Sbjct  818   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALELISGKNNVKYRPNENFVCLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVL + GNLMEL+D +LGS+F+KE+AL+M++VA+LC N SP LRP+MS VVSMLEG   
Sbjct  878   ALVLHQDGNLMELVDRKLGSEFNKEEALRMIKVAVLCVNSSPALRPTMSAVVSMLEGQTP  937

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             + E K N      EL F+A     +  S+ S+ S
Sbjct  938   VCEVKINPSIYGDELRFRAFTEDSDTASVQSTQS  971



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   491 bits (1263),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 230/307 (75%), Positives = 268/307 (87%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG F F Q+KAATNNFD ANK+GEGGFG+VYKG LLDGT IAVKQLSSKS Q
Sbjct  638   DLMGLDLHTGFFKFKQLKAATNNFDTANKLGEGGFGAVYKGELLDGTFIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GN EF+NEIG+IS LQHPNLVKLYGCC+E   L LVYEYMENNSLA+ LFG ++   K+D
Sbjct  698   GNHEFVNEIGMISALQHPNLVKLYGCCIEGNQLFLVYEYMENNSLAHVLFGPDEGLKKLD  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W  RQ+IC+GIA+GLAFLHEEST+K+VHRDIKT N+LLD++LNPKISDFGLAKLD++EK+
Sbjct  758   WNKRQKICLGIARGLAFLHEESTLKIVHRDIKTTNILLDRDLNPKISDFGLAKLDEEEKT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVV LE+VSGKNN+K+RP+EN+VCLLDW
Sbjct  818   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVTLELVSGKNNIKYRPNENFVCLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ+ GNLMEL+D +LGS F+KE+A++M++VALLC NPSP LRPSMS VVSMLEG   
Sbjct  878   ALVLQQNGNLMELVDRKLGSGFNKEEAMRMIKVALLCANPSPALRPSMSAVVSMLEGQTL  937

Query  1121  ILEYKSN  1141
             + E K N
Sbjct  938   VQEVKIN  944



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   490 bits (1262),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 234/326 (72%), Positives = 274/326 (84%), Gaps = 2/326 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LD  TG+FTF QIKAATNNFD  NKIG+GGFGSVYKGTL DGTV+AVKQLSS+S Q
Sbjct  621   ELLGLDQQTGVFTFRQIKAATNNFDPENKIGQGGFGSVYKGTLSDGTVVAVKQLSSRSKQ  680

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNE+G+IS LQHPNLV+LYGCCVER  LLLVYEYMENNSL + LFG +  Q  +D
Sbjct  681   GNREFLNEVGMISALQHPNLVRLYGCCVERNQLLLVYEYMENNSLEHNLFGKKRSQFILD  740

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRIC+GIAKGLAFL EES +++VHRDIK ANVLLDK+LNPKISDFGLAKLD++E +
Sbjct  741   WPTRQRICIGIAKGLAFLQEESALRIVHRDIKAANVLLDKDLNPKISDFGLAKLDEEENT  800

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIV GK+NMKFRPDEN+VCLLDW
Sbjct  801   HISTRVAGTIGYMAPEYALWGYLTHKADVYSFGVVALEIVVGKSNMKFRPDENFVCLLDW  860

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVL +KG+L++L+D RL S F K++A++M++VALLCTNPSP LRP+MS  V MLEG   
Sbjct  861   ALVLHQKGDLLKLVDERLESKFSKKEAVRMIKVALLCTNPSPSLRPTMSEAVRMLEGRAA  920

Query  1121  ILEY--KSNIRELNFQAV*VHYEEMS  1192
             + E+    ++    F A+   Y+++S
Sbjct  921   VPEFVMGQSVYADGFGALRNQYDQIS  946



>ref|XP_006358135.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=779

 Score =   483 bits (1242),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 274/329 (83%), Gaps = 7/329 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             E R LD  TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTL DG VIAVK+LSSKS Q
Sbjct  424   ESRGLDSMTGVFTIRQIKAATNNFDAANKIGEGGFGSVYKGTLSDGAVIAVKKLSSKSKQ  483

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G REF+NEIG+IS LQHPNLV+LYGCC ER  LLLVYEYMENNSLA ALFG E+ +LKI+
Sbjct  484   GKREFVNEIGMISSLQHPNLVQLYGCCAERNNLLLVYEYMENNSLARALFGPEEHRLKIN  543

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE-K  757
             W TRQ+IC+GIAKGL+FLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLA+LDDD+  
Sbjct  544   WPTRQKICIGIAKGLSFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLARLDDDDNN  603

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI+TRVAGTIGY APEYALWGYLT+KADVYSFGV+ALEI +GK+NM +RP+E +VCLLD
Sbjct  604   THITTRVAGTIGYMAPEYALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLLD  663

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WALVLQ +G L E++D  LGSD ++++AL+ML VALLCT+PSP LRP+MS VV +LE + 
Sbjct  664   WALVLQRQGKLKEVVDATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHL  723

Query  1118  DILEYKSNIR------ELNFQAV*VHYEE  1186
             D+ E+    R       LNFQ +   YE+
Sbjct  724   DLPEFTMESRFYDDYDLLNFQGLRDKYED  752



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   489 bits (1259),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 229/331 (69%), Positives = 280/331 (85%), Gaps = 4/331 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT+ QIKAAT+NF   NKIGEGGFG+VYKG LLDGTVIAVKQLS KS Q
Sbjct  665   ELRGLDLRTGLFTYRQIKAATDNFSATNKIGEGGFGAVYKGMLLDGTVIAVKQLSPKSKQ  724

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L HPN+V+LYGCC+E   LLLVYEY+ENN+LA ALFG +D QL++D
Sbjct  725   GNREFVNEIGMISGLLHPNVVRLYGCCIEGDQLLLVYEYLENNNLARALFGPQDLQLELD  784

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQ+IC+GIAKGL+FLH+ES +K+VHRDIKT N+LLDKELNPKISDFGLAKL ++E +
Sbjct  785   WSTRQKICIGIAKGLSFLHDESALKIVHRDIKTNNILLDKELNPKISDFGLAKLVEEENT  844

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFG+VALEIV+GK+NM +RP E+YVCLLDW
Sbjct  845   HISTRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVAGKSNMSYRPSEDYVCLLDW  904

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             ALVLQ++G+L+EL+DPRLGS+ ++ +A++M++VALLCTNPSP LRP+MS  + MLEG   
Sbjct  905   ALVLQQRGSLVELVDPRLGSNINEGEAIRMIKVALLCTNPSPALRPTMSAALGMLEGRIS  964

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGS  1201
               E+ S+       LN Q +   Y+E+   S
Sbjct  965   TQEFSSDPSVYNDGLNLQGLRDKYDELQFSS  995



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 250/399 (63%), Positives = 291/399 (73%), Gaps = 29/399 (7%)
 Frame = +2

Query  62    YAFNFNYFLIL*SMRKLDVVTICACSHMCYADSIPKLILY-----CTRNY-S*SNCSCTE  223
             + FNF Y       +K+ +V +        A S+  LIL+     C + Y    N    E
Sbjct  143   FMFNFPY-------KKVTIVGV--------ATSVSCLILFVLGVLCWKYYFGGKNMMEKE  187

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLSSKS QG
Sbjct  188   LRGLDLQTGSFTLRQIKAATNNFDYANKIGEGGFGSVYKGQLSDGTVIAVKQLSSKSRQG  247

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQ-LKID  580
             NREF+NEIGIISCL HPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG  +R  LK+D
Sbjct  248   NREFVNEIGIISCLHHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALFGKNERSVLKLD  307

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +ICVGIAKGL FLHEES I +VHRDIK  NVLLD+ LN KISDFGLAKL++ E +
Sbjct  308   WATRYKICVGIAKGLTFLHEESRIMIVHRDIKATNVLLDENLNAKISDFGLAKLNEGENT  367

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT KADVYSFGVV LEIVSGKNN  + PD    CLLDW
Sbjct  368   HISTRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDW  427

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VL++KG+LMEL+DP LG++F+K++A  M++VALLCTN S  LRP+MS V+ MLEG   
Sbjct  428   AFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDI  487

Query  1121  ILEYKSNI----RELNFQAV*VHYEEMSIGSSD---SPN  1216
             I E  S+     +++    +  HY+ M + SS    +PN
Sbjct  488   IPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPN  526



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   485 bits (1249),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 227/302 (75%), Positives = 263/302 (87%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  NKIGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  638   LRGLDLQTGFFTFKQIKAATNNFDPINKIGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  697

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALF  E+  LK+DW
Sbjct  698   NREFVNEIGMISGLQHPNLVRLYGCCIESNQLLLVYEYMENNSLARALFVPEESPLKLDW  757

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ IC+GIA+GLAFLH ES +K+VHRDIKT N+LLD++LN KISDFGLAKLD++E +H
Sbjct  758   PTRQNICIGIARGLAFLHAESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTH  817

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGVV LEIV+GK+NMK+RP+EN+VCL+DWA
Sbjct  818   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVAGKSNMKYRPNENFVCLVDWA  877

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             +VLQ+KG L+EL+DPRLGSD  +E+ ++M++VALLC N +P LRP+MS VVSMLEG   +
Sbjct  878   IVLQQKGELLELVDPRLGSDVSEEEVIRMIKVALLCINAAPALRPTMSAVVSMLEGRTAV  937

Query  1124  LE  1129
              E
Sbjct  938   HE  939



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score =   471 bits (1213),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 223/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  234   ELVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTRIAVKQLSAKSKQ  293

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  294   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  353

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  354   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  413

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  414   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  473

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  474   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  533

Query  1118  DILE  1129
             D+ E
Sbjct  534   DVEE  537



>gb|EYU29542.1| hypothetical protein MIMGU_mgv1a0269212mg, partial [Erythranthe 
guttata]
Length=423

 Score =   465 bits (1196),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 256/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD+ANKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  48    ELRALDLQTGYFTLRQIKAATNNFDIANKIGEGGFGPVYKGVLTDGTVIAVKQLSSKSKQ  107

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQH NLV+L+GCC+E   LLL+YEY+ NNSLA ALFG +D++L +D
Sbjct  108   GNREFVTEIGMISALQHHNLVRLFGCCIEGNQLLLIYEYLVNNSLARALFGRDDQRLNLD  167

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  168   WPTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  227

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  228   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  287

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VL E+GNL+EL+DP LG+++ K++AL+ML +ALLC NPSP LRPSMS+VVSMLEG
Sbjct  288   AYVLHEQGNLLELVDPILGTNYSKKEALRMLNLALLCANPSPTLRPSMSSVVSMLEG  344



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score =   463 bits (1192),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 260/307 (85%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG FT  Q++AATNNFD A+KIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  43    DLKGLDLKTGTFTLRQLRAATNNFDSADKIGEGGFGSVYKGKLSDGTLIAVKQLSPKSRQ  102

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALFGSE   L +D
Sbjct  103   GNREFVNEIGMISGLQHPNLVKLYGCCIEGDQLLLVYEYMENNSLAKALFGSETSFLMLD  162

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHEES I++VHRDIK  NVLLDK+L+ KISDFGLAKL+++E +
Sbjct  163   WPTRYKICVGIARGLAFLHEESAIRIVHRDIKGTNVLLDKDLSAKISDFGLAKLNEEENT  222

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSG++N   R    +VCLLDW
Sbjct  223   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSSHRTTNEFVCLLDW  282

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLME++DP+L S+F+KE+A +M+++ALLCTN SP LRP+MS VVSMLEG   
Sbjct  283   ARVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTS  342

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  343   IQEMISD  349



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score =   478 bits (1231),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 224/303 (74%), Positives = 266/303 (88%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD  NK+GEGGFGSVYKG L DGT+IAVKQLS+KS Q
Sbjct  470   ELVGLDLVTGIFTFRQIKAATNDFDPENKLGEGGFGSVYKGVLSDGTIIAVKQLSAKSKQ  529

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ L+G ++ Q K+D
Sbjct  530   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLYGKKEDQRKLD  589

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIAKGLAFLHEEST+K+VHRDIK  NVLLD ++N KISDFG+AKLD+++ +
Sbjct  590   WHTRQRICVGIAKGLAFLHEESTLKIVHRDIKATNVLLDGDMNAKISDFGMAKLDEEDNT  649

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIV+G NNM+FR DE++VCLLDW
Sbjct  650   HITTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDW  709

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL LQ+ G++MEL+DP LGS F+K++A+ M++VALLCTN SP LRP MS VV MLEG GD
Sbjct  710   ALNLQQNGDIMELVDPNLGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGD  769

Query  1121  ILE  1129
             + E
Sbjct  770   VQE  772



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   483 bits (1244),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 225/303 (74%), Positives = 268/303 (88%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD  NK+GEGGFGSVYKG L DGT+IAVKQLS+KS Q
Sbjct  644   ELVGLDLVTGIFTFRQIKAATNDFDPENKLGEGGFGSVYKGVLSDGTIIAVKQLSAKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ L+G ++ Q K+D
Sbjct  704   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLYGKKEDQRKLD  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIAKGLAFLHEEST+K+VHRDIK  NVLLD ++N KISDFG+AKLD+++ +
Sbjct  764   WHTRQRICVGIAKGLAFLHEESTLKIVHRDIKATNVLLDGDMNAKISDFGMAKLDEEDNT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIV+G NNM+FR DE++VCLLDW
Sbjct  824   HITTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL LQ+ G++MEL+DP+LGS FDK++A++M++VALLCTN SP LRP MS VV MLEG GD
Sbjct  884   ALNLQQNGDIMELVDPKLGSGFDKKEAVRMIQVALLCTNQSPALRPKMSAVVKMLEGKGD  943

Query  1121  ILE  1129
             + E
Sbjct  944   VQE  946



>ref|XP_006370931.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
 gb|ERP48728.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
Length=414

 Score =   463 bits (1192),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 216/305 (71%), Positives = 260/305 (85%), Gaps = 0/305 (0%)
 Frame = +2

Query  215   CTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKS  394
             C +L  LDL TG+FTF QIKAATN+FD AN +GEGGFG VYKG L DGT+IAVKQLS+KS
Sbjct  52    CGKLVGLDLVTGIFTFKQIKAATNDFDPANNLGEGGFGVVYKGVLSDGTIIAVKQLSAKS  111

Query  395   SQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLK  574
              QGNREF+NEIG+IS LQHPNLV+LYGCC+  K LLLV+E MENNSLA+ L+G ++ QL 
Sbjct  112   KQGNREFVNEIGMISALQHPNLVRLYGCCINGKELLLVFENMENNSLAHVLYGKKEGQLN  171

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TRQRICV IAKGLAFLHEEST+K+VHRDIKT NVLLD  +N KISDFG+AKLD+++
Sbjct  172   LDWPTRQRICVDIAKGLAFLHEESTLKIVHRDIKTTNVLLDGNMNVKISDFGMAKLDEED  231

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HISTRVAGT+GY APEYAL+G LT+KADVYSFG+VALEIV+G +NM+FR +E++ CLL
Sbjct  232   DTHISTRVAGTMGYMAPEYALYGRLTYKADVYSFGIVALEIVAGMSNMRFRHNESFACLL  291

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             DWAL L + G++MEL+DPRLGSDF K++A +M++VALLCTN SP  RP MS VV MLEG 
Sbjct  292   DWALSLHQNGDVMELVDPRLGSDFKKKEAARMIKVALLCTNQSPAHRPIMSAVVRMLEGK  351

Query  1115  GDILE  1129
             GD+ E
Sbjct  352   GDVQE  356



>ref|XP_006370936.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
 gb|ERP48733.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
Length=580

 Score =   469 bits (1207),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 262/303 (86%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT+IAVKQLS+KS Q
Sbjct  220   ELVGLDLLTGIFTFKQIKAATNDFDPANKLGEGGFGVVYKGVLSDGTIIAVKQLSAKSKQ  279

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQH NLV+LYGCC+  K LLLVYEYMENNSLA+ L+G ++ QL +D
Sbjct  280   GNREFVNEIGMISALQHANLVRLYGCCINGKQLLLVYEYMENNSLAHVLYGKKEAQLNLD  339

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICV IAKGLAFLHEEST+K+VHRDIKT NVLLD  +N KISDFG+AKLD+++ +
Sbjct  340   WPTRQRICVDIAKGLAFLHEESTLKIVHRDIKTTNVLLDGNMNAKISDFGMAKLDEEDNT  399

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT+GY APEYAL+G LT+KADVYSFG+VALEIV+G +NM F+ +E++ CLLDW
Sbjct  400   HISTRVAGTMGYMAPEYALYGRLTYKADVYSFGIVALEIVAGMSNMSFQHNESFACLLDW  459

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL LQ+ G++MEL+DPRLGSDF K++A +M++VALLCTN SP LRP+MS VV MLEG GD
Sbjct  460   ALSLQQNGDMMELVDPRLGSDFKKKEAARMIKVALLCTNQSPALRPTMSAVVRMLEGKGD  519

Query  1121  ILE  1129
             + E
Sbjct  520   VQE  522



>emb|CAN66180.1| hypothetical protein VITISV_025180 [Vitis vinifera]
Length=561

 Score =   468 bits (1205),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 257/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  192   ELKGLDLQTGLFTVRQIKAATNNFDAANKIGEGGFGSVYKGILSDGTIIAVKQLSSKSKQ  251

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ QL++D
Sbjct  252   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLIYEYMENNSLARALFGPEECQLQLD  311

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GL +LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  312   WPTRHRICVGIARGLTYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  371

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFG+VALEIVSG++N  +RP E    LLDW
Sbjct  372   HISTRIAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGRSNTTYRPKEECTYLLDW  431

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             AL L+EKGNLM+L+DPRLGSDF+KE+ + ML +ALLCTN S  +RP+MS+VVSMLEG
Sbjct  432   ALSLKEKGNLMDLVDPRLGSDFNKEEVMAMLNLALLCTNISSAVRPAMSSVVSMLEG  488



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 229/334 (69%), Positives = 273/334 (82%), Gaps = 4/334 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  188   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELTDGTIIAVKQLSPKSRQ  247

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFGSE   L +D
Sbjct  248   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGSETSALMLD  307

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL+++E +
Sbjct  308   WPTRYKICVGIARGLAFLHEGSAIRIVHRDIKVTNVLLDKDLNAKISDFGLAKLNEEENT  367

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSGK+N  +RP+   VCLLDW
Sbjct  368   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLLDW  427

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLME++DP+L S+F+KE+A +M++ ALLCTN SP LRP+MS V++MLEG   
Sbjct  428   AHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVLNMLEGQTS  487

Query  1121  ILEYKSNI----RELNFQAV*VHYEEMSIGSSDS  1210
             I E  S+      +L  + V  HY++++  S +S
Sbjct  488   IPEVTSDPSIYDNDLQSKRVKGHYQQVTDQSLNS  521



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   481 bits (1238),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 264/302 (87%), Gaps = 1/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF QIKAATNNFD  + IGEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  617   LRGLDLQTGFFTFKQIKAATNNFDPIH-IGEGGFGSVYKGILLDGTIIAVKQLSSKSKQG  675

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEYMENNSLA ALF  E+  LK+DW
Sbjct  676   NREFVNEIGMISGLQHPNLVRLYGCCIESNQLLLVYEYMENNSLARALFVPEESPLKLDW  735

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ IC+GIA+GLAFLHEES +K+VHRDIKT N+LLD++LN KISDFGLAKLD++E +H
Sbjct  736   PTRQNICIGIARGLAFLHEESALKIVHRDIKTTNILLDRDLNSKISDFGLAKLDEEENTH  795

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT KADVYSFGVV LEIV+GK+NMK+RP+EN+VCL+DWA
Sbjct  796   ISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVAGKSNMKYRPNENFVCLVDWA  855

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KG L+EL+DPRLGSD  +E+A++M++VALLC N +P LRP+MS VVSMLEG   +
Sbjct  856   LVLQKKGELLELVDPRLGSDVSEEEAIRMIKVALLCINAAPALRPAMSAVVSMLEGRTAV  915

Query  1124  LE  1129
              E
Sbjct  916   HE  917



>ref|XP_010316866.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=993

 Score =   481 bits (1239),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 272/329 (83%), Gaps = 7/329 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             E R LD  TG+FT  QIKAATNNFD ANKIGEGGFGSVYKGTL DG VIAVKQLSSKS Q
Sbjct  638   ESRGLDSMTGVFTIRQIKAATNNFDAANKIGEGGFGSVYKGTLSDGAVIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G REF+NEIG+IS L HPNLV+LYGCC ER  LLLVYEYMENNSLA ALFG E+ +LKID
Sbjct  698   GKREFVNEIGMISSLHHPNLVQLYGCCAERNHLLLVYEYMENNSLARALFGPEEHRLKID  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE-K  757
             W TRQ+IC+GIAKGL+FLHEES++K+VHRDIK  NVLLDK+LNPKISDFGLA+LDDD+  
Sbjct  758   WPTRQKICIGIAKGLSFLHEESSLKIVHRDIKATNVLLDKKLNPKISDFGLARLDDDDNN  817

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI+TRVAGTIGY APEYALWGYLT+KADVYSFGV+ALEI +GK+NM +RP+E +VCLLD
Sbjct  818   THITTRVAGTIGYMAPEYALWGYLTYKADVYSFGVLALEIAAGKSNMTYRPNEKFVCLLD  877

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WALVLQ +G L E++D  LGSD ++++AL+ML VALLCT+PSP LRP+MS VV +LE + 
Sbjct  878   WALVLQRQGKLKEVVDATLGSDLNEDEALRMLNVALLCTSPSPALRPTMSAVVKILENHL  937

Query  1118  DILEYKSNIR------ELNFQAV*VHYEE  1186
             D+ E+    R        NFQ +   YE+
Sbjct  938   DLPEFTMESRFYDDYDLFNFQGLRDKYED  966



>gb|KCW67548.1| hypothetical protein EUGRSUZ_F01302 [Eucalyptus grandis]
Length=663

 Score =   470 bits (1210),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAAT NF   NKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  287   ELRGLDLQTGRFTLRQIKAATGNFASVNKIGEGGFGPVYKGILSDGTIIAVKQLSSKSKQ  346

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA+A+FG +++ +++D
Sbjct  347   GNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLAHAIFGQDEQLIQLD  406

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  407   WATRKKICLGIARGLAYLHEESILKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  466

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  467   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDW  526

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRL S++ +E+A++ML +ALLCTNPSP LRP MS+VVSMLEG G 
Sbjct  527   AYVLQERGNVLELVDPRLDSNYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKGA  586

Query  1121  I  1123
             I
Sbjct  587   I  587



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score =   479 bits (1232),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 226/298 (76%), Positives = 261/298 (88%), Gaps = 0/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG LLDGT+IAVKQLSSKS Q
Sbjct  590   DLRGLDLQTGSFTLRQIKAATNNFDAANKIGEGGFGSVYKGQLLDGTLIAVKQLSSKSKQ  649

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSL+ ALFG +D  LK+D
Sbjct  650   GNREFVNEIGMISGLQHPNLVKLYGCCIEEDQLLLVYEYMENNSLSRALFGPDDGPLKLD  709

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIA+GLAFLHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKLD++EK+
Sbjct  710   WPTRQRICVGIARGLAFLHEESRLKIVHRDIKGTNVLLDRDLNPKISDFGLAKLDEEEKT  769

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HIST+VAGTIGY APEYALWG+LTFKADVYSFGVVALEIVSG+ N  +RP  +  CLLDW
Sbjct  770   HISTQVAGTIGYMAPEYALWGHLTFKADVYSFGVVALEIVSGRTNSTYRPKSDCTCLLDW  829

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             A +LQ++ +L+EL+DPRLGSDF++++  +M++VALLC   SP LRPSMS VVSMLEG+
Sbjct  830   AFLLQKRESLLELVDPRLGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGS  887



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   464 bits (1195),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 233/346 (67%), Positives = 273/346 (79%), Gaps = 16/346 (5%)
 Frame = +2

Query  104   RKLDVVTICACSHMCYADSIPKLILY-----CTRNY-S*SNCSCTELRDLDLGTGMFTFT  265
             RK  V+     S +C       LIL+     C R+Y    N    ELR LDL  G FT  
Sbjct  137   RKFSVIVGAVTSLLC-------LILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLR  189

Query  266   QIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCL  445
             QIKAATNNFD ANKIGEGGFGSV+KG L DGT+IAVKQLSSKS QG REF+NEIG+IS L
Sbjct  190   QIKAATNNFDSANKIGEGGFGSVFKGQLSDGTLIAVKQLSSKSRQGYREFVNEIGLISAL  249

Query  446   QHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQ---LKIDWATRQRICVGIA  616
             QHPNLVKLYGCC E   LLLVYEYMENNSLA ALF   D +   LK+DWATRQ+ICVGIA
Sbjct  250   QHPNLVKLYGCCTEGNQLLLVYEYMENNSLAYALFDKNDAKTSALKLDWATRQKICVGIA  309

Query  617   KGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGY  796
             +G+AFL EEST+K+VHRDIK  NVLLD++LN KISDFGLA+L+ +E +HISTRVAGTIGY
Sbjct  310   RGIAFLQEESTLKIVHRDIKATNVLLDEDLNAKISDFGLARLNGEESTHISTRVAGTIGY  369

Query  797   TAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLME  976
              APEYALWGYLT KAD+YSFGVVALEIVSGKNN  ++P+   VCLLD A VLQ++G+LME
Sbjct  370   MAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLME  429

Query  977   LIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             ++DP+LGS+F++++A +M++VALLCTN SP LRP+MS VVSMLEG 
Sbjct  430   IVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEGQ  475



>gb|KCW71078.1| hypothetical protein EUGRSUZ_F04177 [Eucalyptus grandis]
Length=771

 Score =   473 bits (1216),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/301 (75%), Positives = 262/301 (87%), Gaps = 2/301 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             E+ DLDL TG FT  QIKAAT NFD  NKIGEGGFG+VYKGTLLDGT+IAVKQ SSKS Q
Sbjct  397   EVNDLDLQTGHFTLQQIKAATGNFDSVNKIGEGGFGAVYKGTLLDGTIIAVKQHSSKSKQ  456

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEI +I  LQHPNLVKLYGCC+E   LLLVYEYMENNSLA+ALF  +++Q+++D
Sbjct  457   GNREFLNEISMIFALQHPNLVKLYGCCIEGNQLLLVYEYMENNSLAHALF--DEQQIELD  514

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++I +GIA+GLA+LHEEST+K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  515   WATRKKIGLGIARGLAYLHEESTLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  574

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  575   HISTRVAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDW  634

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ KE+A++ML +ALLCTNPSP LRP MSTVVS+LEGN  
Sbjct  635   AYVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPPMSTVVSILEGNSP  694

Query  1121  I  1123
             I
Sbjct  695   I  695



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   479 bits (1233),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/298 (76%), Positives = 261/298 (88%), Gaps = 0/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG LLDGT+IAVKQLSSKS Q
Sbjct  644   DLRGLDLQTGSFTLRQIKAATNNFDAANKIGEGGFGSVYKGQLLDGTLIAVKQLSSKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSL+ ALFG +D  LK+D
Sbjct  704   GNREFVNEIGMISGLQHPNLVKLYGCCIEEDQLLLVYEYMENNSLSRALFGPDDGPLKLD  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIA+GLAFLHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKLD++EK+
Sbjct  764   WPTRQRICVGIARGLAFLHEESRLKIVHRDIKGTNVLLDRDLNPKISDFGLAKLDEEEKT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HIST+VAGTIGY APEYALWG+LTFKADVYSFGVVALEIVSG+ N  +RP  +  CLLDW
Sbjct  824   HISTQVAGTIGYMAPEYALWGHLTFKADVYSFGVVALEIVSGRTNSTYRPKSDCTCLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             A +LQ++ +L+EL+DPRLGSDF++++  +M++VALLC   SP LRPSMS VVSMLEG+
Sbjct  884   AFLLQKRESLLELVDPRLGSDFNRQEVERMIKVALLCITASPTLRPSMSQVVSMLEGS  941



>ref|XP_006847775.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
 gb|ERN09356.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
Length=559

 Score =   464 bits (1194),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 227/336 (68%), Positives = 269/336 (80%), Gaps = 2/336 (1%)
 Frame = +2

Query  116   VVTICACSHMCYADSIPKLILYCTRNYS*SNCSCTELRDLDLGTGMFTFTQIKAATNNFD  295
             +V I  CS  C+   +   +LY       ++    ELR L+L TG F+  QIKAAT NFD
Sbjct  144   IVGIVVCS--CFVVFLILALLYMKCYLGGNDKENKELRSLELQTGYFSLKQIKAATKNFD  201

Query  296   VANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYG  475
              ANKIGEGGFG VYKG L DG+ IA+KQLSSKS QGNREF+NEIG+IS LQHPNLVKLYG
Sbjct  202   PANKIGEGGFGPVYKGVLPDGSFIAIKQLSSKSKQGNREFVNEIGMISALQHPNLVKLYG  261

Query  476   CCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIK  655
             CC+E   LLL+YEYMENN L+ ALFG ++ +LK+DW TR +IC GIA+GLA+LHEES +K
Sbjct  262   CCIEGNQLLLIYEYMENNCLSRALFGPDESRLKLDWPTRLKICKGIARGLAYLHEESRLK  321

