BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25827_g14_i2 len=230 path=[11870:0-53 11924:54-134 18945:135-159
25096:160-187 24917:188-199 12563:200-204 12568:205-229]

Length=230
                                                                      Score     E

gb|KHF98741.1|  hypothetical protein F383_14220                         120   4e-32   
ref|XP_007213704.1|  hypothetical protein PRUPE_ppa000741mg             127   9e-32   
ref|XP_008245181.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    127   1e-31   
ref|XP_007214558.1|  hypothetical protein PRUPE_ppa000742mg             127   1e-31   
gb|KHG06920.1|  hypothetical protein F383_33692                         118   2e-31   
ref|XP_008225419.1|  PREDICTED: probable leucine-rich repeat rece...    125   3e-31   
ref|XP_004296291.1|  PREDICTED: probable leucine-rich repeat rece...    125   3e-31   
ref|XP_008347521.1|  PREDICTED: probable leucine-rich repeat rece...    125   4e-31   
ref|XP_010088635.1|  putative LRR receptor-like serine/threonine-...    122   5e-31   
ref|XP_010655559.1|  PREDICTED: probable LRR receptor-like serine...    124   1e-30   
ref|XP_010655558.1|  PREDICTED: probable LRR receptor-like serine...    124   1e-30   
ref|XP_008349229.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-30   
emb|CBI30745.3|  unnamed protein product                                124   3e-30   
ref|XP_008345927.1|  PREDICTED: probable LRR receptor-like serine...    115   3e-30   
ref|XP_007025271.1|  Leucine-rich repeat transmembrane protein ki...    119   3e-30   
ref|XP_007213678.1|  hypothetical protein PRUPE_ppa000939mg             122   6e-30   
ref|XP_008225418.1|  PREDICTED: probable LRR receptor-like serine...    122   7e-30   
ref|XP_008225417.1|  PREDICTED: probable LRR receptor-like serine...    122   7e-30   
ref|XP_008225432.1|  PREDICTED: probable LRR receptor-like serine...    120   8e-30   
ref|XP_008345983.1|  PREDICTED: probable LRR receptor-like serine...    120   8e-30   
gb|KDP21156.1|  hypothetical protein JCGZ_21627                         120   2e-29   
emb|CAN61169.1|  hypothetical protein VITISV_010446                     119   2e-29   Vitis vinifera
ref|XP_008371519.1|  PREDICTED: probable LRR receptor-like serine...    120   2e-29   
ref|XP_007214035.1|  hypothetical protein PRUPE_ppa017351mg             119   3e-29   
emb|CBI30743.3|  unnamed protein product                                117   5e-29   
ref|XP_007025266.1|  Leucine-rich repeat transmembrane protein ki...    119   6e-29   
ref|XP_007025270.1|  Leucine-rich repeat transmembrane protein ki...    119   6e-29   
ref|XP_008377580.1|  PREDICTED: probable LRR receptor-like serine...    119   7e-29   
ref|XP_004296585.1|  PREDICTED: probable LRR receptor-like serine...    112   8e-29   
ref|XP_004295407.1|  PREDICTED: probable LRR receptor-like serine...    119   8e-29   
ref|XP_006377514.1|  hypothetical protein POPTR_0011s06595g             114   2e-28   
ref|XP_007214698.1|  hypothetical protein PRUPE_ppa026371mg             117   3e-28   
ref|XP_006370934.1|  hypothetical protein POPTR_0019s01910g             110   3e-28   
ref|XP_010655563.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-28   
ref|XP_008366034.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-28   
ref|XP_010655564.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-28   
ref|XP_010655562.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-28   
ref|XP_007214549.1|  hypothetical protein PRUPE_ppa001005mg             117   4e-28   
emb|CAN65055.1|  hypothetical protein VITISV_012378                     115   4e-28   Vitis vinifera
ref|XP_010655578.1|  PREDICTED: probable LRR receptor-like serine...    116   4e-28   
emb|CAE54078.1|  receptor-like protein kinase                           110   5e-28   Fagus sylvatica
ref|XP_010655575.1|  PREDICTED: probable LRR receptor-like serine...    116   5e-28   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...    116   6e-28   
ref|XP_010655574.1|  PREDICTED: probable LRR receptor-like serine...    116   6e-28   
ref|XP_010088631.1|  putative leucine-rich repeat receptor-like s...    116   6e-28   
ref|XP_006377493.1|  hypothetical protein POPTR_0011s06440g             111   8e-28   
ref|XP_004233025.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-27   
ref|XP_002300205.2|  hypothetical protein POPTR_0001s31610g             115   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010655586.1|  PREDICTED: probable LRR receptor-like serine...    115   2e-27   
ref|XP_002317383.2|  hypothetical protein POPTR_0011s06220g             114   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006377501.1|  hypothetical protein POPTR_0011s06490g             113   2e-27   
emb|CAN81177.1|  hypothetical protein VITISV_011951                     114   2e-27   Vitis vinifera
ref|XP_009351856.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-27   
emb|CBI30748.3|  unnamed protein product                                114   2e-27   
ref|XP_006358075.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-27   
ref|XP_009600347.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-27   
ref|XP_010112408.1|  putative leucine-rich repeat receptor-like s...    114   3e-27   
ref|XP_009795508.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-27   
ref|XP_006358134.1|  PREDICTED: probable LRR receptor-like serine...    114   3e-27   
ref|XP_002317319.2|  hypothetical protein POPTR_0011s032002g            113   4e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008225259.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-27   
ref|XP_006358077.1|  PREDICTED: probable LRR receptor-like serine...    114   4e-27   
gb|AAL73330.1|  putative receptor-like protein kinase RLPK1             108   4e-27   Glycine max [soybeans]
ref|XP_006371025.1|  hypothetical protein POPTR_0019s027401g            107   5e-27   
ref|XP_010316867.1|  PREDICTED: probable LRR receptor-like serine...    113   6e-27   
ref|XP_006358076.1|  PREDICTED: probable LRR receptor-like serine...    113   8e-27   
gb|KCW71078.1|  hypothetical protein EUGRSUZ_F04177                     112   1e-26   
ref|XP_011002049.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_011002044.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_010095160.1|  putative LRR receptor-like serine/threonine-...    106   1e-26   
ref|XP_011002048.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_011002047.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_011002045.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_011002050.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
gb|KDO35800.1|  hypothetical protein CISIN_1g028061mg                   107   1e-26   
ref|XP_011002046.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-26   
ref|XP_004295405.1|  PREDICTED: probable leucine-rich repeat rece...    112   1e-26   
gb|KHN38783.1|  Putative LRR receptor-like serine/threonine-prote...    108   2e-26   
ref|XP_006377472.1|  hypothetical protein POPTR_0011s06260g             110   2e-26   
ref|XP_010063817.1|  PREDICTED: probable LRR receptor-like serine...    112   2e-26   
ref|XP_006377459.1|  hypothetical protein POPTR_0011s06130g             110   2e-26   
ref|XP_011046381.1|  PREDICTED: probable leucine-rich repeat rece...    112   2e-26   
ref|XP_006495027.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-26   
ref|XP_008225260.1|  PREDICTED: probable leucine-rich repeat rece...    112   2e-26   
ref|XP_007025267.1|  Leucine-rich repeat transmembrane protein ki...    112   2e-26   
ref|XP_006371021.1|  hypothetical protein POPTR_0019s027201g            110   3e-26   
ref|XP_006388928.1|  hypothetical protein POPTR_0073s00200g             108   3e-26   
ref|XP_006377482.1|  hypothetical protein POPTR_0011s06335g             110   3e-26   
emb|CDO96888.1|  unnamed protein product                                111   4e-26   
gb|KCW67556.1|  hypothetical protein EUGRSUZ_F01306                     110   4e-26   
ref|XP_004309629.1|  PREDICTED: probable LRR receptor-like serine...    110   4e-26   
ref|XP_006377483.1|  putative receptor-like protein kinase RLPK1        110   5e-26   
ref|XP_006370931.1|  hypothetical protein POPTR_0019s01880g             107   6e-26   
ref|XP_002325753.2|  hypothetical protein POPTR_0019s01950g             110   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_008384518.1|  PREDICTED: TMV resistance protein N-like iso...    110   6e-26   
ref|XP_010665669.1|  PREDICTED: probable LRR receptor-like serine...    110   7e-26   
ref|XP_010665668.1|  PREDICTED: probable LRR receptor-like serine...    110   7e-26   
gb|KCW67547.1|  hypothetical protein EUGRSUZ_F01301                     110   7e-26   
ref|XP_008384519.1|  PREDICTED: TMV resistance protein N-like iso...    110   7e-26   
ref|XP_010064483.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_010665667.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_010060732.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_010272760.1|  PREDICTED: probable leucine-rich repeat rece...    110   8e-26   
ref|XP_011045704.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_010665666.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_010665665.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-26   
ref|XP_006377525.1|  putative receptor-like protein kinase RLPK1        109   8e-26   
ref|XP_006388189.1|  hypothetical protein POPTR_0294s002001g            107   9e-26   
ref|XP_006371019.1|  hypothetical protein POPTR_0019s027001g            109   9e-26   
ref|XP_011046349.1|  PREDICTED: probable LRR receptor-like serine...    110   9e-26   
ref|XP_011046350.1|  PREDICTED: probable LRR receptor-like serine...    110   9e-26   
gb|KCW67550.1|  hypothetical protein EUGRSUZ_F013052                    106   1e-25   
gb|ACM89476.1|  leucine-rich repeat family protein / protein kina...    109   1e-25   Glycine max [soybeans]
emb|CBI30750.3|  unnamed protein product                                108   1e-25   
ref|XP_006370936.1|  hypothetical protein POPTR_0019s01930g             108   1e-25   
ref|XP_002528777.1|  ATP binding protein, putative                      109   1e-25   Ricinus communis
ref|XP_008245184.1|  PREDICTED: probable leucine-rich repeat rece...    109   1e-25   
ref|XP_006847775.1|  hypothetical protein AMTR_s00162p00056910          108   2e-25   
ref|XP_011045702.1|  PREDICTED: probable LRR receptor-like serine...    109   2e-25   
ref|XP_006377507.1|  hypothetical protein POPTR_0011s065502g            106   2e-25   
ref|XP_010088632.1|  putative LRR receptor-like serine/threonine-...    108   2e-25   
ref|XP_011101928.1|  PREDICTED: probable leucine-rich repeat rece...    108   2e-25   
ref|XP_006377518.1|  hypothetical protein POPTR_0011s066201g            108   2e-25   
emb|CAN66180.1|  hypothetical protein VITISV_025180                     107   2e-25   Vitis vinifera
ref|XP_006467585.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-25   
ref|XP_006371027.1|  hypothetical protein POPTR_0019s02760g             108   3e-25   
ref|XP_006377521.1|  hypothetical protein POPTR_0011s06650g             105   3e-25   
ref|XP_011046363.1|  PREDICTED: probable leucine-rich repeat rece...    108   3e-25   
ref|XP_010655585.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-25   
ref|XP_010060733.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-25   
ref|XP_010041838.1|  PREDICTED: probable LRR receptor-like serine...    107   3e-25   
emb|CBI20154.3|  unnamed protein product                                108   4e-25   
ref|XP_006582117.1|  PREDICTED: probable LRR receptor-like serine...    108   5e-25   
ref|XP_006388878.1|  hypothetical protein POPTR_0084s002301g            107   5e-25   
ref|XP_010655583.1|  PREDICTED: probable LRR receptor-like serine...    108   5e-25   
ref|XP_007133298.1|  hypothetical protein PHAVU_011G167800g             107   5e-25   
ref|XP_010655584.1|  PREDICTED: probable LRR receptor-like serine...    108   5e-25   
gb|KHN42594.1|  Putative LRR receptor-like serine/threonine-prote...    108   5e-25   
ref|XP_011014230.1|  PREDICTED: probable leucine-rich repeat rece...    107   6e-25   
emb|CAN81779.1|  hypothetical protein VITISV_034284                     107   6e-25   Vitis vinifera
ref|XP_006370083.1|  hypothetical protein POPTR_0001s393801g            107   6e-25   
ref|XP_006592614.1|  PREDICTED: probable LRR receptor-like serine...    107   6e-25   
gb|KHN36920.1|  Putative LRR receptor-like serine/threonine-prote...    107   6e-25   
ref|NP_001238159.1|  receptor-like serine/threonine kinase              108   6e-25   
ref|XP_006377456.1|  hypothetical protein POPTR_0011s06100g             106   6e-25   
ref|XP_006370088.1|  hypothetical protein POPTR_0001s39420g             107   6e-25   
emb|CBI20124.3|  unnamed protein product                                107   7e-25   
ref|XP_011014228.1|  PREDICTED: probable leucine-rich repeat rece...    107   7e-25   
ref|XP_011014227.1|  PREDICTED: probable leucine-rich repeat rece...    107   7e-25   
ref|XP_011046359.1|  PREDICTED: probable leucine-rich repeat rece...    107   7e-25   
ref|XP_011014229.1|  PREDICTED: probable leucine-rich repeat rece...    107   7e-25   
ref|XP_010644091.1|  PREDICTED: probable LRR receptor-like serine...    107   7e-25   
ref|XP_011046365.1|  PREDICTED: probable leucine-rich repeat rece...    107   8e-25   
gb|KCW71080.1|  hypothetical protein EUGRSUZ_F04179                     107   8e-25   
ref|XP_011046362.1|  PREDICTED: probable leucine-rich repeat rece...    107   8e-25   
ref|XP_007021933.1|  Leucine-rich repeat transmembrane protein ki...    107   8e-25   
ref|XP_011046364.1|  PREDICTED: probable leucine-rich repeat rece...    107   8e-25   
ref|XP_011046360.1|  PREDICTED: probable leucine-rich repeat rece...    107   9e-25   
ref|XP_010065089.1|  PREDICTED: probable LRR receptor-like serine...    107   9e-25   
ref|XP_007149544.1|  hypothetical protein PHAVU_005G0791000g            107   9e-25   
ref|XP_006449566.1|  hypothetical protein CICLE_v10014125mg             107   9e-25   
ref|XP_002283596.2|  PREDICTED: probable leucine-rich repeat rece...    107   9e-25   Vitis vinifera
ref|XP_010272675.1|  PREDICTED: probable LRR receptor-like serine...    100   9e-25   
gb|KDP27082.1|  hypothetical protein JCGZ_20306                         107   1e-24   
ref|XP_011046351.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-24   
ref|XP_011002041.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-24   
ref|XP_011002042.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-24   
ref|XP_002316847.1|  receptor-like protein kinase                       107   1e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011002040.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-24   
ref|XP_011002039.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-24   
ref|XP_006370097.1|  hypothetical protein POPTR_0001s394901g            106   1e-24   
ref|XP_006388874.1|  hypothetical protein POPTR_0084s00200g             100   1e-24   
gb|KCW67548.1|  hypothetical protein EUGRSUZ_F01302                     105   2e-24   
ref|XP_011044591.1|  PREDICTED: probable LRR receptor-like serine...    106   2e-24   
ref|XP_006370087.1|  hypothetical protein POPTR_0001s39420g             106   2e-24   
ref|XP_009406148.1|  PREDICTED: probable LRR receptor-like serine...    106   2e-24   
ref|XP_006370091.1|  hypothetical protein POPTR_0001s39450g             106   2e-24   
ref|XP_006370084.1|  hypothetical protein POPTR_0001s39390g             106   2e-24   
gb|KCW48261.1|  hypothetical protein EUGRSUZ_K019901                    100   3e-24   
ref|XP_011002772.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-24   
ref|XP_011009667.1|  PREDICTED: probable LRR receptor-like serine...    104   3e-24   
ref|XP_011009666.1|  PREDICTED: probable LRR receptor-like serine...    104   3e-24   
gb|KCW84079.1|  hypothetical protein EUGRSUZ_B00960                     104   3e-24   
ref|XP_010093471.1|  putative LRR receptor-like serine/threonine-...    105   3e-24   
emb|CBI30754.3|  unnamed protein product                                104   3e-24   
ref|XP_011014343.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-24   
ref|XP_002522279.1|  ATP binding protein, putative                      105   3e-24   Ricinus communis
ref|XP_010036446.1|  PREDICTED: probable leucine-rich repeat rece...  99.8    4e-24   
ref|XP_009772943.1|  PREDICTED: probable LRR receptor-like serine...    105   4e-24   
ref|XP_011002770.1|  PREDICTED: probable LRR receptor-like serine...    105   4e-24   
ref|XP_010060734.1|  PREDICTED: probable LRR receptor-like serine...    105   4e-24   
ref|XP_009619428.1|  PREDICTED: probable LRR receptor-like serine...    105   5e-24   
ref|XP_010272741.1|  PREDICTED: probable LRR receptor-like serine...    105   5e-24   
gb|KEH38591.1|  LRR receptor-like kinase                                105   5e-24   
ref|XP_010272742.1|  PREDICTED: probable leucine-rich repeat rece...    105   5e-24   
ref|XP_010313922.1|  PREDICTED: probable LRR receptor-like serine...    105   5e-24   
ref|XP_004295408.1|  PREDICTED: probable LRR receptor-like serine...    105   6e-24   
ref|XP_010655590.1|  PREDICTED: probable LRR receptor-like serine...    104   7e-24   
ref|XP_003596262.1|  Receptor-like serine/threonine kinase              104   7e-24   
ref|XP_006358931.1|  PREDICTED: probable LRR receptor-like serine...    104   7e-24   
ref|XP_004251900.1|  PREDICTED: probable LRR receptor-like serine...    104   7e-24   
gb|ABF70100.1|  protein kinase, putative                                104   8e-24   Musa balbisiana [starchy banana]
ref|XP_002305710.2|  hypothetical protein POPTR_0004s06240g             102   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_006384081.1|  hypothetical protein POPTR_0004s06270g             102   9e-24   
gb|EYU29542.1|  hypothetical protein MIMGU_mgv1a0269212mg               102   9e-24   
ref|XP_006477836.1|  PREDICTED: probable LRR receptor-like serine...    104   1e-23   
ref|XP_006442369.1|  hypothetical protein CICLE_v10018721mg             104   1e-23   
gb|KDO42388.1|  hypothetical protein CISIN_1g001767mg                   104   1e-23   
ref|XP_006384080.1|  hypothetical protein POPTR_0004s06270g             102   1e-23   
ref|XP_010675288.1|  PREDICTED: probable LRR receptor-like serine...    104   1e-23   
emb|CDP06040.1|  unnamed protein product                                104   1e-23   
emb|CBI30739.3|  unnamed protein product                                103   1e-23   
ref|XP_010655588.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-23   
ref|XP_010655589.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-23   
ref|XP_011082787.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-23   
ref|XP_004146083.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-23   
emb|CBI30752.3|  unnamed protein product                                102   2e-23   
ref|XP_008451725.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
ref|XP_008451726.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
ref|XP_011098190.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
gb|ABF72026.1|  leucine-rich repeat-containing protein kinase fam...    103   2e-23   Musa acuminata [banana]
emb|CAN73789.1|  hypothetical protein VITISV_025000                     102   2e-23   Vitis vinifera
ref|XP_010478346.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
ref|XP_008795773.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
ref|XP_008795771.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-23   
gb|KCW78573.1|  hypothetical protein EUGRSUZ_C00047                   97.8    2e-23   
ref|XP_006377461.1|  hypothetical protein POPTR_0011s06150g           99.8    3e-23   
ref|XP_011002771.1|  PREDICTED: probable LRR receptor-like serine...    103   3e-23   
ref|XP_010924703.1|  PREDICTED: probable LRR receptor-like serine...    103   3e-23   
ref|XP_006304798.1|  hypothetical protein CARUB_v10012394mg             103   3e-23   
ref|XP_010655557.1|  PREDICTED: probable LRR receptor-like serine...    103   3e-23   
ref|XP_010655556.1|  PREDICTED: probable LRR receptor-like serine...    102   3e-23   
ref|XP_006306238.1|  hypothetical protein CARUB_v10012061mg             102   3e-23   
gb|KCW84087.1|  hypothetical protein EUGRSUZ_B00978                     102   3e-23   
ref|XP_006377463.1|  hypothetical protein POPTR_0011s06170g           99.8    4e-23   
ref|XP_010246505.1|  PREDICTED: probable LRR receptor-like serine...    102   4e-23   
ref|XP_010247775.1|  PREDICTED: probable leucine-rich repeat rece...    102   5e-23   
ref|XP_004168262.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_010246504.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_004137308.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_010479903.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_010246509.1|  PREDICTED: probable leucine-rich repeat rece...    102   5e-23   
ref|XP_010462234.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_010479902.1|  PREDICTED: probable LRR receptor-like serine...    102   5e-23   
ref|XP_009758721.1|  PREDICTED: probable LRR receptor-like serine...  99.8    5e-23   
ref|NP_001117479.1|  Leucine-rich repeat transmembrane protein ki...    102   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDO77959.1|  hypothetical protein CISIN_1g045835mg                   100   6e-23   
