BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25822_g1_i3 len=801 path=[8913:0-82 8996:83-125 5050:126-187
9099:188-207 8469:208-273 9203:274-302 9231:303-314 6563:315-347
15036:348-352 9280:353-393 15065:394-414 8753:415-415 9342:416-438
15144:439-482 9407:483-493 7803:494-526 6620:527-558 9478:559-800]

Length=801
                                                                      Score     E

ref|XP_004290090.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  42.7    6e-06   
ref|XP_008347553.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  45.1    1e-05   
gb|AAK64657.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       45.1    1e-05   Malus domestica [apple tree]
gb|AAL03986.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       45.1    1e-05   Malus domestica [apple tree]
ref|XP_008235831.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  44.7    2e-05   
ref|XP_007199742.1|  hypothetical protein PRUPE_ppa002715mg           44.7    2e-05   
ref|XP_006297340.1|  hypothetical protein CARUB_v10013360mg           44.3    2e-05   
gb|AHI85949.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       44.7    2e-05   
ref|XP_009358901.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  44.7    2e-05   
ref|XP_010690585.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  47.0    2e-05   
ref|XP_010489363.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    2e-05   
ref|XP_010515116.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    2e-05   
ref|XP_010467508.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.5    3e-05   
emb|CAA48610.1|  hydroxymethylglutaryl-CoA reductase (NADPH)          46.6    3e-05   Raphanus sativus
ref|XP_008348952.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.5    4e-05   
gb|EYU40486.1|  hypothetical protein MIMGU_mgv1a003590mg              45.1    4e-05   
gb|AGQ04159.1|  hydroxymethylglutaryl-CoA reductase                   43.9    4e-05   
ref|XP_002884053.1|  3-hydroxy-3-methylglutaryl-CoA reductase 2       43.1    4e-05   
gb|AEZ55672.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     44.7    4e-05   
ref|XP_011092919.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  45.1    4e-05   
ref|XP_004290091.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.1    4e-05   
ref|NP_179329.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2   44.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAK95406.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       43.1    4e-05   Malus domestica [apple tree]
gb|KFK40113.1|  hypothetical protein AALP_AA3G332100                  43.9    5e-05   
ref|XP_002514400.1|  hmg-CoA reductase, putative                      43.1    5e-05   Ricinus communis
gb|ABV25900.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       45.8    6e-05   Antirrhinum majus [garden snapdragon]
sp|P48021.1|HMDH_CAMAC  RecName: Full=3-hydroxy-3-methylglutaryl-...  44.3    7e-05   Camptotheca acuminata
ref|XP_004154522.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    8e-05   
ref|XP_008448157.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    8e-05   
ref|XP_004139979.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    8e-05   
gb|KGN46640.1|  hypothetical protein Csa_6G117710                     43.9    8e-05   
dbj|BAF98281.1|  hydroxymethylglutaryl-CoA reductase                  45.4    8e-05   Hevea brasiliensis [jebe]
gb|ABP04052.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       43.1    8e-05   Corylus avellana [European hazelnut]
gb|AGW82424.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       43.1    9e-05   
gb|KCW55693.1|  hypothetical protein EUGRSUZ_I01544                   44.3    9e-05   
ref|XP_010028873.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  43.9    9e-05   
ref|XP_010548185.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.1    1e-04   
ref|XP_010530977.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.1    1e-04   
ref|XP_006409321.1|  hypothetical protein EUTSA_v10022614mg           40.8    1e-04   
ref|XP_007043108.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  42.4    2e-04   
gb|AAL28015.2|AF389879_1  3-hydroxy-3-methylglutaryl-coenzyme A r...  40.8    2e-04   Andrographis paniculata
gb|ADC44451.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     42.7    2e-04   Salvia miltiorrhiza [Chinese salvia]
gb|ABX82838.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       43.1    2e-04   Cyclocarya paliurus [qing qian liu]
gb|ACT65734.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       42.7    2e-04   Salvia miltiorrhiza [Chinese salvia]
gb|KDP47034.1|  hypothetical protein JCGZ_10761                       45.4    2e-04   
gb|ADX31913.1|  HMG CoA reductase                                     43.9    2e-04   
ref|XP_004290088.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  39.3    2e-04   
gb|ADX31914.1|  HMG CoA reductase                                     43.9    2e-04   
gb|AET72043.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2     43.9    2e-04   
gb|AET72045.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2     43.9    2e-04   
ref|XP_006342182.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  42.7    2e-04   
gb|AET72044.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     42.0    2e-04   
gb|ABF56518.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     42.0    3e-04   Litchi chinensis [litchi]
gb|AIG55301.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       44.3    3e-04   
ref|XP_004300101.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  42.7    3e-04   
gb|AFN89600.1|  3-hydro-3-methylglutary CoA reductase                 43.1    3e-04   
ref|XP_009588198.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    3e-04   
emb|CDY20406.1|  BnaC02g24100D                                        43.1    3e-04   
ref|XP_009785805.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    4e-04   
ref|XP_009128179.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.1    4e-04   
emb|CDY71344.1|  BnaAnng37030D                                        43.1    4e-04   
ref|XP_002313569.2|  hypothetical protein POPTR_0009s17090g           40.8    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010266284.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  41.6    4e-04   
gb|KDP36739.1|  hypothetical protein JCGZ_08030                       42.0    4e-04   
ref|XP_006486561.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  43.9    4e-04   
ref|XP_006422382.1|  hypothetical protein CICLE_v10028082mg           43.9    4e-04   
gb|KDO38001.1|  hypothetical protein CISIN_1g007956mg                 43.9    5e-04   
gb|AFZ93642.1|  hydroxymethylglutaryl coenzyme A reductase            42.4    5e-04   
gb|ADX01170.1|  putative 3-hydroxy-3-methyl-glutaryl-CoA reductase    42.4    5e-04   
gb|AHX36946.1|  3-hydroxy-3-methyl glutaryl coenzyme a reductase      42.4    5e-04   
gb|ABK56831.1|  3-hydroxy-3-methylglutaryl-CoA reductase              42.4    5e-04   Euphorbia pekinensis
gb|ADP94147.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       43.1    6e-04   
ref|XP_006384871.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...  40.0    6e-04   
gb|ACE80213.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     39.3    6e-04   Pyrus pyrifolia [sha li]
ref|XP_011041288.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  41.6    6e-04   
ref|XP_007018657.1|  Hydroxy methylglutaryl CoA reductase 1           40.4    7e-04   
gb|ABV25901.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       41.2    7e-04   Antirrhinum majus [garden snapdragon]
ref|XP_010090727.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  40.0    7e-04   
ref|XP_006390188.1|  hypothetical protein EUTSA_v10018320mg           42.0    8e-04   
gb|AAP14352.2|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       41.6    8e-04   Andrographis paniculata
ref|XP_002510732.1|  hmg-CoA reductase, putative                      40.8    9e-04   Ricinus communis
ref|XP_010270571.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  41.2    9e-04   
ref|XP_006390187.1|  hypothetical protein EUTSA_v10018320mg           42.0    9e-04   
ref|XP_011074058.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  41.6    9e-04   
gb|AEM42971.1|  HMG-CoA reductase                                     42.7    9e-04   
gb|ABC74565.1|  3-hydroxy-3-methylglutaryl-CoA reductase              41.2    0.001   Picrorhiza kurrooa
ref|XP_004146762.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  42.7    0.001   
ref|NP_001284380.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  42.7    0.001   
ref|XP_002306999.1|  hydroxymethylglutaryl-CoA reductase family p...  40.8    0.001   Populus trichocarpa [western balsam poplar]
ref|XP_002887642.1|  3-hydroxy-3-methylglutaryl CoA reductase         41.6    0.001   
ref|XP_006302045.1|  hypothetical protein CARUB_v10020027mg           41.6    0.001   