Query  656   VVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTF  835
             +VHRDIK  NVLLDK+LN KISDFGLAKLD++E +HISTR+AGTIGY APEYA+ GYLT 
Sbjct  322   IVHRDIKGTNVLLDKDLNAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLTD  381

Query  836   KADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKE  1015
             KADVYSFG+VALEIVSGK+N  +RP E  V LLDWA VLQEKG+L+EL+DP LGS++ K+
Sbjct  382   KADVYSFGIVALEIVSGKSNTNYRPKEECVYLLDWAYVLQEKGSLLELVDPELGSNYSKD  441

Query  1016  QALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             +ALKML V LLCTNPSP LRPSMS VVSMLEGN ++
Sbjct  442   EALKMLNVGLLCTNPSPTLRPSMSAVVSMLEGNANV  477



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   478 bits (1230),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 224/303 (74%), Positives = 266/303 (88%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD  NK+GEGGFGSVYKG L DGT+IAVKQLS+KS Q
Sbjct  647   ELVGLDLVTGIFTFRQIKAATNDFDPENKLGEGGFGSVYKGVLSDGTIIAVKQLSAKSKQ  706

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ L+G ++ Q K+D
Sbjct  707   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLYGKKEDQRKLD  766

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICVGIAKGLAFLHEEST+K+VHRDIK  NVLLD ++N KISDFG+AKLD+++ +
Sbjct  767   WHTRQRICVGIAKGLAFLHEESTLKIVHRDIKATNVLLDGDMNAKISDFGMAKLDEEDNT  826

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIV+G NNM+FR DE++VCLLDW
Sbjct  827   HITTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVAGMNNMRFRHDEDFVCLLDW  886

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL LQ+ G++MEL+DP LGS F+K++A+ M++VALLCTN SP LRP MS VV MLEG GD
Sbjct  887   ALNLQQNGDIMELVDPNLGSRFNKKEAVGMIKVALLCTNQSPALRPKMSAVVKMLEGKGD  946

Query  1121  ILE  1129
             + E
Sbjct  947   VQE  949



>ref|XP_006449568.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
 gb|ESR62808.1| hypothetical protein CICLE_v10015563mg [Citrus clementina]
Length=386

 Score =   457 bits (1177),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 219/300 (73%), Positives = 252/300 (84%), Gaps = 12/300 (4%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             +++ DL T  FT  QIKAATNNFD A KIGEGGFG VYKG L DGT+IAVKQLSSKS QG
Sbjct  1     MKESDLQTISFTLKQIKAATNNFDSAKKIGEGGFGPVYKGQLADGTIIAVKQLSSKSRQG  60

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREFLNEI +ISCLQHPNLVK++GCCVE   LLLVYEYMENNSLA+ALFG E+ +LK++W
Sbjct  61    NREFLNEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLAHALFGGENSRLKLNW  120

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
             + RQ+IC+GIA+GLAFLHEES  K+VHRDIK  NVLLD++LNPKISDFGLAKLD++EK+H
Sbjct  121   SVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTH  180

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSGK NM + PD N  CLLDW 
Sbjct  181   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKYNMSYVPDSNCSCLLDW-  239

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
                        L+DPRLGS+F+K +A KM++VALLCTN SP LRP+MS VVSMLEG+ +I
Sbjct  240   -----------LVDPRLGSEFNKVEAEKMIKVALLCTNVSPSLRPTMSEVVSMLEGSSNI  288



>gb|ACM89476.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=631

 Score =   466 bits (1199),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 265/315 (84%), Gaps = 4/315 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L+L TG F+  QIKAATNN D ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  265   LELKTGYFSLRQIKAATNNLDPANKIGEGGFGPVYKGVLSDGHVIAVKQLSSKSKQGNRE  324

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA+ALFG ++++L +DW TR
Sbjct  325   FVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLAHALFGEQEQKLHLDWPTR  384

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +HIST
Sbjct  385   MKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENTHIST  444

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N K+RP E +V LLDWA VL
Sbjct  445   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVL  504

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             QE+GNL+EL+DP LGS +  E+A++ML +ALLCTNPSP LRP+MS+VVSMLEG       
Sbjct  505   QEQGNLLELVDPNLGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEGKIPIQAP  564

Query  1121  ILEYKSNIRELNFQA  1165
             I++   + +++ F+A
Sbjct  565   IIKRSESNQDVRFKA  579



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   478 bits (1229),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 263/302 (87%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FTF Q+KAATNNFD ANK+GEGGFGSVYKG LLDGT+IAVKQLSSKS QG
Sbjct  654   LRGLDLQTGFFTFRQMKAATNNFDAANKLGEGGFGSVYKGVLLDGTIIAVKQLSSKSRQG  713

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             +REFLNE+ +I+ LQHPNLVKLYGCC+E   LLLVYEY+ENNSL  ALFG  + + K+DW
Sbjct  714   DREFLNELSMIAGLQHPNLVKLYGCCIEGNQLLLVYEYLENNSLYRALFGPNESRSKLDW  773

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIAKGLAFLHEES++K+VHRDIKT NVLLD +LN KISDFGLAK D++E +H
Sbjct  774   PTRQKICLGIAKGLAFLHEESSLKIVHRDIKTTNVLLDMDLNAKISDFGLAKFDEEENTH  833

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTRVAGTIGY APEYALWGYLT+KADVYSFG+VALE V+GK N ++ P+E++VCL DWA
Sbjct  834   ISTRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALETVAGKKNTRYGPEEDFVCLQDWA  893

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNLMEL+DP LG +F+KE+A++M++VALLCTNPSP LRP+MS VV ML+G   +
Sbjct  894   LVLQQKGNLMELVDPSLGGEFNKEEAVRMIKVALLCTNPSPALRPNMSEVVKMLKGRTHV  953

Query  1124  LE  1129
              E
Sbjct  954   PE  955



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   477 bits (1228),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 224/304 (74%), Positives = 267/304 (88%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  627   ELVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTRIAVKQLSAKSKQ  686

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  687   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  746

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++K
Sbjct  747   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDK  806

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  807   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  866

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             W L LQ+ G++ME++DPRLGS+F+K++ ++M+ +ALLCTN SP LRP+MSTVVSMLEG  
Sbjct  867   WVLYLQKSGDIMEMVDPRLGSEFNKKEVVRMINIALLCTNQSPALRPTMSTVVSMLEGKT  926

Query  1118  DILE  1129
             D+ E
Sbjct  927   DVEE  930



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score =   476 bits (1226),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 274/324 (85%), Gaps = 2/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  613   DLRSLDLHTGSFTLRQIKAATNNFDAANKIGEGGFGSVYKGLLSDGTIIAVKQLSSKSKQ  672

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYE+M+NNSLA+ALFG E+ QL++D
Sbjct  673   GNREFVNEIGMISALQHPHLVKLYGCCIEDNQLLLVYEFMKNNSLAHALFGPEECQLRLD  732

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TRQ+ICVGIA+GL +LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  733   WSTRQKICVGIARGLTYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  792

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFGVVALEIVSG++N  FR  E  V LLDW
Sbjct  793   HISTRIAGTFGYMAPEYAMKGYLTDKADVYSFGVVALEIVSGRSNTSFRLKEECVDLLDW  852

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+E+GNLM+L+DPRLGSDFDK + ++M+ VALLCTN SP LRP+MS VVSMLEG   
Sbjct  853   ALILKERGNLMDLVDPRLGSDFDKGEVMRMINVALLCTNSSPALRPAMSAVVSMLEGGAI  912

Query  1121  ILEYKS--NIRELNFQAV*VHYEE  1186
             I E+ S  +  E  ++A+  H+++
Sbjct  913   IQEFVSQPSYDESRYKAIQNHFQQ  936



>gb|KHG23496.1| putative LRR receptor-like serine/threonine-protein kinase RFK1 
[Gossypium arboreum]
Length=746

 Score =   469 bits (1207),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 227/336 (68%), Positives = 272/336 (81%), Gaps = 5/336 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL T  FT  QIKAATNNFD  NKIGEGGFG VYKG L DGT+IAVKQLSSKSSQ
Sbjct  385   DLRGLDLQTVSFTLKQIKAATNNFDSGNKIGEGGFGPVYKGQLADGTIIAVKQLSSKSSQ  444

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNE+G+ISCLQHPNLVKLYGCC+E   LLLVYEY+ENNSL+ ALFG E  ++ +D
Sbjct  445   GNREFLNEMGMISCLQHPNLVKLYGCCIEGNQLLLVYEYLENNSLSRALFGPEYSRINLD  504

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIAKG+AFLHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKL D++K+
Sbjct  505   WPTRQKICVGIAKGIAFLHEESRLKIVHRDIKGTNVLLDRDLNPKISDFGLAKLSDEDKT  564

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFG+VALE+VSGK+NM + P + Y CLLDW
Sbjct  565   HISTRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALELVSGKHNMNYGPVDEYTCLLDW  624

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A  LQ+ G L+EL+D +LGS+++K +A +M++VALLCTN SP LRP+MS VV MLEG   
Sbjct  625   ACHLQQSGKLLELVDDKLGSNYNKSEAERMIKVALLCTNASPSLRPTMSDVVGMLEGTIT  684

Query  1121  ILEYKSNI----RELNFQAV*VHYEEM-SIGSSDSP  1213
             I +   N      +L F+A+  H   + S G + +P
Sbjct  685   IPDVIPNACSYNEDLRFKAIRDHRSYIRSQGHTSTP  720



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score =   466 bits (1199),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 261/307 (85%), Gaps = 13/307 (4%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG F F QIKAATNNFD ANK+GEGGFG+VYKG LLDGT+IAVKQLSSKS Q
Sbjct  306   DLRGLDLQTGFFRFKQIKAATNNFDAANKLGEGGFGAVYKGELLDGTIIAVKQLSSKSKQ  365

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLV+LYGCC+E   L L       NS      G E   LK+D
Sbjct  366   GNREFVNEIGMISALKHPNLVRLYGCCIEGNQLRL-------NS------GQEKGILKLD  412

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIA+GLAF+HEEST+K+VHRDIKT N+LLD++LNPKISDFGLAKL+++EKS
Sbjct  413   WPTRQKICVGIARGLAFMHEESTLKIVHRDIKTTNILLDRDLNPKISDFGLAKLNEEEKS  472

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWG+LT K DVY FGVVALE+VSGKNN+K++P+ENYVCLLDW
Sbjct  473   HISTRVAGTIGYMAPEYALWGHLTDKVDVYGFGVVALELVSGKNNIKYQPNENYVCLLDW  532

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLMEL+DP+LGS+F+KE+A++M++VALLCTNPSP LRP+MS VVSMLEG   
Sbjct  533   AFVLQQKGNLMELVDPKLGSEFNKEEAMRMIKVALLCTNPSPALRPTMSAVVSMLEGRAI  592

Query  1121  ILEYKSN  1141
             + E   N
Sbjct  593   VHELNIN  599



>ref|XP_010313922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=919

 Score =   474 bits (1219),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 268/319 (84%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  540   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLADGAIIAVKQLSSKSKQ  599

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LL++YEYMENN LA ALFG +D++L ID
Sbjct  600   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNID  659

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR+RIC GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  660   WATRKRICSGIAKGLAYLHEESRLKIVHRDIKCTNVLLDKDLNAKISDFGLAKLDEEENT  719

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  720   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDW  779

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+DPRLG+++ K++A++M+ V+LLCTNPSP LRPSMS+VVSMLEG   
Sbjct  780   AYVLQEQGNLLELVDPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGKLP  839

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  ++  E+ F++
Sbjct  840   VQAPIIKRTTSDDEMRFKS  858



>ref|XP_006388878.1| hypothetical protein POPTR_0084s002301g, partial [Populus trichocarpa]
 gb|ERP47792.1| hypothetical protein POPTR_0084s002301g, partial [Populus trichocarpa]
Length=584

 Score =   462 bits (1190),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 262/319 (82%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD ANKIGEGGFG V+KG L DG VIAVKQLSSKS Q
Sbjct  212   ELRGLDLQTGYFTLRQIKHATNNFDTANKIGEGGFGPVFKGVLSDGAVIAVKQLSSKSRQ  271

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG E+ QL++D
Sbjct  272   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGREEHQLQLD  331

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL++LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  332   WQTRRKILLGIAKGLSYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  391

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  392   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  451

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+ NL+EL+DPRLGS + KE+A+KML +ALLCTN SP LRP+MS+VV MLEG   
Sbjct  452   AYVLHERNNLLELVDPRLGSSYSKEEAMKMLNLALLCTNLSPSLRPAMSSVVRMLEGKIP  511

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I+   S  +E  F+A
Sbjct  512   VQAPIINRGSMDQEARFKA  530



>gb|KCW67556.1| hypothetical protein EUGRSUZ_F01306 [Eucalyptus grandis]
Length=914

 Score =   473 bits (1217),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 225/301 (75%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAAT NF   NKIGEGGFG VYKGTL DG +IAVKQLSSKS Q
Sbjct  538   ELRGLDLQTGRFTLRQIKAATGNFASVNKIGEGGFGPVYKGTLSDGIIIAVKQLSSKSKQ  597

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA ALFG +++ +++D
Sbjct  598   GNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEQLIQLD  657

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  658   WATRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  717

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  718   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  777

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ KE+A++ML +ALLCTN SP LRP MS+VVSMLEG G 
Sbjct  778   ACVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNLSPTLRPPMSSVVSMLEGKGA  837

Query  1121  I  1123
             I
Sbjct  838   I  838



>ref|XP_010247775.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=938

 Score =   473 bits (1216),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 226/306 (74%), Positives = 258/306 (84%), Gaps = 0/306 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  569   DLRGLDLQTGSFTLRQIKAATNNFDAANKIGEGGFGSVYKGLLSDGTIIAVKQLSSKSKQ  628

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+D
Sbjct  629   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPEEYQLKLD  688

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +K+VHRDIK  N+LLDK LNPKISDFGLAKLDD+E +
Sbjct  689   WPTRHKICVGIARGLAYLHEESRLKIVHRDIKATNILLDKNLNPKISDFGLAKLDDEEDT  748

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFGVV LEIVSG++N  FRP E  + LLDW
Sbjct  749   HISTRIAGTFGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGRSNTSFRPKEERIYLLDW  808

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+EKGNLM+L DPRLGSDF++E+ + M+ VAL+CTNP   LRP MS VVSM+EG   
Sbjct  809   ALILKEKGNLMDLKDPRLGSDFNREEVMAMINVALMCTNPCAQLRPPMSAVVSMIEGRLP  868

Query  1121  ILEYKS  1138
             I E+ S
Sbjct  869   IHEFVS  874



>ref|XP_002305710.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
 gb|EEE86221.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
Length=468

 Score =   457 bits (1176),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 252/307 (82%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG FT  Q+ AATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLS KS Q
Sbjct  103   DLMGLDLKTGSFTLRQLGAATNNFDSANKIGEGGFGSVYKGELSDGTVIAVKQLSPKSRQ  162

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG+E   L +D
Sbjct  163   GNREFVNEIGMISGLKHPNLVKLYGCCIEGDQLLLVYEYMENNSLARALFGAETCALMLD  222

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL + E +
Sbjct  223   WPTRFKICVGIARGLAFLHEGSVIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLSEAENT  282

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSG++N  + P    VCLLDW
Sbjct  283   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDW  342

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ++GNLM L+DP+L S+F+KE+A KM++VALLC N SP LRPSM  VVSMLEG   
Sbjct  343   AFVLQKRGNLMALVDPKLRSEFNKEEAEKMMKVALLCANASPSLRPSMPAVVSMLEGQTS  402

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  403   IQEVISD  409



>ref|XP_011009667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=515

 Score =   459 bits (1180),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 222/307 (72%), Positives = 254/307 (83%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG FT   ++AATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLS KS Q
Sbjct  139   DLKGLDLKTGSFTLRHLRAATNNFDSANKIGEGGFGSVYKGKLSDGTVIAVKQLSPKSRQ  198

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG+E   L +D
Sbjct  199   GNREFVNEIGMISGLKHPNLVKLYGCCIEGDQLLLVYEYMENNSLARALFGTETSALMLD  258

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL + E +
Sbjct  259   WPTRFKICVGIARGLAFLHEGSVIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLSEAENT  318

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVVALEIVSG++N  + P    VCLLDW
Sbjct  319   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDW  378

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ++GNLM L+DP+L S+F+KE+A KM++VALLCTN SP LRP+M  VVSMLEG   
Sbjct  379   AFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCTNASPSLRPTMPAVVSMLEGQTS  438

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  439   IQEVISD  445



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 224/307 (73%), Positives = 259/307 (84%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG FT  Q++AATNNFD A KIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  231   DLMGLDLKTGSFTLRQLRAATNNFDSAGKIGEGGFGSVYKGKLSDGTLIAVKQLSPKSRQ  290

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALFGSE   L +D
Sbjct  291   GNREFVNEIGMISGLQHPNLVKLYGCCIEGDQLLLVYEYMENNSLAKALFGSETSFLMLD  350

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHEES I++VHRDIK  NVLLDK+L+ KISDFGLAKL+++E +
Sbjct  351   WPTRYKICVGIARGLAFLHEESAIRIVHRDIKGTNVLLDKDLSAKISDFGLAKLNEEENT  410

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSG++N  +R    +VCLLDW
Sbjct  411   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLLDW  470

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+KGNLME++DP+L S+F+KE+A +M+++ALLCTN SP LRP+MS VVSMLEG   
Sbjct  471   AHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQTS  530

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  531   IQEMISD  537



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score =   463 bits (1191),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 227/333 (68%), Positives = 270/333 (81%), Gaps = 9/333 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  262   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  321

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-----SEDR  565
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG     SE  
Sbjct  322   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGNHGAGSETS  381

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DW TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL+
Sbjct  382   ALMLDWPTRYKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLN  441

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             ++E +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSGK+N  +RP+   V
Sbjct  442   EEENTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENV  501

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
             CLLDWA  LQ+KGNLME++DP+L S+F+KE+A +M++ ALLCTN SP LRP+MS VVSML
Sbjct  502   CLLDWAHALQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSML  561

Query  1106  EGNGDILEYKSNIR----ELNFQAV*VHYEEMS  1192
             EG   I E  S+      +L+ + +  HY++++
Sbjct  562   EGQTSIQEVTSDPSIYGDDLHSKRLKGHYQQVT  594



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score =   473 bits (1217),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 235/347 (68%), Positives = 272/347 (78%), Gaps = 11/347 (3%)
 Frame = +2

Query  206   NCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLS  385
             N    ELR LDL TG FT  QIKAATNNFD ANKIGEGGFG VYKGTL DG VIAVKQLS
Sbjct  583   NVEDKELRGLDLQTGYFTLRQIKAATNNFDAANKIGEGGFGPVYKGTLSDGAVIAVKQLS  642

Query  386   SKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR  565
             SKS QGNREF+NEIG+IS LQH NLVKLYGCC+E   LLLVYEY+ENNSLA ALFG E +
Sbjct  643   SKSKQGNREFVNEIGMISALQHQNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGKEGQ  702

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DWATR+RIC  IA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD
Sbjct  703   CLNLDWATRKRICSDIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLD  762

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             +DE +HISTR+AGT+GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V
Sbjct  763   EDENTHISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFV  822

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
              LLDWA VLQE+GNL+EL+DP LGS+F K++A+ ML +ALLCTNPSP LRP+MS+ VSML
Sbjct  823   YLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSML  882

Query  1106  EG----NGDILEYKSNIRELNFQAV*VHYEEMSIGSSDSPNKVDICS  1234
             EG       I+   S+ ++  F+A         I S DS  +V   S
Sbjct  883   EGKTAVQAPIIRRNSDSQDARFRA-------FEILSQDSQTQVSTLS  922



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score =   488 bits (1255),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 228/302 (75%), Positives = 263/302 (87%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR +DL TG FT  QIKAATNNFD +NKIGEGGFG VYKG LLDGT+IAVKQLSSKS QG
Sbjct  285   LRGMDLQTGFFTLRQIKAATNNFDPSNKIGEGGFGPVYKGILLDGTIIAVKQLSSKSKQG  344

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+ISCLQHPNLV++YGCC+E   LLLVYEYMENNSLA AL+G ED  L +DW
Sbjct  345   NREFVNEIGMISCLQHPNLVRMYGCCIEANQLLLVYEYMENNSLARALYGPEDDLLNLDW  404

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TR +ICVGIAKGLA+LHEES +KVVHRDIKT NVLLD++LN KISDFGLA+LD++EK+H
Sbjct  405   PTRHKICVGIAKGLAYLHEESAVKVVHRDIKTTNVLLDQDLNAKISDFGLARLDEEEKTH  464

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             IST+VAGTIGY APEYALWG LT+KADVYSFGVVALE VSGKNNMK+RP+EN  CL+DWA
Sbjct  465   ISTKVAGTIGYMAPEYALWGCLTYKADVYSFGVVALETVSGKNNMKYRPNENIQCLMDWA  524

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
              VL +KGNL+EL+DPRLGSDF+K++AL+ ++VALLC NP+  LRP MS VVSMLEG   +
Sbjct  525   HVLHQKGNLLELVDPRLGSDFNKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPV  584

Query  1124  LE  1129
              E
Sbjct  585   DE  586


 Score =   487 bits (1253),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 231/302 (76%), Positives = 266/302 (88%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR LDL TG FT  QIKAATNNFD  NKIGEGGFG VYKGTLLDGT IAVKQLSSKS QG
Sbjct  1313  LRGLDLKTGFFTLRQIKAATNNFDPLNKIGEGGFGCVYKGTLLDGTAIAVKQLSSKSKQG  1372

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+IS LQHPN+V+LYGCC+E   LLLVYEYMENNSLA++LF  E   L +DW
Sbjct  1373  NREFVNEIGMISGLQHPNVVRLYGCCIEGNQLLLVYEYMENNSLAHSLFEEEKGFLNLDW  1432

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ++C+GIA+GLAFLHEEST+KVVHRDIKT NVLLDK+LN KISDFGLAKLD++E +H
Sbjct  1433  PTRQKVCLGIARGLAFLHEESTLKVVHRDIKTTNVLLDKDLNAKISDFGLAKLDEEENTH  1492

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             ISTR+AGTIGY APEYALWG LT+KADVYSFGVVALEIV+GKNNMKFRP++++VCL+DWA
Sbjct  1493  ISTRIAGTIGYMAPEYALWGCLTYKADVYSFGVVALEIVAGKNNMKFRPNDDFVCLVDWA  1552

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LVLQ+KGNL EL+D RLGSD++KEQA++M +VALLCTN +P LRP+MS VVSMLEG   +
Sbjct  1553  LVLQQKGNLKELVDQRLGSDYNKEQAIRMAKVALLCTNSAPSLRPTMSVVVSMLEGKTAV  1612

Query  1124  LE  1129
              E
Sbjct  1613  PE  1614



>ref|XP_006370083.1| hypothetical protein POPTR_0001s393801g, partial [Populus trichocarpa]
 gb|ERP66652.1| hypothetical protein POPTR_0001s393801g, partial [Populus trichocarpa]
Length=620

 Score =   462 bits (1188),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 262/319 (82%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  251   ELRGLDLQTGYFTLRQIKHATNNFDTANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSRQ  310

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG E+ QL++D
Sbjct  311   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGREEHQLQLD  370

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL++LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  371   WQTRRKILLGIAKGLSYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  430

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  431   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  490

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+ NL+EL+DPRLGS + KE+A+KML +ALLCTN SP LRP+MS+VV MLEG   
Sbjct  491   AYVLHERNNLLELVDPRLGSSYSKEEAMKMLNLALLCTNLSPSLRPAMSSVVRMLEGKIP  550

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I+   S  +E  F+A
Sbjct  551   VQAPIINRGSMDQEARFKA  569



>ref|XP_010094305.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB55701.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=363

 Score =   452 bits (1163),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 212/298 (71%), Positives = 257/298 (86%), Gaps = 1/298 (0%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             +DL TG+FT  QIKAAT NFD ANK+GEGGFG+VYKG L DGTVIAVKQLSSKS QGNRE
Sbjct  1     MDLQTGIFTLRQIKAATKNFDAANKLGEGGFGAVYKGQLADGTVIAVKQLSSKSKQGNRE  60

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-SEDRQLKIDWAT  589
             FLNEIG+IS LQHPNLVKL+GCCVE   L+L+YE+MENN L+ ALFG +   +L+++W+T
Sbjct  61    FLNEIGMISALQHPNLVKLHGCCVEGNQLMLIYEFMENNCLSRALFGKNPSSRLRLNWST  120

Query  590   RQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIS  769
             R++IC+GIA+GLA+LH ES +K+VHRDIKT+NVLLDK+ N KISDFGLAKL++D+ +HIS
Sbjct  121   RKKICLGIARGLAYLHGESVLKIVHRDIKTSNVLLDKDFNAKISDFGLAKLNEDDNTHIS  180

Query  770   TRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALV  949
             TR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E++V LLDWA V
Sbjct  181   TRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEDFVYLLDWAYV  240

Query  950   LQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             LQE+GNL+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  ++
Sbjct  241   LQERGNLLELVDPALGSEYLSEEAILMLNVALLCTNASPTLRPTMSQVVSMLEGRTEV  298



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score =   468 bits (1204),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  468   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  527

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  528   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  587

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  588   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  647

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  648   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  707

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  708   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  767

Query  1118  DILE  1129
             D+ E
Sbjct  768   DVEE  771



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score =   460 bits (1183),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 231/353 (65%), Positives = 276/353 (78%), Gaps = 7/353 (2%)
 Frame = +2

Query  173   ILYCTRNYS*SNCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLL  352
             ++Y    Y   N    EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L 
Sbjct  197   VIYWKLCYGDKNTRERELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELA  256

Query  353   DGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNS  532
             DGT+IAVKQLS KS QGNREF+NEIG+ISCLQHPNLV+LYG C+E   LLLVYEYMENNS
Sbjct  257   DGTIIAVKQLSPKSRQGNREFVNEIGMISCLQHPNLVRLYGFCIEGDQLLLVYEYMENNS  316

Query  533   LANALFG---SEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKE  703
             L+ ALFG   SE   L +DW TR +IC GIA+GLAFLHE S I++VHRDIK  NVLLDK+
Sbjct  317   LSRALFGNHSSETSALMLDWPTRYKICAGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKD  376

Query  704   LNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVS  883
             LN KISDFGLAKL+++E +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVS
Sbjct  377   LNAKISDFGLAKLNEEENTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVS  436

Query  884   GKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPS  1063
             GK+N  +RP+   VCLLDWA VLQ+K NLME++DP+L S+F+KE+A +M++ ALLCTN S
Sbjct  437   GKSNSSYRPENENVCLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNAS  496

Query  1064  PVLRPSMSTVVSMLEGNGDILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             P LRP+MS VVSMLEG   I E  S+      +L+ + V  HY++++  S +S
Sbjct  497   PSLRPAMSEVVSMLEGQTSIPEVTSDPSIYGDDLHSKRVKGHYQQVTDQSLNS  549



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score =   473 bits (1217),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 230/324 (71%), Positives = 266/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  206   NCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLS  385
             N    ELR LDL TG FT  QIKAATNNFD ANKIGEGGFG VYKGTL DG VIAVKQLS
Sbjct  633   NVEDKELRGLDLQTGYFTLRQIKAATNNFDAANKIGEGGFGPVYKGTLSDGAVIAVKQLS  692

Query  386   SKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR  565
             SKS QGNREF+NEIG+IS LQH NLVKLYGCC+E   LLLVYEY+ENNSLA ALFG E +
Sbjct  693   SKSKQGNREFVNEIGMISALQHQNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGKEGQ  752

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DWATR+RIC  IA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD
Sbjct  753   CLNLDWATRKRICSDIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLD  812

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             +DE +HISTR+AGT+GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V
Sbjct  813   EDENTHISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFV  872

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
              LLDWA VLQE+GNL+EL+DP LGS+F K++A+ ML +ALLCTNPSP LRP+MS+VVSML
Sbjct  873   YLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSVVSML  932

Query  1106  EG----NGDILEYKSNIRELNFQA  1165
             EG       I+   S+ ++  F+A
Sbjct  933   EGKTAVQAPIIRRNSDSQDARFRA  956



>ref|XP_010060732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1011

 Score =   473 bits (1217),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 225/301 (75%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAAT NF   NKIGEGGFG VYKGTL DG +IAVKQLSSKS Q
Sbjct  635   ELRGLDLQTGRFTLRQIKAATGNFASVNKIGEGGFGPVYKGTLSDGIIIAVKQLSSKSKQ  694

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA ALFG +++ +++D
Sbjct  695   GNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEQLIQLD  754

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  755   WATRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  814

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  815   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  874

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ KE+A++ML +ALLCTN SP LRP MS+VVSMLEG G 
Sbjct  875   ACVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNLSPTLRPPMSSVVSMLEGKGA  934

Query  1121  I  1123
             I
Sbjct  935   I  935



>ref|XP_004251900.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
 ref|XP_010313921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
Length=1018