gb|AAF78445.1|AC018748_24  Contains a weak similarity to disease ...    102   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062936.1|  Os09g0345300                                     99.0    6e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006304589.1|  hypothetical protein CARUB_v10011641mg             102   6e-23   
ref|XP_010093466.1|  putative leucine-rich repeat receptor-like s...  99.4    6e-23   
ref|NP_175748.1|  Leucine-rich repeat transmembrane protein kinase      102   7e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20508.1|  hypothetical protein F383_03730                         102   7e-23   
ref|XP_010499486.1|  PREDICTED: probable LRR receptor-like serine...    101   7e-23   
gb|ACN59254.1|  leucine-rich repeat receptor-like protein kinase        101   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175749.1|  putative LRR receptor-like serine/threonine-pro...    102   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004488999.1|  PREDICTED: probable LRR receptor-like serine...    102   7e-23   
ref|XP_010462239.1|  PREDICTED: probable LRR receptor-like serine...    102   7e-23   
gb|AAF78446.1|AC018748_25  Contains similarity to receptor-like s...    102   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460749.1|  PREDICTED: probable LRR receptor-like serine...    101   7e-23   
gb|KCW48008.1|  hypothetical protein EUGRSUZ_K017432                  99.0    8e-23   
gb|KCW67576.1|  hypothetical protein EUGRSUZ_F013322                  99.0    8e-23   
ref|XP_010045443.1|  PREDICTED: probable LRR receptor-like serine...    101   8e-23   
sp|C0LGG8.1|Y5343_ARATH  RecName: Full=Probable LRR receptor-like...    102   8e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010045768.1|  PREDICTED: probable LRR receptor-like serine...    101   8e-23   
ref|XP_010500994.1|  PREDICTED: probable LRR receptor-like serine...    101   8e-23   
ref|XP_006847776.1|  hypothetical protein AMTR_s00162p00057050        98.6    8e-23   
gb|EEE69521.1|  hypothetical protein OsJ_28982                          101   9e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84403.1|  hypothetical protein OsI_30981                          101   9e-23   Oryza sativa Indica Group [Indian rice]
gb|KCW84086.1|  hypothetical protein EUGRSUZ_B00972                     101   9e-23   
gb|KCW48033.1|  hypothetical protein EUGRSUZ_K01771                     100   9e-23   
gb|KCW48268.1|  hypothetical protein EUGRSUZ_K020001                  98.6    9e-23   
ref|XP_010248481.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
gb|AAG50775.1|AC079288_4  receptor-like serine/threonine kinase, ...    101   1e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CAN78284.1|  hypothetical protein VITISV_000422                     101   1e-22   Vitis vinifera
ref|XP_010479904.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
gb|AAG10621.1|AC008030_21  Putative receptor-like serine/threonin...    101   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008463773.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010499483.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010499481.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010112410.1|  putative LRR receptor-like serine/threonine-...    101   1e-22   
ref|XP_010644094.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010036641.1|  PREDICTED: probable leucine-rich repeat rece...    100   1e-22   
emb|CAN70496.1|  hypothetical protein VITISV_042040                     100   1e-22   
gb|KFK35729.1|  hypothetical protein AALP_AA4G029100                    101   1e-22   
ref|XP_010499484.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010046856.1|  PREDICTED: probable leucine-rich repeat rece...  97.4    1e-22   
ref|XP_010499485.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-22   
ref|XP_010460745.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010460744.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_003617471.1|  BED finger-nbs resistance protein                  101   1e-22   
ref|XP_010036639.1|  PREDICTED: probable leucine-rich repeat rece...    100   1e-22   
ref|XP_002891752.1|  leucine-rich repeat family protein                 101   1e-22   
ref|XP_006370080.1|  hypothetical protein POPTR_0001s39360g             101   1e-22   
emb|CBI20149.3|  unnamed protein product                                100   1e-22   
ref|XP_010246506.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|NP_174266.2|  leucine-rich repeat transmembrane protein kinase      101   1e-22   
ref|XP_010460747.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-22   
ref|XP_010460746.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010460748.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-22   
ref|XP_002283477.2|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010655582.1|  PREDICTED: probable LRR receptor-like serine...    101   1e-22   
ref|XP_010246507.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-22   
ref|XP_006449567.1|  hypothetical protein CICLE_v10014126mg             100   2e-22   
gb|KEH28414.1|  LRR receptor-like kinase                                100   2e-22   
emb|CBI20145.3|  unnamed protein product                                100   2e-22   
gb|KEH28415.1|  LRR receptor-like kinase                                100   2e-22   
ref|XP_002283497.2|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
gb|AET00430.2|  LRR receptor-like kinase                                100   2e-22   
ref|XP_007021935.1|  Leucine-rich repeat transmembrane protein ki...    100   2e-22   
ref|XP_010655580.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
ref|XP_006358135.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
ref|XP_010479905.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
gb|KCW48258.1|  hypothetical protein EUGRSUZ_K01987                     100   2e-22   
ref|XP_010655581.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
gb|KCW67582.1|  hypothetical protein EUGRSUZ_F01341                   97.4    2e-22   
ref|XP_009600352.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
ref|XP_009600351.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
ref|XP_010038877.1|  PREDICTED: probable LRR receptor-like serine...  99.8    2e-22   
ref|XP_010500990.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-22   
ref|XP_010094305.1|  putative LRR receptor-like serine/threonine-...  97.4    3e-22   
ref|XP_009600348.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-22   
ref|XP_006377527.1|  hypothetical protein POPTR_0011s067102g          95.9    3e-22   
gb|KCW48041.1|  hypothetical protein EUGRSUZ_K01781                   99.8    3e-22   
ref|XP_009600350.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-22   
gb|KCW48256.1|  hypothetical protein EUGRSUZ_K01985                   99.8    3e-22   
gb|KCW84082.1|  hypothetical protein EUGRSUZ_B00963                     100   3e-22   
ref|XP_010500991.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-22   
ref|XP_010045761.1|  PREDICTED: probable LRR receptor-like serine...    100   3e-22   
ref|XP_010038964.1|  PREDICTED: probable LRR receptor-like serine...  99.8    3e-22   
ref|XP_010064502.1|  PREDICTED: probable leucine-rich repeat rece...    100   3e-22   
ref|XP_009600349.1|  PREDICTED: probable LRR receptor-like serine...    100   4e-22   
ref|XP_010316866.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-22   
ref|XP_010036442.1|  PREDICTED: probable leucine-rich repeat rece...  99.4    4e-22   
ref|XP_010909919.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-22   
ref|XP_010038955.1|  PREDICTED: probable leucine-rich repeat rece...  99.8    4e-22   
emb|CAN60698.1|  hypothetical protein VITISV_022626                   99.8    4e-22   
ref|XP_010462235.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-22   
ref|XP_008449503.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-22   
gb|KCW67603.1|  hypothetical protein EUGRSUZ_F013601                  94.4    4e-22   
ref|XP_010657080.1|  PREDICTED: probable LRR receptor-like serine...  99.8    4e-22   
ref|XP_010093476.1|  putative LRR receptor-like serine/threonine-...  94.7    4e-22   
ref|XP_010036440.1|  PREDICTED: probable leucine-rich repeat rece...  99.4    4e-22   
ref|XP_011002767.1|  PREDICTED: probable leucine-rich repeat rece...  99.8    5e-22   
emb|CBI20142.3|  unnamed protein product                              99.8    5e-22   
ref|XP_002283521.1|  PREDICTED: probable LRR receptor-like serine...  99.8    5e-22   
gb|AGW52154.1|  RKF                                                   99.8    5e-22   
ref|XP_011010609.1|  PREDICTED: probable LRR receptor-like serine...  99.4    5e-22   
ref|XP_010036439.1|  PREDICTED: probable leucine-rich repeat rece...  99.4    5e-22   
gb|KCW48028.1|  hypothetical protein EUGRSUZ_K01762                   99.4    5e-22   
gb|KCW48003.1|  hypothetical protein EUGRSUZ_K01737                   99.0    6e-22   
ref|NP_001235287.1|  receptor-like protein kinase                     95.9    6e-22   
gb|KHG25891.1|  hypothetical protein F383_04348                       99.4    6e-22   
ref|XP_010038874.1|  PREDICTED: probable leucine-rich repeat rece...  99.0    6e-22   
ref|XP_010248401.1|  PREDICTED: probable LRR receptor-like serine...  99.4    6e-22   
gb|KHN36927.1|  Putative leucine-rich repeat receptor-like serine...  97.8    6e-22   
ref|XP_009351793.1|  PREDICTED: probable LRR receptor-like serine...  99.4    7e-22   
ref|XP_006467584.1|  PREDICTED: probable LRR receptor-like serine...  99.4    7e-22   
ref|XP_006388682.1|  hypothetical protein POPTR_0122s00210g           98.2    7e-22   
gb|KFK43087.1|  hypothetical protein AALP_AA1G077600                  99.0    7e-22   
ref|XP_004167668.1|  PREDICTED: probable LRR receptor-like serine...  99.0    7e-22   
ref|XP_004146084.1|  PREDICTED: probable LRR receptor-like serine...  99.0    7e-22   
ref|XP_011010608.1|  PREDICTED: probable LRR receptor-like serine...  99.0    7e-22   
ref|XP_002306015.2|  hypothetical protein POPTR_0004s14310g           99.0    7e-22   
emb|CDY60204.1|  BnaCnng35830D                                        99.0    7e-22   
ref|XP_010060741.1|  PREDICTED: probable leucine-rich repeat rece...  94.4    7e-22   
ref|XP_003596244.1|  Receptor-like serine/threonine kinase            99.4    8e-22   
ref|XP_008775550.1|  PREDICTED: probable LRR receptor-like serine...  98.2    8e-22   
gb|AES66495.2|  LRR receptor-like kinase                              99.0    8e-22   
emb|CAN81226.1|  hypothetical protein VITISV_038168                   98.6    1e-21   
ref|XP_006346646.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
ref|XP_008775549.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
ref|XP_006348929.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
ref|XP_004243241.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
ref|XP_009144771.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
emb|CDY25853.1|  BnaA05g14440D                                        98.6    1e-21   
ref|XP_007213689.1|  hypothetical protein PRUPE_ppa000854mg           98.6    1e-21   
ref|XP_010644093.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
ref|XP_008226377.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
gb|KCW67583.1|  hypothetical protein EUGRSUZ_F013432                  98.6    1e-21   
ref|XP_008226378.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
ref|XP_010916505.1|  PREDICTED: probable LRR receptor-like serine...  98.6    1e-21   
ref|XP_002305711.2|  RECEPTOR-LIKE KINASE IN FLOWERS 1 family pro...  98.2    1e-21   
gb|KCW48051.1|  hypothetical protein EUGRSUZ_K01793                   97.8    1e-21   
ref|XP_010272733.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
ref|XP_010916513.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
gb|KCW67580.1|  hypothetical protein EUGRSUZ_F01336                   93.6    1e-21   
ref|XP_006377469.1|  hypothetical protein POPTR_0011s062402g          96.7    1e-21   
ref|XP_004294067.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
ref|XP_010644092.1|  PREDICTED: probable LRR receptor-like serine...  98.2    1e-21   
ref|XP_010064500.1|  PREDICTED: probable LRR receptor-like serine...  92.0    1e-21   
ref|XP_002283464.2|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
ref|XP_004491049.1|  PREDICTED: probable leucine-rich repeat rece...  92.8    2e-21   
ref|XP_010691210.1|  PREDICTED: probable leucine-rich repeat rece...  98.2    2e-21   
ref|XP_010272732.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
ref|XP_006392789.1|  hypothetical protein EUTSA_v10011204mg           98.2    2e-21   
emb|CBI20153.3|  unnamed protein product                              97.8    2e-21   
ref|XP_011009661.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
ref|XP_011009658.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
ref|XP_011009660.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
ref|XP_011009659.1|  PREDICTED: probable LRR receptor-like serine...  98.2    2e-21   
emb|CDX98145.1|  BnaC07g09530D                                        92.8    2e-21   
ref|XP_010064505.1|  PREDICTED: probable leucine-rich repeat rece...  97.1    2e-21   
gb|KCW67607.1|  hypothetical protein EUGRSUZ_F013621                  97.8    2e-21   
ref|XP_006303666.1|  hypothetical protein CARUB_v10011709mg           97.8    2e-21   
ref|XP_008225247.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-21   
dbj|BAJ53166.1|  JHL10I11.12                                          97.8    2e-21   
ref|XP_010064506.1|  PREDICTED: probable leucine-rich repeat rece...  97.8    2e-21   
gb|KCW67597.1|  hypothetical protein EUGRSUZ_F013531                  97.1    2e-21   
ref|XP_010921615.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-21   
ref|XP_008792302.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-21   
ref|XP_008225246.1|  PREDICTED: probable LRR receptor-like serine...  97.8    2e-21   
ref|XP_006370076.1|  hypothetical protein POPTR_0001s39320g           97.4    2e-21   
ref|XP_006448019.1|  hypothetical protein CICLE_v10014129mg           97.1    2e-21   
gb|KFK35730.1|  hypothetical protein AALP_AA4G029200                  97.4    3e-21   
ref|XP_006448018.1|  hypothetical protein CICLE_v10014129mg           97.1    3e-21   
gb|KDP20042.1|  hypothetical protein JCGZ_05811                       97.4    3e-21   
ref|XP_010038894.1|  PREDICTED: probable leucine-rich repeat rece...  97.4    3e-21   
ref|XP_003634705.1|  PREDICTED: probable LRR receptor-like serine...  97.4    3e-21   
emb|CAN74151.1|  hypothetical protein VITISV_028028                   97.1    3e-21   
gb|KCW67604.1|  hypothetical protein EUGRSUZ_F01361                   97.1    3e-21   
ref|XP_010655560.1|  PREDICTED: probable LRR receptor-like serine...  97.1    3e-21   
gb|AES66493.2|  LRR receptor-like kinase                              97.1    4e-21   
ref|XP_002532988.1|  conserved hypothetical protein                   97.1    4e-21   
ref|XP_010060749.1|  PREDICTED: probable leucine-rich repeat rece...  97.1    4e-21   
ref|XP_010247776.1|  PREDICTED: probable LRR receptor-like serine...  97.1    4e-21   
emb|CBI30744.3|  unnamed protein product                              97.1    4e-21   
gb|KHG04295.1|  hypothetical protein F383_04630                       96.7    4e-21   
ref|XP_002522276.1|  kinase, putative                                 97.4    4e-21   
ref|XP_004140247.1|  PREDICTED: probable LRR receptor-like serine...  96.7    5e-21   
ref|XP_006448020.1|  hypothetical protein CICLE_v10014129mg           96.7    5e-21   
ref|XP_004488997.1|  PREDICTED: probable leucine-rich repeat rece...  96.7    5e-21   
ref|XP_004491355.1|  PREDICTED: probable LRR receptor-like serine...  96.7    5e-21   
gb|KHG04296.1|  hypothetical protein F383_04630                       96.7    5e-21   
gb|KCW67574.1|  hypothetical protein EUGRSUZ_F013302                  96.3    5e-21   
ref|XP_010552132.1|  PREDICTED: probable leucine-rich repeat rece...  96.7    5e-21   
ref|XP_010246510.1|  PREDICTED: probable leucine-rich repeat rece...  96.7    6e-21   
gb|AAF75093.1|AC007583_29  Contains similarity to a receptor-like...  95.5    6e-21   
ref|XP_010246513.1|  PREDICTED: probable leucine-rich repeat rece...  96.7    6e-21   
ref|XP_004488996.1|  PREDICTED: probable leucine-rich repeat rece...  96.3    6e-21   
emb|CBI20136.3|  unnamed protein product                              95.9    6e-21   
ref|XP_004491354.1|  PREDICTED: probable LRR receptor-like serine...  96.3    6e-21   
ref|XP_007048781.1|  Leucine-rich repeat transmembrane protein ki...  96.3    7e-21   
ref|XP_004305822.1|  PREDICTED: probable LRR receptor-like serine...  96.3    7e-21   
ref|XP_007048780.1|  Leucine-rich repeat transmembrane protein ki...  96.3    7e-21   
ref|XP_004488995.1|  PREDICTED: probable leucine-rich repeat rece...  96.3    7e-21   
ref|XP_010064515.1|  PREDICTED: probable leucine-rich repeat rece...  96.3    7e-21   
ref|XP_009376743.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  96.3    7e-21   
ref|XP_008386284.1|  PREDICTED: probable LRR receptor-like serine...  96.3    7e-21   
ref|XP_008229374.1|  PREDICTED: probable LRR receptor-like serine...  96.3    7e-21   
ref|XP_007214913.1|  hypothetical protein PRUPE_ppa000698mg           96.3    8e-21   
ref|XP_003596245.1|  Receptor-like protein kinase                     95.9    8e-21   
gb|KDP21155.1|  hypothetical protein JCGZ_21626                       95.5    8e-21   
ref|NP_001184930.1|  leucine-rich repeat transmembrane protein ki...  95.9    9e-21   
ref|XP_009359368.1|  PREDICTED: probable LRR receptor-like serine...  95.9    9e-21   
ref|XP_009359367.1|  PREDICTED: probable LRR receptor-like serine...  95.9    9e-21   
ref|NP_172244.2|  leucine-rich repeat transmembrane protein kinase    95.9    9e-21   
gb|KEH38577.1|  LRR receptor-like kinase                              95.9    9e-21   
ref|XP_009359369.1|  PREDICTED: probable LRR receptor-like serine...  95.9    9e-21   
ref|XP_010064492.1|  PREDICTED: probable leucine-rich repeat rece...  92.8    9e-21   
ref|XP_006442368.1|  hypothetical protein CICLE_v10018771mg           95.9    1e-20   
ref|XP_010093474.1|  putative LRR receptor-like serine/threonine-...  95.9    1e-20   
gb|KHG23496.1|  putative LRR receptor-like serine/threonine-prote...  95.5    1e-20   
ref|XP_011098063.1|  PREDICTED: probable LRR receptor-like serine...  95.9    1e-20   
gb|AES66496.2|  LRR receptor-like kinase                              95.9    1e-20   
ref|XP_010552133.1|  PREDICTED: probable LRR receptor-like serine...  95.9    1e-20   
ref|XP_009148012.1|  PREDICTED: probable LRR receptor-like serine...  95.5    1e-20   
emb|CDX93632.1|  BnaA06g04160D                                        95.5    1e-20   
emb|CDX95138.1|  BnaC05g05330D                                        95.5    1e-20   
ref|XP_006417782.1|  hypothetical protein EUTSA_v10006761mg           95.1    1e-20   
ref|XP_010045694.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  95.5    1e-20   
ref|XP_011002052.1|  PREDICTED: probable LRR receptor-like serine...  95.5    1e-20   
ref|XP_010064499.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    1e-20   
ref|XP_002524514.1|  ATP binding protein, putative                    95.5    1e-20   
ref|XP_011002053.1|  PREDICTED: probable LRR receptor-like serine...  95.5    1e-20   
ref|XP_010247772.1|  PREDICTED: probable leucine-rich repeat rece...  95.5    1e-20   
ref|XP_006477832.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_006477831.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_006477830.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_010273492.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_010655573.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-20   
emb|CBI30740.3|  unnamed protein product                              95.5    2e-20   
emb|CDP18745.1|  unnamed protein product                              95.1    2e-20   
ref|XP_010655571.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-20   
ref|XP_010273491.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_007025275.1|  Receptor-like kinase in flowers 1, putative      95.1    2e-20   
ref|XP_006442308.1|  hypothetical protein CICLE_v10024314mg           95.1    2e-20   
ref|XP_010655572.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-20   
gb|KDO42386.1|  hypothetical protein CISIN_1g0041552mg                94.0    2e-20   
gb|KEH19394.1|  LRR receptor-like kinase                              95.1    2e-20   
ref|XP_010273489.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_010273487.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_009350015.1|  PREDICTED: probable LRR receptor-like serine...  95.1    2e-20   
ref|XP_008386286.1|  PREDICTED: probable leucine-rich repeat rece...  92.0    2e-20   
ref|XP_010064485.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_010273486.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
ref|XP_006417781.1|  hypothetical protein EUTSA_v10006761mg           95.1    2e-20   
ref|XP_010273485.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   
gb|KCW67564.1|  hypothetical protein EUGRSUZ_F01313                   94.4    2e-20   
ref|XP_010273490.1|  PREDICTED: probable leucine-rich repeat rece...  95.1    2e-20   