>ref|XP_004290090.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=596

 Score = 42.7 bits (99),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R + PLH+++ SE+ A+LAF ASF+YLLG F
Sbjct  71   RTNTPLHIINLSEIVAILAFVASFIYLLGFF  101


 Score = 34.7 bits (78),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFFA----AVYFLLVSWRDKIVT  360
            TNA+FFA     VYFLL SWR+KI T
Sbjct  47   TNAVFFALFFSVVYFLLTSWREKIRT  72



>ref|XP_008347553.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=608

 Score = 45.1 bits (105),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   RTSTPLHVVNLSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  50   TNAVFFTLFFSVVYFLLTRWREKIRT  75



>gb|AAK64657.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=608

 Score = 45.1 bits (105),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   RTSTPLHVVNLSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  50   TNAVFFTLFFSVVYFLLTRWREKIRT  75



>gb|AAL03986.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=588

 Score = 45.1 bits (105),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  54   RTSTPLHVVNLSEIVAILAFVASFIYLLGFF  84


 Score = 31.2 bits (69),  Expect(2) = 1e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  30   TNAVFFTLFFSVVYFLLTRWREKIRT  55



>ref|XP_008235831.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Prunus mume]
Length=605

 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   RTSTPLHVVNLSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  50   TNAVFFTLFFSVVYFLLTRWREKIRT  75



>ref|XP_007199742.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
 gb|EMJ00941.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
Length=641

 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  110  RTSTPLHVVNLSEIVAILAFVASFIYLLGFF  140


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  86   TNAVFFTLFFSVVYFLLTRWREKIRT  111



>ref|XP_006297340.1| hypothetical protein CARUB_v10013360mg [Capsella rubella]
 gb|EOA30238.1| hypothetical protein CARUB_v10013360mg [Capsella rubella]
Length=563

 Score = 44.3 bits (103),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLG  440
            R+S PLHVV  SE+ AL+ F ASF+YLLG
Sbjct  65   RNSTPLHVVDLSEICALIGFVASFIYLLG  93


 Score = 32.0 bits (71),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  47   ALFFATVYFLLSRWREKI  64



>gb|AHI85949.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Pyrus communis]
Length=608

 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   RTSTPLHVVNFSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  50   TNAVFFTLFFSVVYFLLTRWREKIRT  75



>ref|XP_009358901.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=608

 Score = 44.7 bits (104),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   RTSTPLHVVNFSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  50   TNAVFFTLFFSVVYFLLTRWREKIRT  75



>ref|XP_010690585.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Beta vulgaris subsp. vulgaris]
Length=581

 Score = 47.0 bits (110),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVVS SE+AA++AF ASF+YLLG F
Sbjct  68   RNSTPLHVVSLSEIAAIVAFLASFIYLLGFF  98


 Score = 28.9 bits (63),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VYFLL  WR+KI
Sbjct  51   LFFSVVYFLLQRWREKI  67



>ref|XP_010489363.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Camelina sativa]
Length=552

 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE++AL  F ASF+YLLG F
Sbjct  64   RNSTPLHVVDLSEISALFCFVASFIYLLGFF  94


 Score = 32.0 bits (71),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  46   ALFFATVYFLLSRWREKI  63