 Score =   473 bits (1217),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 225/319 (71%), Positives = 268/319 (84%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  639   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLADGAIIAVKQLSSKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LL++YEYMENN LA ALFG +D++L ID
Sbjct  699   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNID  758

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR+RIC GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  759   WATRKRICSGIAKGLAYLHEESRLKIVHRDIKCTNVLLDKDLNAKISDFGLAKLDEEENT  818

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  819   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDW  878

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+DPRLG+++ K++A++M+ V+LLCTNPSP LRPSMS+VVSMLEG   
Sbjct  879   AYVLQEQGNLLELVDPRLGTNYSKKEAMRMINVSLLCTNPSPTLRPSMSSVVSMLEGKLP  938

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  ++  E+ F++
Sbjct  939   VQAPIIKRTTSDDEMRFKS  957



>ref|XP_011009666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=515

 Score =   457 bits (1176),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 253/307 (82%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG FT   ++AATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLS KS Q
Sbjct  139   DLKGLDLKTGSFTLRHLRAATNNFDSANKIGEGGFGSVYKGKLSDGTVIAVKQLSPKSRQ  198

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLVKLYGCC+E   LLLVYEYMENNSLA ALF +E   L +D
Sbjct  199   GNREFVNEIGMISGLKHPNLVKLYGCCIEGDQLLLVYEYMENNSLARALFAAETSALMLD  258

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL + E +
Sbjct  259   WPTRFKICVGIARGLAFLHEGSVIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLSEAENT  318

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVVALEIVSG++N  + P    VCLLDW
Sbjct  319   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDW  378

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ++GNLM L+DP+L S+F+KE+A KM++VALLCTN SP LRP+M  VVSMLEG   
Sbjct  379   AFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCTNASPSLRPTMPAVVSMLEGQTS  438

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  439   IQEVISD  445



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score =   473 bits (1216),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 232/324 (72%), Positives = 270/324 (83%), Gaps = 4/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATN+FD ANKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  644   DLRGLDLQTGSFTLRQIKAATNDFDPANKIGEGGFGPVYKGVLSDGTVIAVKQLSSKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYE+MENNSLA ALFG E+ QLK+D
Sbjct  704   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEFMENNSLARALFGPEESQLKLD  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD++E +
Sbjct  764   WPTRQKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEENT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  FRP    V LLDW
Sbjct  824   HISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTSFRPKGESVYLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+EKG LM+L+D RLGS+FDKE+ ++M+ VALLCTN S  LRP+MS VVSMLEG   
Sbjct  884   ALILKEKGKLMDLVDIRLGSEFDKEEVMRMINVALLCTNTSSTLRPAMSAVVSMLEGQAA  943

Query  1121  ILEY--KSNIR--ELNFQAV*VHY  1180
             I E+   S+I   E+ ++A+  H+
Sbjct  944   IQEFVPDSSITDDEVRYKAIQDHF  967



>ref|XP_006346646.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Solanum tuberosum]
Length=769

 Score =   465 bits (1197),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 223/319 (70%), Positives = 265/319 (83%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  397   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSKQ  456

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LL++YEYMENN LA ALFG +D++L +D
Sbjct  457   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNLD  516

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR+RIC GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  517   WATRKRICSGIAKGLAYLHEESRLKIVHRDIKCTNVLLDKDLNAKISDFGLAKLDEEENT  576

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA  GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  577   HISTRIAGTVGYMAPEYATRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  636

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+D  LGS++ K++A++M+ ++LLCTN SP LRPSMS+VVSMLEG   
Sbjct  637   AYVLQEQGNLLELVDSHLGSNYSKKEAMQMINISLLCTNLSPTLRPSMSSVVSMLEGKLP  696

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  ++  E+ F++
Sbjct  697   VQAPIIKLTTSTNEMRFKS  715



>ref|XP_006377472.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55269.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=582

 Score =   459 bits (1180),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/298 (74%), Positives = 255/298 (86%), Gaps = 2/298 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  250   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  309

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG--SEDRQLK  574
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG  SE   L 
Sbjct  310   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGAGSETSALM  369

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL+++E
Sbjct  370   LDWPTRYKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLNEEE  429

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSGK+N  +RP+   VCLL
Sbjct  430   NTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCLL  489

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLE  1108
             DWA VLQ+KGNLME++DP+L S+F+KE+A +M++ ALLCTN SP LRP+MS VVSML+
Sbjct  490   DWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLK  547



>ref|XP_004295405.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1351

 Score =   480 bits (1236),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 225/302 (75%), Positives = 261/302 (86%), Gaps = 0/302 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             LR +DL TG FT  QIKAATNNFD +NKIGEGGFG VYKG LLDGT+IAVKQLSSKS QG
Sbjct  612   LRGMDLQTGFFTLRQIKAATNNFDPSNKIGEGGFGPVYKGILLDGTIIAVKQLSSKSKQG  671

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+NEIG+ISCL+HPNLV+LYGCC+E   LLLVYEY+ENNSLA AL+G ED  L +DW
Sbjct  672   NREFVNEIGMISCLRHPNLVRLYGCCIEANQLLLVYEYLENNSLARALYGPEDDSLNLDW  731

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TR +IC+ IAKGLA+LHEES +KVVHRDIKT NVLLD++LN KISDFGLA+LD++EK+H
Sbjct  732   PTRHKICLDIAKGLAYLHEESAVKVVHRDIKTTNVLLDQDLNAKISDFGLARLDEEEKTH  791

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             IST+VAGTIGY APEYALWG LT+KADVYSFGVVALE VSGKNNMK+RP EN  CL+DWA
Sbjct  792   ISTKVAGTIGYMAPEYALWGCLTYKADVYSFGVVALETVSGKNNMKYRPHENIQCLMDWA  851

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
              VL +KGNL+EL+DPRLGSDF+K++AL+ ++VALLC NP+  LRP MS VVSMLEG   +
Sbjct  852   HVLHKKGNLLELVDPRLGSDFNKKEALRTIKVALLCANPTAALRPIMSAVVSMLEGRTPV  911

Query  1124  LE  1129
              E
Sbjct  912   DE  913



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score =   457 bits (1177),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 224/309 (72%), Positives = 260/309 (84%), Gaps = 2/309 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG FT  Q++AATNNFD A+KIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  178   DLKGLDLKTGSFTLRQLRAATNNFDSADKIGEGGFGSVYKGKLSDGTLIAVKQLSPKSRQ  237

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALF--GSEDRQLK  574
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALF  GSE   L 
Sbjct  238   GNREFVNEIGMISGLQHPNLVKLYGCCIEGDQLLLVYEYMENNSLAKALFATGSETSFLM  297

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TR +ICVGIA+GLAFLHEES I++VHRDIK  NVLLDK+L+ KISDFGLAKL+++E
Sbjct  298   LDWPTRYKICVGIARGLAFLHEESAIRIVHRDIKGTNVLLDKDLSAKISDFGLAKLNEEE  357

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSG++N   R    +VCLL
Sbjct  358   NTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSSHRTTNEFVCLL  417

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             DWA VLQ+KGNLME++DP+L S+F+KE+A +M+++ALLCTN SP LRP+MS VVSMLEG 
Sbjct  418   DWAHVLQKKGNLMEIVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQ  477

Query  1115  GDILEYKSN  1141
               I E  S+
Sbjct  478   TSIQEMISD  486



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   471 bits (1211),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 222/302 (74%), Positives = 264/302 (87%), Gaps = 1/302 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF+QIKAATN+FD ANKIGEGGFG VYKG L DG  IAVKQLS+KS Q
Sbjct  607   ELVGLDLLTGIFTFSQIKAATNDFDPANKIGEGGFGCVYKGALSDGIQIAVKQLSAKSKQ  666

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLK-I  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ Q K +
Sbjct  667   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIQAKKL  726

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRIC+ IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  727   DWRTRQRICLSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  786

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  787   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  846

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             W L LQ+ G++M ++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  847   WVLYLQKNGDIMAMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  906

Query  1118  DI  1123
             D+
Sbjct  907   DV  908



>emb|CBI30739.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   467 bits (1201),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 226/316 (72%), Positives = 263/316 (83%), Gaps = 4/316 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             LD+  G FT  QIKAATNNFD  N+IGEGGFG VYKG L DGT IAVKQLSSKS+QGNRE
Sbjct  365   LDVHIGSFTLKQIKAATNNFDSLNQIGEGGFGPVYKGLLPDGTAIAVKQLSSKSTQGNRE  424

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             FLNEIG+ISCLQHPNLVKL+GCC+E   LLLVYEYMENNSLA AL G E+ QLK+DW TR
Sbjct  425   FLNEIGMISCLQHPNLVKLHGCCIEGNQLLLVYEYMENNSLARALLGPENCQLKLDWPTR  484

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
             Q+ICVGIA+GLAFLHEES +K+VHRDIK  NVLLD +LNPKISDFGLAKL ++EK+HIST
Sbjct  485   QKICVGIARGLAFLHEESRLKIVHRDIKGTNVLLDGDLNPKISDFGLAKLHEEEKTHIST  544

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             RVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSGK+NM ++P  +  CLLDWA  L
Sbjct  545   RVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSL  604

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             Q+ G++MEL+D +LGS+F+K++A +M++VALLCTN SP LRP+MS  VSMLEG       
Sbjct  605   QQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDA  664

Query  1121  ILEYKSNIRELNFQAV  1168
             I E  S   +L F+A+
Sbjct  665   IPEAGSYSEDLRFKAI  680



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score =   459 bits (1182),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 264/319 (83%), Gaps = 18/319 (6%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  238   ELVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTRIAVKQLSAKSKQ  297

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLL YEYMENNSLA+ LFG+++ +  K+
Sbjct  298   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLAYEYMENNSLAHVLFGTKEIKATKL  357

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  358   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  417

Query  758   SHISTRVAGTIGYTAPEYALWGYLT-----------------FKADVYSFGVVALEIVSG  886
             +HI TR+AGT+GY APEYAL+GYLT                 +KADVYSFGVVALEIVSG
Sbjct  418   THIDTRIAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSYKADVYSFGVVALEIVSG  477

Query  887   KNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSP  1066
              NN+KFR DEN+VCLLD AL LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP
Sbjct  478   MNNVKFRRDENFVCLLDRALYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSP  537

Query  1067  VLRPSMSTVVSMLEGNGDI  1123
              LRP+MSTVVSMLEG  D+
Sbjct  538   ALRPTMSTVVSMLEGKTDV  556



>ref|XP_010063817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1009

 Score =   471 bits (1213),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 226/301 (75%), Positives = 262/301 (87%), Gaps = 2/301 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             E+ DLDL TG FT  QIKAAT NFD  NKIGEGGFG+VYKGTLLDGT+IAVKQ SSKS Q
Sbjct  635   EVNDLDLQTGHFTLQQIKAATGNFDSVNKIGEGGFGAVYKGTLLDGTIIAVKQHSSKSKQ  694

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEI +I  LQHPNLVKLYGCC+E   LLLVYEYMENNSLA+ALF  +++Q+++D
Sbjct  695   GNREFLNEISMIFALQHPNLVKLYGCCIEGNQLLLVYEYMENNSLAHALF--DEQQIELD  752

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++I +GIA+GLA+LHEEST+K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  753   WATRKKIGLGIARGLAYLHEESTLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  812

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  813   HISTRVAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDW  872

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ KE+A++ML +ALLCTNPSP LRP MSTVVS+LEGN  
Sbjct  873   AYVLQEQGNVLELVDPRLGSDYSKEEAMRMLNLALLCTNPSPTLRPPMSTVVSILEGNSP  932

Query  1121  I  1123
             I
Sbjct  933   I  933



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score =   471 bits (1213),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 265/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  206   NCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLS  385
             N    ELR LDL TG FT  QIKAATNNFD ANKIGEGGFG VYKGTL DG VIAVKQLS
Sbjct  633   NVEDKELRGLDLQTGYFTLRQIKAATNNFDAANKIGEGGFGPVYKGTLSDGAVIAVKQLS  692

Query  386   SKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR  565
             SKS QGNREF+NEIG+IS LQH NLVKLYGCC+E   LLLVYEY+ENNSLA ALFG E +
Sbjct  693   SKSKQGNREFVNEIGMISALQHQNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGKEGQ  752

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DWATR+RIC  IA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD
Sbjct  753   CLNLDWATRKRICSDIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLD  812

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             +DE +HISTR+AGT+GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V
Sbjct  813   EDENTHISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFV  872

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
              LLDWA VLQE+GNL+EL+DP LGS+F K++A+ ML +ALLCTNPSP LRP+MS+ VSML
Sbjct  873   YLLDWAYVLQEQGNLLELVDPSLGSNFSKKEAMTMLNIALLCTNPSPTLRPTMSSAVSML  932

Query  1106  EG----NGDILEYKSNIRELNFQA  1165
             EG       I+   S+ ++  F+A
Sbjct  933   EGKTAVQAPIIRRNSDSQDARFRA  956



>ref|XP_006358931.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Solanum tuberosum]
Length=1020

 Score =   471 bits (1213),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 267/319 (84%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  641   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLADGAIIAVKQLSSKSKQ  700

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LL++YEYMENN LA ALFG +D++L ID
Sbjct  701   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNID  760

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR+RIC GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  761   WATRKRICSGIAKGLAYLHEESRLKIVHRDIKCTNVLLDKDLNAKISDFGLAKLDEEENT  820

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  821   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLDW  880

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+DPRLG+ + K++A++M+ ++LLCTNPSP LRPSMS+VVSMLEG   
Sbjct  881   AYVLQEQGNLLELVDPRLGTHYSKKEAMRMINISLLCTNPSPTLRPSMSSVVSMLEGKLP  940

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  ++  E+ F++
Sbjct  941   VQAPIIKRTTSDDEMRFKS  959



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/310 (72%), Positives = 257/310 (83%), Gaps = 3/310 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  195   ELQGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  254

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG---SEDRQL  571
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG   SE    
Sbjct  255   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGNHSSETSFQ  314

Query  572   KIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDD  751
              +DW TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL+++
Sbjct  315   TLDWPTRNKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLNEE  374

Query  752   EKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCL  931
             E +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSGK+N  +RP    VCL
Sbjct  375   ENTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGKSNSSYRPQNENVCL  434

Query  932   LDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             LDWA VLQ+K NLME++DP+L S+F+KE+A +M++ ALLCTN SP LRP+MS VVSMLEG
Sbjct  435   LDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSLRPAMSEVVSMLEG  494

Query  1112  NGDILEYKSN  1141
                I E  S+
Sbjct  495   QTSIQEMISD  504



>ref|XP_006467585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1045

 Score =   472 bits (1214),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 233/346 (67%), Positives = 272/346 (79%), Gaps = 5/346 (1%)
 Frame = +2

Query  170   LILYCTRNYS*SNCSCTE-LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGT  346
             L ++C R+Y  +     E L  L+     FT  QI+AAT+NFD  NKIGEGGFG VYKG 
Sbjct  622   LGIFCWRHYFRTKSGRQEDLEGLEFQASSFTLKQIRAATSNFDPMNKIGEGGFGPVYKGQ  681

Query  347   LLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMEN  526
             L DGT+IAVK LSSKS QGNREFLNEIG ISCLQHPNLVKLYGCC+E   L+LVYEY+EN
Sbjct  682   LTDGTIIAVKLLSSKSRQGNREFLNEIGTISCLQHPNLVKLYGCCIEGDQLMLVYEYLEN  741

Query  527   NSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKEL  706
             NSLA+ALFG E  QLK++W+ RQ+IC+GIA+GLAFLHEES  K+VHRDIK  NVLLD++L
Sbjct  742   NSLAHALFGGEISQLKLNWSVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDL  801

Query  707   NPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSG  886
             NPKISDFGLAKLD++EK+HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSG
Sbjct  802   NPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSG  861

Query  887   KNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSP  1066
             KNNM + PD N  C LDWA  L   G LMEL+DPRLGS+FDK +A +M++VALLCTN SP
Sbjct  862   KNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDKVEAERMIKVALLCTNASP  921

Query  1067  VLRPSMSTVVSMLEGNGD----ILEYKSNIRELNFQAV*VHYEEMS  1192
              LRP+MS VVSMLEG+ +    I E      +L F+ +  H  EM+
Sbjct  922   SLRPTMSEVVSMLEGSSNIPYVIPEAGGLSEDLRFKTLRDHPREMN  967



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score =   460 bits (1184),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 228/337 (68%), Positives = 271/337 (80%), Gaps = 7/337 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  292   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  351

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG---SEDRQL  571
             GNREF+NEIGIISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG   SE   L
Sbjct  352   GNREFVNEIGIISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGNHSSETSAL  411

Query  572   KIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDD  751
              +DW TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL+++
Sbjct  412   MLDWTTRYKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLNEE  471

Query  752   EKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCL  931
             E +HISTRVAGTIGY APEYA WGYLT KADVYSFGVVALEIVSGK+N  +RP+   VCL
Sbjct  472   ENTHISTRVAGTIGYMAPEYAQWGYLTDKADVYSFGVVALEIVSGKSNSSYRPENENVCL  531

Query  932   LDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             LDWA V Q+K NLME++DP+L S+F+KE+A +M++ ALLCTN SP +RP+MS VVSMLEG
Sbjct  532   LDWAHVFQKKENLMEIVDPKLHSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEG  591

Query  1112  NGDILEYKSN----IRELNFQAV*VHYEEMSIGSSDS  1210
                I E  S+      +L+ + V  HY++++  S +S
Sbjct  592   QTSIPEVTSDPSIFYDDLHSKRVNGHYQQVTDQSLNS  628



>ref|XP_007021933.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
 gb|EOY13458.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
Length=1010

 Score =   470 bits (1210),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 232/347 (67%), Positives = 277/347 (80%), Gaps = 11/347 (3%)
 Frame = +2

Query  206   NCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLS  385
             N    EL  LDL TG F+  Q+KAATNNFD ANKIGEGGFG VYKG L DGTVIAVKQLS
Sbjct  636   NAENNELHGLDLQTGYFSLRQMKAATNNFDAANKIGEGGFGPVYKGVLSDGTVIAVKQLS  695

Query  386   SKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR  565
             SKS QGNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENN LA ALFG +++
Sbjct  696   SKSKQGNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNCLARALFGRDEQ  755

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
             +L +DW+TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD
Sbjct  756   RLNLDWSTRRKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLD  815

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             ++E +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V
Sbjct  816   EEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFV  875

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
              LLDWA VLQE+GNL+EL+DP LGS + KE+AL+ML +ALLCTNPSP LRPSMS+VVSM+
Sbjct  876   YLLDWAYVLQEQGNLLELVDPSLGSHYSKEEALRMLNLALLCTNPSPTLRPSMSSVVSMM  935

Query  1106  EG----NGDILEYKSNIRELNFQAV*VHYEEMSIGSSDSPNKVDICS  1234
             EG       I++ K   ++  F+A    +E +   S DS   V I S
Sbjct  936   EGKIAVQAPIIKRKDADQDARFKA----FEML---SHDSQTNVSIFS  975



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   470 bits (1209),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 223/305 (73%), Positives = 266/305 (87%), Gaps = 1/305 (0%)
 Frame = +2

Query  218   TELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSS  397
             T+L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS 
Sbjct  638   TDLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSK  697

Query  398   QGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLK  574
             QGNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K
Sbjct  698   QGNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATK  757

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++
Sbjct  758   LDWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDED  817

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLL
Sbjct  818   NTHIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLL  877

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             D  L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG 
Sbjct  878   DRVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGK  937

Query  1115  GDILE  1129
              D+ E
Sbjct  938   TDVEE  942



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score =   466 bits (1199),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 278/368 (76%), Gaps = 15/368 (4%)
 Frame = +2

Query  152   ADSIPKLILY-----CTRNY-S*SNCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIG  313
             A S+  LIL+     C + Y    N    ELR LDL TG FT  QIKAATNNFD ANKIG
Sbjct  486   ATSVSCLILFVLGVLCWKYYFGGKNMMEKELRGLDLQTGSFTLRQIKAATNNFDYANKIG  545

Query  314   EGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERK  493
             EGGFGSVYKG L DGTVIAVKQLSSKS QGNREF+NEIGIISCL HPNLVKLYGCC+E  
Sbjct  546   EGGFGSVYKGQLSDGTVIAVKQLSSKSRQGNREFVNEIGIISCLHHPNLVKLYGCCIEGN  605

Query  494   PLLLVYEYMENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDI  673
              LLLVYEYMENNSLA ALF  E   LK+DWATR +ICVGIAKGL FLHEES I +VHRDI
Sbjct  606   QLLLVYEYMENNSLARALF--ERSVLKLDWATRYKICVGIAKGLTFLHEESRIMIVHRDI  663

Query  674   KTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYS  853
             K  NVLLD+ LN KISDFGLAKL++ E +HISTR+AGTIGY APEYALWGYLT KADVYS
Sbjct  664   KATNVLLDENLNAKISDFGLAKLNEGENTHISTRIAGTIGYMAPEYALWGYLTDKADVYS  723

Query  854   FGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKML  1033
             FGVV LEIVSGKNN  + PD    CLLDWA VL++KG+LMEL+DP LG++F+K++A  M+
Sbjct  724   FGVVTLEIVSGKNNSNYTPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNKKEAETMI  783

Query  1034  EVALLCTNPSPVLRPSMSTVVSMLEGNGDILEYKSNI----RELNFQAV*VHYEEMSIGS  1201
             +VALLCTN S  LRP+MS V+ MLEG   I E  S+     +++    +  HY+ M + S
Sbjct  784   KVALLCTNASSKLRPTMSAVLRMLEGQDIIPEVISDPSIYGKDMRISPLRDHYQHMEMQS  843

Query  1202  SD---SPN  1216
             S    +PN
Sbjct  844   SSGSLAPN  851



>ref|XP_006370088.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66657.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=728

 Score =   461 bits (1187),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 254/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F+  QIK ATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLS+KS Q
Sbjct  348   ELRALDLQTGYFSLRQIKHATNNFDPANKIGEGGFGPVYKGMLSDGSVIAVKQLSAKSKQ  407

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  408   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEHQIKLD  467

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL +LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  468   WQTRKKILLGIAKGLTYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  527

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  528   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  587

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ K +AL+ML +ALLCTNPSP LRPSMS+ V MLEG
Sbjct  588   AYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPSMSSAVKMLEG  644



>ref|XP_006495027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=380

 Score =   449 bits (1155),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 216/301 (72%), Positives = 248/301 (82%), Gaps = 4/301 (1%)
 Frame = +2

Query  302   NKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCC  481
             NKIGEGGFG VYKG L DGT+IAVK LSSKS QGNREFLNEIG ISCLQHPNLVKLYGCC
Sbjct  2     NKIGEGGFGPVYKGQLTDGTIIAVKLLSSKSRQGNREFLNEIGTISCLQHPNLVKLYGCC  61

Query  482   VERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVV  661
             +E   L+LVYEY+ENNSLA+ALFG E  QLK++W+ RQ+IC+GIA+GLAFLHEES  K+V
Sbjct  62    IEGDQLMLVYEYLENNSLAHALFGGEISQLKLNWSVRQKICLGIARGLAFLHEESRFKIV  121

Query  662   HRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKA  841
             HRDIK  NVLLD++LNPKISDFGLAKLD++EK+HISTRVAGTIGY APEYALWGYLT+KA
Sbjct  122   HRDIKATNVLLDRDLNPKISDFGLAKLDEEEKTHISTRVAGTIGYMAPEYALWGYLTYKA  181

Query  842   DVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQA  1021
             DVYSFGVVALEIVSGKNNM + PD N  C LDWA  L   G LMEL+DPRLGS+FDK +A
Sbjct  182   DVYSFGVVALEIVSGKNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDKVEA  241

Query  1022  LKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD----ILEYKSNIRELNFQAV*VHYEEM  1189
              +M++VALLCTN SP LRP+MS VVSMLEG+ +    I E      +L F+ +  H  EM
Sbjct  242   ERMIKVALLCTNASPSLRPTMSEVVSMLEGSSNIPYVIPEAGGLSEDLRFKTLRDHPREM  301

Query  1190  S  1192
             +
Sbjct  302   N  302



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   469 bits (1208),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 221/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF+QIKAATN+FD ANKIGEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  638   ELVGLDLLTGIFTFSQIKAATNDFDPANKIGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  698   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  757

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TR RICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  758   DWCTRHRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  817

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN VCLLD
Sbjct  818   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENVVCLLD  877

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             W L LQ+ G++M+++DPR+G++F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  878   WVLYLQKNGDIMDMVDPRMGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  937

Query  1118  DILE  1129
             D+ E
Sbjct  938   DVEE  941



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   469 bits (1208),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 221/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF+QIKAATN+FD ANKIGEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  640   ELVGLDLLTGIFTFSQIKAATNDFDPANKIGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  699

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  700   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  759

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TR RICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  760   DWCTRHRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  819

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN VCLLD
Sbjct  820   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENVVCLLD  879

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             W L LQ+ G++M+++DPR+G++F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  880   WVLYLQKNGDIMDMVDPRMGAEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  939

Query  1118  DILE  1129
             D+ E
Sbjct  940   DVEE  943



>ref|XP_010060734.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score =   469 bits (1207),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 260/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAAT NF   NKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  634   ELRGLDLQTGRFTLRQIKAATGNFASVNKIGEGGFGPVYKGILSDGTIIAVKQLSSKSKQ  693

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA+A+FG +++ +++D
Sbjct  694   GNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLAHAIFGQDEQLIQLD  753

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  754   WATRKKICLGIARGLAYLHEESILKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  813

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  814   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIVSGKSNTNYRPKEEFVYLLDW  873

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRL S++ +E+A++ML +ALLCTNPSP LRP MS+VVSMLEG G 
Sbjct  874   AYVLQERGNVLELVDPRLDSNYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKGA  933

Query  1121  I  1123
             I
Sbjct  934   I  934



>ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score =   469 bits (1207),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 258/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  638   ELKGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGVLSDGTIIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NE+G+IS LQHP+LVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ QL++D
Sbjct  698   GNREFVNELGMISALQHPHLVKLYGCCIEGNQLLLIYEYMENNSLARALFGPEECQLQLD  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  758   WPTRHRICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFG+VALEIVSG++N  +RP E    LLDW
Sbjct  818   HISTRIAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGRSNTTYRPKEECTYLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             AL L+EKGNLM+L+DPRLGSDF+KE+ + ML +ALLCTN S  +RP+MS+VVSMLEG
Sbjct  878   ALSLKEKGNLMDLVDPRLGSDFNKEEVMAMLNIALLCTNISSAVRPAMSSVVSMLEG  934



>ref|XP_006370097.1| hypothetical protein POPTR_0001s394901g, partial [Populus trichocarpa]
 gb|ERP66666.1| hypothetical protein POPTR_0001s394901g, partial [Populus trichocarpa]
Length=784

 Score =   462 bits (1189),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 255/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F+  QIK ATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLS+KS Q
Sbjct  403   ELRALDLQTGYFSLRQIKHATNNFDPANKIGEGGFGPVYKGVLSDGSVIAVKQLSAKSKQ  462

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  463   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEHQIKLD  522

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  523   WQTRKKISLGIAKGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  582

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  583   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  642

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ K +AL+ML +ALLCTNPSP LRPSMS+ V MLEG
Sbjct  643   AYVLQEQGNLLELVDPSLGSNYSKIEALRMLNLALLCTNPSPTLRPSMSSAVKMLEG  699



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   468 bits (1203),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  615   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  674

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  675   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  734

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  735   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  794

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  795   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  854

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  855   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  914

Query  1118  DILE  1129
             D+ E
Sbjct  915   DVEE  918



>gb|KDP27082.1| hypothetical protein JCGZ_20306 [Jatropha curcas]
Length=1030

 Score =   469 bits (1207),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 224/297 (75%), Positives = 257/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  650   ELRGLDLQTGYFTLRQIKHATNNFDAANKIGEGGFGPVYKGVLSDGVVIAVKQLSSKSKQ  709

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLLVYEY+ENNSLA ALFG E+R+L++D
Sbjct  710   GNREFVNEIGMISALQHPNLVRLYGCCIEGNQLLLVYEYLENNSLARALFGPEERRLQLD  769

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGLA+LHEES +K+VHRDIK  NVLLD ELN KISDFGLAKLD++E +
Sbjct  770   WPTRKKILLGIAKGLAYLHEESRLKIVHRDIKATNVLLDMELNAKISDFGLAKLDEEENT  829

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  830   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  889

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGSD+ KE+A ++L +ALLCTNPSP LRPSMS+VVSM+EG
Sbjct  890   AYVLQEQGNLLELMDPSLGSDYSKEEAKRVLNLALLCTNPSPTLRPSMSSVVSMVEG  946



>ref|XP_006384081.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61878.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=464

 Score =   451 bits (1159),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 220/307 (72%), Positives = 251/307 (82%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG FT  Q+ AATNNFD ANKIGEGGFGSVYKG L DGT IAVKQLS KS+Q
Sbjct  103   DLMGLDLKTGSFTLRQLGAATNNFDSANKIGEGGFGSVYKGELSDGTAIAVKQLSPKSTQ  162