>gb|KHF98741.1| hypothetical protein F383_14220 [Gossypium arboreum]
Length=167

 Score =   120 bits (300),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAGKNN KYR  +EN VCL DWA VLQ+  NLMEL+DPRLG++F++
Sbjct  14   KADVYSFGIVALEIVAGKNNTKYR-PEENYVCLQDWAFVLQQRGNLMELVDPRLGTEFNE  72

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  73   EEAIRMTKVALLCTN  87



>ref|XP_007213704.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
 gb|EMJ14903.1| hypothetical protein PRUPE_ppa000741mg [Prunus persica]
Length=1017

 Score =   127 bits (319),  Expect = 9e-32, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NLM+L+DPRLGS+F K
Sbjct  858  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSK  916

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  917  EEAIRMVKVALLCTNP  932



>ref|XP_008245181.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat 
receptor-like serine/threonine-protein kinase At3g14840 [Prunus 
mume]
Length=1017

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NLM+L+DPRLGS+F K
Sbjct  858  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSK  916

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  917  EEAIRMVKVALLCTNP  932



>ref|XP_007214558.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
 gb|EMJ15757.1| hypothetical protein PRUPE_ppa000742mg [Prunus persica]
Length=1017

 Score =   127 bits (318),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NLM+L+DPRLGS+F K
Sbjct  858  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKWNLMDLVDPRLGSNFSK  916

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  917  EEAIRMVKVALLCTNP  932



>gb|KHG06920.1| hypothetical protein F383_33692 [Gossypium arboreum]
Length=164

 Score =   118 bits (295),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV GKNN KYR + E+ VCL DWALVLQ+  NLMEL+DPRLG++F++
Sbjct  14   KADVYSFGIVALEIVTGKNNTKYRPE-EDYVCLQDWALVLQQKGNLMELVDPRLGTEFNE  72

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  73   EEAIRMTKVALLCTN  87



>ref|XP_008225419.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1017

 Score =   125 bits (315),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NLM+L+DPRLGS+F +
Sbjct  858  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGNLMDLVDPRLGSNFSE  916

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  917  EEAIRMVKVALLCTNP  932



>ref|XP_004296291.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=978

 Score =   125 bits (314),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV GKNN+K+R+D EN VC++DWALVLQ+   LMEL+DPRLGSDF++
Sbjct  820  KADVYSFGVVALEIVVGKNNMKFRAD-ENFVCVVDWALVLQQKGKLMELVDPRLGSDFNQ  878

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  879  EEAIRMVKVALLCTNP  894



>ref|XP_008347521.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Malus domestica]
Length=783

 Score =   125 bits (313),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN KYR + +N VCL+DWALVLQ+  NLM+L+DPRLGS F K
Sbjct  623  KADVYSFGVVALEIVAGKNNXKYRPN-QNFVCLVDWALVLQQKGNLMDLVDPRLGSQFSK  681

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  682  EEAIRMVKVALLCTNP  697



>ref|XP_010088635.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36797.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=550

 Score =   122 bits (307),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG VALEIVAGKNN+KYR + EN VCL+DWA+VLQ+  NLMEL+DP LGSDF+K
Sbjct  393  KADVYSFGAVALEIVAGKNNLKYRPN-ENFVCLVDWAIVLQQKGNLMELVDPNLGSDFNK  451

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+A+LC NP
Sbjct  452  EEAVRMIKVAILCINP  467


 Score = 54.7 bits (130),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDW  108
            KADV+SF VVALEI+AG +N+KYR  +EN VCL+DW
Sbjct  14   KADVFSFAVVALEILAGTSNMKYRP-NENYVCLVDW  48



>ref|XP_010655559.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=997

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+C CLLDWA VLQ+  NLMEL+DP+LG++F K
Sbjct  846  KADVYSFGVVALELVAGKNNMKYRPN-EDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKK  904

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM K+ALLCTNP
Sbjct  905  DEAIRMIKVALLCTNP  920



>ref|XP_010655558.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=1003

 Score =   124 bits (311),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+C CLLDWA VLQ+  NLMEL+DP+LG++F K
Sbjct  852  KADVYSFGVVALELVAGKNNMKYRPN-EDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKK  910

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM K+ALLCTNP
Sbjct  911  DEAIRMIKVALLCTNP  926



>ref|XP_008349229.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=284

 Score =   118 bits (296),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NL+EL+DPRLGSD + 
Sbjct  122  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQRGNLIELVDPRLGSDIEV  180

Query  181  EQALRMAKLALLCTNP  228
            E+AL M K+ALLC NP
Sbjct  181  EEALTMVKVALLCINP  196



>emb|CBI30745.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   124 bits (310),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1     KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
             KADVYSFGVVALE+VAGKNN+KYR + E+C CLLDWA VLQ+  NLMEL+DP+LG++F K
Sbjct  1750  KADVYSFGVVALELVAGKNNMKYRPN-EDCFCLLDWAFVLQQKGNLMELVDPKLGTEFKK  1808

Query  181   EQALRMAKLALLCTNP  228
             ++A+RM K+ALLCTNP
Sbjct  1809  DEAIRMIKVALLCTNP  1824



>ref|XP_008345927.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Malus domestica]
Length=159

 Score =   115 bits (288),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+++GKNN+KYR + EN VCLLDWALVLQ+  NLM L+D +LGS+F+K
Sbjct  14   KADVYSFGVVALELLSGKNNIKYRPN-ENFVCLLDWALVLQQXGNLMXLVDRKLGSEFNK  72

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLC NP
Sbjct  73   EEAMRMIKVALLCANP  88



>ref|XP_007025271.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
 gb|EOY27893.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao]
Length=346

 Score =   119 bits (298),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAGKNN KYR + E+ VCL DWALVLQ+  NLMEL+DPRLGS+F++
Sbjct  190  KADVYSFGIVALEIVAGKNNTKYRPE-EDFVCLQDWALVLQQKGNLMELVDPRLGSEFNE  248

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  249  EEAIRMIKVALLCTN  263



>ref|XP_007213678.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
 gb|EMJ14877.1| hypothetical protein PRUPE_ppa000939mg [Prunus persica]
Length=955

 Score =   122 bits (305),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+++GKNN+KYR + EN VCLLDWALVLQ+  NLMEL+DP+LGS F+K
Sbjct  808  KADVYSFGVVALELLSGKNNIKYRPN-ENFVCLLDWALVLQQKGNLMELVDPKLGSQFNK  866

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLC NP
Sbjct  867  EEAMRMIKVALLCANP  882



>ref|XP_008225418.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Prunus mume]
Length=989

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+++GKNN+KYR + EN VCLLDWALVLQ+  NLMEL+DP+LGS F+K
Sbjct  842  KADVYSFGVVALELLSGKNNIKYRPN-ENFVCLLDWALVLQQKGNLMELVDPKLGSQFNK  900

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLC NP
Sbjct  901  EEAMRMIKVALLCANP  916



>ref|XP_008225417.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Prunus mume]
Length=992

 Score =   122 bits (305),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+++GKNN+KYR + EN VCLLDWALVLQ+  NLMEL+DP+LGS F+K
Sbjct  845  KADVYSFGVVALELLSGKNNIKYRPN-ENFVCLLDWALVLQQKGNLMELVDPKLGSQFNK  903

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLC NP
Sbjct  904  EEAMRMIKVALLCANP  919



>ref|XP_008225432.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=657

 Score =   120 bits (302),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K DVY FGVVALE+V+GKNN+KY+ + EN VCLLDWA VLQ+  NLMEL+DP+LGS+F+K
Sbjct  498  KVDVYGFGVVALELVSGKNNIKYQPN-ENYVCLLDWAFVLQQKGNLMELVDPKLGSEFNK  556

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  557  EEAMRMIKVALLCTNP  572



>ref|XP_008345983.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=674

 Score =   120 bits (302),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NL+EL+DPRLGSDF+ 
Sbjct  511  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGNLIELVDPRLGSDFEV  569

Query  181  EQALRMAKLALLCTNP  228
            E+ + M K+ALLC NP
Sbjct  570  EEVITMVKVALLCINP  585



>gb|KDP21156.1| hypothetical protein JCGZ_21627 [Jatropha curcas]
Length=962

 Score =   120 bits (302),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+KYR D E+ VCLLDWA VLQ+  NLM+L+DPRLGS F K
Sbjct  802  KADVYSFGVVALEIVSGKNNMKYRPD-EDFVCLLDWAFVLQQKGNLMDLVDPRLGSKFKK  860

Query  181  EQALRMAKLALLCTN  225
            E+ +RMAK+ALLCTN
Sbjct  861  EEVIRMAKVALLCTN  875



>emb|CAN61169.1| hypothetical protein VITISV_010446 [Vitis vinifera]
Length=661

 Score =   119 bits (299),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+  CLLDWA VLQ+  NLMEL+DP+LG++F K
Sbjct  510  KADVYSFGVVALELVAGKNNMKYRPN-EDYFCLLDWAFVLQQKGNLMELVDPKLGTEFKK  568

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM K+ALLCTNP
Sbjct  569  DEAIRMIKVALLCTNP  584



>ref|XP_008371519.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=1011

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+  NL+EL+DPRLGSDF+ 
Sbjct  848  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGNLIELVDPRLGSDFEV  906

Query  181  EQALRMAKLALLCTNP  228
            E+ + M K+ALLC NP
Sbjct  907  EEVITMVKVALLCINP  922



>ref|XP_007214035.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
 gb|EMJ15234.1| hypothetical protein PRUPE_ppa017351mg [Prunus persica]
Length=876

 Score =   119 bits (299),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K DVYSFGVVALE+V+GKNN+KYR + EN VCLLDWA VLQ+  NLMEL+D +LGS+F+K
Sbjct  772  KVDVYSFGVVALELVSGKNNIKYRPN-ENYVCLLDWAFVLQQKGNLMELVDLKLGSEFNK  830

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  831  EEAMRMIKVALLCTNP  846



>emb|CBI30743.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   117 bits (293),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+  CLLDWA VLQ+  NLMEL+DP LG++F K
Sbjct  375  KADVYSFGVVALELVAGKNNMKYRPN-EDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKK  433

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  434  EEAIRMIKVALLCTN  448



>ref|XP_007025266.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27888.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=988

 Score =   119 bits (298),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+K+R + EN VCLLDWALVLQ+  NLMEL+D +LGS F+K
Sbjct  840  KADVYSFGVVALEIVAGKNNMKFRPN-ENYVCLLDWALVLQQKGNLMELLDTKLGSKFNK  898

Query  181  EQALRMAKLALLCTNP  228
            E+A+R+ ++ALLCTNP
Sbjct  899  EEAMRIIRVALLCTNP  914



>ref|XP_007025270.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
 gb|EOY27892.1| Leucine-rich repeat transmembrane protein kinase, putative [Theobroma 
cacao]
Length=941

 Score =   119 bits (297),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 56/75 (75%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAGKNN KYR + E+ VCL DWALVLQ   NLMEL+DPRLGS+F++
Sbjct  785  KADVYSFGIVALEIVAGKNNTKYRPE-EDFVCLQDWALVLQHKGNLMELVDPRLGSEFNE  843