>ref|XP_010515116.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=557

 Score = 43.9 bits (102),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE++AL  F ASF+YLLG F
Sbjct  64   RNSTPLHVVDLSEISALFGFVASFIYLLGFF  94


 Score = 32.0 bits (71),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  46   ALFFATVYFLLSRWREKI  63



>ref|XP_010467508.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=559

 Score = 43.5 bits (101),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE++AL  F ASF+YLLG F
Sbjct  65   RNSTPLHVVDLSEISALFGFVASFIYLLGFF  95


 Score = 32.0 bits (71),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  47   ALFFATVYFLLSRWREKI  64



>emb|CAA48610.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
Length=583

 Score = 46.6 bits (109),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            RHS PLHV++ +E+ ALLA  ASF+YLLG F
Sbjct  65   RHSTPLHVITITELGALLALVASFIYLLGFF  95


 Score = 28.5 bits (62),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  41   TNAVFFTLFFSVAYYLLRRWRDKI  64



>ref|XP_008348952.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=605

 Score = 43.5 bits (101),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV  SE+ A++AF ASF+YLLG F
Sbjct  73   RTSTPLHVVDLSEIVAIVAFVASFIYLLGFF  103


 Score = 31.6 bits (70),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  49   TNAVFFTLFFSVVYFLLTRWREKIRT  74



>gb|EYU40486.1| hypothetical protein MIMGU_mgv1a003590mg [Erythranthe guttata]
Length=575

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA++ F ASF+YLLG F
Sbjct  59   RNSTPLHVVTLSEIAAIVTFVASFIYLLGFF  89


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    + VY+LL+ WR+KI
Sbjct  35   TNAVFFTLFFSVVYYLLLRWREKI  58



>gb|AGQ04159.1| hydroxymethylglutaryl-CoA reductase [Lavandula angustifolia]
Length=565

 Score = 43.9 bits (102),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE++A++ F ASF+YLLG F
Sbjct  52   RNSTPLHVVTLSEISAIVTFVASFIYLLGFF  82


 Score = 30.8 bits (68),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL+ WR+KI
Sbjct  28   TNAFFLTLFFSVVYFLLIRWREKI  51



>ref|XP_002884053.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60312.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=564

 Score = 43.1 bits (100),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLG  440
            R+S PLHVV  SE+ +L+ F ASF+YLLG
Sbjct  66   RNSTPLHVVDLSEICSLIGFVASFIYLLG  94


 Score = 31.6 bits (70),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  48   ALFFATVYFLLSRWREKI  65



>gb|AEZ55672.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Salvia miltiorrhiza]
Length=562

 Score = 44.7 bits (104),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ S++AA+L F ASF+YLLG F
Sbjct  54   RNSTPLHVVTLSDIAAVLTFVASFIYLLGFF  84


 Score = 30.0 bits (66),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL+ WR+KI
Sbjct  30   TNAFFFTLFFSVVYFLLLRWREKI  53



>ref|XP_011092919.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sesamum 
indicum]
Length=582

 Score = 45.1 bits (105),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA++ F ASF+YLLG F
Sbjct  60   RNSTPLHVVTLSEIAAIVTFVASFIYLLGFF  90


 Score = 29.6 bits (65),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    + VY+LL+ WR+KI
Sbjct  36   TNAVFFTLFFSVVYYLLLRWREKI  59



>ref|XP_004290091.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=595

 Score = 43.1 bits (100),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLH+V+ SE+ A+LAF ASF+YLLG F
Sbjct  73   RTSTPLHMVNLSEIVAILAFVASFIYLLGFF  103


 Score = 31.6 bits (70),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  49   TNAVFFTLFFSVVYFLLTRWREKIRT  74



>ref|NP_179329.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Arabidopsis 
thaliana]
 sp|P43256.1|HMDH2_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=AtHMGR2; Short=HMG-CoA reductase 2 [Arabidopsis thaliana]
 gb|AAA67317.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Arabidopsis thaliana]
 gb|AAL15311.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gb|AAN28869.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gb|AEC06618.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Arabidopsis 
thaliana]
Length=562

 Score = 44.3 bits (103),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLG  440
            R+S PLHVV  SE+ AL+ F ASF+YLLG
Sbjct  64   RNSTPLHVVDLSEICALIGFVASFIYLLG  92


 Score = 30.4 bits (67),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            ++FFA VYFLL  WR+KI
Sbjct  46   SLFFATVYFLLSRWREKI  63



>gb|AAK95406.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Malus domestica]
Length=608

 Score = 43.1 bits (100),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            + S PLHVV+ SE+ A+LAF ASF+YLLG F
Sbjct  74   KTSTPLHVVNLSEIVAILAFVASFIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAI----FFAAVYFLLVSWRDKIVT  360
            TNA+    FF+ VYFLL  WR+KI T
Sbjct  50   TNAVCFTLFFSVVYFLLTRWREKIKT  75



>gb|KFK40113.1| hypothetical protein AALP_AA3G332100 [Arabis alpina]
Length=541

 Score = 43.9 bits (102),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE++AL+ F ASF+YLLG F
Sbjct  55   RNSTPLHVVDLSEISALITFLASFIYLLGFF  85


 Score = 30.4 bits (67),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            ++FFA VYFLL  WR+KI
Sbjct  37   SLFFATVYFLLSRWREKI  54



>ref|XP_002514400.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF47996.1| hmg-CoA reductase, putative [Ricinus communis]
Length=586