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLVKL GCC+E   LLLVYEYMENN LA ALFG+E   L +D
Sbjct  163   GNREFVNEIGMISGLKHPNLVKLCGCCIEGDQLLLVYEYMENNCLARALFGAETSALMLD  222

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL++ E +
Sbjct  223   WPTRFKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLNEAENT  282

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVVALEIVSG++N  + P    VCLLDW
Sbjct  283   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDW  342

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ++GNLM L+DP+L S+F+KE+A KM++VALLC N SP LRPSM  VVSMLEG   
Sbjct  343   AFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCANASPSLRPSMPAVVSMLEGQTS  402

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  403   IQEVISD  409



>emb|CBI20124.3| unnamed protein product [Vitis vinifera]
Length=1036

 Score =   469 bits (1206),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 258/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  667   ELKGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGVLSDGTIIAVKQLSSKSKQ  726

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NE+G+IS LQHP+LVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ QL++D
Sbjct  727   GNREFVNELGMISALQHPHLVKLYGCCIEGNQLLLIYEYMENNSLARALFGPEECQLQLD  786

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  787   WPTRHRICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  846

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFG+VALEIVSG++N  +RP E    LLDW
Sbjct  847   HISTRIAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGRSNTTYRPKEECTYLLDW  906

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             AL L+EKGNLM+L+DPRLGSDF+KE+ + ML +ALLCTN S  +RP+MS+VVSMLEG
Sbjct  907   ALSLKEKGNLMDLVDPRLGSDFNKEEVMAMLNIALLCTNISSAVRPAMSSVVSMLEG  963



>ref|XP_006448019.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61259.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=716

 Score =   459 bits (1181),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 219/298 (73%), Positives = 259/298 (87%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG++T  QIKAATNNFD ANK+GEGGFGSVYKG L DGTVIAVKQLSSKS Q
Sbjct  351   ELRGLDLQTGLYTLRQIKAATNNFDPANKVGEGGFGSVYKGILSDGTVIAVKQLSSKSRQ  410

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSE-DRQLKI  577
             GNREF+NEIG+IS  QHPNLVKLYGCCVE   LLLVYEYM+NN L+ A+FG + + +LK+
Sbjct  411   GNREFVNEIGMISAQQHPNLVKLYGCCVEGNQLLLVYEYMKNNCLSRAIFGKDTEYRLKL  470

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TR++IC+GIA+GLA+LHE+S IK+VHRDIKT+NVLLDK+LN KISDFGLAKL +++K
Sbjct  471   DWPTRKKICIGIARGLAYLHEDSRIKIVHRDIKTSNVLLDKDLNAKISDFGLAKLYEEDK  530

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP+E++V LLD
Sbjct  531   THISTRIAGTIGYMAPEYAMRGYLTSKADVYSFGVVTLEIVSGKSNTNYRPNEDFVYLLD  590

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VLQE+GNL+EL+D  LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  591   WAYVLQERGNLLELVDTSLGSEYSSEEAMAMLNVALLCTNASPTLRPTMSQVVSMLEG  648



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   468 bits (1203),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  639   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  699   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  758

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  759   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  818

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  819   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  878

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  879   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  938

Query  1118  DILE  1129
             D+ E
Sbjct  939   DVEE  942



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   468 bits (1203),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  637   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  696

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  697   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  756

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  757   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  816

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  817   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  876

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  877   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  936

Query  1118  DILE  1129
             D+ E
Sbjct  937   DVEE  940



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   468 bits (1203),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  637   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  696

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  697   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  756

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  757   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  816

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  817   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  876

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  877   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  936

Query  1118  DILE  1129
             D+ E
Sbjct  937   DVEE  940



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   468 bits (1203),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  637   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  696

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  697   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  756

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  757   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  816

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  817   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  876

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  877   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  936

Query  1118  DILE  1129
             D+ E
Sbjct  937   DVEE  940



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   468 bits (1203),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  639   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  699   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  758

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  759   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  818

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  819   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  878

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  879   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  938

Query  1118  DILE  1129
             D+ E
Sbjct  939   DVEE  942



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score =   457 bits (1176),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 223/309 (72%), Positives = 261/309 (84%), Gaps = 2/309 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LDL TG FT  Q++AATNNFD A+KIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  335   DLKGLDLKTGSFTLRQLRAATNNFDSADKIGEGGFGSVYKGKLSDGTLIAVKQLSPKSRQ  394

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALF--GSEDRQLK  574
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALF  GSE   L 
Sbjct  395   GNREFVNEIGMISGLQHPNLVKLYGCCIEGDQLLLVYEYMENNSLAKALFATGSETSFLM  454

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TR +ICVGIA+GLAFLHEES I++VHRDIK  NVLLDK+L+ KISDFGLAKL+++E
Sbjct  455   LDWPTRYKICVGIARGLAFLHEESAIRIVHRDIKGTNVLLDKDLSAKISDFGLAKLNEEE  514

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEIVSG++N  +R    +VCLL
Sbjct  515   NTHISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIVSGRSNSSYRTTNEFVCLL  574

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             DWA V+Q+KGNLME++DP+L S+F+KE+A +M+++ALLCTN SP LRP+MS VVSMLEG 
Sbjct  575   DWAHVVQKKGNLMEMVDPKLQSEFNKEEAERMIKLALLCTNASPSLRPAMSEVVSMLEGQ  634

Query  1115  GDILEYKSN  1141
               I E  S+
Sbjct  635   TSIQEMISD  643



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   467 bits (1202),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  639   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  699   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  758

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  759   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  818

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  819   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  878

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  879   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  938

Query  1118  DILE  1129
             D+ E
Sbjct  939   DVEE  942



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   467 bits (1202),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 222/304 (73%), Positives = 265/304 (87%), Gaps = 1/304 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS Q
Sbjct  639   DLVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLKI  577
             GNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K+
Sbjct  699   GNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATKL  758

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++ 
Sbjct  759   DWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDEDN  818

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+KFR DEN+VCLLD
Sbjct  819   THIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNVKFRRDENFVCLLD  878

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
               L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP LRP+MSTVVSMLEG  
Sbjct  879   RVLYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPALRPTMSTVVSMLEGKT  938

Query  1118  DILE  1129
             D+ E
Sbjct  939   DVEE  942



>ref|XP_006448018.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
 gb|ESR61258.1| hypothetical protein CICLE_v10014129mg [Citrus clementina]
Length=739

 Score =   459 bits (1181),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 219/298 (73%), Positives = 259/298 (87%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG++T  QIKAATNNFD ANK+GEGGFGSVYKG L DGTVIAVKQLSSKS Q
Sbjct  374   ELRGLDLQTGLYTLRQIKAATNNFDPANKVGEGGFGSVYKGILSDGTVIAVKQLSSKSRQ  433

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSE-DRQLKI  577
             GNREF+NEIG+IS  QHPNLVKLYGCCVE   LLLVYEYM+NN L+ A+FG + + +LK+
Sbjct  434   GNREFVNEIGMISAQQHPNLVKLYGCCVEGNQLLLVYEYMKNNCLSRAIFGKDTEYRLKL  493

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TR++IC+GIA+GLA+LHE+S IK+VHRDIKT+NVLLDK+LN KISDFGLAKL +++K
Sbjct  494   DWPTRKKICIGIARGLAYLHEDSRIKIVHRDIKTSNVLLDKDLNAKISDFGLAKLYEEDK  553

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP+E++V LLD
Sbjct  554   THISTRIAGTIGYMAPEYAMRGYLTSKADVYSFGVVTLEIVSGKSNTNYRPNEDFVYLLD  613

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VLQE+GNL+EL+D  LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  614   WAYVLQERGNLLELVDTSLGSEYSSEEAMAMLNVALLCTNASPTLRPTMSQVVSMLEG  671



>ref|XP_011014343.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Populus euphratica]
Length=898

 Score =   464 bits (1194),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 262/319 (82%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  526   ELRGLDLQTGYFTLRQIKHATNNFDTANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSRQ  585

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG E+ QL++D
Sbjct  586   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGREEHQLQLD  645

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL++LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  646   WQTRRKILLGIAKGLSYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  705

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  706   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  765

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+ NL+EL+DPRLGS + KE+A+KML +ALLCTN SP LRPSMS+VV MLEG   
Sbjct  766   AYVLHERNNLLELVDPRLGSSYSKEEAMKMLNLALLCTNLSPSLRPSMSSVVRMLEGKIP  825

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I+   S  +E  F+A
Sbjct  826   VQAPIISRGSTDQEARFKA  844



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score =   463 bits (1191),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/345 (68%), Positives = 273/345 (79%), Gaps = 16/345 (5%)
 Frame = +2

Query  104   RKLDVVTICACSHMCYADSIPKLILY-----CTRNY-S*SNCSCTELRDLDLGTGMFTFT  265
             RK  V+     S +C       LIL+     C R+Y    N    ELR LDL  G FT  
Sbjct  476   RKFSVIVGAVTSLLC-------LILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLR  528

Query  266   QIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCL  445
             QIKAATNNFD ANKIGEGGFGSV+KG L DGT+IAVKQLSSKS QG REF+NEIG+IS L
Sbjct  529   QIKAATNNFDSANKIGEGGFGSVFKGQLSDGTLIAVKQLSSKSRQGYREFVNEIGLISAL  588

Query  446   QHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQ---LKIDWATRQRICVGIA  616
             QHPNLVKLYGCC E   LLLVYEYMENNSLA ALF   D +   LK+DWATRQ+ICVGIA
Sbjct  589   QHPNLVKLYGCCTEGNQLLLVYEYMENNSLAYALFDKNDAKTSALKLDWATRQKICVGIA  648

Query  617   KGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGY  796
             +G+AFL EEST+K+VHRDIK  NVLLD++LN KISDFGLA+L+ +E +HISTRVAGTIGY
Sbjct  649   RGIAFLQEESTLKIVHRDIKATNVLLDEDLNAKISDFGLARLNGEESTHISTRVAGTIGY  708

Query  797   TAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLME  976
              APEYALWGYLT KAD+YSFGVVALEIVSGKNN  ++P+   VCLLD A VLQ++G+LME
Sbjct  709   MAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLME  768

Query  977   LIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             ++DP+LGS+F++++A +M++VALLCTN SP LRP+MS VVSMLEG
Sbjct  769   IVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEG  813



>ref|XP_006449566.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
 gb|ESR62806.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
Length=1024

 Score =   468 bits (1203),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 229/346 (66%), Positives = 274/346 (79%), Gaps = 5/346 (1%)
 Frame = +2

Query  170   LILYCTRNYS*SNCSCTE-LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGT  346
             L ++C R+Y  +     E L+ L+     FT  QI+AAT+NFD  NKIGEGGFG VYKG 
Sbjct  601   LGIFCWRHYFRTKSGRQEDLQGLEFQASSFTLKQIRAATSNFDPMNKIGEGGFGPVYKGQ  660

Query  347   LLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMEN  526
             L +GT+IAVK LSSKS QGNREFLNEIG ISCLQHPNLVKLYGCC+E   L+LVYEY+EN
Sbjct  661   LTNGTIIAVKLLSSKSRQGNREFLNEIGTISCLQHPNLVKLYGCCIEGDQLMLVYEYLEN  720

Query  527   NSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKEL  706
             NSLA+ALFG E+ QLK++W+ RQ+IC+GIA+GLAFLHEES  K+VHRDIK  NVLLD++L
Sbjct  721   NSLAHALFGGENSQLKLNWSVRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDL  780

Query  707   NPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSG  886
             NPKISDFGLAKLD++ K+HISTRVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSG
Sbjct  781   NPKISDFGLAKLDEEVKTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSG  840

Query  887   KNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSP  1066
             KNNM + PD N  C LDWA  L   G LMEL+DPRLGS+F+K +A +M+++ALLCTN SP
Sbjct  841   KNNMSYVPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNKVEAERMIKIALLCTNASP  900

Query  1067  VLRPSMSTVVSMLEGNG---DILEYKSNIRE-LNFQAV*VHYEEMS  1192
              LRP+MS VVSMLEG+    D++     + E L F+ +  H  EM+
Sbjct  901   SLRPTMSEVVSMLEGSSNIPDVIPEAGGLSEDLRFKTLRDHPREMN  946



>dbj|BAJ53166.1| JHL10I11.12 [Jatropha curcas]
Length=927

 Score =   465 bits (1196),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 222/298 (74%), Positives = 257/298 (86%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT NFD ANK+GEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  540   ELRGLDLQTGIFTLKQIKAATKNFDAANKVGEGGFGSVYKGQLSDGTIIAVKQLSSKSKQ  599

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-SEDRQLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLL+YEYMENN L+ ALFG +   +LK+
Sbjct  600   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLLLIYEYMENNCLSRALFGKNPTSRLKL  659

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+A+GLA+LHEES IK+VHRDIKT+NVL+DK+LN KISDFGLAKL++D+ 
Sbjct  660   DWPTRQKICLGVARGLAYLHEESIIKIVHRDIKTSNVLIDKDLNAKISDFGLAKLNEDDN  719

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTRVAGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  720   THISTRVAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  779

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VLQE+G+L+EL+DP LGS +  E+A+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  780   WAYVLQERGSLLELVDPELGSAYSSEEAMLMLNVALLCTNASPTLRPTMSQVVSMLEG  837



>ref|XP_002532988.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29396.1| conserved hypothetical protein [Ricinus communis]
Length=941

 Score =   465 bits (1196),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/298 (75%), Positives = 257/298 (86%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT NFD ANK+GEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  561   ELRGLDLQTGIFTLRQIKAATKNFDPANKLGEGGFGSVYKGLLSDGTIIAVKQLSSKSKQ  620

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-SEDRQLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLL+YEYMENN L+ ALFG +   +LK+
Sbjct  621   GNREFVNEIGMISGLQHPNLVKLYGCCVEGNQLLLIYEYMENNCLSRALFGKNSTSRLKL  680

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+A+GLA+LHEES IK+VHRDIKT+NVLLDK+LN KISDFGLAKL++DE 
Sbjct  681   DWPTRQKICLGVARGLAYLHEESIIKIVHRDIKTSNVLLDKDLNAKISDFGLAKLNEDEN  740

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  741   THISTRIAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  800

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VLQE+G+L+EL+DP LGS +  E+A+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  801   WAYVLQERGSLLELVDPELGSAYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEG  858



>gb|KHN36920.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1023

 Score =   467 bits (1201),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 262/315 (83%), Gaps = 4/315 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L L TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  651   LGLKTGYFSLRQIKAATNNFDPANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSKQGNRE  710

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ ++++DW  R
Sbjct  711   FINEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALFGKENERMQLDWPRR  770

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIAKGLA+LHEES +K+VHRDIK  NVLLDK L+ KISDFGLAKLD++E +HIST
Sbjct  771   MKICVGIAKGLAYLHEESRLKIVHRDIKATNVLLDKHLHAKISDFGLAKLDEEENTHIST  830

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDWA VL
Sbjct  831   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVL  890

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             QE+GNL+EL+DP LGS +  E+A++ML++ALLCTNPSP LRPSMS+VVSMLEG       
Sbjct  891   QEQGNLLELVDPSLGSKYSSEEAMRMLQLALLCTNPSPTLRPSMSSVVSMLEGKTPIQAP  950

Query  1121  ILEYKSNIRELNFQA  1165
             I++   ++ ++ F+A
Sbjct  951   IIKRSDSVEDVRFKA  965



>emb|CAN70496.1| hypothetical protein VITISV_042040 [Vitis vinifera]
Length=766

 Score =   459 bits (1181),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 219/326 (67%), Positives = 269/326 (83%), Gaps = 8/326 (2%)
 Frame = +2

Query  236   DLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREF  415
             +LGTG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLSSKS QGNREF
Sbjct  387   ELGTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSVIAVKQLSSKSKQGNREF  446

Query  416   LNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATRQ  595
             +NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENNSLA ALFG ++++L +DW TR+
Sbjct  447   VNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNSLARALFGRDEQRLNLDWPTRK  506

Query  596   RICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTR  775
             +IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +HISTR
Sbjct  507   KICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEDENTHISTR  566

Query  776   VAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQ  955
             +AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDWA VL 
Sbjct  567   IAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDWAYVLH  626

Query  956   EKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGDI  1123
             E+GNL+EL+DP LGS++ +E+ ++ML +ALLCTN SP LRP MS+VVSML+G        
Sbjct  627   EQGNLLELVDPSLGSNYSEEEVMRMLNLALLCTNQSPTLRPPMSSVVSMLDGKIAVQAPT  686

Query  1124  LEYKSNIRELNFQAV*VHYEEMSIGS  1201
             +++ S   ++ F+A    +E++S+ S
Sbjct  687   IKHDSMNPDMRFKA----FEKLSLDS  708



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   466 bits (1200),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 263/303 (87%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG+VYKG L DGT+IAVKQLS+KS Q
Sbjct  662   ELVGLDLLTGIFTFEQIKAATNDFDPANKLGEGGFGAVYKGVLSDGTMIAVKQLSAKSKQ  721

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+  K LLLVYEYMENNSLA+ L+G ++ QL +D
Sbjct  722   GNREFVNEIGMISALQHPNLVRLYGCCINGKELLLVYEYMENNSLAHVLYGKKEGQLNLD  781

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQRICV IAKGLAFLHEEST+K+VHRD+KT NVLLD  +N KISDFG+AKLD+++ +
Sbjct  782   WPTRQRICVDIAKGLAFLHEESTLKIVHRDVKTTNVLLDGNMNAKISDFGMAKLDEEDNT  841

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT+GY APEYAL+G LT KADVYSFG+VALEIV+G +NM F+ +E++VCLLDW
Sbjct  842   HISTRVAGTMGYMAPEYALYGRLTSKADVYSFGIVALEIVAGMSNMSFQHNESFVCLLDW  901

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL LQ+ G++MEL+DPRLGSDF K++A +M++V LLCTN SP LRP+MS VV MLEG GD
Sbjct  902   ALSLQQNGDIMELVDPRLGSDFKKKEAARMIKVTLLCTNQSPALRPTMSAVVRMLEGKGD  961

Query  1121  ILE  1129
             + E
Sbjct  962   VQE  964



>ref|XP_010247776.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Nelumbo nucifera]
Length=978

 Score =   465 bits (1196),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 229/323 (71%), Positives = 260/323 (80%), Gaps = 0/323 (0%)
 Frame = +2

Query  173   ILYCTRNYS*SNCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLL  352
             IL+ T      N    +LR LDL TG FT  QIKAATNNF VANKIGEGGFGSVYKG L 
Sbjct  593   ILWWTGYLGCKNTIDKDLRGLDLQTGSFTLRQIKAATNNFHVANKIGEGGFGSVYKGLLS  652

Query  353   DGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNS  532
             DGT+IAVKQLSSKS QGNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNS
Sbjct  653   DGTIIAVKQLSSKSKQGNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNS  712

Query  533   LANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNP  712
             LA ALFG E+ QLK+DW TR +ICVGIA+GL +LHEES +K+VHRDIK  NVLLDK+LNP
Sbjct  713   LARALFGPEEYQLKLDWPTRYKICVGIARGLTYLHEESRLKIVHRDIKATNVLLDKDLNP  772

Query  713   KISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKN  892
             KISDFGLAKLDD+E +HISTRVAGT GY APEYA+ GYLT KADVYSFGVVALEIVSG++
Sbjct  773   KISDFGLAKLDDEENTHISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGRS  832

Query  893   NMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVL  1072
             N  FRP    + LLDWAL+L+EKGNLM+L+DP LG DF KE+ + M+ VALLCTN    L
Sbjct  833   NTSFRPKGERIYLLDWALILKEKGNLMDLVDPWLGLDFSKEEVMAMINVALLCTNACSQL  892

Query  1073  RPSMSTVVSMLEGNGDILEYKSN  1141
             RP MS VV MLEG   + E+ S+
Sbjct  893   RPPMSVVVRMLEGRVPVQEFVSD  915



>ref|XP_010924703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Elaeis guineensis]
Length=1020

 Score =   466 bits (1199),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 223/317 (70%), Positives = 267/317 (84%), Gaps = 3/317 (1%)
 Frame = +2

Query  161   IPKLILYCTRNYS*SNCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYK  340
             I  L+ +C R    +N   +ELR L+L TG FT  QIK AT NFD  NKIGEGGFGSVY+
Sbjct  637   IITLLWFCFRRKQTAN---SELRGLELQTGYFTIKQIKTATKNFDPGNKIGEGGFGSVYR  693

Query  341   GTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYM  520
             G L DG+ IAVKQLSSKS QGNREF+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYM
Sbjct  694   GVLPDGSEIAVKQLSSKSKQGNREFINEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYM  753

Query  521   ENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDK  700
             ENNSLA ALFG ++ +LK+DW TR++IC+GIA+GLAFLHEES IK+VHRDIK  N+LLDK
Sbjct  754   ENNSLARALFGPQEYRLKLDWRTRRKICLGIARGLAFLHEESRIKIVHRDIKATNILLDK  813

Query  701   ELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIV  880
             +LN KISDFGLA+LD++E +HISTR+AGT+GY APEYA+ GYLT KADVYSFGVVALE+V
Sbjct  814   DLNAKISDFGLARLDEEENTHISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVALELV  873

Query  881   SGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNP  1060
             SG +N  +RP E++V LLDWA VLQE+G+L+EL+DP LGS++ KE+AL+ML +ALLCTNP
Sbjct  874   SGMSNTNYRPKEDFVYLLDWAYVLQEQGSLLELVDPNLGSNYPKEEALQMLNLALLCTNP  933

Query  1061  SPVLRPSMSTVVSMLEG  1111
             SP LRP+MSTVVSML+G
Sbjct  934   SPTLRPTMSTVVSMLDG  950



>ref|XP_010273522.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=436

 Score =   447 bits (1150),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 218/326 (67%), Positives = 266/326 (82%), Gaps = 5/326 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LD+ TG FT  QIK ATNNFD  NKIG+GGFGSVYKG L DGT++AVK+LSSKS Q
Sbjct  49    DLIGLDVQTGSFTLRQIKDATNNFDDGNKIGQGGFGSVYKGLLSDGTLVAVKKLSSKSKQ  108

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS L HP+LVK+YGCC E   LLLVYEYMENNSLA ALFG E+  LK+D
Sbjct  109   GNREFLNEIGMISALHHPHLVKIYGCCTEGNQLLLVYEYMENNSLARALFGPEECHLKLD  168

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIA+GLA+LHEEST+K+VHRDIK  N+LLDK+LNPKISDFGLAKLD++E +
Sbjct  169   WPTRYKICIGIARGLAYLHEESTLKIVHRDIKATNILLDKDLNPKISDFGLAKLDEEENT  228

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYA+ G+LT KAD+YSFG+VALEIVSGK+N  FRP+E+ V LLDW
Sbjct  229   HISTRVAGTFGYMAPEYAMRGHLTDKADIYSFGIVALEIVSGKSNSGFRPEED-VYLLDW  287

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
               +L+EKG L++++DP LGS+F++EQ + M+ VALLCTNPS  LRP+MS+VVSMLEG   
Sbjct  288   VHILKEKGALIDIVDPMLGSEFNEEQVVGMINVALLCTNPSASLRPAMSSVVSMLEGQVS  347

Query  1121  ILEYKSNI----RELNFQAV*VHYEE  1186
             I E+ S+       L+F+A    Y++
Sbjct  348   IQEFASDASFCDENLSFKAAIRRYKQ  373



>ref|XP_008384519.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=913

 Score =   463 bits (1191),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 220/303 (73%), Positives = 258/303 (85%), Gaps = 4/303 (1%)
 Frame = +2

Query  227   RDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGN  406
             R L+L TG FTF QIKAATNNFD  N+IG+GGFG VYKG LLDGT+IAVK+LSSKS QGN
Sbjct  547   RGLNLRTGFFTFRQIKAATNNFDPENEIGKGGFGPVYKGILLDGTIIAVKKLSSKSKQGN  606

Query  407   REFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWA  586
             +EFLNEIG+IS L HPNLV+LYG C+E   LLLVYEYMENNSLA  LFG     LK+DW+
Sbjct  607   QEFLNEIGMISALHHPNLVRLYGWCIESNQLLLVYEYMENNSLARTLFGP----LKLDWS  662

Query  587   TRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHI  766
             TRQ+IC+GIA+GLAFLHEEST+K VHRDIK  N+LLD++ N KISDFGLAKL+D+E +HI
Sbjct  663   TRQKICIGIARGLAFLHEESTLKXVHRDIKATNILLDQDJNAKISDFGLAKLNDEEXTHI  722

Query  767   STRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWAL  946
             STR+AGTIGY APEYALWGYLT KADVYSFGVVALEIV+GK+NMK+ P+EN VCL+DWAL
Sbjct  723   STRIAGTIGYMAPEYALWGYLTNKADVYSFGVVALEIVAGKSNMKYIPNENLVCLVDWAL  782

Query  947   VLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDIL  1126
             VLQ+KGNL+EL+DP LGS F+ E+A+ M++VALLC NP+  LRP+MS VVSMLEG   + 
Sbjct  783   VLQQKGNLIELVDPSLGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGRTLVH  842

Query  1127  EYK  1135
             E K
Sbjct  843   ELK  845



>emb|CBI20136.3| unnamed protein product [Vitis vinifera]
Length=710

 Score =   457 bits (1175),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 221/308 (72%), Positives = 258/308 (84%), Gaps = 0/308 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR L+L TG FT  QIKAATNNFD ANKIGEGGFGSVYKG LLDGT+IAVKQLSSKS Q
Sbjct  340   DLRGLNLQTGTFTLRQIKAATNNFDAANKIGEGGFGSVYKGLLLDGTIIAVKQLSSKSKQ  399

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG +D QLK+D
Sbjct  400   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPKDSQLKLD  459

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD++E +
Sbjct  460   WPTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEENT  519

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ G+LT KADVYSFGVVALEIVSGK+N      +  V LLDW
Sbjct  520   HISTRIAGTFGYMAPEYAMRGHLTEKADVYSFGVVALEIVSGKSNTNHILKDGCVYLLDW  579

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+E GNL+EL+DP L S+F KE+ + M+ VALLCT+ SPV RP+MS+VVS+LEG   
Sbjct  580   ALLLKENGNLLELVDPILESNFKKEEVMAMINVALLCTSFSPVARPTMSSVVSILEGRAH  639

Query  1121  ILEYKSNI  1144
             + E  S +
Sbjct  640   VQEISSGL  647



>ref|XP_010655557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Vitis vinifera]
Length=1060

 Score =   467 bits (1201),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 226/316 (72%), Positives = 263/316 (83%), Gaps = 4/316 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             LD+  G FT  QIKAATNNFD  N+IGEGGFG VYKG L DGT IAVKQLSSKS+QGNRE
Sbjct  648   LDVHIGSFTLKQIKAATNNFDSLNQIGEGGFGPVYKGLLPDGTAIAVKQLSSKSTQGNRE  707

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             FLNEIG+ISCLQHPNLVKL+GCC+E   LLLVYEYMENNSLA AL G E+ QLK+DW TR
Sbjct  708   FLNEIGMISCLQHPNLVKLHGCCIEGNQLLLVYEYMENNSLARALLGPENCQLKLDWPTR  767

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
             Q+ICVGIA+GLAFLHEES +K+VHRDIK  NVLLD +LNPKISDFGLAKL ++EK+HIST
Sbjct  768   QKICVGIARGLAFLHEESRLKIVHRDIKGTNVLLDGDLNPKISDFGLAKLHEEEKTHIST  827

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             RVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSGK+NM ++P  +  CLLDWA  L
Sbjct  828   RVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSL  887

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             Q+ G++MEL+D +LGS+F+K++A +M++VALLCTN SP LRP+MS  VSMLEG       
Sbjct  888   QQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDA  947

Query  1121  ILEYKSNIRELNFQAV  1168
             I E  S   +L F+A+
Sbjct  948   IPEAGSYSEDLRFKAI  963



>emb|CBI20153.3| unnamed protein product [Vitis vinifera]
Length=840

 Score =   461 bits (1185),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 272/331 (82%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR+L + TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLSSKS Q
Sbjct  459   ELRELGMQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSVIAVKQLSSKSKQ  518

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENN LA ALFGSE+++L +D
Sbjct  519   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNCLARALFGSEEQRLNLD  578

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +
Sbjct  579   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEDENT  638

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  639   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  698

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GNL+EL+DP LGS++ +E+ ++ML +ALL TN SP LRPSMS+VVSML+G   
Sbjct  699   AYVLHEQGNLLELVDPSLGSNYSEEEVMRMLNLALLSTNQSPTLRPSMSSVVSMLDGKIA  758

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  +++ S   ++ F+A    +E++S+ S
Sbjct  759   VQAPTIKHDSMNPDMRFKA----FEKLSLDS  785



>ref|XP_002283521.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Vitis vinifera]
 ref|XP_010644095.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Vitis vinifera]
 ref|XP_010644096.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Vitis vinifera]
Length=1023