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  844  EEAIRMIKVALLCTN  858



>ref|XP_008377580.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=987

 Score =   119 bits (297),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LE+V+GKNN+KYR + EN VCLLDWALVLQ+N NLMEL+D +LGS F+K
Sbjct  843  KADVYSFGVVTLELVSGKNNIKYRPN-ENFVCLLDWALVLQQNGNLMELVDRKLGSGFNK  901

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLC NP
Sbjct  902  EEAMRMIKVALLCANP  917



>ref|XP_004296585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=206

 Score =   112 bits (281),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K DVYSFGVVALE+V+G+NNVK+R + EN VCLLD+ALVLQ+ E LMEL+DP+L S F+K
Sbjct  54   KVDVYSFGVVALELVSGENNVKFRPN-ENYVCLLDYALVLQQKEKLMELVDPKLESKFNK  112

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCT+P
Sbjct  113  EEAMRMIKVALLCTHP  128



>ref|XP_004295407.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1681

 Score =   119 bits (298),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +1

Query  1     KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
             KADVYSFGVVALEIVAGKNN+K+R +D+  VCL+DWALVLQ+  NL EL+D RLGSD++K
Sbjct  1517  KADVYSFGVVALEIVAGKNNMKFRPNDD-FVCLVDWALVLQQKGNLKELVDQRLGSDYNK  1575

Query  181   EQALRMAKLALLCTN  225
             EQA+RMAK+ALLCTN
Sbjct  1576  EQAIRMAKVALLCTN  1590


 Score =   113 bits (283),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE V+GKNN+KYR + EN  CL+DWA VL +  NL+EL+DPRLGSDF+K
Sbjct  489  KADVYSFGVVALETVSGKNNMKYRPN-ENIQCLMDWAHVLHQKGNLLELVDPRLGSDFNK  547

Query  181  EQALRMAKLALLCTNP  228
            ++ALR  K+ALLC NP
Sbjct  548  KEALRTIKVALLCANP  563



>ref|XP_006377514.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
 gb|ERP55311.1| hypothetical protein POPTR_0011s06595g [Populus trichocarpa]
Length=308

 Score =   114 bits (284),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  138  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  196

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  197  EEAERMIKLALLCTN  211



>ref|XP_007214698.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
 gb|EMJ15897.1| hypothetical protein PRUPE_ppa026371mg [Prunus persica]
Length=936

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+   L+EL+DPRLGSD  +
Sbjct  773  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGELLELVDPRLGSDVSE  831

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLC N
Sbjct  832  EEAIRMIKVALLCIN  846



>ref|XP_006370934.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
 gb|ERP48731.1| hypothetical protein POPTR_0019s01910g [Populus trichocarpa]
Length=173

 Score =   110 bits (275),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLDW L L+ N ++ME++DPRLGS+F+K
Sbjct  14   KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDWVLYLKTNGDIMEMVDPRLGSEFNK  72

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  73   KEVVRMINVALLCTN  87



>ref|XP_010655563.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=972

 Score =   117 bits (293),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+  CLLDWA VLQ+  NLMEL+DP LG++F K
Sbjct  821  KADVYSFGVVALELVAGKNNMKYRPN-EDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKK  879

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  880  EEAIRMIKVALLCTN  894



>ref|XP_008366034.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Malus domestica]
Length=980

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K DVYSFGVVALE+ +GKNN+K+R   EN VCLLDWA VLQ+  NLMEL DP LGSDF+K
Sbjct  825  KVDVYSFGVVALELXSGKNNIKFRPY-ENYVCLLDWAFVLQQTGNLMELXDPXLGSDFNK  883

Query  181  EQALRMAKLALLCTNP  228
            EQA+RM K+A+LCTNP
Sbjct  884  EQAMRMIKVAILCTNP  899



>ref|XP_010655564.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=972

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+  CLLDWA VLQ+  NLMEL+DP LG++F K
Sbjct  821  KADVYSFGVVALELVAGKNNMKYRPN-EDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKK  879

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  880  EEAIRMIKVALLCTN  894



>ref|XP_010655562.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
Length=994

 Score =   117 bits (292),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+VAGKNN+KYR + E+  CLLDWA VLQ+  NLMEL+DP LG++F K
Sbjct  843  KADVYSFGVVALELVAGKNNMKYRPN-EDYFCLLDWAFVLQQKGNLMELVDPNLGTEFKK  901

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLCTN
Sbjct  902  EEAIRMIKVALLCTN  916



>ref|XP_007214549.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
 gb|EMJ15748.1| hypothetical protein PRUPE_ppa001005mg [Prunus persica]
Length=935

 Score =   117 bits (292),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/75 (73%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + EN VCL+DWALVLQ+   L+EL+DPRLGSD  +
Sbjct  784  KADVYSFGVVALEIVAGKNNMKYRPN-ENFVCLVDWALVLQQKGELLELVDPRLGSDVSE  842

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLC N
Sbjct  843  EEAIRMIKVALLCIN  857



>emb|CAN65055.1| hypothetical protein VITISV_012378 [Vitis vinifera]
Length=575

 Score =   115 bits (288),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + E+   LLDWA  LQ+  NLMEL+DP+L SDF+K
Sbjct  419  KADVYSFGVVALEIVAGKNNMKYRPN-EDYFSLLDWAFFLQQKGNLMELVDPKLESDFNK  477

Query  181  EQALRMAKLALLCTNP  228
            E+ LRM K++LLCTNP
Sbjct  478  EEVLRMIKISLLCTNP  493



>ref|XP_010655578.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Vitis vinifera]
Length=864

 Score =   116 bits (291),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KY+ + E+ VCLLDWA VLQ+  NLMEL+DP+LG+D +K
Sbjct  704  KADVYSFGVVALEIVAGKNNMKYKPN-EDYVCLLDWAFVLQQKGNLMELVDPKLGADLNK  762

Query  181  EQALRMAKLALLCTNP  228
            E+A  M K+ALLCTNP
Sbjct  763  EEAKIMIKVALLCTNP  778



>emb|CAE54078.1| receptor-like protein kinase [Fagus sylvatica]
Length=217

 Score =   110 bits (276),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLGS +  
Sbjct  57   KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGSSYSS  115

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  116  EEAMRMLNLALLCTNP  131



>ref|XP_010655575.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Vitis vinifera]
Length=986

 Score =   116 bits (291),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KY+ + E+ VCLLDWA VLQ+  NLMEL+DP+LG+D +K
Sbjct  826  KADVYSFGVVALEIVAGKNNMKYKPN-EDYVCLLDWAFVLQQKGNLMELVDPKLGADLNK  884

Query  181  EQALRMAKLALLCTNP  228
            E+A  M K+ALLCTNP
Sbjct  885  EEAKIMIKVALLCTNP  900



>ref|XP_010655576.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Vitis vinifera]
Length=985

 Score =   116 bits (291),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KY+ + E+ VCLLDWA VLQ+  NLMEL+DP+LG+D +K
Sbjct  825  KADVYSFGVVALEIVAGKNNMKYKPN-EDYVCLLDWAFVLQQKGNLMELVDPKLGADLNK  883

Query  181  EQALRMAKLALLCTNP  228
            E+A  M K+ALLCTNP
Sbjct  884  EEAKIMIKVALLCTNP  899



>ref|XP_010655574.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Vitis vinifera]
 emb|CBI30746.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score =   116 bits (291),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KY+ + E+ VCLLDWA VLQ+  NLMEL+DP+LG+D +K
Sbjct  848  KADVYSFGVVALEIVAGKNNMKYKPN-EDYVCLLDWAFVLQQKGNLMELVDPKLGADLNK  906

Query  181  EQALRMAKLALLCTNP  228
            E+A  M K+ALLCTNP
Sbjct  907  EEAKIMIKVALLCTNP  922



>ref|XP_010088631.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXB36793.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=924

 Score =   116 bits (290),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGV+ALEIVAGKNN++YR + EN VCLLDWA+ LQ+  NLM+L+DP+ GS+F+K
Sbjct  771  KADVYSFGVLALEIVAGKNNMRYRPN-ENFVCLLDWAIFLQQKGNLMDLVDPKSGSEFNK  829

Query  181  EQALRMAKLALLCTNP  228
            E+A RM K+ALLCTNP
Sbjct  830  EEANRMIKVALLCTNP  845



>ref|XP_006377493.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
 gb|ERP55290.1| hypothetical protein POPTR_0011s06440g [Populus trichocarpa]
Length=276

 Score =   111 bits (278),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  107  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  165

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  166  EEAERMIKAALLCTN  180



>ref|XP_004233025.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=1002

 Score =   115 bits (289),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/76 (72%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVV LE+VAGKNN+KY  D EN VCLLDWALVLQ+    +EL+DPRLGS +DK
Sbjct  848  KADLYSFGVVVLELVAGKNNMKYHPD-ENYVCLLDWALVLQKKGKFLELVDPRLGSYYDK  906

Query  181  EQALRMAKLALLCTNP  228
            E+ALRM K+AL CTNP
Sbjct  907  EEALRMIKVALRCTNP  922



>ref|XP_002300205.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
 gb|EEE85010.2| hypothetical protein POPTR_0001s31610g [Populus trichocarpa]
Length=1003

 Score =   115 bits (287),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAG NN+++R D E+ VCLLDWAL LQ+N ++MEL+DP+LGS FDK
Sbjct  849  KADVYSFGVVALEIVAGMNNMRFRHD-EDFVCLLDWALNLQQNGDIMELVDPKLGSGFDK  907

Query  181  EQALRMAKLALLCTN  225
            ++A+RM ++ALLCTN
Sbjct  908  KEAVRMIQVALLCTN  922



>ref|XP_010655586.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
 ref|XP_010655587.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Vitis vinifera]
Length=1006

 Score =   115 bits (287),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + E+   LLDWA  LQ+  NLMEL+DP+L SDF+K
Sbjct  850  KADVYSFGVVALEIVAGKNNMKYRPN-EDYFSLLDWAFFLQQKGNLMELVDPKLESDFNK  908

Query  181  EQALRMAKLALLCTNP  228
            E+ LRM K++LLCTNP
Sbjct  909  EEVLRMIKISLLCTNP  924



>ref|XP_002317383.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
 gb|EEE97995.2| hypothetical protein POPTR_0011s06220g [Populus trichocarpa]
Length=591

 Score =   114 bits (284),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  421  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  479

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  480  EEAERMIKAALLCTN  494



>ref|XP_006377501.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
 gb|ERP55298.1| hypothetical protein POPTR_0011s06490g [Populus trichocarpa]
Length=573

 Score =   113 bits (283),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  403  KADVYSFGVVALEIVSGKSNSSYRPQNEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  461

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  462  EEAERMIKAALLCTN  476



>emb|CAN81177.1| hypothetical protein VITISV_011951 [Vitis vinifera]
Length=868

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KY+ + E+ VCLLDWA V Q+  NLMEL+DP+LG+D +K
Sbjct  708  KADVYSFGVVALEIVAGKNNMKYKPN-EDYVCLLDWAFVXQQKGNLMELVDPKLGADLNK  766

Query  181  EQALRMAKLALLCTNP  228
            E+A  M K+ALLCTNP
Sbjct  767  EEAKIMIKVALLCTNP  782



>ref|XP_009351856.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Pyrus x bretschneideri]
Length=988

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 67/75 (89%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+++GKNNVKYR + EN VCLLDWALVL ++ NLMEL+D +LGS+F+K
Sbjct  843  KADVYSFGVVALELISGKNNVKYRPN-ENFVCLLDWALVLHQDGNLMELVDRKLGSEFNK  901

Query  181  EQALRMAKLALLCTN  225
            E+ALRM K+A+LC N
Sbjct  902  EEALRMIKVAVLCVN  916



>emb|CBI30748.3| unnamed protein product [Vitis vinifera]
Length=1017

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + E+   LLDWA  LQ+  NLMEL+DP+L SDF+K
Sbjct  861  KADVYSFGVVALEIVAGKNNMKYRPN-EDYFSLLDWAFFLQQKGNLMELVDPKLESDFNK  919

Query  181  EQALRMAKLALLCTNP  228
            E+ LRM K++LLCTNP
Sbjct  920  EEVLRMIKISLLCTNP  935



>ref|XP_006358075.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X1 [Solanum tuberosum]
Length=1002

 Score =   114 bits (286),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K D+YSFGVV LE+VAGKNN+KY  D EN VCLLDWALVLQ+    +EL+DPRLGS++DK
Sbjct  848  KVDLYSFGVVVLELVAGKNNMKYHPD-ENYVCLLDWALVLQKKAKFLELVDPRLGSNYDK  906

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM K+AL CTNP
Sbjct  907  KEALRMIKVALQCTNP  922



>ref|XP_009600347.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana tomentosiformis]
Length=1003

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVV LE+VAGKNN+KY + DEN VCLLDWALVLQ     +EL+DPRLGS+++K
Sbjct  848  KADLYSFGVVVLELVAGKNNMKY-NPDENYVCLLDWALVLQRKGKFLELVDPRLGSNYNK  906

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM K+ALLCTNP
Sbjct  907  KEALRMIKVALLCTNP  922



>ref|XP_010112408.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
 gb|EXC33466.1| putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase [Morus notabilis]
Length=941

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 66/75 (88%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADV+SF VVALEI+AG +N+KYR + EN VCL+DWALVLQ+  NLMEL+DP LGSDF+K
Sbjct  765  KADVFSFAVVALEILAGTSNMKYRPN-ENYVCLVDWALVLQQQGNLMELVDPNLGSDFNK  823

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+A+LCTN
Sbjct  824  EEAVRMIKIAILCTN  838



>ref|XP_009795508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nicotiana sylvestris]
Length=1003

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVV LE+VAGKNN+KY + DEN VCLLDWALVLQ     +EL+DPRLGS+++K
Sbjct  848  KADLYSFGVVVLELVAGKNNMKY-NPDENYVCLLDWALVLQRKGKFLELVDPRLGSNYNK  906

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM K+ALLCTNP
Sbjct  907  KEALRMIKVALLCTNP  922



>ref|XP_006358134.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=1028

 Score =   114 bits (285),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + E  VCLLDWALVLQ++  LMEL+D  L SDF K
Sbjct  876  KADVYSFGVVALEIVAGKNNMKYRPN-EKFVCLLDWALVLQKHGKLMELVDETLSSDFKK  934

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM  +ALLCTNP
Sbjct  935  DEALRMINVALLCTNP  950



>ref|XP_002317319.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
 gb|EEE97931.2| hypothetical protein POPTR_0011s032002g, partial [Populus trichocarpa]
Length=668

 Score =   113 bits (282),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA V Q+ ENLME++DP+L S+F+K
Sbjct  500  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVFQKKENLMEIVDPKLHSEFNK  558

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  559  EEAERMIKAALLCTN  573



>ref|XP_008225259.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Prunus mume]
Length=883

 Score =   114 bits (284),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIVAGK+N+KYR + EN VCLLDWALVLQ+   L+EL+DPRLGSD  +
Sbjct  720  KADVYSFGVVTLEIVAGKSNMKYRPN-ENFVCLLDWALVLQQKGELLELVDPRLGSDVSE  778

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLC N
Sbjct  779  EEAIRMIKVALLCIN  793



>ref|XP_006358077.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Solanum tuberosum]
Length=932

 Score =   114 bits (284),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K D+YSFGVV LE+VAGKNN+KY  D EN VCLLDWALVLQ+    +EL+DPRLGS++DK
Sbjct  778  KVDLYSFGVVVLELVAGKNNMKYHPD-ENYVCLLDWALVLQKKGKFLELVDPRLGSNYDK  836

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM K+AL CTNP
Sbjct  837  KEALRMIKVALRCTNP  852



>gb|AAL73330.1| putative receptor-like protein kinase RLPK1 [Glycine max]
Length=225

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  54   KADVYSFGVVALEIVSGKSNANYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSS  112

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM +LALLCTNP
Sbjct  113  EEAMRMLQLALLCTNP  128



>ref|XP_006371025.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
 gb|ERP48822.1| hypothetical protein POPTR_0019s027401g, partial [Populus trichocarpa]
Length=177

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  16   KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  74

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  75   KEVVRMINVALLCTN  89



>ref|XP_010316867.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Solanum lycopersicum]
Length=998

 Score =   113 bits (283),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGKNN+KYR + E  VCLLDWALVLQ++  LMEL+D  L SDF K
Sbjct  849  KADVYSFGVVALEIVAGKNNMKYRPN-EKFVCLLDWALVLQKHGKLMELVDETLNSDFKK  907

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM  +ALLCTNP
Sbjct  908  DEALRMINVALLCTNP  923



>ref|XP_006358076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like isoform X2 [Solanum tuberosum]
Length=883

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            K D+YSFGVV LE+VAGKNN+KY  D EN VCLLDWALVLQ+    +EL+DPRLGS++DK
Sbjct  729  KVDLYSFGVVVLELVAGKNNMKYHPD-ENYVCLLDWALVLQKKAKFLELVDPRLGSNYDK  787

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM K+AL CTNP
Sbjct  788  KEALRMIKVALRCTNP  803



>gb|KCW71078.1| hypothetical protein EUGRSUZ_F04177 [Eucalyptus grandis]
Length=771

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRLGSD+ K
Sbjct  600  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNVLELVDPRLGSDYSK  658

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  659  EEAMRMLNLALLCTNP  674



>ref|XP_011002049.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X6 [Populus euphratica]
Length=959

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  808  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  866

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  867  EEAERMIKAALLCTN  881



>ref|XP_011002044.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1007

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  856  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  914

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  915  EEAERMIKAALLCTN  929



>ref|XP_010095160.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC41541.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=179

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA V QE  NL+EL+DP LGS + K
Sbjct  14   KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVQQEQGNLLELVDPSLGSKYSK  72

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  +ALLCTNP
Sbjct  73   EEAMRMLNIALLCTNP  88



>ref|XP_011002048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X5 [Populus euphratica]
Length=963

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  812  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  870

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  871  EEAERMIKAALLCTN  885



>ref|XP_011002047.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=983

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  832  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  890

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  891  EEAERMIKAALLCTN  905



>ref|XP_011002045.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=985

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  834  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  892

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  893  EEAERMIKAALLCTN  907



>ref|XP_011002050.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X7 [Populus euphratica]
Length=1002

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  851  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  909

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  910  EEAERMIKAALLCTN  924



>gb|KDO35800.1| hypothetical protein CISIN_1g028061mg [Citrus sinensis]
Length=214

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+ Y   D NC C LDWA  L ++  LME +DPRLGS+F+K
Sbjct  14   KADVYSFGVVALEIVSGKNNMSY-VPDSNCTCPLDWAFHLHQSGTLMEFVDPRLGSEFNK  72

Query  181  EQALRMAKLALLCTN  225
             +A RM K+ALLCTN
Sbjct  73   VEAERMIKIALLCTN  87



>ref|XP_011002046.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=983

 Score =   112 bits (280),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/75 (72%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+ ENLME++DP+L S+F+K
Sbjct  832  KADVYSFGVVALEIVSGKSNSIYRPENEN-VCLLDWAHVLQKKENLMEIVDPKLQSEFNK  890

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  891  EEAERMIKAALLCTN  905



>ref|XP_004295405.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Fragaria vesca subsp. 
vesca]
Length=1351

 Score =   112 bits (281),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE V+GKNN+KYR   EN  CL+DWA VL +  NL+EL+DPRLGSDF+K
Sbjct  816  KADVYSFGVVALETVSGKNNMKYRPH-ENIQCLMDWAHVLHKKGNLLELVDPRLGSDFNK  874

Query  181  EQALRMAKLALLCTNP  228
            ++ALR  K+ALLC NP
Sbjct  875  KEALRTIKVALLCANP  890



>gb|KHN38783.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=296

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  131  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSP  189

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  190  EEAMRMLSLALLCTNP  205



>ref|XP_006377472.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
 gb|ERP55269.1| hypothetical protein POPTR_0011s06260g [Populus trichocarpa]
Length=582

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  457  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKGNLMEIVDPKLQSEFNK  515

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  516  EEAERMIKAALLCTN  530



>ref|XP_010063817.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1009

 Score =   112 bits (280),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRLGSD+ K
Sbjct  838  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNVLELVDPRLGSDYSK  896

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  897  EEAMRMLNLALLCTNP  912



>ref|XP_006377459.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
 gb|ERP55256.1| hypothetical protein POPTR_0011s06130g [Populus trichocarpa]
Length=585

 Score =   110 bits (276),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  393  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKGNLMEIVDPKLQSEFNK  451

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  452  EEAERMIKAALLCTN  466



>ref|XP_011046381.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Populus euphratica]
Length=992

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLDW L LQ++ ++ME++DPRLGS+F+K
Sbjct  833  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDWVLYLQKSGDIMEMVDPRLGSEFNK  891

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  892  KEVVRMINIALLCTN  906



>ref|XP_006495027.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=380

 Score =   108 bits (271),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+ Y   D NC C LDWA  L  +  LMEL+DPRLGS+FDK
Sbjct  180  KADVYSFGVVALEIVSGKNNMSY-VPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDK  238

Query  181  EQALRMAKLALLCTN  225
             +A RM K+ALLCTN
Sbjct  239  VEAERMIKVALLCTN  253



>ref|XP_008225260.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=983

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIVAGK+N+KYR + EN VCL+DWALVLQ+   L+EL+DPRLGSD  +
Sbjct  820  KADVYSFGVVTLEIVAGKSNMKYRPN-ENFVCLVDWALVLQKKGELLELVDPRLGSDVSE  878

Query  181  EQALRMAKLALLCTN  225
            E+A+RM K+ALLC N
Sbjct  879  EEAIRMIKVALLCIN  893



>ref|XP_007025267.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
 gb|EOY27889.1| Leucine-rich repeat transmembrane protein kinase, putative isoform 
1 [Theobroma cacao]
Length=1007

 Score =   112 bits (279),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALE VAGK N +Y   +E+ VCL DWALVLQ+  NLMEL+DP LG +F+K
Sbjct  858  KADVYSFGIVALETVAGKKNTRY-GPEEDFVCLQDWALVLQQKGNLMELVDPSLGGEFNK  916

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM K+ALLCTNP
Sbjct  917  EEAVRMIKVALLCTNP  932



>ref|XP_006371021.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
 gb|ERP48818.1| hypothetical protein POPTR_0019s027201g, partial [Populus trichocarpa]
Length=620

 Score =   110 bits (276),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD AL LQ+N ++ME++DPRLGS+F+K
Sbjct  461  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRALYLQKNGDIMEMVDPRLGSEFNK  519

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  520  KEVVRMINVALLCTN  534



>ref|XP_006388928.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
 gb|ERP47842.1| hypothetical protein POPTR_0073s00200g [Populus trichocarpa]
Length=415

 Score =   108 bits (270),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD AL LQ+N ++ME++DPRLGS+F+K
Sbjct  256  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRALYLQKNGDIMEMVDPRLGSEFNK  314

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  315  KEVVRMINVALLCTN  329



>ref|XP_006377482.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
 gb|ERP55279.1| hypothetical protein POPTR_0011s06335g [Populus trichocarpa]
Length=617

 Score =   110 bits (275),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  447  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHVLQKKGNLMEIMDPKLQSEFNK  505

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  506  EEAERMIKAALLCTN  520



>emb|CDO96888.1| unnamed protein product [Coffea canephora]
Length=1019

 Score =   111 bits (277),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAGK+N+ YR   E+ VCLLDWALVLQ+  +L+EL+DPRLGS+ ++
Sbjct  870  KADVYSFGIVALEIVAGKSNMSYRPS-EDYVCLLDWALVLQQRGSLVELVDPRLGSNINE  928

Query  181  EQALRMAKLALLCTNP  228
             +A+RM K+ALLCTNP
Sbjct  929  GEAIRMIKVALLCTNP  944



>gb|KCW67556.1| hypothetical protein EUGRSUZ_F01306 [Eucalyptus grandis]
Length=914

 Score =   110 bits (276),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRLGSD+ K
Sbjct  743  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWACVLQEQGNVLELVDPRLGSDYSK  801

Query  181  EQALRMAKLALLCTN  225
            E+A+RM  LALLCTN
Sbjct  802  EEAMRMLNLALLCTN  816



>ref|XP_004309629.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=710

 Score =   110 bits (275),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+KYR   EN  CL+DWA VL +  NL+EL+D RLGSDF K
Sbjct  550  KADVYSFGVVALEIVSGKNNMKYRPH-ENIQCLMDWAHVLHKKGNLLELVDQRLGSDFKK  608

Query  181  EQALRMAKLALLCTNP  228
            ++ALR  K+ALLC NP
Sbjct  609  KEALRTIKVALLCANP  624



>ref|XP_006377483.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
 gb|ERP55280.1| putative receptor-like protein kinase RLPK1 [Populus trichocarpa]
Length=642

 Score =   110 bits (274),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR ++EN VCLLDWA  LQ+  NLME++DP+L S+F+K
Sbjct  472  KADVYSFGVVALEIVSGKSNSSYRPENEN-VCLLDWAHALQKKGNLMEIVDPKLQSEFNK  530

Query  181  EQALRMAKLALLCTN  225
            E+A RM K ALLCTN
Sbjct  531  EEAERMIKAALLCTN  545



>ref|XP_006370931.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
 gb|ERP48728.1| hypothetical protein POPTR_0019s01880g [Populus trichocarpa]
Length=414

 Score =   107 bits (268),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAG +N+++R + E+  CLLDWAL L +N ++MEL+DPRLGSDF K
Sbjct  259  KADVYSFGIVALEIVAGMSNMRFRHN-ESFACLLDWALSLHQNGDVMELVDPRLGSDFKK  317

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  318  KEAARMIKVALLCTN  332



>ref|XP_002325753.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
 gb|EEF00135.2| hypothetical protein POPTR_0019s01950g [Populus trichocarpa]
Length=972

 Score =   110 bits (276),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLDW L LQ+N ++M ++DPRLGS+F+K
Sbjct  813  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDWVLYLQKNGDIMAMVDPRLGSEFNK  871

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  872  KEVVRMINVALLCTN  886



>ref|XP_008384518.1| PREDICTED: TMV resistance protein N-like isoform X1 [Malus domestica]
Length=915

 Score =   110 bits (275),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGK+N+KY  + EN VCL+DWALVLQ+  NL+EL+DP LGS F+ 
Sbjct  748  KADVYSFGVVALEIVAGKSNMKYIPN-ENLVCLVDWALVLQQKGNLIELVDPSLGSHFEV  806

Query  181  EQALRMAKLALLCTNP  228
            E+A+ M K+ALLC NP
Sbjct  807  EEAITMVKVALLCINP  822



>ref|XP_010665669.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X5 [Beta vulgaris subsp. vulgaris]
Length=858

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENE-NLMELIDPRLGSDFD  177
            KADVYSFGV ALEIVAG++N  ++ DD N  CLLDWA  LQ+ + N+MEL+DP+LG+D+ 
Sbjct  703  KADVYSFGVFALEIVAGRSNTNFKPDD-NYFCLLDWAFALQQQKGNIMELVDPKLGTDYK  761

Query  178  KEQALRMAKLALLCTNP  228
            KE+ LRM K+ALLCTNP
Sbjct  762  KEEVLRMIKIALLCTNP  778



>ref|XP_010665668.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X4 [Beta vulgaris subsp. vulgaris]
Length=862

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENE-NLMELIDPRLGSDFD  177
            KADVYSFGV ALEIVAG++N  ++ DD N  CLLDWA  LQ+ + N+MEL+DP+LG+D+ 
Sbjct  707  KADVYSFGVFALEIVAGRSNTNFKPDD-NYFCLLDWAFALQQQKGNIMELVDPKLGTDYK  765

Query  178  KEQALRMAKLALLCTNP  228
            KE+ LRM K+ALLCTNP
Sbjct  766  KEEVLRMIKIALLCTNP  782



>gb|KCW67547.1| hypothetical protein EUGRSUZ_F01301 [Eucalyptus grandis]
Length=918

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  Y  ++E  V LLDWA VLQE  N++EL+DPRLGSD+ +
Sbjct  747  KADVYSFGVVALEIVSGKSNTNYMPEEE-FVHLLDWAYVLQEQGNVLELVDPRLGSDYSE  805

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  806  EEAMRMLNLALLCTNP  821



>ref|XP_008384519.1| PREDICTED: TMV resistance protein N-like isoform X2 [Malus domestica]
Length=913

 Score =   110 bits (275),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGK+N+KY  + EN VCL+DWALVLQ+  NL+EL+DP LGS F+ 
Sbjct  746  KADVYSFGVVALEIVAGKSNMKYIPN-ENLVCLVDWALVLQQKGNLIELVDPSLGSHFEV  804

Query  181  EQALRMAKLALLCTNP  228
            E+A+ M K+ALLC NP
Sbjct  805  EEAITMVKVALLCINP  820



>ref|XP_010064483.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Eucalyptus grandis]
Length=1018

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  Y  ++E  V LLDWA VLQE  N++EL+DPRLGSD+ +
Sbjct  847  KADVYSFGVVALEIVSGKSNTNYMPEEE-FVHLLDWAYVLQEQGNVLELVDPRLGSDYSE  905

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  906  EEAMRMLNLALLCTNP  921



>ref|XP_010665667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X3 [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENE-NLMELIDPRLGSDFD  177
            KADVYSFGV ALEIVAG++N  ++ DD N  CLLDWA  LQ+ + N+MEL+DP+LG+D+ 
Sbjct  821  KADVYSFGVFALEIVAGRSNTNFKPDD-NYFCLLDWAFALQQQKGNIMELVDPKLGTDYK  879

Query  178  KEQALRMAKLALLCTNP  228
            KE+ LRM K+ALLCTNP
Sbjct  880  KEEVLRMIKIALLCTNP  896



>ref|XP_010060732.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1011

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 53/75 (71%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRLGSD+ K
Sbjct  840  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWACVLQEQGNVLELVDPRLGSDYSK  898

Query  181  EQALRMAKLALLCTN  225
            E+A+RM  LALLCTN
Sbjct  899  EEAMRMLNLALLCTN  913



>ref|XP_010272760.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840, partial [Nelumbo nucifera]
Length=983

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  +R  +E CV LLDWAL+L+E  NLM+L+DPRLGSDFDK
Sbjct  818  KADVYSFGVVALEIVSGRSNTSFRLKEE-CVDLLDWALILKERGNLMDLVDPRLGSDFDK  876

Query  181  EQALRMAKLALLCTN  225
             + +RM  +ALLCTN
Sbjct  877  GEVMRMINVALLCTN  891



>ref|XP_011045704.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=829

 Score =   110 bits (274),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAG NN+++R D E+ VCLLDWAL LQ+N ++MEL+DP LGS F+K
Sbjct  675  KADVYSFGVVALEIVAGMNNMRFRHD-EDFVCLLDWALNLQQNGDIMELVDPNLGSRFNK  733

Query  181  EQALRMAKLALLCTN  225
            ++A+ M K+ALLCTN
Sbjct  734  KEAVGMIKVALLCTN  748



>ref|XP_010665666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=999

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENE-NLMELIDPRLGSDFD  177
            KADVYSFGV ALEIVAG++N  ++ DD N  CLLDWA  LQ+ + N+MEL+DP+LG+D+ 
Sbjct  844  KADVYSFGVFALEIVAGRSNTNFKPDD-NYFCLLDWAFALQQQKGNIMELVDPKLGTDYK  902

Query  178  KEQALRMAKLALLCTNP  228
            KE+ LRM K+ALLCTNP
Sbjct  903  KEEVLRMIKIALLCTNP  919



>ref|XP_010665665.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1000

 Score =   110 bits (275),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 2/77 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENE-NLMELIDPRLGSDFD  177
            KADVYSFGV ALEIVAG++N  ++ DD N  CLLDWA  LQ+ + N+MEL+DP+LG+D+ 
Sbjct  845  KADVYSFGVFALEIVAGRSNTNFKPDD-NYFCLLDWAFALQQQKGNIMELVDPKLGTDYK  903

Query  178  KEQALRMAKLALLCTNP  228
            KE+ LRM K+ALLCTNP
Sbjct  904  KEEVLRMIKIALLCTNP  920



>ref|XP_006377525.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
 gb|ERP55322.1| putative receptor-like protein kinase RLPK1, partial [Populus 
trichocarpa]
Length=607

 Score =   109 bits (272),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  436  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHVLQKKGNLMEIVDPKLQSEFNK  494

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  495  EEAERMIKLALLCTN  509



>ref|XP_006388189.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
 gb|ERP47103.1| hypothetical protein POPTR_0294s002001g, partial [Populus trichocarpa]
Length=325

 Score =   107 bits (266),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  166  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  224

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  225  KEVVRMINVALLCTN  239



>ref|XP_006371019.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
 gb|ERP48816.1| hypothetical protein POPTR_0019s027001g, partial [Populus trichocarpa]
Length=599

 Score =   109 bits (272),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  440  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  498

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  499  KEVVRMINVALLCTN  513



>ref|XP_011046349.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1005

 Score =   110 bits (274),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLDW L LQ+N ++M+++DPR+G++F+K
Sbjct  846  KADVYSFGVVALEIVSGMNNVKFRRD-ENVVCLLDWVLYLQKNGDIMDMVDPRMGAEFNK  904

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  905  KEVVRMINVALLCTN  919



>ref|XP_011046350.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=1003

 Score =   110 bits (274),  Expect = 9e-26, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLDW L LQ+N ++M+++DPR+G++F+K
Sbjct  844  KADVYSFGVVALEIVSGMNNVKFRRD-ENVVCLLDWVLYLQKNGDIMDMVDPRMGAEFNK  902

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  903  KEVVRMINVALLCTN  917



>gb|KCW67550.1| hypothetical protein EUGRSUZ_F013052, partial [Eucalyptus grandis]
Length=337

 Score =   106 bits (265),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N +EL+DPRLGS++ +
Sbjct  166  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNFLELVDPRLGSNYSE  224

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  225  EEAMRMLNLALLCTNP  240



>gb|ACM89476.1| leucine-rich repeat family protein / protein kinase family protein 
[Glycine max]
Length=631

 Score =   109 bits (272),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  466  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLGSKYSP  524

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  525  EEAMRMLSLALLCTNP  540



>emb|CBI30750.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   108 bits (269),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALEIV+GKNN  Y+ ++E CVCLLD A VLQ+  +LME++DP+LGS+F++
Sbjct  383  KADIYSFGVVALEIVSGKNNTSYKPENE-CVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQ  441