 Score = 43.1 bits (100),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+  F ASF+YLLG F
Sbjct  67   RTSTPLHVVTLSEIAAIFGFIASFIYLLGFF  97


 Score = 31.2 bits (69),  Expect(2) = 5e-05, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAI----FFAAVYFLLVSWRDKIVT  360
            TNAI    FF+ VYFLL  WR+KI T
Sbjct  43   TNAICFTLFFSVVYFLLSRWREKIRT  68



>gb|ABV25900.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=586

 Score = 45.8 bits (107),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+L F ASF+YLLG F
Sbjct  61   RNSTPLHVVTLSELAAILTFLASFIYLLGFF  91


 Score = 28.5 bits (62),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VY+LL+ WR+KI
Sbjct  44   LFFSVVYYLLLRWREKI  60



>sp|P48021.1|HMDH_CAMAC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Camptotheca acuminata]
 gb|AAA33040.1| 3-hydroxy-3-methylglutaryl coA reductase [Camptotheca acuminata]
Length=593

 Score = 44.3 bits (103),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+  F ASF+YLLG F
Sbjct  79   RNSTPLHVVTLSEIAAIFTFVASFIYLLGFF  109


 Score = 29.6 bits (65),  Expect(2) = 7e-05, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF  VY+LLV WR+KI
Sbjct  62   LFFTVVYYLLVRWREKI  78



>ref|XP_004154522.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A+ AF ASF+YLLG F
Sbjct  82   RSSTPLHVVTLSEMVAISAFIASFIYLLGFF  112


 Score = 30.0 bits (66),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  58   TNAAFFTLFFSVVYFLLTRWREKI  81



>ref|XP_008448157.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis melo]
Length=597

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A+ AF ASF+YLLG F
Sbjct  82   RSSTPLHVVTLSEMVAISAFIASFIYLLGFF  112


 Score = 30.0 bits (66),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  58   TNAAFFTLFFSVVYFLLTRWREKI  81



>ref|XP_004139979.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A+ AF ASF+YLLG F
Sbjct  82   RSSTPLHVVTLSEMVAISAFIASFIYLLGFF  112


 Score = 30.0 bits (66),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  58   TNAAFFTLFFSVVYFLLTRWREKI  81



>gb|KGN46640.1| hypothetical protein Csa_6G117710 [Cucumis sativus]
Length=665

 Score = 43.9 bits (102),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A+ AF ASF+YLLG F
Sbjct  150  RSSTPLHVVTLSEMVAISAFIASFIYLLGFF  180


 Score = 30.0 bits (66),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  126  TNAAFFTLFFSVVYFLLTRWREKI  149



>dbj|BAF98281.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=606

 Score = 45.4 bits (106),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA++AF ASF+YLLG F
Sbjct  64   RTSTPLHVVALSEIAAIVAFVASFIYLLGFF  94


 Score = 28.5 bits (62),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKIVT  360
            +FF  VYFLL  WR+KI T
Sbjct  47   VFFYVVYFLLSRWREKIRT  65



>gb|ABP04052.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=567

 Score = 43.1 bits (100),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE+ AL+A  ASF+YLLG F
Sbjct  64   RNSTPLHVVDLSEIVALVALVASFIYLLGFF  94


 Score = 30.4 bits (67),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    + VYFLL  WR+KI
Sbjct  40   TNAVFFTLFFSVVYFLLTRWREKI  63



>gb|AGW82424.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=565

 Score = 43.1 bits (100),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE+ AL+A  ASF+YLLG F
Sbjct  62   RNSTPLHVVDLSEIVALVALVASFIYLLGFF  92


 Score = 30.4 bits (67),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    + VYFLL  WR+KI
Sbjct  38   TNAVFFTLFFSVVYFLLTRWREKI  61



>gb|KCW55693.1| hypothetical protein EUGRSUZ_I01544 [Eucalyptus grandis]
Length=626

 Score = 44.3 bits (103),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLH+V+ +EMAA++AF ASF+YL+G F
Sbjct  95   RTSTPLHLVTPAEMAAIVAFVASFIYLVGFF  125


 Score = 29.3 bits (64),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VY+LL  WR+KI T
Sbjct  71   TNAVFFTLFFSVVYYLLSRWREKIRT  96



>ref|XP_010028873.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-methylglutaryl-coenzyme 
A reductase 1 [Eucalyptus grandis]
Length=603

 Score = 43.9 bits (102),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLH+V+ +EMAA++AF ASF+YL+G F
Sbjct  72   RTSTPLHLVTPAEMAAIVAFVASFIYLVGFF  102


 Score = 29.6 bits (65),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VY+LL  WR+KI T
Sbjct  48   TNAVFFTLFFSVVYYLLSRWREKIRT  73



>ref|XP_010548185.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Tarenaya hassleriana]
Length=583

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV  SE+ A++AF ASF+YLLG F
Sbjct  66   RRSAPLHVVDLSEILAIIAFVASFIYLLGFF  96


 Score = 30.0 bits (66),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            ++FFA VYFLL  WR+KI
Sbjct  48   SLFFAVVYFLLSRWREKI  65



>ref|XP_010530977.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010530978.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X2 [Tarenaya hassleriana]
Length=579

 Score = 43.1 bits (100),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV  SE+ A++AF ASF+YLLG F
Sbjct  63   RRSTPLHVVDFSEILAIIAFVASFIYLLGFF  93


 Score = 30.0 bits (66),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 12/17 (71%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FFA VYFLL  WR+KI
Sbjct  46   LFFAVVYFLLSRWREKI  62



>ref|XP_006409321.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
 gb|ESQ50774.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
Length=582