 Score =   466 bits (1198),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 268/319 (84%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L+L TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG++IAVKQLSSKS Q
Sbjct  639   ELRALELQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSIIAVKQLSSKSKQ  698

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLL+YEYMENNSLA ALFG E+ +L +D
Sbjct  699   GNREFVNEIGMISALQHPNLVRLYGCCIEGNQLLLIYEYMENNSLARALFGREEHRLHLD  758

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+L+ KISDFGLAKLD++E +
Sbjct  759   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLSAKISDFGLAKLDEEENT  818

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  819   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  878

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GN++EL+DP LGS++ +E+A KML ++LLCTNPSP LRPSMS+VVSMLEG   
Sbjct  879   AYVLHEQGNILELVDPILGSNYSEEEAAKMLNLSLLCTNPSPTLRPSMSSVVSMLEGKIA  938

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  S  +++ F+A
Sbjct  939   VQAPIVKKSSMNQDMRFKA  957



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score =   465 bits (1197),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 235/339 (69%), Positives = 267/339 (79%), Gaps = 9/339 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLSSKS Q
Sbjct  656   ELRGLDLQTGSFTLRQIKAATNNFDYANKIGEGGFGSVYKGQLSDGTVIAVKQLSSKSRQ  715

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIGIISCL HPNLVKLYGCC+E   LLLVYEYMENNSLA ALF  E   LK+D
Sbjct  716   GNREFVNEIGIISCLHHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALF--ERSVLKLD  773

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +ICVGIAKGL FLHEES I +VHRDIK  NVLLD+ LN KISDFGLAKL++ E +
Sbjct  774   WATRYKICVGIAKGLTFLHEESRIMIVHRDIKATNVLLDENLNAKISDFGLAKLNEGENT  833

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT KADVYSFGVV LEIVSGKNN  + PD    CLLDW
Sbjct  834   HISTRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDW  893

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VL++KG+LMEL+DP LG++F+K++A  M++VALLCTN S  LRP+MS V+ MLEG   
Sbjct  894   AFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDI  953

Query  1121  ILEYKSNI----RELNFQAV*VHYEEMSIGSSD---SPN  1216
             I E  S+     +++    +  HY+ M + SS    +PN
Sbjct  954   IPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPN  992



>emb|CBI20142.3| unnamed protein product [Vitis vinifera]
Length=1021

 Score =   466 bits (1198),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 268/319 (84%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L+L TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG++IAVKQLSSKS Q
Sbjct  637   ELRALELQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSIIAVKQLSSKSKQ  696

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLL+YEYMENNSLA ALFG E+ +L +D
Sbjct  697   GNREFVNEIGMISALQHPNLVRLYGCCIEGNQLLLIYEYMENNSLARALFGREEHRLHLD  756

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+L+ KISDFGLAKLD++E +
Sbjct  757   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLSAKISDFGLAKLDEEENT  816

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  817   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  876

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GN++EL+DP LGS++ +E+A KML ++LLCTNPSP LRPSMS+VVSMLEG   
Sbjct  877   AYVLHEQGNILELVDPILGSNYSEEEAAKMLNLSLLCTNPSPTLRPSMSSVVSMLEGKIA  936

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  S  +++ F+A
Sbjct  937   VQAPIVKKSSMNQDMRFKA  955



>ref|XP_011010609.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=879

 Score =   462 bits (1188),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 223/324 (69%), Positives = 267/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  Q+KAATNNFD  NK+GEGGFGSVYKG+L DGTVIAVK LSSKS Q
Sbjct  512   ELKGLDLQTGLFTLRQMKAATNNFDAENKVGEGGFGSVYKGSLSDGTVIAVKLLSSKSKQ  571

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR-QLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   L++VYEYMENN L+ AL G E + ++K+
Sbjct  572   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLMIVYEYMENNCLSRALLGKESKLRMKL  631

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+AKGL +LHEES IK+VHRDIKT+NVLLDKELN KISDFGLAKL++D+ 
Sbjct  632   DWPTRQKICLGVAKGLMYLHEESIIKIVHRDIKTSNVLLDKELNAKISDFGLAKLNEDDD  691

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  692   THISTRIAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  751

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VLQE+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  752   WAYVLQERGSLLELVDPELGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRT  811

Query  1118  DILEYKSNIRELNFQAV*VHYEEM  1189
              + +  S   +  F A+   Y+ +
Sbjct  812   PVQDLLS---DPGFSAINTKYKAI  832



>ref|XP_009772943.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Nicotiana sylvestris]
Length=1011

 Score =   465 bits (1197),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 255/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  636   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLADGAIIAVKQLSSKSKQ  695

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L HPNLV+LYGCC+E   LL++YEYMENN LA ALFG +D++L +D
Sbjct  696   GNREFVNEIGMISALHHPNLVRLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNLD  755

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR+RIC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+L+ KISDFGLAKLD++E +
Sbjct  756   WPTRKRICLGIARGLAYLHEESALKIVHRDIKATNVLLDKDLSAKISDFGLAKLDEEENT  815

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  816   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  875

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DPRLGS + K++ ++M+ + LLCTNPSP LRPSMS+VVSMLEG
Sbjct  876   AYVLQEQGNLLELVDPRLGSSYSKKEVMQMINLGLLCTNPSPTLRPSMSSVVSMLEG  932



>ref|XP_010655556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Vitis vinifera]
Length=1067

 Score =   467 bits (1201),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 226/316 (72%), Positives = 263/316 (83%), Gaps = 4/316 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             LD+  G FT  QIKAATNNFD  N+IGEGGFG VYKG L DGT IAVKQLSSKS+QGNRE
Sbjct  655   LDVHIGSFTLKQIKAATNNFDSLNQIGEGGFGPVYKGLLPDGTAIAVKQLSSKSTQGNRE  714

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             FLNEIG+ISCLQHPNLVKL+GCC+E   LLLVYEYMENNSLA AL G E+ QLK+DW TR
Sbjct  715   FLNEIGMISCLQHPNLVKLHGCCIEGNQLLLVYEYMENNSLARALLGPENCQLKLDWPTR  774

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
             Q+ICVGIA+GLAFLHEES +K+VHRDIK  NVLLD +LNPKISDFGLAKL ++EK+HIST
Sbjct  775   QKICVGIARGLAFLHEESRLKIVHRDIKGTNVLLDGDLNPKISDFGLAKLHEEEKTHIST  834

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             RVAGTIGY APEYALWGYLT+KADVYSFGVVALEIVSGK+NM ++P  +  CLLDWA  L
Sbjct  835   RVAGTIGYMAPEYALWGYLTYKADVYSFGVVALEIVSGKHNMSYQPKNDCACLLDWACSL  894

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             Q+ G++MEL+D +LGS+F+K++A +M++VALLCTN SP LRP+MS  VSMLEG       
Sbjct  895   QQSGDIMELVDQKLGSEFNKKEAERMIKVALLCTNASPSLRPNMSEAVSMLEGITTIPDA  954

Query  1121  ILEYKSNIRELNFQAV  1168
             I E  S   +L F+A+
Sbjct  955   IPEAGSYSEDLRFKAI  970



>ref|XP_011082787.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Sesamum indicum]
Length=1025

 Score =   466 bits (1198),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 258/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAAT+NFD ANKIGEGGFG VYKG L DGTVIAVKQLS+KS Q
Sbjct  644   ELRALDLQTGYFTLRQIKAATHNFDNANKIGEGGFGPVYKGVLSDGTVIAVKQLSAKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKL+GCC+E   LLL+YEY+ENN LA ALFG E+++L +D
Sbjct  704   GNREFVNEIGMISALQHPNLVKLFGCCIEGNQLLLIYEYLENNCLARALFGREEQRLNLD  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  764   WQTRKKICIGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  824   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LG ++ KE+A++ML +ALLC NPSP LRP+MS+VVSMLEG
Sbjct  884   AYVLQEQGNLLELVDPSLGLNYSKEEAMRMLNLALLCANPSPTLRPTMSSVVSMLEG  940



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score =   465 bits (1196),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 235/339 (69%), Positives = 267/339 (79%), Gaps = 9/339 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLSSKS Q
Sbjct  656   ELRGLDLQTGSFTLRQIKAATNNFDYANKIGEGGFGSVYKGQLSDGTVIAVKQLSSKSRQ  715

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIGIISCL HPNLVKLYGCC+E   LLLVYEYMENNSLA ALF  E   LK+D
Sbjct  716   GNREFVNEIGIISCLHHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALF--ERSVLKLD  773

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +ICVGIAKGL FLHEES I +VHRDIK  NVLLD+ LN KISDFGLAKL++ E +
Sbjct  774   WATRYKICVGIAKGLTFLHEESRIMIVHRDIKATNVLLDENLNAKISDFGLAKLNEGENT  833

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT KADVYSFGVV LEIVSGKNN  + PD    CLLDW
Sbjct  834   HISTRIAGTIGYMAPEYALWGYLTDKADVYSFGVVTLEIVSGKNNSNYTPDTTCTCLLDW  893

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VL++KG+LMEL+DP LG++F+K++A  M++VALLCTN S  LRP+MS V+ MLEG   
Sbjct  894   AFVLKQKGSLMELVDPNLGTEFNKKEAETMIKVALLCTNASSKLRPTMSAVLRMLEGQDI  953

Query  1121  ILEYKSNI----RELNFQAV*VHYEEMSIGSSD---SPN  1216
             I E  S+     +++    +  HY+ M + SS    +PN
Sbjct  954   IPEVISDPSIYGKDMRISPLRDHYQHMEMQSSSGSLAPN  992



>ref|XP_006592614.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Glycine max]
Length=1011

 Score =   465 bits (1197),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 265/315 (84%), Gaps = 4/315 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L+L TG F+  QIKAATNN D ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  645   LELKTGYFSLRQIKAATNNLDPANKIGEGGFGPVYKGVLSDGHVIAVKQLSSKSKQGNRE  704

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA+ALFG ++++L +DW TR
Sbjct  705   FVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLAHALFGEQEQKLHLDWPTR  764

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +HIST
Sbjct  765   MKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENTHIST  824

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N K+RP E +V LLDWA VL
Sbjct  825   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVL  884

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             QE+GNL+EL+DP LGS +  E+A++ML +ALLCTNPSP LRP+MS+VVSMLEG       
Sbjct  885   QEQGNLLELVDPNLGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEGKIPIQAP  944

Query  1121  ILEYKSNIRELNFQA  1165
             I++   + +++ F+A
Sbjct  945   IIKRSESNQDVRFKA  959



>ref|XP_011098190.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Sesamum indicum]
Length=1024

 Score =   465 bits (1197),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 257/297 (87%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  642   ELRGLDLQTGYFTLRQIKAATNNFDNANKIGEGGFGPVYKGVLSDGTIIAVKQLSSKSKQ  701

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKL+GCC+E   LLL+YEY+ENN LA ALFG ++++L +D
Sbjct  702   GNREFVNEIGMISALQHPNLVKLFGCCIEGNQLLLIYEYLENNCLARALFGRQEQRLNLD  761

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  762   WQTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  821

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  822   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  881

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++  E+A++ML +ALLC NPSP LRP MS+VVSMLEG
Sbjct  882   AYVLQEQGNLLELVDPILGSNYSMEEAMRMLNLALLCANPSPTLRPPMSSVVSMLEG  938



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score =   464 bits (1195),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 227/334 (68%), Positives = 273/334 (82%), Gaps = 4/334 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  646   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  705

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFGSE   L +D
Sbjct  706   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGSETSALMLD  765

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK+ N+LLDK+LN KISDFGLAKL+++E +
Sbjct  766   WPTRYKICVGIARGLAFLHEGSAIRIVHRDIKSTNILLDKDLNAKISDFGLAKLNEEENT  825

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYALWG+LT KADVYSFGVVALEIVSGK+N  +RP+   VCLLDW
Sbjct  826   HISTRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENVCLLDW  885

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ+K NLME++DP+L S+F+KE+A +M++ ALLCTN SP +RP+MS VVSMLEG   
Sbjct  886   AHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSMLEGQTS  945

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             I E  S+      EL+ + V  HY++++  S +S
Sbjct  946   IPEVTSDPSIYGDELHSKRVKGHYQQVTDQSLNS  979



>gb|AAF78446.1|AC018748_25 Contains similarity to receptor-like serine/threonine kinase 
from Arabidopsis thaliana gb|AF024648 and contains multiple 
leucine rich PF|00560 repeats and protein kinase PF|00069 domain. 
ESTs gb|T04455, gb|N38129 come from this gene [Arabidopsis 
thaliana]
Length=942

 Score =   463 bits (1191),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  550   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  609

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  610   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  669

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKL+DDE +
Sbjct  670   WSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENT  729

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  730   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  789

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  790   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEG  846



>ref|NP_001117479.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE32940.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=997

 Score =   464 bits (1195),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  605   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  664

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  665   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  724

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKL+DDE +
Sbjct  725   WSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENT  784

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  785   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  844

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  845   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEG  901



>ref|XP_008384518.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=915

 Score =   462 bits (1188),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 220/303 (73%), Positives = 258/303 (85%), Gaps = 2/303 (1%)
 Frame = +2

Query  227   RDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGN  406
             R L+L TG FTF QIKAATNNFD  N+IG+GGFG VYKG LLDGT+IAVK+LSSKS QGN
Sbjct  547   RGLNLRTGFFTFRQIKAATNNFDPENEIGKGGFGPVYKGILLDGTIIAVKKLSSKSKQGN  606

Query  407   REFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWA  586
             +EFLNEIG+IS L HPNLV+LYG C+E   LLLVYEYMENNSLA  LFG     LK+DW+
Sbjct  607   QEFLNEIGMISALHHPNLVRLYGWCIESNQLLLVYEYMENNSLARTLFGPG--PLKLDWS  664

Query  587   TRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHI  766
             TRQ+IC+GIA+GLAFLHEEST+K VHRDIK  N+LLD++ N KISDFGLAKL+D+E +HI
Sbjct  665   TRQKICIGIARGLAFLHEESTLKXVHRDIKATNILLDQDJNAKISDFGLAKLNDEEXTHI  724

Query  767   STRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWAL  946
             STR+AGTIGY APEYALWGYLT KADVYSFGVVALEIV+GK+NMK+ P+EN VCL+DWAL
Sbjct  725   STRIAGTIGYMAPEYALWGYLTNKADVYSFGVVALEIVAGKSNMKYIPNENLVCLVDWAL  784

Query  947   VLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDIL  1126
             VLQ+KGNL+EL+DP LGS F+ E+A+ M++VALLC NP+  LRP+MS VVSMLEG   + 
Sbjct  785   VLQQKGNLIELVDPSLGSHFEVEEAITMVKVALLCINPASALRPTMSAVVSMLEGRTLVH  844

Query  1127  EYK  1135
             E K
Sbjct  845   ELK  847



>gb|KCW48008.1| hypothetical protein EUGRSUZ_K017432, partial [Eucalyptus grandis]
Length=365

 Score =   443 bits (1140),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 250/296 (84%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             L+ L L  G+FT  QIKAATNNFDVANKIGEGGFGSVYKG L DGT IAVKQLSSKS QG
Sbjct  1     LKGLALQIGLFTLRQIKAATNNFDVANKIGEGGFGSVYKGFLSDGTTIAVKQLSSKSQQG  60

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             N EFL EIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+DW
Sbjct  61    NNEFLTEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPEELQLKLDW  120

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKLD+++K+H
Sbjct  121   WTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDEDLNPKISDFGLAKLDEEDKTH  180

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             IST++AGT GY APEYA+ GYLT KAD+YSFGVVALE+V+G++N   +  E    LLDWA
Sbjct  181   ISTKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVNGRSNTSSQRTEECFNLLDWA  240

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
               L+E  NL+EL+DPRLGS F+KE+AL +++VAL+CTN +P LRP MS+VVSMLEG
Sbjct  241   HFLKEGENLIELVDPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEG  296



>gb|KCW67547.1| hypothetical protein EUGRSUZ_F01301 [Eucalyptus grandis]
Length=918

 Score =   462 bits (1188),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 215/301 (71%), Positives = 258/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL  G FT  QIK AT NFD  NKIGEGGFG VYKGTL +GT IAVKQLSSKS Q
Sbjct  542   ELYGLDLQIGYFTLRQIKVATGNFDSVNKIGEGGFGPVYKGTLSNGTTIAVKQLSSKSKQ  601

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG++S LQHPNLVKLYGCC+E   LL++YEY++NNSLA ALFG +++ +++D
Sbjct  602   GNREFLNEIGMVSALQHPNLVKLYGCCIEENQLLVIYEYLDNNSLARALFGRDEQLIELD  661

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  662   WATRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  721

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TR+AGT+GY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  + P+E +V LLDW
Sbjct  722   HINTRIAGTLGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYMPEEEFVHLLDW  781

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ +E+A++ML +ALLCTNPSP LRP MS+VVSMLEG   
Sbjct  782   AYVLQEQGNVLELVDPRLGSDYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKSA  841

Query  1121  I  1123
             I
Sbjct  842   I  842



>ref|XP_011002770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Populus euphratica]
Length=989

 Score =   464 bits (1193),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 262/319 (82%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  617   ELRGLDLQTGYFTLRQIKHATNNFDTANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSRQ  676

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG E+ QL++D
Sbjct  677   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGREEHQLQLD  736

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL++LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  737   WQTRRKILLGIAKGLSYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  796

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  797   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  856

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+ NL+EL+DPRLGS + KE+A+KML +ALLCTN SP LRPSMS+VV MLEG   
Sbjct  857   AYVLHERNNLLELVDPRLGSSYSKEEAMKMLNLALLCTNLSPSLRPSMSSVVRMLEGKIP  916

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I+   S  +E  F+A
Sbjct  917   VQAPIISRGSTDQEARFKA  935



>gb|KHN42594.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1011

 Score =   464 bits (1194),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/315 (70%), Positives = 265/315 (84%), Gaps = 4/315 (1%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L+L TG F+  QIKAATNN D ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  645   LELKTGYFSLRQIKAATNNLDPANKIGEGGFGPVYKGVLSDGHVIAVKQLSSKSKQGNRE  704

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA+ALFG ++++L +DW TR
Sbjct  705   FVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLAHALFGEQEQKLHLDWPTR  764

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +HIST
Sbjct  765   MKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENTHIST  824

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N K+RP E +V LLDWA VL
Sbjct  825   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVL  884

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG----NGD  1120
             QE+GNL+EL+DP LGS +  E+A++ML +ALLCTNPSP LRP+MS+VVSMLEG       
Sbjct  885   QEQGNLLELVDPNLGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEGKIPIQAP  944

Query  1121  ILEYKSNIRELNFQA  1165
             I++   + +++ F+A
Sbjct  945   IIKRSESNQDVRFKA  959



>ref|XP_006377469.1| hypothetical protein POPTR_0011s062402g, partial [Populus trichocarpa]
 gb|ERP55266.1| hypothetical protein POPTR_0011s062402g, partial [Populus trichocarpa]
Length=495

 Score =   448 bits (1152),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 258/321 (80%), Gaps = 5/321 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +++ LD   G F+  QI+AATN+FD +NKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  135   DVKGLDFPKGTFSLKQIRAATNDFDASNKIGEGGFGPVYKGQLPDGTVIAVKQLSSKSRQ  194

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNE+G+ISCLQHPNLVKL+GCC+E   LLLVYEYMENNSLA ALF  E+ QL +D
Sbjct  195   GNREFLNEMGMISCLQHPNLVKLHGCCIESDQLLLVYEYMENNSLARALFRHENNQLNLD  254

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIA+GLAFLHEES +K+VHRDIK  NVLLD  LNPKISDFGLA+LD++EKS
Sbjct  255   WPTRLKICIGIARGLAFLHEESRLKIVHRDIKATNVLLDGNLNPKISDFGLARLDEEEKS  314

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRP-DENYVCLLD  937
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEI+SGKNN  + P + + VCLLD
Sbjct  315   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIISGKNNNNYMPSNSSCVCLLD  374

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN-  1114
             WA  LQ+ G+ +EL+D  LGS+   E+A  M++VALLCTN SP +RP+MS VVSMLEG  
Sbjct  375   WACHLQQSGSFIELVDETLGSEVHIEEAETMVKVALLCTNASPTVRPTMSEVVSMLEGRM  434

Query  1115  ---GDILEYKSNIRELNFQAV  1168
                  + E  S   +L F+A+
Sbjct  435   AVPNTLPELSSYTEDLMFKAM  455



>gb|ACN59254.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=870

 Score =   460 bits (1184),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  479   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  538

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  539   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  598

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR ++C+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKLD++E +
Sbjct  599   WSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENT  658

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E ++ LLDW
Sbjct  659   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDW  718

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSML+G
Sbjct  719   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQG  775



>gb|KDP24894.1| hypothetical protein JCGZ_25156 [Jatropha curcas]
Length=544

 Score =   449 bits (1156),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/332 (68%), Positives = 267/332 (80%), Gaps = 10/332 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG FT  QIKAATN FD ANKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  169   DLRGLDLQTGSFTLRQIKAATNIFDHANKIGEGGFGPVYKGLLSDGTVIAVKQLSSKSKQ  228

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QL +D
Sbjct  229   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGREEHQLNLD  288

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIA+GLAFLHEES +K+VHRDIK  NVLLDK LNPKISDFGLAKLD++E +
Sbjct  289   WPTRQKICVGIARGLAFLHEESRLKIVHRDIKATNVLLDKNLNPKISDFGLAKLDEEEDT  348

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFR----PDENYVC  928
             HISTR+AGT GY APEYA+ G+LT KADVYSFG+VALEIVSG++N   R     D+ Y  
Sbjct  349   HISTRIAGTFGYMAPEYAMRGHLTDKADVYSFGIVALEIVSGRSNTSNRHNMKKDDFY--  406

Query  929   LLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLE  1108
             LLDWA VL+EKG+L+EL+DPRL  D++KEQ   ++ VALLCTN SP +RP+MS+VVS+LE
Sbjct  407   LLDWACVLKEKGSLLELVDPRLSKDYNKEQVETVIRVALLCTNVSPAVRPAMSSVVSILE  466

Query  1109  GNGDILEYKSNIRELN----FQAV*VHYEEMS  1192
             G   + + K +   LN     +A+  H++++S
Sbjct  467   GKASVQDSKLDSSVLNDDFMVEAMRKHFQQIS  498



>gb|KHG04296.1| hypothetical protein F383_04630 [Gossypium arboreum]
Length=885

 Score =   460 bits (1184),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 224/308 (73%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+F+  QIKAAT NFD  NKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  529   ELRGLDLQTGIFSLRQIKAATKNFDTENKIGEGGFGCVYKGLLSDGTVIAVKQLSSKSRQ  588

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR-QLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLLVYEYMENN L+ ALFG     +LK+
Sbjct  589   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLLLVYEYMENNCLSRALFGKNATCKLKL  648

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             +W TRQ+IC+GIA+GLA+LHEES IK+VHRDIKT+NVLLDK+LN KISDFGLAKL++D+K
Sbjct  649   NWPTRQKICLGIARGLAYLHEESRIKIVHRDIKTSNVLLDKDLNAKISDFGLAKLNEDDK  708

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E++V LLD
Sbjct  709   THISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPSEDFVYLLD  768

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VL+E+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  769   WAYVLRERGSLLELVDPDLGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRT  828

Query  1118  DILEYKSN  1141
              + E  S+
Sbjct  829   AVQELLSD  836



>ref|XP_007025276.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27898.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=951

 Score =   462 bits (1189),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 266/328 (81%), Gaps = 4/328 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LD+ T  FT  QIKAATNNFD ANKIGEGGFG VYKG L DGT+IAVKQLSSKSSQ
Sbjct  555   DLEGLDVQTVSFTLKQIKAATNNFDSANKIGEGGFGPVYKGQLADGTIIAVKQLSSKSSQ  614

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+ISCLQH NLVKLYGCC+E   LLLVYEY+ENNSL+ ALFGSE  Q+ +D
Sbjct  615   GNREFMNEIGMISCLQHSNLVKLYGCCIEGDQLLLVYEYLENNSLSRALFGSEKSQMNLD  674

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC GIA+GLAFLHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKL ++EK+
Sbjct  675   WPTRHKICTGIARGLAFLHEESRLKIVHRDIKGTNVLLDRDLNPKISDFGLAKLHEEEKT  734

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYLT+KADVYSFG+VALEIVSGK+NM + P+  Y CLLDW
Sbjct  735   HISTRVAGTIGYIAPEYALWGYLTYKADVYSFGIVALEIVSGKHNMTYGPENKYTCLLDW  794

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN--  1114
             A  LQ+   L EL+D +LG++F+K +A  M+++ALLCTN SP LRP+MS VV MLEG   
Sbjct  795   ACNLQQNRKLSELVDEKLGTEFNKAEAEAMIKIALLCTNGSPSLRPTMSEVVGMLEGKII  854

Query  1115  --GDILEYKSNIRELNFQAV*VHYEEMS  1192
                 + +  S  ++L F+A+  H++ M+
Sbjct  855   LPESVPDPGSYSQDLRFKAIRDHHKSMN  882



>ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score =   464 bits (1193),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 228/337 (68%), Positives = 275/337 (82%), Gaps = 7/337 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  638   ELKGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGVLSDGTIIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ QL++D
Sbjct  698   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLIYEYMENNSLARALFGPEECQLQLD  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  758   WPTRHRICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFGVVALEIVSG++N  +RP E  + LLD 
Sbjct  818   HISTRIAGTYGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGRSNTTYRPKEESIYLLDR  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL L+EKG+LM+++DPRLGSDF+KE+ + ML +ALLCT  S  +RP+MS+VVSMLEG   
Sbjct  878   ALSLKEKGSLMDIVDPRLGSDFNKEEVMAMLNIALLCTTISSAVRPAMSSVVSMLEGRTA  937

Query  1121  ILEYKSNIR----ELNFQAV*VHY---EEMSIGSSDS  1210
             + +  S+      +L  + +  HY   +E S+G S+S
Sbjct  938   VQDIVSDPSAPSDDLKLEEMKEHYRHIQEKSMGVSES  974



>ref|XP_010248481.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Nelumbo nucifera]
Length=938

 Score =   462 bits (1188),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 277/342 (81%), Gaps = 13/342 (4%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L+  TG F+  QIKAAT NFD ANKIGEGGFG VYKG L DG+VIAVKQLSSKS Q
Sbjct  581   ELRRLE--TGYFSLKQIKAATGNFDAANKIGEGGFGPVYKGILSDGSVIAVKQLSSKSKQ  638

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ +LK+D
Sbjct  639   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGREEHRLKLD  698

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  699   WPTRRKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  758

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E++V LLDW
Sbjct  759   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTSYRPKEDFVYLLDW  818

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
               VL+E+GNL+EL+DP L S++ KE+AL+ML +ALLCTNPSP LRP+MS VVSM+EG   
Sbjct  819   TYVLEEQGNLLELVDPILESNYSKEEALRMLNLALLCTNPSPTLRPAMSAVVSMIEGKIA  878

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGSSDSPNKVDICS  1234
                 +++ +S   EL F+A    +E++   S DS + + I S
Sbjct  879   IQAPLVKRRSADEELRFKA----FEKL---SHDSQSYISITS  913



>ref|XP_010093471.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB54095.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=954

 Score =   462 bits (1189),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L+L TG F+   IKAAT NFD ANKIGEGGFG VYKG L DG V+AVKQLSSKS Q
Sbjct  572   ELRALELQTGYFSLRHIKAATANFDPANKIGEGGFGPVYKGVLSDGRVVAVKQLSSKSKQ  631

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLL+YEY+ENNSLA ALFGS + +L +D
Sbjct  632   GNREFVNEIGMISALQHPNLVRLYGCCIEGNQLLLIYEYLENNSLARALFGSSEHRLHLD  691

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+ICVGIA+GL +LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  692   WPTRQKICVGIARGLVYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  751

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  752   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  811

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A V QE+GNL+EL+DP LGS++ KE+AL ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  812   AYVQQEQGNLLELVDPSLGSNYSKEEALTMLNLALLCTNPSPTLRPIMSSVVSMLEG  868



>gb|KHG04295.1| hypothetical protein F383_04630 [Gossypium arboreum]
Length=899

 Score =   460 bits (1184),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/308 (73%), Positives = 261/308 (85%), Gaps = 1/308 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+F+  QIKAAT NFD  NKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  529   ELRGLDLQTGIFSLRQIKAATKNFDTENKIGEGGFGCVYKGLLSDGTVIAVKQLSSKSRQ  588

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR-QLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLLVYEYMENN L+ ALFG     +LK+
Sbjct  589   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLLLVYEYMENNCLSRALFGKNATCKLKL  648

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             +W TRQ+IC+GIA+GLA+LHEES IK+VHRDIKT+NVLLDK+LN KISDFGLAKL++D+K
Sbjct  649   NWPTRQKICLGIARGLAYLHEESRIKIVHRDIKTSNVLLDKDLNAKISDFGLAKLNEDDK  708

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E++V LLD
Sbjct  709   THISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPSEDFVYLLD  768

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VL+E+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  769   WAYVLRERGSLLELVDPDLGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRT  828