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  442  DEAERMIKVALLCTN  456



>ref|XP_006370936.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
 gb|ERP48733.1| hypothetical protein POPTR_0019s01930g [Populus trichocarpa]
Length=580

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAG +N+ ++ + E+  CLLDWAL LQ+N ++MEL+DPRLGSDF K
Sbjct  425  KADVYSFGIVALEIVAGMSNMSFQHN-ESFACLLDWALSLQQNGDMMELVDPRLGSDFKK  483

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  484  KEAARMIKVALLCTN  498



>ref|XP_002528777.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF33599.1| ATP binding protein, putative [Ricinus communis]
Length=1007

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV GK+N+K+R D EN VCLLDWALVL +  +L++L+D RL S F K
Sbjct  826  KADVYSFGVVALEIVVGKSNMKFRPD-ENFVCLLDWALVLHQKGDLLKLVDERLESKFSK  884

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM K+ALLCTNP
Sbjct  885  KEAVRMIKVALLCTNP  900



>ref|XP_008245184.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Prunus mume]
Length=1005

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIVAGK+N+KYR + EN VCL+DWA+VLQ+   L+EL+DPRLGSD  +
Sbjct  842  KADVYSFGVVTLEIVAGKSNMKYRPN-ENFVCLVDWAIVLQQKGELLELVDPRLGSDVSE  900

Query  181  EQALRMAKLALLCTN  225
            E+ +RM K+ALLC N
Sbjct  901  EEVIRMIKVALLCIN  915



>ref|XP_006847775.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
 gb|ERN09356.1| hypothetical protein AMTR_s00162p00056910 [Amborella trichopoda]
Length=559

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E CV LLDWA VLQE  +L+EL+DP LGS++ K
Sbjct  382  KADVYSFGIVALEIVSGKSNTNYRPKEE-CVYLLDWAYVLQEKGSLLELVDPELGSNYSK  440

Query  181  EQALRMAKLALLCTNP  228
            ++AL+M  + LLCTNP
Sbjct  441  DEALKMLNVGLLCTNP  456



>ref|XP_011045702.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
 ref|XP_011045703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=1006

 Score =   109 bits (273),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAG NN+++R D E+ VCLLDWAL LQ+N ++MEL+DP LGS F+K
Sbjct  852  KADVYSFGVVALEIVAGMNNMRFRHD-EDFVCLLDWALNLQQNGDIMELVDPNLGSRFNK  910

Query  181  EQALRMAKLALLCTN  225
            ++A+ M K+ALLCTN
Sbjct  911  KEAVGMIKVALLCTN  925



>ref|XP_006377507.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
 gb|ERP55304.1| hypothetical protein POPTR_0011s065502g, partial [Populus trichocarpa]
Length=387

 Score =   106 bits (265),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  +R+ +E  VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  248  KADVYSFGVVALEIVSGRSNSSHRTTNE-FVCLLDWARVLQKKGNLMEIVDPKLQSEFNK  306

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  307  EEAERMIKLALLCTN  321



>ref|XP_010088632.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB36794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=617

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALE+VAG +N K+   DE+ VCLLDWALV Q+   LM L+DPRLGSDF+ 
Sbjct  472  KADVYSFGIVALELVAGISNTKF-GPDEDYVCLLDWALVSQQKGKLMRLVDPRLGSDFNT  530

Query  181  EQALRMAKLALLCTNP  228
            E+A RM K+AL CTNP
Sbjct  531  EEAARMIKVALQCTNP  546



>ref|XP_011101928.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Sesamum indicum]
Length=815

 Score =   108 bits (271),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIVAGK+N+K+ S  EN  CLLDWALVLQ+  +LMEL+DPRLGS+F+K
Sbjct  660  KADVYSFGVVALEIVAGKSNMKF-SPSENFFCLLDWALVLQKKGSLMELVDPRLGSNFNK  718

Query  181  EQALRMAKLALLCTNP  228
             +A ++ ++ALLCT+P
Sbjct  719  NEAEKIIRVALLCTSP  734



>ref|XP_006377518.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
 gb|ERP55315.1| hypothetical protein POPTR_0011s066201g, partial [Populus trichocarpa]
Length=662

 Score =   108 bits (270),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA V+Q+  NLME++DP+L S+F+K
Sbjct  542  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHVVQKKGNLMEMVDPKLQSEFNK  600

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  601  EEAERMIKLALLCTN  615



>emb|CAN66180.1| hypothetical protein VITISV_025180 [Vitis vinifera]
Length=561

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+G++N  YR  +E C  LLDWAL L+E  NLM+L+DPRLGSDF+K
Sbjct  397  KADVYSFGIVALEIVSGRSNTTYRPKEE-CTYLLDWALSLKEKGNLMDLVDPRLGSDFNK  455

Query  181  EQALRMAKLALLCTN  225
            E+ + M  LALLCTN
Sbjct  456  EEVMAMLNLALLCTN  470



>ref|XP_006467585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1-like [Citrus sinensis]
Length=1045

 Score =   108 bits (271),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+ Y   D NC C LDWA  L  +  LMEL+DPRLGS+FDK
Sbjct  845  KADVYSFGVVALEIVSGKNNMSY-VPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFDK  903

Query  181  EQALRMAKLALLCTN  225
             +A RM K+ALLCTN
Sbjct  904  VEAERMIKVALLCTN  918



>ref|XP_006371027.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
 gb|ERP48824.1| hypothetical protein POPTR_0019s02760g [Populus trichocarpa]
Length=781

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  622  KADVYSFGVVALEIVSGTNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  680

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  681  KEVVRMINVALLCTN  695



>ref|XP_006377521.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
 gb|ERP55318.1| hypothetical protein POPTR_0011s06650g [Populus trichocarpa]
Length=331

 Score =   105 bits (262),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA V+Q+  NLME++DP+L S+F+K
Sbjct  160  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHVVQKKGNLMEMVDPKLQSEFNK  218

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  219  EEAERMIKLALLCTN  233



>ref|XP_011046363.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X5 [Populus euphratica]
Length=833

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  674  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  732

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  733  KEVVRMINVALLCTN  747



>ref|XP_010655585.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=861

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALEIV+GKNN  Y+ ++E CVCLLD A VLQ+  +LME++DP+LGS+F++
Sbjct  722  KADIYSFGVVALEIVSGKNNTSYKPENE-CVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQ  780

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  781  DEAERMIKVALLCTN  795



>ref|XP_010060733.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score =   108 bits (270),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N +EL+DPRLGS++ +
Sbjct  839  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNFLELVDPRLGSNYSE  897

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  898  EEAMRMLNLALLCTNP  913



>ref|XP_010041838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=607

 Score =   107 bits (267),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRLGS++ +
Sbjct  436  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQERGNVLELVDPRLGSNYSE  494

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  495  EEAMRMLNLALLCTNP  510



>emb|CBI20154.3| unnamed protein product [Vitis vinifera]
Length=1181

 Score =   108 bits (270),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1     KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
             KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE ENL+EL+DP LGS + K
Sbjct  1007  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQENLLELVDPSLGSKYSK  1065

Query  181   EQALRMAKLALLCTNP  228
             E+A RM  LALLC NP
Sbjct  1066  EEAQRMLNLALLCANP  1081



>ref|XP_006582117.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Glycine max]
Length=1012

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  847  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSP  905

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  906  EEAMRMLSLALLCTNP  921



>ref|XP_006388878.1| hypothetical protein POPTR_0084s002301g, partial [Populus trichocarpa]
 gb|ERP47792.1| hypothetical protein POPTR_0084s002301g, partial [Populus trichocarpa]
Length=584

 Score =   107 bits (266),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VL E  NL+EL+DPRLGS + K
Sbjct  417  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLHERNNLLELVDPRLGSSYSK  475

Query  181  EQALRMAKLALLCTN  225
            E+A++M  LALLCTN
Sbjct  476  EEAMKMLNLALLCTN  490



>ref|XP_010655583.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=988

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALEIV+GKNN  Y+ ++E CVCLLD A VLQ+  +LME++DP+LGS+F++
Sbjct  849  KADIYSFGVVALEIVSGKNNTSYKPENE-CVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQ  907

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  908  DEAERMIKVALLCTN  922



>ref|XP_007133298.1| hypothetical protein PHAVU_011G167800g [Phaseolus vulgaris]
 gb|ESW05292.1| hypothetical protein PHAVU_011G167800g [Phaseolus vulgaris]
Length=917

 Score =   107 bits (268),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS + +
Sbjct  841  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSQ  899

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  900  EEAMRMLSLALLCTNP  915



>ref|XP_010655584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=975

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 65/75 (87%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALEIV+GKNN  Y+ ++E CVCLLD A VLQ+  +LME++DP+LGS+F++
Sbjct  836  KADIYSFGVVALEIVSGKNNTSYKPENE-CVCLLDLAFVLQQRGSLMEIVDPKLGSEFNQ  894

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  895  DEAERMIKVALLCTN  909



>gb|KHN42594.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1011

 Score =   108 bits (269),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  846  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLGSKYSP  904

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  905  EEAMRMLSLALLCTNP  920



>ref|XP_011014230.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=980

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  821  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  879

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  880  KEVVRMINVALLCTN  894



>emb|CAN81779.1| hypothetical protein VITISV_034284 [Vitis vinifera]
Length=970

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE ENL+EL+DP LGS + K
Sbjct  796  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQENLLELVDPSLGSKYSK  854

Query  181  EQALRMAKLALLCTNP  228
            E+A RM  LALLC NP
Sbjct  855  EEAQRMLNLALLCANP  870



>ref|XP_006370083.1| hypothetical protein POPTR_0001s393801g, partial [Populus trichocarpa]
 gb|ERP66652.1| hypothetical protein POPTR_0001s393801g, partial [Populus trichocarpa]
Length=620

 Score =   107 bits (266),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VL E  NL+EL+DPRLGS + K
Sbjct  456  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLHERNNLLELVDPRLGSSYSK  514

Query  181  EQALRMAKLALLCTN  225
            E+A++M  LALLCTN
Sbjct  515  EEAMKMLNLALLCTN  529



>ref|XP_006592614.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Glycine max]
Length=1011

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N KYR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  846  KADVYSFGVVALEIVSGKSNTKYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLGSKYSP  904

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  905  EEAMRMLSLALLCTNP  920



>gb|KHN36920.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=1023

 Score =   107 bits (268),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  852  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSS  910

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM +LALLCTNP
Sbjct  911  EEAMRMLQLALLCTNP  926



>ref|NP_001238159.1| receptor-like serine/threonine kinase [Glycine max]
 gb|ACJ37422.1| receptor-like serine/threonine kinase [Glycine max]
Length=1321

 Score =   108 bits (269),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1     KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
             KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  1138  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSKYSS  1196

Query  181   EQALRMAKLALLCTNP  228
             E+A+RM +LALLCTNP
Sbjct  1197  EEAMRMLQLALLCTNP  1212



>ref|XP_006377456.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
 gb|ERP55253.1| hypothetical protein POPTR_0011s06100g [Populus trichocarpa]
Length=555

 Score =   106 bits (265),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  +R+ +E  VCLLDWA VLQ+  NLME++DP+L S+F+K
Sbjct  385  KADVYSFGVVALEIVSGRSNSSHRTTNE-FVCLLDWAHVLQKKGNLMEIVDPKLQSEFNK  443

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  444  EEAERMIKLALLCTN  458



>ref|XP_006370088.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66657.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=728

 Score =   107 bits (267),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ K
Sbjct  553  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNYSK  611

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  612  TEALRMLNLALLCTNP  627



>emb|CBI20124.3| unnamed protein product [Vitis vinifera]
Length=1036

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+G++N  YR  +E C  LLDWAL L+E  NLM+L+DPRLGSDF+K
Sbjct  872  KADVYSFGIVALEIVSGRSNTTYRPKEE-CTYLLDWALSLKEKGNLMDLVDPRLGSDFNK  930

Query  181  EQALRMAKLALLCTN  225
            E+ + M  +ALLCTN
Sbjct  931  EEVMAMLNIALLCTN  945



>ref|XP_011014228.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  845  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  903

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  904  KEVVRMINVALLCTN  918



>ref|XP_011014227.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
Length=1004

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  845  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  903

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  904  KEVVRMINVALLCTN  918



>ref|XP_011046359.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X1 [Populus euphratica]
 ref|XP_011046361.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1004

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  845  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  903

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  904  KEVVRMINVALLCTN  918



>ref|XP_011014229.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X3 [Populus euphratica]
Length=1002

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  843  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  901

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  902  KEVVRMINVALLCTN  916



>ref|XP_010644091.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Vitis vinifera]
Length=1012

 Score =   107 bits (268),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE ENL+EL+DP LGS + K
Sbjct  838  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQENLLELVDPSLGSKYSK  896

Query  181  EQALRMAKLALLCTNP  228
            E+A RM  LALLC NP
Sbjct  897  EEAQRMLNLALLCANP  912



>ref|XP_011046365.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X7 [Populus euphratica]
Length=1002

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  843  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  901

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  902  KEVVRMINVALLCTN  916



>gb|KCW71080.1| hypothetical protein EUGRSUZ_F04179 [Eucalyptus grandis]
Length=912

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+D RLGS++ K
Sbjct  741  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNVLELVDSRLGSNYSK  799

Query  181  EQALRMAKLALLCTNP  228
            E+A+R+  LALLCTNP
Sbjct  800  EEAMRLLNLALLCTNP  815



>ref|XP_011046362.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X4 [Populus euphratica]
Length=1004

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  845  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  903

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  904  KEVVRMINVALLCTN  918



>ref|XP_007021933.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
 gb|EOY13458.1| Leucine-rich repeat transmembrane protein kinase isoform 1 [Theobroma 
cacao]
Length=1010

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS + K
Sbjct  846  KADVYSFGVVLLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSHYSK  904

Query  181  EQALRMAKLALLCTNP  228
            E+ALRM  LALLCTNP
Sbjct  905  EEALRMLNLALLCTNP  920



>ref|XP_011046364.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X6 [Populus euphratica]
Length=1002

 Score =   107 bits (267),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  843  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  901

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  902  KEVVRMINVALLCTN  916



>ref|XP_011046360.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Populus euphratica]
Length=1004

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G NNVK+R D EN VCLLD  L LQ+N ++ME++DPRLGS+F+K
Sbjct  845  KADVYSFGVVALEIVSGMNNVKFRRD-ENFVCLLDRVLYLQKNGDIMEMVDPRLGSEFNK  903

Query  181  EQALRMAKLALLCTN  225
            ++ +RM  +ALLCTN
Sbjct  904  KEVVRMINVALLCTN  918



>ref|XP_010065089.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1011

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+D RLGS++ K
Sbjct  840  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNVLELVDSRLGSNYSK  898

Query  181  EQALRMAKLALLCTNP  228
            E+A+R+  LALLCTNP
Sbjct  899  EEAMRLLNLALLCTNP  914



>ref|XP_007149544.1| hypothetical protein PHAVU_005G0791000g, partial [Phaseolus vulgaris]
 gb|ESW21538.1| hypothetical protein PHAVU_005G0791000g, partial [Phaseolus vulgaris]
Length=884

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL++L+DP LGS +  
Sbjct  725  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLDLVDPSLGSKYSS  783

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM +LALLCTNP
Sbjct  784  EEAMRMLQLALLCTNP  799



>ref|XP_006449566.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
 gb|ESR62806.1| hypothetical protein CICLE_v10014125mg [Citrus clementina]
Length=1024

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GKNN+ Y   D NC C LDWA  L  +  LMEL+DPRLGS+F+K
Sbjct  824  KADVYSFGVVALEIVSGKNNMSY-VPDSNCTCPLDWAFHLHRSGTLMELVDPRLGSEFNK  882

Query  181  EQALRMAKLALLCTN  225
             +A RM K+ALLCTN
Sbjct  883  VEAERMIKIALLCTN  897



>ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Vitis vinifera]
Length=1007

 Score =   107 bits (267),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+G++N  YR  +E C  LLDWAL L+E  NLM+L+DPRLGSDF+K
Sbjct  843  KADVYSFGIVALEIVSGRSNTTYRPKEE-CTYLLDWALSLKEKGNLMDLVDPRLGSDFNK  901

Query  181  EQALRMAKLALLCTN  225
            E+ + M  +ALLCTN
Sbjct  902  EEVMAMLNIALLCTN  916



>ref|XP_010272675.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Nelumbo nucifera]
Length=162

 Score =   100 bits (250),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR   E+ V LLDW  VL+E  NL+EL+DP L S++ K
Sbjct  8    KADVYSFGVVLLEIVSGKSNTSYR-PKEDFVYLLDWTYVLEEQGNLLELVDPILESNYSK  66

Query  181  EQALRMAKLALLCTNP  228
            E+ALRM  LALLCTNP
Sbjct  67   EEALRMLNLALLCTNP  82



>gb|KDP27082.1| hypothetical protein JCGZ_20306 [Jatropha curcas]
Length=1030

 Score =   107 bits (267),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/76 (70%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGSD+ K
Sbjct  855  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELMDPSLGSDYSK  913

Query  181  EQALRMAKLALLCTNP  228
            E+A R+  LALLCTNP
Sbjct  914  EEAKRVLNLALLCTNP  929



>ref|XP_011046351.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 [Populus euphratica]
Length=1022

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIVAG +N+ ++ + E+ VCLLDWAL LQ+N ++MEL+DPRLGSDF K
Sbjct  867  KADVYSFGIVALEIVAGMSNMSFQHN-ESFVCLLDWALSLQQNGDIMELVDPRLGSDFKK  925