 Score = 40.8 bits (94),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV  SE++AL  F AS +YLLG F
Sbjct  66   RNSTPLHVVDLSEISALFGFVASCIYLLGFF  96


 Score = 32.0 bits (71),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 0/18 (0%)
 Frame = +1

Query  301  AIFFAAVYFLLVSWRDKI  354
            A+FFA VYFLL  WR+KI
Sbjct  48   ALFFATVYFLLSRWREKI  65



>ref|XP_007043108.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043109.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043110.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98939.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98941.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
Length=584

 Score = 42.4 bits (98),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+ A  ASF+YLLG F
Sbjct  64   RTSTPLHVVNFSEIAAIFALVASFIYLLGFF  94


 Score = 30.8 bits (68),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 18/26 (69%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL  WR+KI T
Sbjct  40   TNAVFFTLFFSVVYFLLSRWREKIRT  65



>gb|AAL28015.2|AF389879_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
 gb|AAR03707.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
Length=595

 Score = 40.8 bits (94),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ ++++F ASF+YLLG F
Sbjct  65   RSSIPLHVVTLSEICSIVSFVASFIYLLGFF  95


 Score = 32.0 bits (71),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFFA----AVYFLLVSWRDKI  354
            TNA+FFA    +VY+LL+ WR+KI
Sbjct  41   TNAVFFALFFSSVYYLLLQWREKI  64



>gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Salvia miltiorrhiza]
Length=550

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE++A++ F ASF+YLLG F
Sbjct  48   RNSVPLHVVTLSEISAIVVFVASFIYLLGFF  78


 Score = 30.0 bits (66),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VYFLL+ WR+KI
Sbjct  31   LFFSVVYFLLLRWREKI  47



>gb|ABX82838.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Cyclocarya paliurus]
Length=583

 Score = 43.1 bits (100),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLH+V  SE+ A++AF ASFVYLLG F
Sbjct  67   RNSTPLHIVDLSEIVAIVAFFASFVYLLGFF  97


 Score = 29.6 bits (65),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VYFLL  WR+KI
Sbjct  50   LFFSVVYFLLTRWREKI  66



>gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza]
Length=550

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE++A++ F ASF+YLLG F
Sbjct  48   RNSVPLHVVTLSEISAIVVFVASFIYLLGFF  78


 Score = 30.0 bits (66),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 15/17 (88%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VYFLL+ WR+KI
Sbjct  31   LFFSVVYFLLLRWREKI  47



>gb|KDP47034.1| hypothetical protein JCGZ_10761 [Jatropha curcas]
Length=596

 Score = 45.4 bits (106),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVVS SE++A++AF ASFVYLLG F
Sbjct  65   RTSTPLHVVSLSEISAIVAFIASFVYLLGFF  95


 Score = 27.3 bits (59),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 17/26 (65%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKIVT  360
            TNA    +FF  VYFLL  WR+KI T
Sbjct  41   TNAFSFSVFFWVVYFLLSRWREKIRT  66



>gb|ADX31913.1| HMG CoA reductase [Bacopa monnieri]
Length=589

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA++ F ASF+YL+G F
Sbjct  66   RNSTPLHVVTLSEIAAIVTFVASFIYLIGFF  96


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIF----FAAVYFLLVSWRDKI  354
            TNA+F    F+ VY+LL  WR+KI
Sbjct  42   TNAVFITLFFSVVYYLLRRWREKI  65



>ref|XP_004290088.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=578

 Score = 39.3 bits (90),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R + PLH++  SE+ A+LA  ASF+YLLG F
Sbjct  57   RTNTPLHMIDLSEVVAILALVASFIYLLGFF  87


 Score = 33.5 bits (75),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    + VYFLL SWR+KI T
Sbjct  33   TNAVFFTLFFSVVYFLLTSWREKIRT  58



>gb|ADX31914.1| HMG CoA reductase [Bacopa monnieri]
Length=589

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA++ F ASF+YL+G F
Sbjct  66   RNSTPLHVVTLSEIAAIVTFVASFIYLIGFF  96


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIF----FAAVYFLLVSWRDKI  354
            TNA+F    F+ VY+LL  WR+KI
Sbjct  42   TNAVFITLFFSVVYYLLRRWREKI  65



>gb|AET72043.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Litchi chinensis]
Length=568

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A++AF AS +YLLG F
Sbjct  60   RTSTPLHVVTMSEMGAIVAFVASCIYLLGFF  90


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFFA----AVYFLLVSWRDKIVT  360
            TNA+FF      VY+LL  WR+K+ T
Sbjct  36   TNAVFFTLFFTVVYYLLSRWREKVRT  61



>gb|AET72045.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Dimocarpus 
longan]
Length=568

 Score = 43.9 bits (102),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SEM A++AF AS +YLLG F
Sbjct  60   RTSTPLHVVTMSEMGAIVAFVASCIYLLGFF  90


 Score = 28.5 bits (62),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIF----FAAVYFLLVSWRDKIVT  360
            TNA+F    F  VY+LL  WR+K+ T
Sbjct  36   TNAVFLTLFFTVVYYLLSRWREKVRT  61



>ref|XP_006342182.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Solanum tuberosum]
Length=583

 Score = 42.7 bits (99),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  74   RSSTPLHVVTLSELAAILSLIASFIYLLGFF  104


 Score = 29.3 bits (64),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL  WRDKI
Sbjct  50   TNAIFFTLFFSVAYYLLHRWRDKI  73



>gb|AET72044.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Dimocarpus 
longan]
Length=564