Query  1118  DILEYKSN  1141
              + E  S+
Sbjct  829   AVQELLSD  836



>ref|XP_010246507.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X2 [Nelumbo nucifera]
Length=984

 Score =   462 bits (1190),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 267/319 (84%), Gaps = 6/319 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L  GTG F+  QIKAAT NFDV NKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  622   ELRGL--GTGYFSLKQIKAATRNFDVENKIGEGGFGPVYKGILPDGTLIAVKQLSSKSKQ  679

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA ALFG E++ L +D
Sbjct  680   GNREFINEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGREEQILILD  739

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR++IC+GIA+GLA+LHEES IK+VHRDIK  NVLLD +LN KISDFGLAKLD++E +
Sbjct  740   WSTRRKICLGIARGLAYLHEESRIKIVHRDIKATNVLLDGDLNAKISDFGLAKLDEEENT  799

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+V LE+VSGK+N  +RP E++V LLDW
Sbjct  800   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVLLELVSGKSNTSYRPKEDFVYLLDW  859

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+DP L S++ KE+AL+ML +AL CTNPSP LRPSMS+VVSMLEG   
Sbjct  860   AYVLQEQGNLLELVDPILESNYSKEEALRMLNLALFCTNPSPTLRPSMSSVVSMLEGKIA  919

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++ +S+  E+ F+A
Sbjct  920   IQAPIIKKRSDDEEVRFKA  938



>ref|XP_006370087.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66656.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=900

 Score =   460 bits (1184),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 254/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F+  QIK ATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLS+KS Q
Sbjct  520   ELRALDLQTGYFSLRQIKHATNNFDPANKIGEGGFGPVYKGMLSDGSVIAVKQLSAKSKQ  579

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  580   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEHQIKLD  639

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGL +LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  640   WQTRKKILLGIAKGLTYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  699

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  700   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  759

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ K +AL+ML +ALLCTNPSP LRPSMS+ V MLEG
Sbjct  760   AYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPSMSSAVKMLEG  816



>gb|AAF75093.1|AC007583_29 Contains similarity to a receptor-like serine/threonine kinase 
from Arabidopsis thaliana gb|AF024648. It contains a pkinase 
domain PF|00069 [Arabidopsis thaliana]
Length=554

 Score =   449 bits (1155),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 217/307 (71%), Positives = 257/307 (84%), Gaps = 1/307 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             +R LDL TG FT  QIKAAT+NFDV  KIGEGGFGSVYKG L +G +IAVKQLS+KS QG
Sbjct  196   IRGLDLQTGTFTLRQIKAATDNFDVTRKIGEGGFGSVYKGELSEGKLIAVKQLSAKSRQG  255

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGS-EDRQLKID  580
             NREF+NEIG+IS LQHPNLVKLYGCCVE   L+LVYEY+ENN L+ ALFG  E  +LK+D
Sbjct  256   NREFVNEIGMISALQHPNLVKLYGCCVEGNQLILVYEYLENNCLSRALFGKDESSRLKLD  315

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR++I +GIAKGL FLHEES IK+VHRDIK +NVLLDK+LN KISDFGLAKL+DD  +
Sbjct  316   WSTRKKIFLGIAKGLTFLHEESRIKIVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNT  375

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  FRP E++V LLDW
Sbjct  376   HISTRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRPTEDFVYLLDW  435

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+G+L+EL+DP L SD+ +E+A+ ML VAL+CTN SP LRP+MS VVS++EG   
Sbjct  436   AYVLQERGSLLELVDPTLASDYSEEEAMLMLNVALMCTNASPTLRPTMSQVVSLIEGKTA  495

Query  1121  ILEYKSN  1141
             + E  S+
Sbjct  496   MQELLSD  502



>ref|XP_009619428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Nicotiana tomentosiformis]
Length=1016

 Score =   463 bits (1192),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 254/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F   QIKAATNNFD ANKIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  641   ELRALDLQTGHFRLRQIKAATNNFDPANKIGEGGFGPVYKGVLADGAIIAVKQLSSKSKQ  700

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L HPNLV+LYGCC+E   LL++YEYMENN LA ALFG +D++L +D
Sbjct  701   GNREFVNEIGMISALHHPNLVRLYGCCIEGNQLLVIYEYMENNCLARALFGRDDQRLNLD  760

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR+RIC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+L+ KISDFGLAKLD++E +
Sbjct  761   WPTRKRICLGIARGLAYLHEESALKIVHRDIKATNVLLDKDLSAKISDFGLAKLDEEENT  820

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT+GY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDW
Sbjct  821   HISTRIAGTVGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDW  880

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DPRLGS + K++ ++M+ + LLCTNPSP LRP MS+VVSMLEG
Sbjct  881   AYVLQEQGNLLELVDPRLGSSYSKKEVMQMINLGLLCTNPSPTLRPCMSSVVSMLEG  937



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score =   462 bits (1189),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 233/345 (68%), Positives = 273/345 (79%), Gaps = 16/345 (5%)
 Frame = +2

Query  104   RKLDVVTICACSHMCYADSIPKLILY-----CTRNY-S*SNCSCTELRDLDLGTGMFTFT  265
             RK  V+     S +C       LIL+     C R+Y    N    ELR LDL  G FT  
Sbjct  590   RKFSVIVGAVTSLLC-------LILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLR  642

Query  266   QIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCL  445
             QIKAATNNFD ANKIGEGGFGSV+KG L DGT+IAVKQLSSKS QG REF+NEIG+IS L
Sbjct  643   QIKAATNNFDSANKIGEGGFGSVFKGQLSDGTLIAVKQLSSKSRQGYREFVNEIGLISAL  702

Query  446   QHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQ---LKIDWATRQRICVGIA  616
             QHPNLVKLYGCC E   LLLVYEYMENNSLA ALF   D +   LK+DWATRQ+ICVGIA
Sbjct  703   QHPNLVKLYGCCTEGNQLLLVYEYMENNSLAYALFDKNDAKTSALKLDWATRQKICVGIA  762

Query  617   KGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGY  796
             +G+AFL EEST+K+VHRDIK  NVLLD++LN KISDFGLA+L+ +E +HISTRVAGTIGY
Sbjct  763   RGIAFLQEESTLKIVHRDIKATNVLLDEDLNAKISDFGLARLNGEESTHISTRVAGTIGY  822

Query  797   TAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLME  976
              APEYALWGYLT KAD+YSFGVVALEIVSGKNN  ++P+   VCLLD A VLQ++G+LME
Sbjct  823   MAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLME  882

Query  977   LIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             ++DP+LGS+F++++A +M++VALLCTN SP LRP+MS VVSMLEG
Sbjct  883   IVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEG  927



>emb|CBI20149.3| unnamed protein product [Vitis vinifera]
Length=904

 Score =   460 bits (1184),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 221/331 (67%), Positives = 271/331 (82%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR+L + TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG+V AVKQLSSKS Q
Sbjct  520   ELRELGMQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSVSAVKQLSSKSKQ  579

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENNSLA ALFGS++++L +D
Sbjct  580   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNSLARALFGSDEQRLNLD  639

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +
Sbjct  640   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEDENT  699

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA  GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  700   HISTRIAGTIGYMAPEYATRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  759

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GNL+EL+DP LGS++ +E+ ++ML +ALLCTN SP LRP MS+VVSML+G   
Sbjct  760   AYVLHEQGNLLELVDPSLGSNYSEEEVMRMLNLALLCTNQSPTLRPPMSSVVSMLDGKIA  819

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  +++ S   ++ F+A    +E++S+ S
Sbjct  820   VQAPTIKHDSMNPDMRFKA----FEKLSLDS  846



>ref|XP_006388682.1| hypothetical protein POPTR_0122s00210g [Populus trichocarpa]
 gb|ERP47596.1| hypothetical protein POPTR_0122s00210g [Populus trichocarpa]
Length=573

 Score =   449 bits (1156),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 255/313 (81%), Gaps = 1/313 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +++ LD   G F+  QI+AATN+FD +NKIGEGGFG VYKG L DGTVIAVKQLSSKS Q
Sbjct  208   DVKGLDFPKGTFSLKQIRAATNDFDASNKIGEGGFGPVYKGQLPDGTVIAVKQLSSKSRQ  267

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNE+G+ISCLQHPNLVKL+GCC+E   LLLVYEYMENNSLA ALF  E+ QL +D
Sbjct  268   GNREFLNEMGMISCLQHPNLVKLHGCCIESDQLLLVYEYMENNSLARALFRHENNQLNLD  327

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIA+GLAFLHEES +K+VHRDIK  NVLLD  LNPKISDFGLA+LD++EKS
Sbjct  328   WPTRLKICIGIARGLAFLHEESRLKIVHRDIKATNVLLDGNLNPKISDFGLARLDEEEKS  387

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRP-DENYVCLLD  937
             HISTRVAGTIGY APEYALWGYLT KADVYSFGVVALEI+SGKNN  + P + + VCLLD
Sbjct  388   HISTRVAGTIGYMAPEYALWGYLTDKADVYSFGVVALEIISGKNNNNYMPSNSSCVCLLD  447

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA  LQ+ G+ +EL+D  LGS+ + E+A  M++VALLCTN SP LRP+MS VVSMLEG  
Sbjct  448   WACYLQQSGSFIELVDETLGSEVNIEEAETMVKVALLCTNASPTLRPTMSEVVSMLEGRM  507

Query  1118  DILEYKSNIRELN  1156
              + + +  +   N
Sbjct  508   AVPDTRPELSSYN  520



>gb|KDP20042.1| hypothetical protein JCGZ_05811 [Jatropha curcas]
Length=1041

 Score =   464 bits (1193),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 225/324 (69%), Positives = 267/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT NFD ANK+GEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  654   ELRGLDLQTGIFTLKQIKAATKNFDAANKVGEGGFGSVYKGQLSDGTIIAVKQLSSKSKQ  713

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-SEDRQLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLL+YEYMENN L+ ALFG +   +LK+
Sbjct  714   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLLLIYEYMENNCLSRALFGKNPTSRLKL  773

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+A+GLA+LHEES IK+VHRDIKT+NVL+DK+LN KISDFGLAKL++D+ 
Sbjct  774   DWPTRQKICLGVARGLAYLHEESIIKIVHRDIKTSNVLIDKDLNAKISDFGLAKLNEDDN  833

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTRVAGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  834   THISTRVAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  893

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VLQE+G+L+EL+DP LGS +  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  894   WAYVLQERGSLLELVDPELGSAYSSEEAMLMLNVALLCTNASPTLRPTMSQVVSMLEGRT  953

Query  1118  DILEYKSNIRELNFQAV*VHYEEM  1189
              + +    + +  F A+   Y+ +
Sbjct  954   AVQDL---LSDPGFSAINTKYKAI  974



>sp|C0LGG8.1|Y5343_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein 
kinase At1g53430; Flags: Precursor [Arabidopsis thaliana]
 gb|ACN59253.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=1038

 Score =   464 bits (1193),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  646   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  705

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  706   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  765

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKL+DDE +
Sbjct  766   WSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENT  825

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  826   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  885

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  886   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEG  942



>ref|XP_007048781.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
 gb|EOX92938.1| Leucine-rich repeat transmembrane protein kinase isoform 2 [Theobroma 
cacao]
Length=873

 Score =   459 bits (1181),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 220/298 (74%), Positives = 258/298 (87%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+F+  QIKAAT NF+  NKIGEGGFG VY+G L DGTVIAVKQLSSKS Q
Sbjct  506   ELRCLDLQTGIFSLRQIKAATKNFNAENKIGEGGFGCVYRGLLSDGTVIAVKQLSSKSKQ  565

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSE-DRQLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLLVYEYMENN L+ ALFG +   +LK+
Sbjct  566   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLLLVYEYMENNCLSRALFGKDATHKLKL  625

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+GIA+GLA+LHEES IK+VHRDIKT+NVLLDK LN KISDFGLAKL++D+K
Sbjct  626   DWPTRQKICLGIARGLAYLHEESRIKIVHRDIKTSNVLLDKNLNAKISDFGLAKLNEDDK  685

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KAD+YSFGVVALEIVSGK+N  +RP+E++V LLD
Sbjct  686   THISTRIAGTIGYMAPEYAMRGYLTNKADIYSFGVVALEIVSGKSNTNYRPNEDFVYLLD  745

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VL+E+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  746   WAYVLRERGSLLELVDPALGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEG  803



>gb|KCW48268.1| hypothetical protein EUGRSUZ_K020001, partial [Eucalyptus grandis]
Length=365

 Score =   442 bits (1136),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/296 (71%), Positives = 249/296 (84%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             L+ L L  G+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT IAVKQLSSKS QG
Sbjct  1     LKGLALQIGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGFLSDGTAIAVKQLSSKSQQG  60

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             N EFL EIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+DW
Sbjct  61    NNEFLTEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPEELQLKLDW  120

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKLD+++K+H
Sbjct  121   WTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDEDLNPKISDFGLAKLDEEDKTH  180

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             IST++AGT GY APEYA+ GYLT KAD+YSFGVVALE+V+G++N   +  E    LLDWA
Sbjct  181   ISTKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVNGRSNTSSQRTEECFNLLDWA  240

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
               L+E  NL+EL+DPRLGS F+KE+AL +++VAL+CTN +P LRP MS+VVSMLEG
Sbjct  241   HFLKEGENLIELVDPRLGSHFNKEEALALIKVALMCTNVTPALRPPMSSVVSMLEG  296



>ref|NP_175748.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE32939.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=1030

 Score =   463 bits (1192),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 220/297 (74%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  638   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  697

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  698   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  757

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKL+DDE +
Sbjct  758   WSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENT  817

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  818   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  877

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  878   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEG  934



>ref|XP_010246506.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   462 bits (1190),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 224/319 (70%), Positives = 267/319 (84%), Gaps = 6/319 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L  GTG F+  QIKAAT NFDV NKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  646   ELRGL--GTGYFSLKQIKAATRNFDVENKIGEGGFGPVYKGILPDGTLIAVKQLSSKSKQ  703

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA ALFG E++ L +D
Sbjct  704   GNREFINEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGREEQILILD  763

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR++IC+GIA+GLA+LHEES IK+VHRDIK  NVLLD +LN KISDFGLAKLD++E +
Sbjct  764   WSTRRKICLGIARGLAYLHEESRIKIVHRDIKATNVLLDGDLNAKISDFGLAKLDEEENT  823

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+V LE+VSGK+N  +RP E++V LLDW
Sbjct  824   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVLLELVSGKSNTSYRPKEDFVYLLDW  883

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VLQE+GNL+EL+DP L S++ KE+AL+ML +AL CTNPSP LRPSMS+VVSMLEG   
Sbjct  884   AYVLQEQGNLLELVDPILESNYSKEEALRMLNLALFCTNPSPTLRPSMSSVVSMLEGKIA  943

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++ +S+  E+ F+A
Sbjct  944   IQAPIIKKRSDDEEVRFKA  962



>emb|CDY60204.1| BnaCnng35830D [Brassica napus]
Length=1044

 Score =   463 bits (1192),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 222/297 (75%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  652   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLGDGTTIAVKQLSSKSKQ  711

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  712   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  771

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  772   WATRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDQSLNAKISDFGLAKLDEEENT  831

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  832   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  891

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+D  LG++F K++A +ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  892   AYVLQEQGNLLELVDMDLGTNFSKKEAKRMLNIALLCTNPSPTLRPPMSSVVSMLEG  948



>ref|XP_010657080.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 emb|CBI22045.3| unnamed protein product [Vitis vinifera]
Length=1011

 Score =   462 bits (1190),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 222/298 (74%), Positives = 258/298 (87%), Gaps = 1/298 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG+FT  QIKAAT NFD  NK+GEGGFG+V+KGTL DGTVIAVKQLSSKS Q
Sbjct  646   ELRGLDLQTGLFTLRQIKAATKNFDAENKLGEGGFGAVFKGTLSDGTVIAVKQLSSKSKQ  705

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSE-DRQLKI  577
             GNREF+NE+G+IS LQHPNLVKLYGCC+E   L LVYEYMENNSL+ ALFG +   +LK+
Sbjct  706   GNREFVNEVGMISALQHPNLVKLYGCCIEGNQLSLVYEYMENNSLSRALFGRDATYKLKL  765

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             +W+TRQ ICVGIA+GLA+LHEEST+K+VHRDIKT+NVLLDK++N KISDFGLAKLD+D+ 
Sbjct  766   NWSTRQNICVGIARGLAYLHEESTLKIVHRDIKTSNVLLDKDMNAKISDFGLAKLDEDDN  825

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  826   THISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  885

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             WA VLQE+G L+EL+DP LGS++  EQA+ ML VALLCTN SP LRP+MS VVSMLEG
Sbjct  886   WAYVLQERGGLLELVDPDLGSEYSSEQAMVMLNVALLCTNASPTLRPTMSQVVSMLEG  943



>ref|XP_007025275.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
 gb|EOY27897.1| Receptor-like kinase in flowers 1, putative [Theobroma cacao]
Length=995

 Score =   462 bits (1189),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ LD  T  FT  QIKAATNNFD  NKIGEGGFG VYKG L DGT+IAVKQLSSKSSQ
Sbjct  632   DLKGLDPQTVSFTLKQIKAATNNFDSVNKIGEGGFGPVYKGQLADGTIIAVKQLSSKSSQ  691

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNE+GI SCLQHPNLVKLYGCC+E   LLLVYEYMENNSL+ ALFG E  ++ ++
Sbjct  692   GNREFLNEMGIFSCLQHPNLVKLYGCCIEGNQLLLVYEYMENNSLSRALFGPEYSRINLE  751

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHEES +K+VHRDIK  NVLLD++LNPKISDFGLAKL ++EK+
Sbjct  752   WPTRHKICVGIARGLAFLHEESRLKIVHRDIKATNVLLDRDLNPKISDFGLAKLHEEEKT  811

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYALWGYLT+KADVYSFG+VALEIVSGK+NM + PD+ + CLLDW
Sbjct  812   HISTRIAGTIGYIAPEYALWGYLTYKADVYSFGIVALEIVSGKHNMNYGPDDKHTCLLDW  871

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A  LQ+ G L+EL+D +LGS+++K +A  M++VALLCTN SP LRP+MS VV MLEG
Sbjct  872   ACHLQQSGKLLELVDNQLGSEYNKSEAEGMIKVALLCTNASPSLRPTMSQVVEMLEG  928



>gb|KFK35729.1| hypothetical protein AALP_AA4G029100 [Arabis alpina]
Length=1033

 Score =   463 bits (1191),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 220/301 (73%), Positives = 252/301 (84%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR +DL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  643   ELRGMDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGTTIAVKQLSSKSKQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  703   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKL+DDE +
Sbjct  763   WPTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDESLNAKISDFGLAKLNDDENT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP + +V LLDW
Sbjct  823   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKDEFVYLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GNL+EL+D  LG+ F K++A +ML +ALLCTNPSP LRP MS+VVSMLEG   
Sbjct  883   AYVLQEQGNLLELVDMDLGTSFSKKEAKRMLNIALLCTNPSPTLRPPMSSVVSMLEGKSK  942

Query  1121  I  1123
             +
Sbjct  943   V  943



>ref|XP_009144771.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Brassica rapa]
Length=1044

 Score =   463 bits (1191),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 222/297 (75%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  652   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLGDGTTIAVKQLSSKSKQ  711

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  712   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  771

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  772   WATRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDQSLNAKISDFGLAKLDEEENT  831

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  832   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  891

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+D  LG++F K++A +ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  892   AYVLQEQGNLLELVDMDLGTNFSKKEAKRMLNIALLCTNPSPTLRPPMSSVVSMLEG  948



>ref|XP_010247772.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1001

 Score =   462 bits (1188),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 219/303 (72%), Positives = 258/303 (85%), Gaps = 0/303 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ +DL TG FT  QIKAATNNFD ANKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  632   DLKGVDLQTGTFTLRQIKAATNNFDNANKIGEGGFGPVYKGILSDGTIIAVKQLSSKSKQ  691

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LV+LYGCC+E   LLL+YEY+ENNSLA ALFG E+ QLK+D
Sbjct  692   GNREFVNEIGMISALQHPHLVRLYGCCIEGNQLLLIYEYLENNSLARALFGPEEFQLKLD  751

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD++E +
Sbjct  752   WPTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEENT  811

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  FRP E  + LLDW
Sbjct  812   HISTRIAGTYGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTSFRPKEERIYLLDW  871

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+ KG L++L+DPRLGS+F+K+Q + M+ VALLCTN S  LRP+MS+VVSMLEG   
Sbjct  872   ALILKAKGCLIDLVDPRLGSEFNKDQVMAMINVALLCTNESAELRPAMSSVVSMLEGQAP  931

Query  1121  ILE  1129
             I E
Sbjct  932   IQE  934



>ref|XP_006377482.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
 gb|ERP55279.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
Length=617

 Score =   450 bits (1158),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 228/367 (62%), Positives = 273/367 (74%), Gaps = 37/367 (10%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  209   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  268

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALF----------  550
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALF          
Sbjct  269   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFVAFVDKFPVK  328

Query  551   -----------------------GSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVV  661
                                    GSE   L +DW TR +I VGIA+GLAFLHE S I++V
Sbjct  329   NIFYNTASTSKHEMILSTILLGAGSETSALMLDWPTRYKIYVGIARGLAFLHEGSAIRIV  388

Query  662   HRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKA  841
             HRDIK  NVLLDK+LN KISDFGLAKL+++E +HISTRVAGTIGY APEYALWGYLT KA
Sbjct  389   HRDIKVTNVLLDKDLNAKISDFGLAKLNEEENTHISTRVAGTIGYMAPEYALWGYLTDKA  448

Query  842   DVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQA  1021
             DVYSFGVVALEIVSGK+N  +RP+   VCLLDWA VLQ+KGNLME++DP+L S+F+KE+A
Sbjct  449   DVYSFGVVALEIVSGKSNSSYRPENENVCLLDWAHVLQKKGNLMEIMDPKLQSEFNKEEA  508

Query  1022  LKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDILEYKSNI----RELNFQAV*VHYEEM  1189
              +M++ ALLCTN SP LRP+MS V++MLEG  +I E  S+      +L  + V  HY+++
Sbjct  509   ERMIKAALLCTNASPSLRPAMSEVLNMLEGQTNIPEVTSDPSIYDNDLQSKRVKGHYQQV  568

Query  1190  SIGSSDS  1210
             +  S +S
Sbjct  569   TDQSLNS  575



>gb|KHG20508.1| hypothetical protein F383_03730 [Gossypium arboreum]
Length=950

 Score =   461 bits (1185),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 220/320 (69%), Positives = 265/320 (83%), Gaps = 4/320 (1%)
 Frame = +2

Query  218   TELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSS  397
             +EL+ L+L TG F+  QIKAATNNFD +NKIGEGGFG VYKG L DG VIAVKQLSSKS 
Sbjct  573   SELQGLELQTGYFSLRQIKAATNNFDSSNKIGEGGFGPVYKGVLSDGMVIAVKQLSSKSK  632

Query  398   QGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKI  577
             QGNREF+NEIG+IS LQH NLVKLYGCC+E   LLL+YEY+ENNSLA ALFG ++ +L +
Sbjct  633   QGNREFVNEIGMISALQHSNLVKLYGCCIEGNQLLLIYEYLENNSLARALFGRDEHRLTL  692

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW+TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E 
Sbjct  693   DWSTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEEN  752

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLD
Sbjct  753   THISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVLLEIVSGKSNTNYRPKEEFVYLLD  812

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG--  1111
             WA V QE+GNL+EL+DP LGS +  E+AL+ML +ALLCTNPSP LRPSMS+VVSM+EG  
Sbjct  813   WAYVQQEQGNLLELVDPSLGSKYSNEEALRMLNIALLCTNPSPTLRPSMSSVVSMMEGKI  872

Query  1112  --NGDILEYKSNIRELNFQA  1165
                  +++ K   R+  F+A
Sbjct  873   PVQAPLIKQKDADRDARFRA  892



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score =   461 bits (1187),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 233/345 (68%), Positives = 273/345 (79%), Gaps = 16/345 (5%)
 Frame = +2

Query  104   RKLDVVTICACSHMCYADSIPKLILY-----CTRNY-S*SNCSCTELRDLDLGTGMFTFT  265
             RK  V+     S +C       LIL+     C R+Y    N    ELR LDL  G FT  
Sbjct  603   RKFSVIVGAVTSLLC-------LILFVLGVLCWRHYLGDKNTRERELRGLDLQIGSFTLR  655

Query  266   QIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCL  445
             QIKAATNNFD ANKIGEGGFGSV+KG L DGT+IAVKQLSSKS QG REF+NEIG+IS L
Sbjct  656   QIKAATNNFDSANKIGEGGFGSVFKGQLSDGTLIAVKQLSSKSRQGYREFVNEIGLISAL  715

Query  446   QHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQ---LKIDWATRQRICVGIA  616
             QHPNLVKLYGCC E   LLLVYEYMENNSLA ALF   D +   LK+DWATRQ+ICVGIA
Sbjct  716   QHPNLVKLYGCCTEGNQLLLVYEYMENNSLAYALFDKNDAKTSALKLDWATRQKICVGIA  775

Query  617   KGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHISTRVAGTIGY  796
             +G+AFL EEST+K+VHRDIK  NVLLD++LN KISDFGLA+L+ +E +HISTRVAGTIGY
Sbjct  776   RGIAFLQEESTLKIVHRDIKATNVLLDEDLNAKISDFGLARLNGEESTHISTRVAGTIGY  835

Query  797   TAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVLQEKGNLME  976
              APEYALWGYLT KAD+YSFGVVALEIVSGKNN  ++P+   VCLLD A VLQ++G+LME
Sbjct  836   MAPEYALWGYLTNKADIYSFGVVALEIVSGKNNTSYKPENECVCLLDLAFVLQQRGSLME  895

Query  977   LIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             ++DP+LGS+F++++A +M++VALLCTN SP LRP+MS VVSMLEG
Sbjct  896   IVDPKLGSEFNQDEAERMIKVALLCTNASPTLRPTMSAVVSMLEG  940



>ref|XP_006389048.1| hypothetical protein POPTR_0053s00220g [Populus trichocarpa]
 gb|ERP47962.1| hypothetical protein POPTR_0053s00220g [Populus trichocarpa]
Length=387

 Score =   442 bits (1136),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/305 (70%), Positives = 254/305 (83%), Gaps = 16/305 (5%)
 Frame = +2

Query  218   TELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSS  397
             TEL  LDL TG+FTF QIKAATN+FD ANK+GEGGFG VYKG L DGT IAVKQLS+KS 
Sbjct  36    TELVGLDLLTGIFTFRQIKAATNDFDPANKLGEGGFGCVYKGVLSDGTQIAVKQLSAKSK  95

Query  398   QGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSED-RQLK  574
             QGNREF+NEIG+IS LQHPNLV+LYGCC+E K LLLVYEYMENNSLA+ LFG+++ +  K
Sbjct  96    QGNREFVNEIGMISALQHPNLVRLYGCCIEGKQLLLVYEYMENNSLAHVLFGTKEIKATK  155

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW TRQRICV IAKGL FLHEEST+K+VHRDIK  N+LLDK++N KISDFG+AKLDD++
Sbjct  156   LDWRTRQRICVSIAKGLVFLHEESTLKIVHRDIKGTNILLDKDMNAKISDFGMAKLDDED  215

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HI TRVAGT+GY APEYAL+GYLT+KADVYSFGVVALEIVSG NN+            
Sbjct  216   NTHIDTRVAGTMGYMAPEYALYGYLTYKADVYSFGVVALEIVSGMNNV------------  263

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
                L LQ+ G++ME++DPRLGS+F+K++ ++M+ VALLCTN SP +RP+MSTVVSMLEG 
Sbjct  264   ---LYLQKNGDIMEMVDPRLGSEFNKKEVVRMINVALLCTNQSPAVRPTMSTVVSMLEGK  320

Query  1115  GDILE  1129
              D+ E
Sbjct  321   TDVEE  325



>gb|KEH38591.1| LRR receptor-like kinase [Medicago truncatula]
Length=916

 Score =   459 bits (1182),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 251/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L+L TG ++  QIK ATNNFD  NKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  552   LELKTGYYSLRQIKVATNNFDPKNKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSKQGNRE  611

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG  +++L +DW TR
Sbjct  612   FVNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALFGKPEQRLNLDWRTR  671

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD++E +HIST
Sbjct  672   MKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEEENTHIST  731

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSG +N  +RP E +V LLDWA VL
Sbjct  732   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGMSNTNYRPKEEFVYLLDWAYVL  791

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             QE+GNL+EL+DP LGS +  E+A++ML++ALLCTNPSP LRP MS+VVSMLEGN  I
Sbjct  792   QEQGNLLELVDPTLGSKYSSEEAMRMLQLALLCTNPSPTLRPPMSSVVSMLEGNTPI  848



>ref|XP_010036442.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Eucalyptus grandis]
Length=659

 Score =   451 bits (1161),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ L L  G+FT  QIKAATNNFD+ANKIGEGGFGSVYKG L DGT IAVKQLSSKS Q
Sbjct  294   DLKGLALQIGLFTLRQIKAATNNFDIANKIGEGGFGSVYKGFLSDGTTIAVKQLSSKSQQ  353