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ LLCTN
Sbjct  926  KEAARMIKVTLLCTN  940



>ref|XP_011002041.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Populus euphratica]
Length=1009

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA  LQ+  NLME++DP+L S+F+K
Sbjct  855  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHGLQKKRNLMEIVDPKLQSEFNK  913

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  914  EEAERMIKLALLCTN  928



>ref|XP_011002042.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X4 [Populus euphratica]
Length=1002

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA  LQ+  NLME++DP+L S+F+K
Sbjct  831  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHGLQKKRNLMEIVDPKLQSEFNK  889

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  890  EEAERMIKLALLCTN  904



>ref|XP_002316847.1| receptor-like protein kinase [Populus trichocarpa]
 gb|EEE97459.1| receptor-like protein kinase [Populus trichocarpa]
Length=1015

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ +
Sbjct  855  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLGSNYSE  913

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  914  EEAMRMLNLALLCTNP  929



>ref|XP_011002040.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Populus euphratica]
Length=1024

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA  LQ+  NLME++DP+L S+F+K
Sbjct  853  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHGLQKKRNLMEIVDPKLQSEFNK  911

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  912  EEAERMIKLALLCTN  926



>ref|XP_011002039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Populus euphratica]
Length=1026

 Score =   107 bits (266),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA  LQ+  NLME++DP+L S+F+K
Sbjct  855  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHGLQKKRNLMEIVDPKLQSEFNK  913

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  914  EEAERMIKLALLCTN  928



>ref|XP_006370097.1| hypothetical protein POPTR_0001s394901g, partial [Populus trichocarpa]
 gb|ERP66666.1| hypothetical protein POPTR_0001s394901g, partial [Populus trichocarpa]
Length=784

 Score =   106 bits (264),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ K
Sbjct  608  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNYSK  666

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  667  IEALRMLNLALLCTNP  682



>ref|XP_006388874.1| hypothetical protein POPTR_0084s00200g [Populus trichocarpa]
 gb|ERP47788.1| hypothetical protein POPTR_0084s00200g [Populus trichocarpa]
Length=177

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  +R+  E+ V LLDWALVL+E   L+EL+DP+LG D++K
Sbjct  14   KADVYSFGIVALEIVSGKSNTSHRTK-EDTVYLLDWALVLKEKGTLLELVDPKLGQDYNK  72

Query  181  EQALRMAKLALLCTN  225
            E+A+ M  +ALLC+N
Sbjct  73   EEAITMINVALLCSN  87



>gb|KCW67548.1| hypothetical protein EUGRSUZ_F01302 [Eucalyptus grandis]
Length=663

 Score =   105 bits (263),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRL S++ +
Sbjct  492  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQERGNVLELVDPRLDSNYSE  550

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  551  EEAMRMLNLALLCTNP  566



>ref|XP_011044591.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Populus euphratica]
Length=1015

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ +
Sbjct  855  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLGSNYSE  913

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  914  EEAMRMLNLALLCTNP  929



>ref|XP_006370087.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
 gb|ERP66656.1| hypothetical protein POPTR_0001s39420g [Populus trichocarpa]
Length=900

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ K
Sbjct  725  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNYSK  783

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  784  TEALRMLNLALLCTNP  799



>ref|XP_009406148.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Musa acuminata subsp. malaccensis]
Length=1007

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G +N KYR + E+CV LLDWA V  E  NL+EL+DP LGS F  
Sbjct  856  KADVYSFGVVALEIVSGMSNTKYRPE-EDCVYLLDWAYVCHEKGNLLELVDPALGSSFST  914

Query  181  EQALRMAKLALLCTN  225
            E+AL+M KLALLCTN
Sbjct  915  EEALQMLKLALLCTN  929



>ref|XP_006370091.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
 gb|ERP66660.1| hypothetical protein POPTR_0001s39450g [Populus trichocarpa]
Length=994

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ K
Sbjct  819  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNYSK  877

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  878  TEALRMLNLALLCTNP  893



>ref|XP_006370084.1| hypothetical protein POPTR_0001s39390g [Populus trichocarpa]
 gb|ERP66653.1| hypothetical protein POPTR_0001s39390g [Populus trichocarpa]
Length=1053

 Score =   106 bits (265),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++ K
Sbjct  878  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNYSK  936

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  937  TEALRMLNLALLCTNP  952



>gb|KCW48261.1| hypothetical protein EUGRSUZ_K019901, partial [Eucalyptus grandis]
Length=173

 Score =   100 bits (248),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFG+VALE+V+G++N   +  +E C  LLDWA  L+E  NL+EL+DPRLGSDFDK
Sbjct  16   KADIYSFGIVALEVVSGQSNTSSQKTEE-CFILLDWAHFLKERGNLIELVDPRLGSDFDK  74

Query  181  EQALRMAKLALLCTN  225
            E+ L + K+AL+CTN
Sbjct  75   EEVLALIKVALMCTN  89



>ref|XP_011002772.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Populus euphratica]
Length=1033

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS + K
Sbjct  858  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSSYSK  916

Query  181  EQALRMAKLALLCTNP  228
             +ALRM  LALLCTNP
Sbjct  917  TEALRMLNLALLCTNP  932



>ref|XP_011009667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X2 [Populus euphratica]
Length=515

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  Y   +E+ VCLLDWA VLQ+  NLM L+DP+L S+F+K
Sbjct  344  KADVYSFGVVALEIVSGRSNSSYNPTNES-VCLLDWAFVLQKRGNLMALVDPKLRSEFNK  402

Query  181  EQALRMAKLALLCTN  225
            E+A +M K+ALLCTN
Sbjct  403  EEAEKMIKVALLCTN  417



>ref|XP_011009666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Populus euphratica]
Length=515

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  Y   +E+ VCLLDWA VLQ+  NLM L+DP+L S+F+K
Sbjct  344  KADVYSFGVVALEIVSGRSNSSYNPTNES-VCLLDWAFVLQKRGNLMALVDPKLRSEFNK  402

Query  181  EQALRMAKLALLCTN  225
            E+A +M K+ALLCTN
Sbjct  403  EEAEKMIKVALLCTN  417



>gb|KCW84079.1| hypothetical protein EUGRSUZ_B00960 [Eucalyptus grandis]
Length=579

 Score =   104 bits (260),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE V+GK+N  YRS +E+ V LLDWA  LQE  +++EL+DPRLGS++ +
Sbjct  494  KADVYSFGVVALETVSGKSNTNYRSKEES-VYLLDWAHGLQEQGHVLELMDPRLGSNYSE  552

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  553  EEAMRMLNLALLCTNP  568



>ref|XP_010093471.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB54095.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=954

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA V QE  NL+EL+DP LGS++ K
Sbjct  777  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVQQEQGNLLELVDPSLGSNYSK  835

Query  181  EQALRMAKLALLCTNP  228
            E+AL M  LALLCTNP
Sbjct  836  EEALTMLNLALLCTNP  851



>emb|CBI30754.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GKNN  Y + D  C CLLDWA VL++  +LMEL+DP LG++F+K
Sbjct  393  KADVYSFGVVTLEIVSGKNNSNY-TPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNK  451

Query  181  EQALRMAKLALLCTN  225
            ++A  M K+ALLCTN
Sbjct  452  KEAETMIKVALLCTN  466



>ref|XP_011014343.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Populus euphratica]
Length=898

 Score =   105 bits (262),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VL E  NL+EL+DPRLGS + K
Sbjct  731  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLHERNNLLELVDPRLGSSYSK  789

Query  181  EQALRMAKLALLCTN  225
            E+A++M  LALLCTN
Sbjct  790  EEAMKMLNLALLCTN  804



>ref|XP_002522279.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF40137.1| ATP binding protein, putative [Ricinus communis]
Length=988

 Score =   105 bits (263),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/78 (71%), Positives = 65/78 (83%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLG--SDF  174
            KADVYSFGVVALEIV+GKNN+K R DD+  VCLLDWALVL ++ NLMEL+DPRL   S F
Sbjct  827  KADVYSFGVVALEIVSGKNNMKRRPDDD-FVCLLDWALVLHQDGNLMELVDPRLDLKSKF  885

Query  175  DKEQALRMAKLALLCTNP  228
            +KE  LR+ ++ALLCTNP
Sbjct  886  EKE-VLRVIEVALLCTNP  902



>ref|XP_010036446.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Eucalyptus grandis]
Length=167

 Score = 99.8 bits (247),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALE+V G++N   +  +E C  LLDWA  L+E ENL+EL+DPRLGS F+K
Sbjct  14   KADIYSFGVVALEVVNGRSNTSSQRTEE-CFNLLDWAHFLKEGENLIELVDPRLGSHFNK  72

Query  181  EQALRMAKLALLCTN  225
            E+AL + K+AL+CTN
Sbjct  73   EEALALIKVALMCTN  87



>ref|XP_009772943.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Nicotiana sylvestris]
Length=1011

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLGS + K
Sbjct  841  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGSSYSK  899

Query  181  EQALRMAKLALLCTNP  228
            ++ ++M  L LLCTNP
Sbjct  900  KEVMQMINLGLLCTNP  915



>ref|XP_011002770.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Populus euphratica]
Length=989

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VL E  NL+EL+DPRLGS + K
Sbjct  822  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLHERNNLLELVDPRLGSSYSK  880

Query  181  EQALRMAKLALLCTN  225
            E+A++M  LALLCTN
Sbjct  881  EEAMKMLNLALLCTN  895



>ref|XP_010060734.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Eucalyptus grandis]
Length=1010

 Score =   105 bits (262),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  N++EL+DPRL S++ +
Sbjct  839  KADVYSFGVVTLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQERGNVLELVDPRLDSNYSE  897

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLCTNP
Sbjct  898  EEAMRMLNLALLCTNP  913



>ref|XP_009619428.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Nicotiana tomentosiformis]
Length=1016

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLGS + K
Sbjct  846  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGSSYSK  904

Query  181  EQALRMAKLALLCTNP  228
            ++ ++M  L LLCTNP
Sbjct  905  KEVMQMINLGLLCTNP  920



>ref|XP_010272741.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650 isoform X1 [Nelumbo nucifera]
Length=1008

 Score =   105 bits (262),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G+ N  YR   + C CLLDWA +LQ+ E+L+EL+DPRLGSDF++
Sbjct  849  KADVYSFGVVALEIVSGRTNSTYRPKSD-CTCLLDWAFLLQKRESLLELVDPRLGSDFNR  907

Query  181  EQALRMAKLALLC  219
            ++  RM K+ALLC
Sbjct  908  QEVERMIKVALLC  920



>gb|KEH38591.1| LRR receptor-like kinase [Medicago truncatula]
Length=916

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G +N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  753  KADVYSFGVVALEIVSGMSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPTLGSKYSS  811

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM +LALLCTNP
Sbjct  812  EEAMRMLQLALLCTNP  827



>ref|XP_010272742.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 isoform X2 [Nelumbo nucifera]
Length=954

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 60/73 (82%), Gaps = 1/73 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G+ N  YR   + C CLLDWA +LQ+ E+L+EL+DPRLGSDF++
Sbjct  795  KADVYSFGVVALEIVSGRTNSTYRPKSD-CTCLLDWAFLLQKRESLLELVDPRLGSDFNR  853

Query  181  EQALRMAKLALLC  219
            ++  RM K+ALLC
Sbjct  854  QEVERMIKVALLC  866



>ref|XP_010313922.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=919

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLG+++ K
Sbjct  745  KADVYSFGVVLLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGTNYSK  803

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  ++LLCTNP
Sbjct  804  KEAMRMINVSLLCTNP  819



>ref|XP_004295408.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=1071

 Score =   105 bits (261),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 57/108 (53%), Positives = 67/108 (62%), Gaps = 34/108 (31%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDW------------------------  108
            KADVYSFGVVALE+V+GKNN+KYR  +EN VCLLDW                        
Sbjct  881  KADVYSFGVVALELVSGKNNIKYRP-NENFVCLLDWVRSSLYPIRMASYLFAGIVFLITN  939

Query  109  ---------ALVLQENENLMELIDPRLGSDFDKEQALRMAKLALLCTN  225
                     ALVLQ+  NLMEL+DP+LGS F+KE+ALRM K+ALLC N
Sbjct  940  FTSISSPMQALVLQQKGNLMELVDPKLGSGFNKEEALRMIKVALLCAN  987



>ref|XP_010655590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X3 [Vitis vinifera]
Length=865

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GKNN  Y + D  C CLLDWA VL++  +LMEL+DP LG++F+K
Sbjct  718  KADVYSFGVVTLEIVSGKNNSNY-TPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNK  776

Query  181  EQALRMAKLALLCTN  225
            ++A  M K+ALLCTN
Sbjct  777  KEAETMIKVALLCTN  791



>ref|XP_003596262.1| Receptor-like serine/threonine kinase [Medicago truncatula]
 gb|AES66513.1| LRR receptor-like kinase [Medicago truncatula]
Length=1011

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G +N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS +  
Sbjct  848  KADVYSFGVVALEIVSGMSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPTLGSKYSS  906

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM +LALLCTNP
Sbjct  907  EEAMRMLQLALLCTNP  922



>ref|XP_006358931.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Solanum tuberosum]
Length=1020

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLG+ + K
Sbjct  846  KADVYSFGVVLLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGTHYSK  904

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  ++LLCTNP
Sbjct  905  KEAMRMINISLLCTNP  920



>ref|XP_004251900.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
 ref|XP_010313921.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Solanum lycopersicum]
Length=1018

 Score =   104 bits (260),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DPRLG+++ K
Sbjct  844  KADVYSFGVVLLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPRLGTNYSK  902

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  ++LLCTNP
Sbjct  903  KEAMRMINVSLLCTNP  918



>gb|ABF70100.1| protein kinase, putative [Musa balbisiana]
Length=1016

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+G +N KYR + E+CV LLDWA V  E  NL+EL+DP LGS F  
Sbjct  865  KADVYSFGVVTLEIVSGMSNTKYRPE-EDCVYLLDWAYVCHEKGNLLELVDPALGSSFST  923

Query  181  EQALRMAKLALLCTN  225
            E+AL+M KLALLCTN
Sbjct  924  EEALQMLKLALLCTN  938



>ref|XP_002305710.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
 gb|EEE86221.2| hypothetical protein POPTR_0004s06240g [Populus trichocarpa]
Length=468

 Score =   102 bits (254),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  Y   +E+ VCLLDWA VLQ+  NLM L+DP+L S+F+K
Sbjct  308  KADVYSFGVVALEIVSGRSNSSYNPTNES-VCLLDWAFVLQKRGNLMALVDPKLRSEFNK  366

Query  181  EQALRMAKLALLCTN  225
            E+A +M K+ALLC N
Sbjct  367  EEAEKMMKVALLCAN  381



>ref|XP_006384081.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61878.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=464

 Score =   102 bits (254),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  Y   +E+ VCLLDWA VLQ+  NLM L+DP+L S+F+K
Sbjct  308  KADVYSFGVVALEIVSGRSNSSYNPTNES-VCLLDWAFVLQKRGNLMALVDPKLRSEFNK  366

Query  181  EQALRMAKLALLCTN  225
            E+A +M K+ALLC N
Sbjct  367  EEAEKMIKVALLCAN  381



>gb|EYU29542.1| hypothetical protein MIMGU_mgv1a0269212mg, partial [Erythranthe 
guttata]
Length=423

 Score =   102 bits (253),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VL E  NL+EL+DP LG+++ K
Sbjct  253  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLHEQGNLLELVDPILGTNYSK  311

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM  LALLC NP
Sbjct  312  KEALRMLNLALLCANP  327



>ref|XP_006477836.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Citrus sinensis]
 ref|XP_006477837.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Citrus sinensis]
 ref|XP_006477838.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X3 [Citrus sinensis]
Length=1016

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS+F K
Sbjct  843  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNFSK  901

Query  181  EQALRMAKLALLCTNP  228
            ++A+ M  +ALLCTNP
Sbjct  902  KEAMTMLNIALLCTNP  917



>ref|XP_006442369.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
 gb|ESR55609.1| hypothetical protein CICLE_v10018721mg [Citrus clementina]
Length=966

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS+F K
Sbjct  793  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNFSK  851

Query  181  EQALRMAKLALLCTNP  228
            ++A+ M  +ALLCTNP
Sbjct  852  KEAMTMLNIALLCTNP  867



>gb|KDO42388.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
 gb|KDO42389.1| hypothetical protein CISIN_1g001767mg [Citrus sinensis]
Length=1016

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS+F K
Sbjct  843  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSNFSK  901

Query  181  EQALRMAKLALLCTNP  228
            ++A+ M  +ALLCTNP
Sbjct  902  KEAMTMLNIALLCTNP  917



>ref|XP_006384080.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
 gb|ERP61877.1| hypothetical protein POPTR_0004s06270g [Populus trichocarpa]
Length=462

 Score =   102 bits (253),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G++N  Y   +E+ VCLLDWA VLQ+  NLM L+DP+L S+F+K
Sbjct  306  KADVYSFGVVALEIVSGRSNSSYNPTNES-VCLLDWAFVLQKRGNLMALVDPKLRSEFNK  364

Query  181  EQALRMAKLALLCTN  225
            E+A +M K+ALLC N
Sbjct  365  EEAEKMIKVALLCAN  379



>ref|XP_010675288.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Beta vulgaris subsp. vulgaris]
Length=1019

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+G +N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS + K
Sbjct  842  KADVYSFGVVVLEIVSGTSNTSYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSSYSK  900