 Score = 42.0 bits (97),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  65   RSSTPLHVVTLSEIAAIVSLIASFIYLLGFF  95


 Score = 30.4 bits (67),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  YFLL  WRDKI
Sbjct  41   TNAIFFTLFFSVAYFLLHRWRDKI  64



>gb|ABF56518.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Litchi chinensis]
Length=562

 Score = 42.0 bits (97),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  63   RSSTPLHVVTLSEIAAIVSLIASFIYLLGFF  93


 Score = 30.0 bits (66),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  YFLL  WRDKI
Sbjct  39   TNAIFFTLFFSVAYFLLHRWRDKI  62



>gb|AIG55301.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=590

 Score = 44.3 bits (103),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLH+++ SE+AA++AF ASF+YLLG F
Sbjct  65   RNSTPLHLITLSEIAAIVAFVASFIYLLGFF  95


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 14/17 (82%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+ VY+LL  WR+KI
Sbjct  48   LFFSVVYYLLSRWREKI  64



>ref|XP_004300101.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=568

 Score = 42.7 bits (99),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  78   RTSTPLHVVNLSELAAILSLIASFIYLLGFF  108


 Score = 29.3 bits (64),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 17/26 (65%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TNA+FF    +  Y+LL  WRDKI T
Sbjct  54   TNAVFFTLFFSVAYYLLHRWRDKIRT  79



>gb|AFN89600.1| 3-hydro-3-methylglutary CoA reductase [Gentiana macrophylla]
Length=580

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  76   RTSTPLHVVTLSELAAILSLIASFIYLLGFF  106


 Score = 28.9 bits (63),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TN IFF    +  Y+LL  WRDKI T
Sbjct  52   TNGIFFTLFFSVAYYLLHRWRDKIRT  77



>ref|XP_009588198.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana tomentosiformis]
Length=589

 Score = 43.9 bits (102),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  74   RNSTPLHVVTLSELAAILSLIASFIYLLGFF  104


 Score = 27.7 bits (60),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  Y+LL  WRDKI
Sbjct  50   TNGIFFTLFFSVAYYLLHRWRDKI  73



>emb|CDY20406.1| BnaC02g24100D [Brassica napus]
Length=581

 Score = 43.1 bits (100),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ AL+A  ASF+YLLG F
Sbjct  69   RYNTPLHVVTVTELGALIALVASFIYLLGFF  99


 Score = 28.5 bits (62),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  45   TNAVFFTLFFSVAYYLLHRWRDKI  68



>ref|XP_009785805.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana sylvestris]
Length=589

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  74   RNSTPLHVVTLSELAAILSLIASFIYLLGFF  104


 Score = 27.7 bits (60),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  Y+LL  WRDKI
Sbjct  50   TNGIFFTLFFSVAYYLLHRWRDKI  73



>ref|XP_009128179.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Brassica rapa]
Length=581

 Score = 43.1 bits (100),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ AL+A  ASF+YLLG F
Sbjct  69   RYNTPLHVVTVTELGALIALVASFIYLLGFF  99


 Score = 28.5 bits (62),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  45   TNAVFFTLFFSVAYYLLHRWRDKI  68



>emb|CDY71344.1| BnaAnng37030D, partial [Brassica napus]
Length=356

 Score = 43.1 bits (100),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ AL+A  ASF+YLLG F
Sbjct  69   RYNTPLHVVTVTELGALIALVASFIYLLGFF  99


 Score = 28.5 bits (62),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  45   TNAVFFTLFFSVAYYLLHRWRDKI  68



>ref|XP_002313569.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
 gb|EEE87524.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
Length=646

 Score = 40.8 bits (94),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLH+V+ S++ A+ AF ASF+Y+LG F
Sbjct  124  RNSTPLHLVTLSDIVAIFAFVASFIYMLGFF  154


 Score = 30.4 bits (67),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  100  TNALFFTVFFSVVYFLLTRWREKI  123



>ref|XP_010266284.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nelumbo nucifera]
Length=608

 Score = 41.6 bits (96),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  83   RTSTPLHVVTLSEIAAIVSLIASFIYLLGFF  113


 Score = 29.6 bits (65),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 15/26 (58%), Positives = 16/26 (62%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TN IFF    +  YFLL  WRDKI T
Sbjct  59   TNGIFFTLFFSVAYFLLHRWRDKIRT  84



>gb|KDP36739.1| hypothetical protein JCGZ_08030 [Jatropha curcas]
Length=584

 Score = 42.0 bits (97),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLH+V+ SE+AA+++  ASF+YLLG F
Sbjct  73   RNSTPLHIVTLSEIAAIVSLIASFIYLLGFF  103


 Score = 29.3 bits (64),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL  WRDKI
Sbjct  49   TNAIFFTLFFSVAYYLLHRWRDKI  72



>ref|XP_006486561.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Citrus sinensis]
Length=583

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SEM A++AF AS +YLLG F
Sbjct  59   RNSTPLHVVTLSEMVAIVAFVASCIYLLGFF  89


 Score = 27.3 bits (59),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF  VY+LL  WR+KI
Sbjct  42   LFFTVVYYLLSRWREKI  58



>ref|XP_006422382.1| hypothetical protein CICLE_v10028082mg [Citrus clementina]
 gb|ESR35622.1| hypothetical protein CICLE_v10028082mg [Citrus clementina]
Length=583

 Score = 43.9 bits (102),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SEM A++AF AS +YLLG F
Sbjct  59   RNSTPLHVVTLSEMVAIVAFVASCIYLLGFF  89