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GN EFL EIG IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+D
Sbjct  354   GNNEFLTEIGTISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPEEFQLKLD  413

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++K+
Sbjct  414   WWTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDKT  473

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HIST++AGT GY APEYA+ GYLT KAD+YSFG+VALE+VSG++N   +  E    LLDW
Sbjct  474   HISTKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDW  533

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A  L+E+GNL+EL+DPRLGS FDKE+AL +++VAL+CTN +P LRP MS+VVSMLEG
Sbjct  534   AHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEG  590



>emb|CDY25853.1| BnaA05g14440D [Brassica napus]
Length=1044

 Score =   463 bits (1191),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 222/297 (75%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  652   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLGDGTTIAVKQLSSKSKQ  711

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  712   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  771

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  772   WATRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDQSLNAKISDFGLAKLDEEENT  831

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  832   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  891

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+D  LG++F K++A +ML +ALLCTNPSP LRP MS+VVSMLEG
Sbjct  892   AYVLQEQGNLLELVDMDLGTNFSKKEAKRMLNIALLCTNPSPTLRPPMSSVVSMLEG  948



>ref|XP_004166352.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like, partial [Cucumis sativus]
Length=380

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 214/309 (69%), Positives = 253/309 (82%), Gaps = 0/309 (0%)
 Frame = +2

Query  215   CTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKS  394
             C ELR LDL T  FT  QIK ATNNFD ANKIGEGGFG VYKG L DGT IAVKQLSSKS
Sbjct  9     CAELRGLDLQTCSFTLRQIKVATNNFDAANKIGEGGFGPVYKGVLADGTTIAVKQLSSKS  68

Query  395   SQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLK  574
              QGNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA+ALFG E+ +L+
Sbjct  69    KQGNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLAHALFGQEESELE  128

Query  575   IDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDE  754
             +DW+TRQ+ICVGIA+GLA+LHEES +K+VHRDIK  N+LLDK+LNPKISDFGLAKLD++ 
Sbjct  129   LDWSTRQKICVGIARGLAYLHEESRLKIVHRDIKATNILLDKDLNPKISDFGLAKLDEEG  188

Query  755   KSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLL  934
              +HISTR+AGT GY APEYA+ G+LT KADVYSFGVVALEIVSG+ N       +   LL
Sbjct  189   NTHISTRIAGTFGYMAPEYAMQGHLTDKADVYSFGVVALEIVSGRMNTTLWAANDCSYLL  248

Query  935   DWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGN  1114
             D AL  +EK +L+EL+DP LGS+F+K +AL+M+++AL CTN SP  RP+MS+VVSMLEG 
Sbjct  249   DSALKFKEKNSLLELVDPGLGSNFNKGEALRMIKIALHCTNVSPAARPNMSSVVSMLEGR  308

Query  1115  GDILEYKSN  1141
               I +  SN
Sbjct  309   QGIEDIVSN  317



>gb|KCW67576.1| hypothetical protein EUGRSUZ_F013322, partial [Eucalyptus grandis]
Length=379

 Score =   441 bits (1134),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 209/296 (71%), Positives = 248/296 (84%), Gaps = 0/296 (0%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             L+ L L  G FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT IAVKQLSSKS QG
Sbjct  1     LKVLALQIGSFTLRQIKAATNNFDAANKIGEGGFGSVYKGLLSDGTTIAVKQLSSKSKQG  60

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREF+ E+G+IS LQHP+LVKLYGCC+E   LLLVY+YMENN+LA ALFG E+ QLK+DW
Sbjct  61    NREFVTELGMISALQHPHLVKLYGCCIEGNQLLLVYQYMENNNLARALFGPEEFQLKLDW  120

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD+++ +H
Sbjct  121   GTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNSKISDFGLAKLDEEDNTH  180

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWA  943
             IST++AGT GY APEYA+ GYLT KAD+YSFGVVALE+VSG+ N+ ++  +    LLDWA
Sbjct  181   ISTKIAGTYGYMAPEYAMHGYLTDKADIYSFGVVALEVVSGQCNISYQKKDECFHLLDWA  240

Query  944   LVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
               L+E+GNL++L+D RLGS FDKEQ L M++VALLCTN +P LRP MS+VVSMLEG
Sbjct  241   RELKERGNLIDLVDARLGSHFDKEQVLAMIKVALLCTNATPTLRPVMSSVVSMLEG  296



>ref|XP_006392789.1| hypothetical protein EUTSA_v10011204mg [Eutrema salsugineum]
 gb|ESQ30075.1| hypothetical protein EUTSA_v10011204mg [Eutrema salsugineum]
Length=1031

 Score =   462 bits (1189),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 253/301 (84%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  640   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGTTIAVKQLSSKSKQ  699

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  700   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  759

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  760   WSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDQSLNAKISDFGLAKLDEEENT  819

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  820   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  879

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GNL+EL+D  LG+ F K++A +ML +ALLCTNPSP LRP MS+VVSMLEG   
Sbjct  880   AYVLQEQGNLLELVDMDLGTSFSKKEAKRMLNIALLCTNPSPTLRPPMSSVVSMLEGKSK  939

Query  1121  I  1123
             +
Sbjct  940   V  940



>ref|XP_007149532.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
 gb|ESW21526.1| hypothetical protein PHAVU_005G078100g [Phaseolus vulgaris]
Length=690

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 221/332 (67%), Positives = 269/332 (81%), Gaps = 4/332 (1%)
 Frame = +2

Query  206   NCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLS  385
             N    EL+ L+L  GMFT  QIK ATNNFD++NKIGEGGFG VYKGTL DGT+IAVK+LS
Sbjct  315   NSLAKELKHLNLQMGMFTMRQIKVATNNFDISNKIGEGGFGPVYKGTLSDGTIIAVKKLS  374

Query  386   SKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR  565
             SKS QGNREF+NEIG+IS LQHP LVKLYGCCVE   LLLVYEYMENNSLA+ALF + + 
Sbjct  375   SKSKQGNREFINEIGLISALQHPCLVKLYGCCVEGDELLLVYEYMENNSLAHALFRNGES  434

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L++DW TR +ICVGIA+GLAFLHEES +KVVHRDIK  NVLLDK+LNPKISDFGLAKLD
Sbjct  435   CLQLDWPTRYKICVGIARGLAFLHEESRLKVVHRDIKATNVLLDKDLNPKISDFGLAKLD  494

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             D++ +HISTR+AGT GY APEYA+ GYLT KADVYSFGVVALEIV+GK N   RP +  +
Sbjct  495   DEDNTHISTRIAGTYGYMAPEYAMHGYLTDKADVYSFGVVALEIVTGKTNTIHRPKQEAL  554

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
              LLDWA +++EKGNLMEL+D RLGS+F++++ + M++V LLCTN +  LRPSMS+V+SML
Sbjct  555   LLLDWAHLVKEKGNLMELVDRRLGSNFNEKEVMMMIKVGLLCTNTTANLRPSMSSVLSML  614

Query  1106  EGNGDILEYKSN----IRELNFQAV*VHYEEM  1189
             EG   I E+ S+    + E+  +A+  +Y +M
Sbjct  615   EGKTVIPEFISDSSEVMDEMKLEAMRQYYSQM  646



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score =   457 bits (1177),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 264/317 (83%), Gaps = 5/317 (2%)
 Frame = +2

Query  173   ILYCTRNYS*SNCSCTE--LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGT  346
             I  C R +   + +  E  L  LDL TG+FTF QIKAATNNF   +KIGEGGFG+VY G 
Sbjct  486   IFICWRKHRSKDMASREQVLAGLDLQTGLFTFRQIKAATNNFSADSKIGEGGFGTVYLGI  545

Query  347   LLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMEN  526
             LLDGT IAVK LSS+S QGN+EF+NEIG+IS L+HPNLV+LYGCCVE   L L+YEYMEN
Sbjct  546   LLDGTHIAVKLLSSRSKQGNQEFVNEIGMISGLRHPNLVRLYGCCVEGSQLFLIYEYMEN  605

Query  527   NSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKEL  706
             N+LA ALF  ++ QLK++W TRQ+IC+G+A+GL FLHEESTIK+VHRDIK  N+LLDK+L
Sbjct  606   NNLARALF--DNSQLKLNWPTRQKICIGVARGLTFLHEESTIKIVHRDIKATNILLDKDL  663

Query  707   NPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSG  886
             N KISDFGLA+LD+  ++HISTRVAGTIGY APEYALWGYLT+KADVYSFGV ALEIV+G
Sbjct  664   NAKISDFGLARLDEGGRTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAG  723

Query  887   KNNMKFRPDENYVCLLDWALVL-QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPS  1063
             ++N  F+PD+NY CLLDWA  L Q+KGN+MEL+DP+LG+D+ KE+ L+M+++ALLCTNPS
Sbjct  724   RSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPS  783

Query  1064  PVLRPSMSTVVSMLEGN  1114
             P +RP MS V+SMLEG+
Sbjct  784   PAVRPVMSEVLSMLEGS  800



>emb|CDP06040.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   461 bits (1185),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 253/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIKAATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS Q
Sbjct  611   ELRALDLQTGYFTLRQIKAATNNFDPANKIGEGGFGPVYKGLLTDGAVIAVKQLSSKSRQ  670

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLV+LYGCC+E   LLL+YEY+ENN L  ALFG  +R L +D
Sbjct  671   GNREFVNEIGMISALQHPNLVRLYGCCIEGNQLLLIYEYLENNCLGRALFGRTERLLYLD  730

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  731   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  790

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  791   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  850

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL++L+DP LGSD   ++AL+M+ +ALLCTNPSP LRP+MS+ VSMLEG
Sbjct  851   AYVLQEQGNLLDLVDPSLGSDCPADEALRMINLALLCTNPSPTLRPTMSSAVSMLEG  907



>gb|KCW84087.1| hypothetical protein EUGRSUZ_B00978 [Eucalyptus grandis]
Length=623

 Score =   449 bits (1156),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 212/297 (71%), Positives = 256/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LD+  G FT  QIK AT+NFD  NKIGEGGFG VYKGTL +GT+IAVKQLSS+S Q
Sbjct  249   ELHGLDIQIGHFTLRQIKDATSNFDSVNKIGEGGFGPVYKGTLSNGTIIAVKQLSSRSKQ  308

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA ALFG +D+Q+++D
Sbjct  309   GNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDDQQIELD  368

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK ANVLLDKELN KISDFGLAKL++++ +
Sbjct  369   WATRKKICLGIARGLAYLHEESRLKIVHRDIKAANVLLDKELNAKISDFGLAKLNEEDNT  428

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ G+LT KADVYSFGVVALEIVSGK+N  +R  E    LLDW
Sbjct  429   HISTRIAGTIGYMAPEYAMRGHLTDKADVYSFGVVALEIVSGKSNTNYRSKEESFYLLDW  488

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A  LQE+G+++EL+DPRLGS + +E+A+++L +ALLCTNP+P LRP MS+VVSMLEG
Sbjct  489   AHGLQEQGHVLELMDPRLGSYYSEEEAMRILNLALLCTNPTPTLRPPMSSVVSMLEG  545



>ref|XP_010246510.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1011

 Score =   461 bits (1187),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/327 (67%), Positives = 268/327 (82%), Gaps = 4/327 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LD+ TG FT  QIKAATNNFD  NKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  640   DLRGLDMQTGSFTLRQIKAATNNFDSTNKIGEGGFGSVYKGHLSDGTIIAVKQLSSKSKQ  699

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYE+MENNSL++ALF  E  QLK+D
Sbjct  700   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEFMENNSLSHALFDPEKCQLKLD  759

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TRQ+IC+GIA+GLAFLHEES +K+VHRDIK  N+LLDK+LNPKI+DFGLAKL ++E +
Sbjct  760   WRTRQKICIGIARGLAFLHEESRLKIVHRDIKATNILLDKDLNPKIADFGLAKLYEEENT  819

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYA+ GYLT KADVYSFGVVALEIVSGK N  F+P E ++ LLDW
Sbjct  820   HISTRVAGTFGYMAPEYAMKGYLTNKADVYSFGVVALEIVSGKRNTSFKPQEEFIDLLDW  879

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+++G+L++L+DPRLG +F+K++A+KM+ VALLCTN    LRP+MS VV MLEG   
Sbjct  880   ALILKDQGSLLDLVDPRLGLEFNKDEAMKMINVALLCTNTCAPLRPTMSAVVGMLEGQAS  939

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEM  1189
             + E+ S+      E  F+ +  HY ++
Sbjct  940   VTEFVSDTSISSVEWRFKTMMNHYSQV  966



>ref|XP_006304798.1| hypothetical protein CARUB_v10012394mg [Capsella rubella]
 gb|EOA37696.1| hypothetical protein CARUB_v10012394mg [Capsella rubella]
Length=1034

 Score =   462 bits (1188),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 250/297 (84%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  640   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  699

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  700   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQKLHLD  759

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKLD+DE +
Sbjct  760   WPTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEDENT  819

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  820   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  879

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VV MLEG
Sbjct  880   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVKMLEG  936



>ref|XP_010675288.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Beta vulgaris subsp. vulgaris]
Length=1019

 Score =   461 bits (1187),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 255/301 (85%), Gaps = 2/301 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR L  GTG FT  QIKAAT++FD  NKIGEGGFG V+KG L D  VIAVKQLSSKS Q
Sbjct  639   ELRKL--GTGYFTLKQIKAATDDFDHRNKIGEGGFGPVFKGVLPDSKVIAVKQLSSKSKQ  696

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E K LLLVYEYMENNSLA ALFG E+++L++D
Sbjct  697   GNREFVNEIGMISALQHPNLVKLYGCCIEGKELLLVYEYMENNSLARALFGRENQKLQLD  756

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR  IC+GIAKGLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD+DE +
Sbjct  757   WQTRMSICLGIAKGLAYLHEESRLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEDENT  816

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSG +N  +RP E +V LLDW
Sbjct  817   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGTSNTSYRPKEEFVYLLDW  876

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GNL+EL+DP LGS + KE+AL++L +ALLCTNPSP LRPSMS+V+SM+EG   
Sbjct  877   AYVLQEQGNLLELVDPSLGSSYSKEEALRLLNIALLCTNPSPSLRPSMSSVMSMIEGQSP  936

Query  1121  I  1123
             +
Sbjct  937   V  937



>ref|XP_010064483.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1018

 Score =   461 bits (1186),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 215/301 (71%), Positives = 258/301 (86%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  LDL  G FT  QIK AT NFD  NKIGEGGFG VYKGTL +GT IAVKQLSSKS Q
Sbjct  642   ELYGLDLQIGYFTLRQIKVATGNFDSVNKIGEGGFGPVYKGTLSNGTTIAVKQLSSKSKQ  701

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREFLNEIG++S LQHPNLVKLYGCC+E   LL++YEY++NNSLA ALFG +++ +++D
Sbjct  702   GNREFLNEIGMVSALQHPNLVKLYGCCIEENQLLVIYEYLDNNSLARALFGRDEQLIELD  761

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDKELN KISDFGLAKLD++E +
Sbjct  762   WATRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKELNAKISDFGLAKLDEEENT  821

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HI+TR+AGT+GY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  + P+E +V LLDW
Sbjct  822   HINTRIAGTLGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYMPEEEFVHLLDW  881

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GN++EL+DPRLGSD+ +E+A++ML +ALLCTNPSP LRP MS+VVSMLEG   
Sbjct  882   AYVLQEQGNVLELVDPRLGSDYSEEEAMRMLNLALLCTNPSPTLRPPMSSVVSMLEGKSA  941

Query  1121  I  1123
             I
Sbjct  942   I  942



>gb|KHG25892.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Gossypium arboreum]
Length=619

 Score =   449 bits (1155),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 212/307 (69%), Positives = 256/307 (83%), Gaps = 0/307 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL T  F+  QIKAATNNFDVANKIGEGGFG VYKGTL DGTVIAVKQLS+KS Q
Sbjct  247   ELKGLDLQTSSFSLRQIKAATNNFDVANKIGEGGFGPVYKGTLADGTVIAVKQLSAKSKQ  306

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKL+GCC+E   LLL+YEYMENNSLA ALFG  D QLK+D
Sbjct  307   GNREFVNEIGMISALQHPHLVKLFGCCIEGNQLLLIYEYMENNSLARALFGPLDCQLKLD  366

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LNPKISDFGLAKLD+++ +
Sbjct  367   WPTRRKICIGIARGLAYLHEESRLKIVHRDIKATNVLLDKHLNPKISDFGLAKLDEEDNT  426

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYA+ GYLT KADVYSFG+V LEIVSG++N   RP E    LLDW
Sbjct  427   HISTRVAGTYGYMAPEYAMRGYLTDKADVYSFGIVILEIVSGRSNTNCRPKEESFYLLDW  486

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
               VL+E+GNL+ L+DPRLGS+++KE+ + M+ VA LCT+ +   RP+MS+VVSMLEG   
Sbjct  487   VHVLKEEGNLLGLVDPRLGSNYNKEEVMTMINVAFLCTDVNAATRPAMSSVVSMLEGKAS  546

Query  1121  ILEYKSN  1141
             + E++++
Sbjct  547   VQEFETD  553



>ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1011

 Score =   461 bits (1186),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 273/337 (81%), Gaps = 7/337 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  QIKAATNNFD ANKIGEGGFGSVYKG L DGT+IAVKQLSSKS Q
Sbjct  642   ELKGLDLQTGLFTLRQIKAATNNFDAANKIGEGGFGSVYKGVLSDGTIIAVKQLSSKSKQ  701

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHP+LVKLYGCC+E   LLL+YEYMENNSLA ALFG E+ QL++D
Sbjct  702   GNREFVTEIGMISALQHPHLVKLYGCCIEGNQLLLIYEYMENNSLARALFGPEECQLQLD  761

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD++  +
Sbjct  762   WPTRHRICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEYNT  821

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFGVVALEIVSG++N  +RP E  + LLD 
Sbjct  822   HISTRIAGTFGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGRSNTTYRPKEESIYLLDR  881

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL L+EKG+LM+++DPRLGSDF+KE+ + ML +ALLCT  S  +RP+MS+VVSMLEG   
Sbjct  882   ALSLKEKGSLMDIVDPRLGSDFNKEEVMAMLNIALLCTTISSAVRPAMSSVVSMLEGRTA  941

Query  1121  ILEYKSNIR----ELNFQAV*VHY---EEMSIGSSDS  1210
             + +  S+      +L  + +  HY   +E S+G S+S
Sbjct  942   VQDIVSDPSAPSDDLKLEEMKEHYRHIQEKSMGVSES  978



>ref|XP_006370084.1| hypothetical protein POPTR_0001s39390g [Populus trichocarpa]
 gb|ERP66653.1| hypothetical protein POPTR_0001s39390g [Populus trichocarpa]
Length=1053

 Score =   462 bits (1188),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/297 (74%), Positives = 255/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG F+  QIK ATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLS+KS Q
Sbjct  673   ELRALDLQTGYFSLRQIKHATNNFDPANKIGEGGFGPVYKGVLSDGSVIAVKQLSAKSKQ  732

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  733   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEHQIKLD  792

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  793   WQTRKKILLGIAKGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  852

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  853   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  912

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ K +AL+ML +ALLCTNPSP LRPSMS+ V MLEG
Sbjct  913   AYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPSMSSAVKMLEG  969



>ref|XP_007149544.1| hypothetical protein PHAVU_005G0791000g, partial [Phaseolus vulgaris]
 gb|ESW21538.1| hypothetical protein PHAVU_005G0791000g, partial [Phaseolus vulgaris]
Length=884

 Score =   457 bits (1176),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 249/297 (84%), Gaps = 0/297 (0%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             + L TG F+  QIKAAT NFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  524   IGLKTGYFSLRQIKAATKNFDPANKIGEGGFGPVYKGVLSDGAVIAVKQLSSKSKQGNRE  583

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLLVYEYMENNSLA ALFG E  ++++DW  R
Sbjct  584   FINEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYMENNSLARALFGKEHERMQLDWPRR  643

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIAKGLA+LHEES +K+VHRDIK  NVLLDK +  KISDFGLAKLD++E +HIST
Sbjct  644   MKICVGIAKGLAYLHEESRLKIVHRDIKATNVLLDKHMKAKISDFGLAKLDEEENTHIST  703

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLDWA VL
Sbjct  704   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVL  763

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGDI  1123
             QE+GNL++L+DP LGS +  E+A++ML++ALLCTNPSP LRP MS+VVSMLEG   I
Sbjct  764   QEQGNLLDLVDPSLGSKYSSEEAMRMLQLALLCTNPSPTLRPPMSSVVSMLEGKSPI  820



>ref|XP_006582117.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Glycine max]
Length=1012

 Score =   461 bits (1185),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 219/293 (75%), Positives = 253/293 (86%), Gaps = 0/293 (0%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             L+L TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG VIAVKQLSSKS QGNRE
Sbjct  646   LELKTGYFSLRQIKAATNNFDPANKIGEGGFGPVYKGVLSDGDVIAVKQLSSKSKQGNRE  705

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             F+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYMENNSLA ALFG  +++L + W TR
Sbjct  706   FVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYMENNSLARALFGEHEQKLHLYWPTR  765

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
              +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +HIST
Sbjct  766   MKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENTHIST  825

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             R+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N K+RP E +V LLDWA VL
Sbjct  826   RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVALEIVSGKSNTKYRPKEEFVYLLDWAYVL  885

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             QE+GNL+EL+DP LGS +  E+A++ML +ALLCTNPSP LRP+MS+VVSMLEG
Sbjct  886   QEQGNLLELVDPSLGSKYSPEEAMRMLSLALLCTNPSPTLRPTMSSVVSMLEG  938



>ref|XP_010552133.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Tarenaya hassleriana]
Length=1022

 Score =   461 bits (1186),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 221/297 (74%), Positives = 255/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATN FDVANKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  642   ELRGLDLQTGSFTLKQIKRATNTFDVANKIGEGGFGPVYKGVLSDGTTIAVKQLSSKSKQ  701

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GN+EF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG E+ +L++D
Sbjct  702   GNKEFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGPEEHRLQLD  761

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR++IC+GIAKGLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD++E +
Sbjct  762   WSTRKKICMGIAKGLAYLHEESRLKIVHRDIKATNVLLDKSLNAKISDFGLAKLDEEENT  821

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLD 
Sbjct  822   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDE  881

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+D  LGS + KE+A++ML +A+LCTNPSP LRPSMS+VVSMLEG
Sbjct  882   AYVLQEQGNLLELVDLNLGSHYSKEEAMRMLNLAILCTNPSPTLRPSMSSVVSMLEG  938



>gb|AAF78445.1|AC018748_24 Contains a weak similarity to disease resistance protein (cf-5) 
gene from Lycopersicon esculentum gb|AF053993 and contains 
multiple leucine rich PF|00560 repeats and protein kinase 
PF|00069 domain. EST gb|T04455 comes from this gene [Arabidopsis 
thaliana]
Length=979

 Score =   460 bits (1183),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  588   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  647

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  648   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  707

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR ++C+GIAKGLA+LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKLD++E +
Sbjct  708   WSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENT  767

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E ++ LLDW
Sbjct  768   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDW  827

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VVSML+G
Sbjct  828   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLQG  884



>ref|XP_010479903.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Camelina sativa]
Length=876

 Score =   457 bits (1175),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 249/297 (84%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  483   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  542

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  543   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  602

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +IC+GIAKGL +LHEES +K+VHRDIK  NVLLD  LN KISDFGLAKLD++E +
Sbjct  603   WPTRNKICLGIAKGLYYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENT  662

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  663   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDW  722

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VV MLEG
Sbjct  723   AYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVKMLEG  779



>gb|KDO77959.1| hypothetical protein CISIN_1g045835mg, partial [Citrus sinensis]
Length=511

 Score =   445 bits (1144),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 212/292 (73%), Positives = 247/292 (85%), Gaps = 2/292 (1%)
 Frame = +2

Query  224   LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQG  403
             +++ DL T  FT  QIKAATNNFD A KIGEGGFG VYKG L DGT+IAVKQLSSKS QG
Sbjct  220   MKESDLQTISFTLKQIKAATNNFDSAKKIGEGGFGPVYKGQLADGTIIAVKQLSSKSRQG  279

Query  404   NREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDW  583
             NREFLNEI +ISCLQHPNLVK++GCCVE   LLLVYEYMENNSLA ALFG E+ +L++DW
Sbjct  280   NREFLNEIAMISCLQHPNLVKIHGCCVEGDQLLLVYEYMENNSLACALFGRENCELELDW  339

Query  584   ATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSH  763
              TRQ+IC+GIA+GLAFLHEES  K+VHRDIK  NVLLD++LNPKISDFGLAKLD+ +K+H
Sbjct  340   PTRQKICLGIARGLAFLHEESRFKIVHRDIKATNVLLDRDLNPKISDFGLAKLDEGDKTH  399

Query  764   ISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENY--VCLLD  937
             ISTR+AGTIGY APEYALWGYLT+KADVYSFG+VALEIVSGKNNM + P   +   CLLD
Sbjct  400   ISTRIAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVSGKNNMSYAPALEFDCTCLLD  459

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTV  1093
             WA  LQ+ G L+EL+D RLGS + KE+A +M++V+LLCTN SP LRP+MS V
Sbjct  460   WACHLQQDGKLVELVDERLGSKYKKEEAERMIKVSLLCTNASPSLRPTMSEV  511



>ref|XP_008451726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Cucumis melo]
Length=927

 Score =   458 bits (1179),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/319 (69%), Positives = 265/319 (83%), Gaps = 4/319 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL  +DL TG FT  QIKAATNNFD  +KIGEGGFG VYKG L DG +IAVKQLSSKS Q
Sbjct  540   ELSGIDLQTGHFTLKQIKAATNNFDPKSKIGEGGFGPVYKGVLSDGALIAVKQLSSKSKQ  599

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             G+REF+ EIG+IS LQHPNLVKLYGCCVE   LLLVYEYMENNSLA ALFG E+++L +D
Sbjct  600   GSREFVTEIGMISALQHPNLVKLYGCCVEGNQLLLVYEYMENNSLARALFGREEQRLHLD  659

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+ IA+GLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  660   WRTRKKICLEIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  719

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  720   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  779

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL+E+GNL+EL+DP LGS++  E+A++ML VALLCTNPSP LRP+MS+VVSMLEG   
Sbjct  780   AYVLEEQGNLLELVDPDLGSNYSSEEAMRMLNVALLCTNPSPTLRPAMSSVVSMLEGKIA  839

Query  1112  -NGDILEYKSNIRELNFQA  1165
                 I++  S+ ++  F+A
Sbjct  840   VQAPIIKRTSSGQDPRFRA  858



>emb|CBI30752.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   445 bits (1144),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 224/327 (69%), Positives = 271/327 (83%), Gaps = 4/327 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG+FT  QIKAATNNF+ ANKIGEGGFG VYKG L +GT+IAVKQLSSKS Q
Sbjct  132   DLRRLDLQTGLFTLRQIKAATNNFNAANKIGEGGFGPVYKGQLSNGTLIAVKQLSSKSRQ  191

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIGIIS LQHPNLVKLYGCC+ER  LLLVYEYMENNSLA ALFG+E     +D
Sbjct  192   GNREFVNEIGIISGLQHPNLVKLYGCCIERTQLLLVYEYMENNSLARALFGAETSVPILD  251

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             WATRQ+IC+G+A+GLAFLHEEST+K+VHRDIK ANVLLD +L  KISDFGLAKL+++E +
Sbjct  252   WATRQKICIGLARGLAFLHEESTLKIVHRDIKAANVLLDGDLKAKISDFGLAKLNEEENT  311

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYALWG+LT KAD+YSFGVVALEIVSGKNN   +P+   VCLLD 
Sbjct  312   HISTRIAGTRGYMAPEYALWGHLTDKADIYSFGVVALEIVSGKNNSSRKPENECVCLLDR  371

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A  LQ+KG+LME++DP+LGS+F++++A +M++VA+LCTN SP LRP MS VVSMLEG   
Sbjct  372   AFALQQKGSLMEIVDPKLGSEFNRDEAERMIKVAILCTNASPTLRPIMSAVVSMLEGQTI  431

Query  1121  ILEYKSNIR----ELNFQAV*VHYEEM  1189
             + E  S+       LNF+++  +++ M
Sbjct  432   VPEVISDASMDEDYLNFKSLGDYHKRM  458



>ref|XP_010036440.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Eucalyptus grandis]
Length=714

 Score =   452 bits (1162),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ L L  G+FT  QIKAATNNFD+ANKIGEGGFGSVYKG L DGT IAVKQLSSKS Q
Sbjct  349   DLKGLALQIGLFTLRQIKAATNNFDIANKIGEGGFGSVYKGFLSDGTTIAVKQLSSKSQQ  408

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GN EFL EIG IS LQHP+LVKLYGCC+E   LLLVYEYMENNSLA ALFG E+ QLK+D
Sbjct  409   GNNEFLTEIGTISALQHPHLVKLYGCCIEGNQLLLVYEYMENNSLARALFGPEEFQLKLD  468