Query  181  EQALRMAKLALLCTNP  228
            E+ALR+  +ALLCTNP
Sbjct  901  EEALRLLNIALLCTNP  916



>emb|CDP06040.1| unnamed protein product [Coffea canephora]
Length=986

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL++L+DP LGSD   
Sbjct  816  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLDLVDPSLGSDCPA  874

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM  LALLCTNP
Sbjct  875  DEALRMINLALLCTNP  890



>emb|CBI30739.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N+ Y+  ++ C CLLDWA  LQ++ ++MEL+D +LGS+F+K
Sbjct  566  KADVYSFGVVALEIVSGKHNMSYQPKND-CACLLDWACSLQQSGDIMELVDQKLGSEFNK  624

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  625  KEAERMIKVALLCTN  639



>ref|XP_010655588.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X1 [Vitis vinifera]
Length=1006

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GKNN  Y + D  C CLLDWA VL++  +LMEL+DP LG++F+K
Sbjct  859  KADVYSFGVVTLEIVSGKNNSNY-TPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNK  917

Query  181  EQALRMAKLALLCTN  225
            ++A  M K+ALLCTN
Sbjct  918  KEAETMIKVALLCTN  932



>ref|XP_010655589.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 isoform X2 [Vitis vinifera]
Length=999

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GKNN  Y + D  C CLLDWA VL++  +LMEL+DP LG++F+K
Sbjct  859  KADVYSFGVVTLEIVSGKNNSNY-TPDTTCTCLLDWAFVLKQKGSLMELVDPNLGTEFNK  917

Query  181  EQALRMAKLALLCTN  225
            ++A  M K+ALLCTN
Sbjct  918  KEAETMIKVALLCTN  932



>ref|XP_011082787.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Sesamum indicum]
Length=1025

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LG ++ K
Sbjct  849  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGLNYSK  907

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLC NP
Sbjct  908  EEAMRMLNLALLCANP  923



>ref|XP_004146083.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
 ref|XP_004167552.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Cucumis sativus]
Length=1012

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP L S++ K
Sbjct  844  KADVYSFGVVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPNLDSNYPK  902

Query  181  EQALRMAKLALLCTNP  228
            E+ +RM  +ALLCTNP
Sbjct  903  EEVMRMINIALLCTNP  918



>emb|CBI30752.3| unnamed protein product [Vitis vinifera]
Length=511

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFGVVALEIV+GKNN   + ++E CVCLLD A  LQ+  +LME++DP+LGS+F++
Sbjct  337  KADIYSFGVVALEIVSGKNNSSRKPENE-CVCLLDRAFALQQKGSLMEIVDPKLGSEFNR  395

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+A+LCTN
Sbjct  396  DEAERMIKVAILCTN  410



>ref|XP_008451725.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Cucumis melo]
Length=1029

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VL+E  NL+EL+DP LGS++  
Sbjct  847  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLEEQGNLLELVDPDLGSNYSS  905

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  +ALLCTNP
Sbjct  906  EEAMRMLNVALLCTNP  921



>ref|XP_008451726.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Cucumis melo]
Length=927

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VL+E  NL+EL+DP LGS++  
Sbjct  745  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLEEQGNLLELVDPDLGSNYSS  803

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  +ALLCTNP
Sbjct  804  EEAMRMLNVALLCTNP  819



>ref|XP_011098190.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 [Sesamum indicum]
Length=1024

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS++  
Sbjct  847  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPILGSNYSM  905

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  LALLC NP
Sbjct  906  EEAMRMLNLALLCANP  921



>gb|ABF72026.1| leucine-rich repeat-containing protein kinase family protein 
[Musa acuminata]
Length=956

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+G +N KYR + E+CV LLDWA V  E  NL+EL+DP L S F  
Sbjct  805  KADVYSFGVVALEIVSGMSNTKYRPE-EDCVYLLDWAYVCHEKGNLLELVDPALDSSFST  863

Query  181  EQALRMAKLALLCTN  225
            E+AL+M KLALLCTN
Sbjct  864  EEALQMLKLALLCTN  878



>emb|CAN73789.1| hypothetical protein VITISV_025000 [Vitis vinifera]
Length=667

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 62/75 (83%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  Y   ++ C CLLDWA  LQ++ ++MEL+D +LGS+F+K
Sbjct  456  KADVYSFGVVALEIVSGKHNXSYXPKND-CACLLDWACXLQQSGDIMELVDQKLGSEFNK  514

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  515  KEAERMIKVALLCTN  529



>ref|XP_010478346.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g29720 [Camelina sativa]
Length=996

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVA+EIV+GKNN KY  DDE CV LLDWA +LQ+  +  E++DPRL   FD 
Sbjct  842  KADVYSFGVVAMEIVSGKNNTKYMPDDECCVGLLDWAFMLQKKGDFTEILDPRLEGKFDV  901

Query  181  EQALRMAKLALLCTN  225
             +A RM K++LLC+N
Sbjct  902  MEAERMIKVSLLCSN  916



>ref|XP_008795773.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Phoenix dactylifera]
Length=1024

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LE+++G +N  YR + E+CV L+DWA VLQE   L+EL+DP LGS++ K
Sbjct  862  KADVYSFGVVMLEVISGMSNTNYRPE-EDCVYLIDWAYVLQERGTLLELVDPSLGSNYSK  920

Query  181  EQALRMAKLALLCTNP  228
            E+AL+M  LAL+CTNP
Sbjct  921  EEALQMLNLALICTNP  936



>ref|XP_008795771.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Phoenix dactylifera]
Length=1025

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LE+++G +N  YR + E+CV L+DWA VLQE   L+EL+DP LGS++ K
Sbjct  863  KADVYSFGVVMLEVISGMSNTNYRPE-EDCVYLIDWAYVLQERGTLLELVDPSLGSNYSK  921

Query  181  EQALRMAKLALLCTNP  228
            E+AL+M  LAL+CTNP
Sbjct  922  EEALQMLNLALICTNP  937



>gb|KCW78573.1| hypothetical protein EUGRSUZ_C00047 [Eucalyptus grandis]
Length=179

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KAD+YSFG+VALE+V+G++N   +  +E C  LL+WA  L+E E L+EL+DPRLGS FD+
Sbjct  14   KADIYSFGIVALEVVSGRSNTSSQKTEE-CFILLNWAHFLKERETLIELVDPRLGSHFDR  72

Query  181  EQALRMAKLALLCTN  225
            E+AL + K+AL+CTN
Sbjct  73   EEALALIKVALMCTN  87



>ref|XP_006377461.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
 gb|ERP55258.1| hypothetical protein POPTR_0011s06150g [Populus trichocarpa]
Length=313

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 64/78 (82%), Gaps = 4/78 (5%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLME---LIDPRLGSD  171
            KADVYSFGVVALEIV+G++N  YR+ +E  VCLLDWA V+Q+  NLME   ++DP+L S+
Sbjct  139  KADVYSFGVVALEIVSGRSNSSYRTTNE-FVCLLDWAHVVQKKGNLMESMEIVDPKLQSE  197

Query  172  FDKEQALRMAKLALLCTN  225
            F+KE+A RM KLALLCTN
Sbjct  198  FNKEEAERMIKLALLCTN  215



>ref|XP_011002771.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Populus euphratica]
Length=1035

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  NL+EL+DP LGS + K
Sbjct  860  KADVYSFGVVVLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGNLLELVDPSLGSSYSK  918

Query  181  EQALRMAKLALLCTNP  228
             +ALR+  LALLCTNP
Sbjct  919  IEALRILNLALLCTNP  934



>ref|XP_010924703.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Elaeis guineensis]
Length=1020

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 50/76 (66%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALE+V+G +N  YR   E+ V LLDWA VLQE  +L+EL+DP LGS++ K
Sbjct  859  KADVYSFGVVALELVSGMSNTNYRPK-EDFVYLLDWAYVLQEQGSLLELVDPNLGSNYPK  917

Query  181  EQALRMAKLALLCTNP  228
            E+AL+M  LALLCTNP
Sbjct  918  EEALQMLNLALLCTNP  933



>ref|XP_006304798.1| hypothetical protein CARUB_v10012394mg [Capsella rubella]
 gb|EOA37696.1| hypothetical protein CARUB_v10012394mg [Capsella rubella]
Length=1034

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  845  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGSLLELVDPDLGTSFSK  903

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  904  KEAMRMLNIALLCTNP  919



>ref|XP_010655557.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X2 [Vitis vinifera]
Length=1060

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N+ Y+  ++ C CLLDWA  LQ++ ++MEL+D +LGS+F+K
Sbjct  849  KADVYSFGVVALEIVSGKHNMSYQPKND-CACLLDWACSLQQSGDIMELVDQKLGSEFNK  907

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  908  KEAERMIKVALLCTN  922



>ref|XP_010655556.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RFK1 isoform X1 [Vitis vinifera]
Length=1067

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 47/75 (63%), Positives = 64/75 (85%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N+ Y+  ++ C CLLDWA  LQ++ ++MEL+D +LGS+F+K
Sbjct  856  KADVYSFGVVALEIVSGKHNMSYQPKND-CACLLDWACSLQQSGDIMELVDQKLGSEFNK  914

Query  181  EQALRMAKLALLCTN  225
            ++A RM K+ALLCTN
Sbjct  915  KEAERMIKVALLCTN  929



>ref|XP_006306238.1| hypothetical protein CARUB_v10012061mg [Capsella rubella]
 gb|EOA39136.1| hypothetical protein CARUB_v10012061mg [Capsella rubella]
Length=1040

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  + LLDWA VLQE  +L+EL+DP LG++F K
Sbjct  852  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FIYLLDWAYVLQEQGSLLELVDPDLGTNFSK  910

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  911  KEAMRMLNIALLCTNP  926



>gb|KCW84087.1| hypothetical protein EUGRSUZ_B00978 [Eucalyptus grandis]
Length=623

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YRS +E+   LLDWA  LQE  +++EL+DPRLGS + +
Sbjct  454  KADVYSFGVVALEIVSGKSNTNYRSKEES-FYLLDWAHGLQEQGHVLELMDPRLGSYYSE  512

Query  181  EQALRMAKLALLCTNP  228
            E+A+R+  LALLCTNP
Sbjct  513  EEAMRILNLALLCTNP  528



>ref|XP_006377463.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
 gb|ERP55260.1| hypothetical protein POPTR_0011s06170g [Populus trichocarpa]
Length=363

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 2/75 (3%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGV ALEIV+G++N  YR+ +E  VCLLDWA V Q+  NLME++DP+L S+F+K
Sbjct  193  KADVYSFGV-ALEIVSGRSNSSYRTTNE-FVCLLDWAHVPQKKGNLMEIVDPKLQSEFNK  250

Query  181  EQALRMAKLALLCTN  225
            E+A RM KLALLCTN
Sbjct  251  EEAERMIKLALLCTN  265



>ref|XP_010246505.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X2 [Nelumbo nucifera]
Length=997

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR   E+ V LLDWA VLQE +NL+EL+DP L S + K
Sbjct  822  KADVYSFGVVLLEIVSGKSNTSYRPK-EDFVYLLDWAYVLQEEDNLLELVDPTLESRYSK  880

Query  181  EQALRMAKLALLCTNP  228
            E+ALRM  LALLCT P
Sbjct  881  EEALRMLSLALLCTGP  896



>ref|XP_010247775.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=938

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/76 (61%), Positives = 61/76 (80%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+G++N  +R  +E  + LLDWAL+L+E  NLM+L DPRLGSDF++
Sbjct  774  KADVYSFGVVTLEIVSGRSNTSFRPKEER-IYLLDWALILKEKGNLMDLKDPRLGSDFNR  832

Query  181  EQALRMAKLALLCTNP  228
            E+ + M  +AL+CTNP
Sbjct  833  EEVMAMINVALMCTNP  848



>ref|XP_004168262.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like, partial [Cucumis sativus]
Length=993

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VL+E  NL+EL DP LGS++  
Sbjct  810  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLEEQGNLLELADPDLGSNYSS  868

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  +ALLCTNP
Sbjct  869  EEAMRMLNVALLCTNP  884



>ref|XP_010246504.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X1 [Nelumbo nucifera]
Length=1021

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR   E+ V LLDWA VLQE +NL+EL+DP L S + K
Sbjct  846  KADVYSFGVVLLEIVSGKSNTSYRPK-EDFVYLLDWAYVLQEEDNLLELVDPTLESRYSK  904

Query  181  EQALRMAKLALLCTNP  228
            E+ALRM  LALLCT P
Sbjct  905  EEALRMLSLALLCTGP  920



>ref|XP_004137308.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Cucumis sativus]
Length=1030

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  YR  +E  V LLDWA VL+E  NL+EL DP LGS++  
Sbjct  847  KADVYSFGIVALEIVSGKSNTNYRPKEE-FVYLLDWAYVLEEQGNLLELADPDLGSNYSS  905

Query  181  EQALRMAKLALLCTNP  228
            E+A+RM  +ALLCTNP
Sbjct  906  EEAMRMLNVALLCTNP  921



>ref|XP_010479903.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Camelina sativa]
Length=876

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  688  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGSLLELVDPDLGTSFSK  746

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  747  KEAMRMLNIALLCTNP  762



>ref|XP_010246509.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840 [Nelumbo nucifera]
Length=1013

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFG+VALEIV+GK+N  +R   E+ V LLDWAL+L+E   LM+L+D RLGS+FDK
Sbjct  849  KADVYSFGIVALEIVSGKSNTSFRPKGES-VYLLDWALILKEKGKLMDLVDIRLGSEFDK  907

Query  181  EQALRMAKLALLCTN  225
            E+ +RM  +ALLCTN
Sbjct  908  EEVMRMINVALLCTN  922



>ref|XP_010462234.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Camelina sativa]
Length=1042

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  854  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGSLLELVDPDLGTSFSK  912

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  913  KEAMRMLNIALLCTNP  928



>ref|XP_010479902.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Camelina sativa]
Length=1043

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  855  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGSLLELVDPDLGTSFSK  913

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  914  KEAMRMLNIALLCTNP  929



>ref|XP_009758721.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650, partial [Nicotiana sylvestris]
Length=422

 Score = 99.8 bits (247),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEI AGK+ + YR + E  VCLLDWA+VLQ    LM+L+D  LGSD  +
Sbjct  272  KADVYSFGVVALEIAAGKSIMTYRPN-EKFVCLLDWAVVLQRQGKLMDLVDETLGSDLKQ  330

Query  181  EQALRMAKLALLCTNP  228
            ++ALRM  +ALLCTNP
Sbjct  331  DEALRMINVALLCTNP  346



>ref|NP_001117479.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AEE32940.1| Leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
Length=997

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  V LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  810  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FVYLLDWAYVLQEQGSLLELVDPDLGTSFSK  868

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  869  KEAMRMLNIALLCTNP  884



>gb|KDO77959.1| hypothetical protein CISIN_1g045835mg, partial [Citrus sinensis]
Length=511

 Score =   100 bits (250),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDE-NCVCLLDWALVLQENENLMELIDPRLGSDFD  177
            KADVYSFG+VALEIV+GKNN+ Y    E +C CLLDWA  LQ++  L+EL+D RLGS + 
Sbjct  424  KADVYSFGIVALEIVSGKNNMSYAPALEFDCTCLLDWACHLQQDGKLVELVDERLGSKYK  483

Query  178  KEQALRMAKLALLCTN  225
            KE+A RM K++LLCTN
Sbjct  484  KEEAERMIKVSLLCTN  499



>gb|AAF78445.1|AC018748_24 Contains a weak similarity to disease resistance protein (cf-5) 
gene from Lycopersicon esculentum gb|AF053993 and contains 
multiple leucine rich PF|00560 repeats and protein kinase 
PF|00069 domain. EST gb|T04455 comes from this gene [Arabidopsis 
thaliana]
Length=979

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  + LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  793  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FIYLLDWAYVLQEQGSLLELVDPDLGTSFSK  851

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  852  KEAMRMLNIALLCTNP  867



>ref|NP_001062936.1| Os09g0345300 [Oryza sativa Japonica Group]
 dbj|BAF24850.1| Os09g0345300, partial [Oryza sativa Japonica Group]
Length=320

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVVALEIV+GK+N  YR   E+ V LLDWA VL E  NL+EL+DP LGSD+  
Sbjct  167  KADVYSFGVVALEIVSGKSNTSYRPK-EDFVYLLDWACVLHERGNLLELVDPELGSDYST  225

Query  181  EQALRMAKLALLCTN  225
            E+AL M  +ALLCTN
Sbjct  226  EEALLMLNVALLCTN  240



>ref|XP_006304589.1| hypothetical protein CARUB_v10011641mg [Capsella rubella]
 gb|EOA37487.1| hypothetical protein CARUB_v10011641mg [Capsella rubella]
Length=1041

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +1

Query  1    KADVYSFGVVALEIVAGKNNVKYRSDDENCVCLLDWALVLQENENLMELIDPRLGSDFDK  180
            KADVYSFGVV LEIV+GK+N  YR  +E  + LLDWA VLQE  +L+EL+DP LG+ F K
Sbjct  853  KADVYSFGVVCLEIVSGKSNTNYRPKEE-FIYLLDWAYVLQEQGSLLELVDPDLGTSFSK  911

Query  181  EQALRMAKLALLCTNP  228
            ++A+RM  +ALLCTNP
Sbjct  912  KEAMRMLNIALLCTNP  927



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522609235886