 Score = 27.3 bits (59),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF  VY+LL  WR+KI
Sbjct  42   LFFTVVYYLLSRWREKI  58



>gb|KDO38001.1| hypothetical protein CISIN_1g007956mg [Citrus sinensis]
Length=583

 Score = 43.9 bits (102),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SEM A++AF AS +YLLG F
Sbjct  59   RNSTPLHVVTLSEMVAIVAFVASCIYLLGFF  89


 Score = 27.3 bits (59),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF  VY+LL  WR+KI
Sbjct  42   LFFTVVYYLLSRWREKI  58



>gb|AFZ93642.1| hydroxymethylglutaryl coenzyme A reductase [Euphorbia lathyris]
Length=582

 Score = 42.4 bits (98),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  69   RNSTPLHVVTLSEIAAIVSLIASFIYLLGFF  99


 Score = 28.5 bits (62),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  45   TNAVFFTLFFSVAYYLLHRWRDKI  68



>gb|ADX01170.1| putative 3-hydroxy-3-methyl-glutaryl-CoA reductase [Bacopa monnieri]
Length=563

 Score = 42.4 bits (98),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA++ F ASF+YL+G F
Sbjct  59   RNSTPLHVVTLSEIAAVVTFFASFIYLIGFF  89


 Score = 28.9 bits (63),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIF----FAAVYFLLVSWRDKI  354
            TNAIF    F+ VY+LL  WR+KI
Sbjct  35   TNAIFITIFFSVVYYLLRRWREKI  58



>gb|AHX36946.1| 3-hydroxy-3-methyl glutaryl coenzyme a reductase [Betula platyphylla]
Length=587

 Score = 42.4 bits (98),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  85   RNSTPLHVVTLSEIAAIVSLIASFIYLLGFF  115


 Score = 28.5 bits (62),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  61   TNAVFFTLFFSVAYYLLHRWRDKI  84



>gb|ABK56831.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Euphorbia pekinensis]
Length=583

 Score = 42.4 bits (98),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  70   RNSTPLHVVTLSEIAAIVSLIASFIYLLGFF  100


 Score = 28.5 bits (62),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  46   TNAVFFTLFFSVAYYLLHRWRDKI  69



>gb|ADP94147.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Withania somnifera]
Length=575

 Score = 43.1 bits (100),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+L+  ASF+YLLG F
Sbjct  66   RSSTPLHVVTLSELAAILSLIASFIYLLGFF  96


 Score = 28.1 bits (61),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  Y+LL  WRDKI
Sbjct  42   TNGIFFTLFFSVAYYLLHRWRDKI  65



>ref|XP_006384871.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|ERP62668.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=594

 Score = 40.0 bits (92),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLH+++ SE+AA+ AF  SF+Y+LG F
Sbjct  66   RNSTPLHLLTLSEIAAIFAFITSFIYMLGFF  96


 Score = 30.4 bits (67),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNA----IFFAAVYFLLVSWRDKI  354
            TNA    +FF+ VYFLL  WR+KI
Sbjct  42   TNALFFTVFFSVVYFLLTRWREKI  65



>gb|ACE80213.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Pyrus pyrifolia]
Length=609

 Score = 39.3 bits (90),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+ A+L+  AS +YLLG F
Sbjct  74   RTSTPLHVVTLSEIVAILSLVASVIYLLGFF  104


 Score = 31.6 bits (70),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKIVT  360
            +FF+ VYFLL +WR+KI T
Sbjct  57   LFFSVVYFLLTAWREKIRT  75



>ref|XP_011041288.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1, 
partial [Populus euphratica]
Length=577

 Score = 41.6 bits (96),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+  E+AA+++  ASF+YLLG F
Sbjct  68   RNSTPLHVVTFPEIAAIISLTASFIYLLGFF  98


 Score = 29.3 bits (64),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL  WRDKI
Sbjct  44   TNAIFFTLFFSVAYYLLYRWRDKI  67



>ref|XP_007018657.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
 gb|EOY15882.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
Length=578

 Score = 40.4 bits (93),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+  E+AA+++  ASF+YLLG F
Sbjct  71   RNSMPLHVVTLPELAAIVSLIASFIYLLGFF  101


 Score = 30.4 bits (67),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL+ WRDKI
Sbjct  47   TNAIFFTLFFSVAYYLLLRWRDKI  70



>gb|ABV25901.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=548

 Score = 41.2 bits (95),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHV++ SE+AA++   ASF+YLLG F
Sbjct  60   RNSIPLHVLTLSELAAIICLIASFIYLLGFF  90


 Score = 29.3 bits (64),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  YFLL  WRDKI
Sbjct  36   TNGIFFCLFFSVAYFLLHQWRDKI  59



>ref|XP_010090727.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Morus notabilis]
 gb|EXB40446.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Morus notabilis]
Length=586

 Score = 40.0 bits (92),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHV++ SE++AL A  ASF+YLLG F
Sbjct  68   RTSTPLHVLTFSEISALFALLASFIYLLGFF  98


 Score = 30.4 bits (67),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKIVT  360
            +FF+ VYFLL  WR+KI T
Sbjct  51   LFFSVVYFLLTRWREKIRT  69



>ref|XP_006390188.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27474.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=594

 Score = 42.0 bits (97),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ AL+A  ASF+YLLG F
Sbjct  79   RYNTPLHVVTITELGALVALIASFIYLLGFF  109


 Score = 28.5 bits (62),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  55   TNAVFFTLFFSVAYYLLHRWRDKI  78