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++K+
Sbjct  469   WWTRHKICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDKT  528

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HIST++AGT GY APEYA+ GYLT KAD+YSFG+VALE+VSG++N   +  E    LLDW
Sbjct  529   HISTKIAGTYGYMAPEYAMHGYLTDKADIYSFGIVALEVVSGQSNTSSQKTEECFILLDW  588

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A  L+E+GNL+EL+DPRLGS FDKE+AL +++VAL+CTN +P LRP MS+VVSMLEG
Sbjct  589   AHFLKERGNLIELVDPRLGSHFDKEEALALIKVALVCTNVTPALRPPMSSVVSMLEG  645



>ref|XP_007213901.1| hypothetical protein PRUPE_ppa003884mg [Prunus persica]
 gb|EMJ15100.1| hypothetical protein PRUPE_ppa003884mg [Prunus persica]
Length=542

 Score =   446 bits (1147),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 219/340 (64%), Positives = 265/340 (78%), Gaps = 3/340 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L+ +DL TG F+F Q+KAATNNFD ANKIGEGGFGSVYKG L DGTVIAVKQLSSKS Q
Sbjct  172   DLKGVDLQTGKFSFRQLKAATNNFDKANKIGEGGFGSVYKGLLSDGTVIAVKQLSSKSKQ  231

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKL+GCC+E   LLLVYEYMENNSLA +LFG E+ QLK+D
Sbjct  232   GNREFVNEIGMISALQHPHLVKLHGCCIEGNQLLLVYEYMENNSLARSLFGPEESQLKLD  291

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLA+LHEES +KVVHRDIK  NVLLDK L PKISDFGLAKLD+++ +
Sbjct  292   WPTRHKICVGIARGLAYLHEESRLKVVHRDIKATNVLLDKNLTPKISDFGLAKLDEEDNT  351

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGT GY APEYA+ GYLT KADVYSFG++ LEIVSG+NN  +R  E    LLDW
Sbjct  352   HISTRIAGTYGYMAPEYAMRGYLTDKADVYSFGILVLEIVSGRNNTTYRAKEKSFYLLDW  411

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A +L+ +G LM+L+DPRLGSDF+KE+ +  + VALLC N +  +RP+MS+VVSMLEG   
Sbjct  412   AQLLKGQGRLMDLVDPRLGSDFNKEEMMLTINVALLCCNVTSTVRPTMSSVVSMLEGRAA  471

Query  1121  ILEYKS--NIRELNFQAV*VHYEEMSIGSSDSPNKVDICS  1234
             + E  S  N      +A+  H+E  S G     ++    S
Sbjct  472   VQELVSDPNASTNEIEAMRKHFES-SFGRKTGESQTQTAS  510



>ref|XP_006384080.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61877.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=462

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 219/307 (71%), Positives = 249/307 (81%), Gaps = 2/307 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +L  LDL TG FT  Q+ AATNNFD ANKIGEGGFGSVYKG L DGT IAVKQLS KS+Q
Sbjct  103   DLMGLDLKTGSFTLRQLGAATNNFDSANKIGEGGFGSVYKGELSDGTAIAVKQLSPKSTQ  162

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS L+HPNLVKL GCC+E   LLLVYEYMENN LA ALF  E   L +D
Sbjct  163   GNREFVNEIGMISGLKHPNLVKLCGCCIEGDQLLLVYEYMENNCLARALF--ETSALMLD  220

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR +ICVGIA+GLAFLHE S I++VHRDIK  NVLLDK+LN KISDFGLAKL++ E +
Sbjct  221   WPTRFKICVGIARGLAFLHEGSAIRIVHRDIKGTNVLLDKDLNAKISDFGLAKLNEAENT  280

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGTIGY APEYALWGYL+ KADVYSFGVVALEIVSG++N  + P    VCLLDW
Sbjct  281   HISTRVAGTIGYMAPEYALWGYLSDKADVYSFGVVALEIVSGRSNSSYNPTNESVCLLDW  340

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQ++GNLM L+DP+L S+F+KE+A KM++VALLC N SP LRPSM  VVSMLEG   
Sbjct  341   AFVLQKRGNLMALVDPKLRSEFNKEEAEKMIKVALLCANASPSLRPSMPAVVSMLEGQTS  400

Query  1121  ILEYKSN  1141
             I E  S+
Sbjct  401   IQEVISD  407



>ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
 gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa]
Length=1028

 Score =   461 bits (1185),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/324 (69%), Positives = 267/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  Q+KAATNNFD  NK+GEGGFGSVYKG+L DGTVIAVK LSSKS Q
Sbjct  661   ELKGLDLQTGLFTLRQMKAATNNFDAENKVGEGGFGSVYKGSLSDGTVIAVKLLSSKSKQ  720

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR-QLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   L++VYEYMENN L+ AL G E + ++K+
Sbjct  721   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLMIVYEYMENNCLSRALLGKESKFRMKL  780

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+AKGL +LHEES IK+VHRDIKT+NVLLDKELN KISDFGLAKL++D+ 
Sbjct  781   DWPTRQKICLGVAKGLMYLHEESIIKIVHRDIKTSNVLLDKELNAKISDFGLAKLNEDDD  840

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  841   THISTRIAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  900

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VLQE+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  901   WAYVLQERGSLLELVDPELGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRT  960

Query  1118  DILEYKSNIRELNFQAV*VHYEEM  1189
              + +    + +  F A+   Y+ +
Sbjct  961   PVQDL---LSDPGFSAINTKYKAI  981



>ref|XP_003634705.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Vitis vinifera]
Length=1014

 Score =   460 bits (1184),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 272/331 (82%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR+L + TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLSSKS Q
Sbjct  636   ELRELGMQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSVIAVKQLSSKSKQ  695

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENN LA ALFGSE+++L +D
Sbjct  696   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNCLARALFGSEEQRLNLD  755

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +
Sbjct  756   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEDENT  815

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  816   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  875

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GNL+EL+DP LGS++ +E+ ++ML +ALL TN SP LRPSMS+VVSML+G   
Sbjct  876   AYVLHEQGNLLELVDPSLGSNYSEEEVMRMLNLALLSTNQSPTLRPSMSSVVSMLDGKIA  935

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  +++ S   ++ F+A    +E++S+ S
Sbjct  936   VQAPTIKHDSMNPDMRFKA----FEKLSLDS  962



>ref|XP_010665669.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Beta vulgaris subsp. vulgaris]
Length=858

 Score =   456 bits (1173),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 264/317 (83%), Gaps = 5/317 (2%)
 Frame = +2

Query  173   ILYCTRNYS*SNCSCTE--LRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGT  346
             I  C R +   + +  E  L  LDL TG+FTF QIKAATNNF   +KIGEGGFG+VY G 
Sbjct  482   IFICWRKHRSKDMASREQVLAGLDLQTGLFTFRQIKAATNNFSADSKIGEGGFGTVYLGI  541

Query  347   LLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMEN  526
             LLDGT IAVK LSS+S QGN+EF+NEIG+IS L+HPNLV+LYGCCVE   L L+YEYMEN
Sbjct  542   LLDGTHIAVKLLSSRSKQGNQEFVNEIGMISGLRHPNLVRLYGCCVEGSQLFLIYEYMEN  601

Query  527   NSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKEL  706
             N+LA ALF  ++ QLK++W TRQ+IC+G+A+GL FLHEESTIK+VHRDIK  N+LLDK+L
Sbjct  602   NNLARALF--DNSQLKLNWPTRQKICIGVARGLTFLHEESTIKIVHRDIKATNILLDKDL  659

Query  707   NPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSG  886
             N KISDFGLA+LD+  ++HISTRVAGTIGY APEYALWGYLT+KADVYSFGV ALEIV+G
Sbjct  660   NAKISDFGLARLDEGGRTHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGVFALEIVAG  719

Query  887   KNNMKFRPDENYVCLLDWALVL-QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPS  1063
             ++N  F+PD+NY CLLDWA  L Q+KGN+MEL+DP+LG+D+ KE+ L+M+++ALLCTNPS
Sbjct  720   RSNTNFKPDDNYFCLLDWAFALQQQKGNIMELVDPKLGTDYKKEEVLRMIKIALLCTNPS  779

Query  1064  PVLRPSMSTVVSMLEGN  1114
             P +RP MS V+SMLEG+
Sbjct  780   PAVRPVMSEVLSMLEGS  796



>ref|XP_002316847.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE97459.1| receptor-like protein kinase [Populus trichocarpa]
Length=1015

 Score =   460 bits (1184),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 256/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             +LR LDL TG F+  QIK ATNNFD ANKIGEGGFG VYKG L DGT+IAVKQLSSKS Q
Sbjct  650   DLRALDLQTGYFSLRQIKNATNNFDPANKIGEGGFGPVYKGVLSDGTIIAVKQLSSKSKQ  709

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LL+VYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  710   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLVVYEYLENNSLARALFGRDEHQIKMD  769

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  770   WQTRKKILLGIAKGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  829

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  830   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  889

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ +E+A++ML +ALLCTNPSP LRP MS+ VSM+EG
Sbjct  890   AYVLQEQGNLLELVDPNLGSNYSEEEAMRMLNLALLCTNPSPSLRPLMSSAVSMIEG  946



>ref|XP_008792302.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Phoenix dactylifera]
Length=1018

 Score =   460 bits (1184),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 227/352 (64%), Positives = 278/352 (79%), Gaps = 12/352 (3%)
 Frame = +2

Query  161   IPKLILYCTRNYS*SNCSCTELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYK  340
             I  L+  C R     N   +ELR L+L TG FT  QIK AT NFD  NKIGEGGFGSVY+
Sbjct  635   IITLLWICIRRKKTEN---SELRGLELQTGYFTLKQIKTATKNFDPENKIGEGGFGSVYR  691

Query  341   GTLLDGTVIAVKQLSSKSSQGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYM  520
             G L DG+ IAVKQLSSKS QGNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEYM
Sbjct  692   GVLPDGSEIAVKQLSSKSKQGNREFINEIGMISALQHPNLVKLYGCCMEGNQLLLIYEYM  751

Query  521   ENNSLANALFGSEDRQLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDK  700
             ENNSLA ALFG ++ +LK+DW TR++IC+GIA+GLAFLHEES IK+VHRDIK  N+LLDK
Sbjct  752   ENNSLARALFGPQEHRLKLDWRTRRKICLGIARGLAFLHEESRIKIVHRDIKGTNILLDK  811

Query  701   ELNPKISDFGLAKLDDDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIV  880
             +L+ KISDFGLA+LD++E +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIV
Sbjct  812   DLDAKISDFGLARLDEEENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVTLEIV  871

Query  881   SGKNNMKFRPDENYVCLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNP  1060
             SG +N  +RP E++V LLDWA VLQE+G+L+EL+D  LGS++ KE+AL+ML +AL+CTNP
Sbjct  872   SGMSNTNYRPKEDFVYLLDWAYVLQEQGSLLELVDTNLGSNYSKEEALQMLNLALVCTNP  931

Query  1061  SPVLRPSMSTVVSMLEGNG-----DILEYKSNIRELNFQAV*VHYEEMSIGS  1201
             SP LRP+MSTVVSML+G       +++   S   +L F++    +E+MS  S
Sbjct  932   SPTLRPTMSTVVSMLDGKTPVRVPEVMRSISKAEDLRFKS----FEKMSNAS  979



>ref|XP_010644094.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Vitis vinifera]
Length=1017

 Score =   460 bits (1184),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 221/331 (67%), Positives = 271/331 (82%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR+L + TG F+  QIKAATNNFD ANKIGEGGFG VYKG L DG+V AVKQLSSKS Q
Sbjct  633   ELRELGMQTGYFSLRQIKAATNNFDSANKIGEGGFGPVYKGVLSDGSVSAVKQLSSKSKQ  692

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCC+E   LLL+YEY+ENNSLA ALFGS++++L +D
Sbjct  693   GNREFVNEIGMISALQHPNLVKLYGCCIEGNQLLLIYEYLENNSLARALFGSDEQRLNLD  752

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +
Sbjct  753   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKNLNAKISDFGLAKLDEDENT  812

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA  GYLT KADVYSFG+VALEIVSGK+N  +RP E +V LLDW
Sbjct  813   HISTRIAGTIGYMAPEYATRGYLTDKADVYSFGIVALEIVSGKSNTNYRPKEEFVYLLDW  872

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GNL+EL+DP LGS++ +E+ ++ML +ALLCTN SP LRP MS+VVSML+G   
Sbjct  873   AYVLHEQGNLLELVDPSLGSNYSEEEVMRMLNLALLCTNQSPTLRPPMSSVVSMLDGKIA  932

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  +++ S   ++ F+A    +E++S+ S
Sbjct  933   VQAPTIKHDSMNPDMRFKA----FEKLSLDS  959



>gb|KCW84079.1| hypothetical protein EUGRSUZ_B00960 [Eucalyptus grandis]
Length=579

 Score =   447 bits (1149),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 209/292 (72%), Positives = 254/292 (87%), Gaps = 0/292 (0%)
 Frame = +2

Query  218   TELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSS  397
             +EL  LD+  G FT  QIKAAT+NFD  NKIGEGGFG VYKGTL +GT+IAVKQLSS+S 
Sbjct  288   SELHGLDIQIGHFTLRQIKAATSNFDSVNKIGEGGFGPVYKGTLSNGTIIAVKQLSSRSK  347

Query  398   QGNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKI  577
             QGNREFLNEIG+IS LQHPNLVKLYGCC+E   LLLVYEY+ENNSLA ALFG +D+Q+++
Sbjct  348   QGNREFLNEIGMISALQHPNLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDDQQIEL  407

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DWATR++IC+GIA+GLA+LHEES +K+VHRDIK ANVLLDKELNPKISDFGLAKL++++ 
Sbjct  408   DWATRKKICLGIARGLAYLHEESRLKIVHRDIKAANVLLDKELNPKISDFGLAKLNEEDN  467

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ G+LT KADVYSFGVVALE VSGK+N  +R  E  V LLD
Sbjct  468   THISTRIAGTIGYMAPEYAMRGHLTDKADVYSFGVVALETVSGKSNTNYRSKEESVYLLD  527

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTV  1093
             WA  LQE+G+++EL+DPRLGS++ +E+A++ML +ALLCTNP+P LRP MS+V
Sbjct  528   WAHGLQEQGHVLELMDPRLGSNYSEEEAMRMLNLALLCTNPTPTLRPPMSSV  579



>ref|XP_006370091.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
 gb|ERP66660.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
Length=994

 Score =   459 bits (1182),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 254/297 (86%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG  +  QIK ATNNFD ANKIGEGGFG VYKG L DG+VIAVKQLS+KS Q
Sbjct  614   ELRALDLQTGYLSLRQIKHATNNFDPANKIGEGGFGPVYKGMLSDGSVIAVKQLSAKSKQ  673

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHP+LVKLYGCC+E   LLLVYEY+ENNSLA ALFG ++ Q+K+D
Sbjct  674   GNREFVNEIGMISALQHPHLVKLYGCCIEGNQLLLVYEYLENNSLARALFGRDEHQIKLD  733

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++I +GIAKGLA+LHEES +K+VHRDIK  NVLLDK+LN KISDFGLAKLD++E +
Sbjct  734   WQTRKKILLGIAKGLAYLHEESRLKIVHRDIKATNVLLDKDLNAKISDFGLAKLDEEENT  793

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E +V LLDW
Sbjct  794   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVVLEIVSGKSNTNYRPKEEFVYLLDW  853

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+GNL+EL+DP LGS++ K +AL+ML +ALLCTNPSP LRPSMS+ V MLEG
Sbjct  854   AYVLQEQGNLLELVDPSLGSNYSKTEALRMLNLALLCTNPSPTLRPSMSSAVKMLEG  910



>ref|XP_011010608.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1029

 Score =   460 bits (1184),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/324 (69%), Positives = 267/324 (82%), Gaps = 4/324 (1%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG+FT  Q+KAATNNFD  NK+GEGGFGSVYKG+L DGTVIAVK LSSKS Q
Sbjct  662   ELKGLDLQTGLFTLRQMKAATNNFDAENKVGEGGFGSVYKGSLSDGTVIAVKLLSSKSKQ  721

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDR-QLKI  577
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   L++VYEYMENN L+ AL G E + ++K+
Sbjct  722   GNREFVNEIGMISALQHPNLVKLYGCCVEGNQLMIVYEYMENNCLSRALLGKESKLRMKL  781

Query  578   DWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEK  757
             DW TRQ+IC+G+AKGL +LHEES IK+VHRDIKT+NVLLDKELN KISDFGLAKL++D+ 
Sbjct  782   DWPTRQKICLGVAKGLMYLHEESIIKIVHRDIKTSNVLLDKELNAKISDFGLAKLNEDDD  841

Query  758   SHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLD  937
             +HISTR+AGTIGY APEYA+ GYLT KADVYSFGVVALEIVSGK+N  +RP E +V LLD
Sbjct  842   THISTRIAGTIGYMAPEYAMRGYLTNKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLD  901

Query  938   WALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG  1117
             WA VLQE+G+L+EL+DP LGS++  E+A+ ML VALLCTN SP LRP+MS VVSMLEG  
Sbjct  902   WAYVLQERGSLLELVDPELGSEYSSEEAMVMLNVALLCTNASPTLRPTMSQVVSMLEGRT  961

Query  1118  DILEYKSNIRELNFQAV*VHYEEM  1189
              + +  S   +  F A+   Y+ +
Sbjct  962   PVQDLLS---DPGFSAINTKYKAI  982



>ref|XP_002891752.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68011.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   460 bits (1184),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 217/297 (73%), Positives = 252/297 (85%), Gaps = 0/297 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR LDL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DG  IAVKQLSSKS Q
Sbjct  646   ELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQ  705

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFG+E ++L +D
Sbjct  706   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLD  765

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W+TR +IC+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  766   WSTRNKICLGIAKGLAYLHEESRLKIVHRDIKATNVLLDQSLNAKISDFGLAKLDEEENT  825

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSGK+N  +RP E ++ LLDW
Sbjct  826   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLDW  885

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG  1111
             A VLQE+G+L+EL+DP LG+ F K++A++ML +ALLCTNPSP LRP MS+VV MLEG
Sbjct  886   AYVLQEQGSLLELMDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVRMLEG  942



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score =   458 bits (1179),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 273/339 (81%), Gaps = 9/339 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  598   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  657

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-----SEDR  565
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG     SE  
Sbjct  658   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGNHRAGSETS  717

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DW TR +ICVGIA+GLAFLHE S I++VHRDIK+ N+LLDK+LN KISDFGLAKL+
Sbjct  718   ALMLDWPTRYKICVGIARGLAFLHEGSAIRIVHRDIKSTNILLDKDLNAKISDFGLAKLN  777

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             ++E +HISTRVAGT GY APEYALWG+LT KADVYSFGVVALEIVSGK+N  +RP+   V
Sbjct  778   EEENTHISTRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENV  837

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
             CLLDWA VLQ+K NLME++DP+L S+F+KE+A +M++ ALLCTN SP +RP+MS VVSML
Sbjct  838   CLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSML  897

Query  1106  EGNGDILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             EG   I E  S+      EL+ + V  HY++++  S +S
Sbjct  898   EGQTSIPEVTSDPSIYGDELHSKRVKGHYQQVTDQSLNS  936



>ref|XP_010644093.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X3 [Vitis vinifera]
Length=1015

 Score =   460 bits (1183),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 224/331 (68%), Positives = 271/331 (82%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR+L + TG F+  QIKAATNNFD A+KIGEGGFG VYKG L DG+VIAVKQLSSKS Q
Sbjct  631   ELRELGMQTGYFSLRQIKAATNNFDSASKIGEGGFGPVYKGVLSDGSVIAVKQLSSKSKQ  690

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKLYGCCVE   LLL+YEY+ENNSLA ALFGSE+++L +D
Sbjct  691   GNREFVNEIGLISALQHPNLVKLYGCCVEGNQLLLIYEYLENNSLARALFGSEEQRLNLD  750

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR++IC+GIA+GLA+LHEES +K+VHRDIK  NVLLDK LN KISDFGLAKLD+DE +
Sbjct  751   WPTRKKICLGIARGLAYLHEESRLKIVHRDIKATNVLLDKYLNAKISDFGLAKLDEDENT  810

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA  GYLT KADVYSFGVVALEIVSGK+N  +RP +  V LLDW
Sbjct  811   HISTRIAGTIGYMAPEYATRGYLTDKADVYSFGVVALEIVSGKSNANYRPKQESVYLLDW  870

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEG---  1111
             A VL E+GNL+EL+DP LGS++ +E+ + ML +ALLCTN SP LRPSMS+VVSML+G   
Sbjct  871   AYVLHEQGNLLELVDPSLGSNYSEEEVMGMLNLALLCTNQSPTLRPSMSSVVSMLDGKIA  930

Query  1112  -NGDILEYKSNIRELNFQAV*VHYEEMSIGS  1201
                  +++ S   ++ F+A    +E++S+ S
Sbjct  931   VQAPTIKHDSMNPDMRFKA----FEKLSLDS  957



>gb|KDO42386.1| hypothetical protein CISIN_1g0041552mg, partial [Citrus sinensis]
Length=500

 Score =   444 bits (1141),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 224/327 (69%), Positives = 265/327 (81%), Gaps = 6/327 (2%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR +DL TG FT  QIKAATNNF   NKIGEGGFG VYKG + DGTV+AVKQLSSKS Q
Sbjct  129   ELRGVDLHTGSFTLRQIKAATNNFAPDNKIGEGGFGPVYKGHMADGTVVAVKQLSSKSKQ  188

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+NEIG+IS LQHPNLVKL+GCC+E   LLL+YEYMENNSLA ALFG E  +LK+D
Sbjct  189   GNREFVNEIGMISALQHPNLVKLHGCCIEGNQLLLIYEYMENNSLARALFGPEAHRLKLD  248

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR RICVGIA+GLA+LHEES +K+VHRDIK  NVLLDK+LNPKISDFGLAKLD+++ +
Sbjct  249   WPTRHRICVGIARGLAYLHEESRLKIVHRDIKATNVLLDKDLNPKISDFGLAKLDEEDNT  308

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTRVAGT GY APEYA+ GYLT KADVYSFG+VALEIVSG++N   +P E+   LLDW
Sbjct  309   HISTRVAGTFGYMAPEYAMRGYLTDKADVYSFGIVALEIVSGRSNSSCKPKEDIFYLLDW  368

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             AL+L+ +GNLMEL+D RLGS+FDKEQ + M+ VALLCT+ S   RPSMS+VVSMLEG  D
Sbjct  369   ALILKAQGNLMELVDKRLGSNFDKEQVMVMINVALLCTDVSSTSRPSMSSVVSMLEGRAD  428

Query  1121  ILEY------KSNIRELNFQAV*VHYE  1183
             + ++       SNI +   +A+  +YE
Sbjct  429   VQDFVPDSSVVSNIDKTKSEAIRNYYE  455



>ref|XP_008225247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Prunus mume]
Length=938

 Score =   457 bits (1177),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 266/316 (84%), Gaps = 5/316 (2%)
 Frame = +2

Query  233   LDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQGNRE  412
             LD  TG FT  Q+KAATN+FD ANKIGEGGFG VYKG L DGTVIAVKQLSSKS QGNRE
Sbjct  578   LDGQTGTFTLKQLKAATNDFDSANKIGEGGFGPVYKGQLPDGTVIAVKQLSSKSRQGNRE  637

Query  413   FLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKIDWATR  592
             FLNE+G+ISCLQHPNLVKL+GCC++   LLLVYEYMENN+LA AL G E+  LK+DW TR
Sbjct  638   FLNEMGMISCLQHPNLVKLHGCCIDGGQLLLVYEYMENNNLARALLGREN-HLKLDWPTR  696

Query  593   QRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKSHIST  772
             + IC+GIA+GLAFLHEES +K+VHRD+K  NVLLD++LNPKISDFGLAKLD++EK+H+ST
Sbjct  697   RNICIGIARGLAFLHEESVLKIVHRDVKATNVLLDRDLNPKISDFGLAKLDEEEKTHMST  756

Query  773   RVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDWALVL  952
             RVAGTIGY APEYALWG+LT+KADVYSFGVVALEI+SGKNN  + P +++VCLLDWA  L
Sbjct  757   RVAGTIGYMAPEYALWGHLTYKADVYSFGVVALEIISGKNNNNYIPSDDWVCLLDWACHL  816

Query  953   QEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNG---DI  1123
             Q+ GNL+EL+D +LGS+FD+++A  M++VAL+CTN S  LRPSMS VVSMLEG     D+
Sbjct  817   QQTGNLLELVDEKLGSEFDQKEAEIMVKVALICTNASASLRPSMSEVVSMLEGQTLVPDV  876

Query  1124  LEYKSNIRE-LNFQAV  1168
             +   S  RE L F+A+
Sbjct  877   IPEPSTYREDLRFKAM  892



>gb|KFK35730.1| hypothetical protein AALP_AA4G029200 [Arabis alpina]
Length=1032

 Score =   460 bits (1183),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 218/301 (72%), Positives = 253/301 (84%), Gaps = 0/301 (0%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             ELR +DL TG FT  QIK ATNNFD  NKIGEGGFG VYKG L DGT IAVKQLSSKS Q
Sbjct  643   ELRGMDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGTTIAVKQLSSKSKQ  702

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFGSEDRQLKID  580
             GNREF+ EIG+IS LQHPNLVKLYGCC+E K LLLVYEY+ENNSLA ALFGSE ++L +D
Sbjct  703   GNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGSEKQRLHLD  762

Query  581   WATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLDDDEKS  760
             W TR ++C+GIAKGLA+LHEES +K+VHRDIK  NVLLD+ LN KISDFGLAKLD++E +
Sbjct  763   WPTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDQALNAKISDFGLAKLDEEENT  822

Query  761   HISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYVCLLDW  940
             HISTR+AGTIGY APEYA+ GYLT KADVYSFGVV LEIVSG +N  +RP E +V LLDW
Sbjct  823   HISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGTSNTNYRPKEEFVYLLDW  882

Query  941   ALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSMLEGNGD  1120
             A VLQE+GNL+EL+D  LG++F K++A +ML++ALLCTNPSP LRP MS+VVSMLEG   
Sbjct  883   AYVLQEQGNLLELVDMDLGTNFSKKEAKRMLDIALLCTNPSPTLRPPMSSVVSMLEGKSK  942

Query  1121  I  1123
             +
Sbjct  943   V  943



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score =   458 bits (1179),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 273/339 (81%), Gaps = 9/339 (3%)
 Frame = +2

Query  221   ELRDLDLGTGMFTFTQIKAATNNFDVANKIGEGGFGSVYKGTLLDGTVIAVKQLSSKSSQ  400
             EL+ LDL TG FT  Q+KAAT+NF+  NKIGEGGFGSVYKG L DGT+IAVKQLS KS Q
Sbjct  602   ELKGLDLKTGSFTLRQLKAATDNFNSENKIGEGGFGSVYKGELADGTIIAVKQLSPKSRQ  661

Query  401   GNREFLNEIGIISCLQHPNLVKLYGCCVERKPLLLVYEYMENNSLANALFG-----SEDR  565
             GNREF+NEIG+ISCLQHPNLV+LYGCC+E   LLLVYEYMENNSL+ ALFG     SE  
Sbjct  662   GNREFVNEIGMISCLQHPNLVRLYGCCIEGDQLLLVYEYMENNSLSRALFGNHRAGSETS  721

Query  566   QLKIDWATRQRICVGIAKGLAFLHEESTIKVVHRDIKTANVLLDKELNPKISDFGLAKLD  745
              L +DW TR +ICVGIA+GLAFLHE S I++VHRDIK+ N+LLDK+LN KISDFGLAKL+
Sbjct  722   ALMLDWPTRYKICVGIARGLAFLHEGSAIRIVHRDIKSTNILLDKDLNAKISDFGLAKLN  781

Query  746   DDEKSHISTRVAGTIGYTAPEYALWGYLTFKADVYSFGVVALEIVSGKNNMKFRPDENYV  925
             ++E +HISTRVAGT GY APEYALWG+LT KADVYSFGVVALEIVSGK+N  +RP+   V
Sbjct  782   EEENTHISTRVAGTRGYIAPEYALWGHLTDKADVYSFGVVALEIVSGKSNSIYRPENENV  841

Query  926   CLLDWALVLQEKGNLMELIDPRLGSDFDKEQALKMLEVALLCTNPSPVLRPSMSTVVSML  1105
             CLLDWA VLQ+K NLME++DP+L S+F+KE+A +M++ ALLCTN SP +RP+MS VVSML
Sbjct  842   CLLDWAHVLQKKENLMEIVDPKLQSEFNKEEAERMIKAALLCTNASPSIRPAMSEVVSML  901

Query  1106  EGNGDILEYKSNIR----ELNFQAV*VHYEEMSIGSSDS  1210
             EG   I E  S+      EL+ + V  HY++++  S +S
Sbjct  902   EGQTSIPEVTSDPSIYGDELHSKRVKGHYQQVTDQSLNS  940



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3792526190046