>gb|AAP14352.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Andrographis 
paniculata]
Length=556

 Score = 41.6 bits (96),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHV++ SE+AA++   ASF+YLLG F
Sbjct  63   RNSTPLHVLTLSELAAIVCLIASFIYLLGFF  93


 Score = 28.9 bits (63),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  YFLL  WRDKI
Sbjct  39   TNGIFFTLFFSVAYFLLHRWRDKI  62



>ref|XP_002510732.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF52919.1| hmg-CoA reductase, putative [Ricinus communis]
Length=576

 Score = 40.8 bits (94),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHV++ SE+AA+++  ASF+YLLG F
Sbjct  73   RNSTPLHVLTLSEIAAIVSLIASFIYLLGFF  103


 Score = 29.3 bits (64),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL  WRDKI
Sbjct  49   TNAIFFTLFFSVAYYLLHRWRDKI  72



>ref|XP_010270571.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nelumbo nucifera]
Length=605

 Score = 41.2 bits (95),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  79   RTSTPLHVVTLSEIAAIVSLIASFIYLLGFF  109


 Score = 28.9 bits (63),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 16/26 (62%), Gaps = 4/26 (15%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKIVT  360
            TN IFF    +  Y+LL  WRDKI T
Sbjct  55   TNGIFFTLFFSVAYYLLHRWRDKIRT  80



>ref|XP_006390187.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27473.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=431

 Score = 42.0 bits (97),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ AL+A  ASF+YLLG F
Sbjct  79   RYNTPLHVVTITELGALVALIASFIYLLGFF  109


 Score = 28.1 bits (61),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  55   TNAVFFTLFFSVAYYLLHRWRDKI  78



>ref|XP_011074058.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Sesamum indicum]
Length=555

 Score = 41.6 bits (96),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHV++ SE+AA+L+  ASF+YLLG F
Sbjct  61   RNSVPLHVLTLSELAAVLSLIASFIYLLGFF  91


 Score = 28.9 bits (63),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 11/17 (65%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+  YFLL  WRDKI
Sbjct  44   LFFSVAYFLLHRWRDKI  60



>gb|AEM42971.1| HMG-CoA reductase [Siraitia grosvenorii]
Length=582

 Score = 42.7 bits (99),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  80   RNSTPLHVVTLSEIAAIVSLIASFIYLLGFF  110


 Score = 27.3 bits (59),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+  Y+LL  WRDKI
Sbjct  63   LFFSVAYYLLHRWRDKI  79



>gb|ABC74565.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Picrorhiza kurrooa]
Length=561

 Score = 41.2 bits (95),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHV++ SE+AA++   ASF+YLLG F
Sbjct  72   RNSIPLHVLTVSELAAIICLIASFIYLLGFF  102


 Score = 28.9 bits (63),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (63%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TN IFF    +  YFLL  WRDKI
Sbjct  48   TNGIFFTLFFSVAYFLLHRWRDKI  71



>ref|XP_004146762.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 ref|XP_004170898.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 gb|KGN47779.1| hypothetical protein Csa_6G401490 [Cucumis sativus]
Length=590

 Score = 42.7 bits (99),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  82   RNSTPLHVVTLSEIAAIVSLMASFIYLLGFF  112


 Score = 27.7 bits (60),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+  Y+LL  WRDKI
Sbjct  65   LFFSVAYYLLHRWRDKI  81



>ref|NP_001284380.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Cucumis melo]
 dbj|BAA36291.1| HMG-CoA reductase [Cucumis melo]
 gb|ACZ50511.1| 3-hydroxy-3-methylglutaryl coenzyme-A reductase [Cucumis melo]
Length=587

 Score = 42.7 bits (99),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+ SE+AA+++  ASF+YLLG F
Sbjct  79   RNSTPLHVVTLSEIAAIVSLMASFIYLLGFF  109


 Score = 27.3 bits (59),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +1

Query  304  IFFAAVYFLLVSWRDKI  354
            +FF+  Y+LL  WRDKI
Sbjct  62   LFFSVAYYLLHRWRDKI  78



>ref|XP_002306999.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE93995.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
Length=563

 Score = 40.8 bits (94),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R+S PLHVV+  E+AA+++  ASF+YLLG F
Sbjct  54   RNSTPLHVVTFPEIAAIISLMASFIYLLGFF  84


 Score = 29.3 bits (64),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNAIFF    +  Y+LL  WRDKI
Sbjct  30   TNAIFFTLFFSVAYYLLYRWRDKI  53



>ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63901.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
Length=635

 Score = 41.6 bits (96),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ A++A  ASF+YLLG F
Sbjct  127  RYNTPLHVVTITELGAIIALIASFIYLLGFF  157


 Score = 28.5 bits (62),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  103  TNAVFFTLFFSVAYYLLHRWRDKI  126



>ref|XP_006302045.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
 gb|EOA34943.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
Length=515

 Score = 41.6 bits (96),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  354  RHSKPLHVVSSSEMAALLAFAASFVYLLGGF  446
            R++ PLHVV+ +E+ A++A  ASF+YLLG F
Sbjct  82   RYNTPLHVVTITELGAIIALIASFIYLLGFF  112


 Score = 28.5 bits (62),  Expect(2) = 0.001, Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 16/24 (67%), Gaps = 4/24 (17%)
 Frame = +1

Query  295  TNAIFF----AAVYFLLVSWRDKI  354
            TNA+FF    +  Y+LL  WRDKI
Sbjct  58   TNAVFFTLFFSVAYYLLHRWRDKI  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1487544256264