BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25822_g1_i2 len=171 path=[1:0-60 62:61-170]

Length=171
                                                                      Score     E

dbj|BAF79624.1|  3-hydroxy-3-methylglutaryl CoA reductase             79.0    2e-16   Solanum melongena [aubergine]
gb|AGQ04159.1|  hydroxymethylglutaryl-CoA reductase                   81.6    2e-16   
dbj|BAF79618.1|  3-hydroxy-3-methylglutaryl-CoA reductase             77.4    3e-16   Fragaria x ananassa
gb|ABB51072.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase       79.0    3e-16   Solanum torvum [berenjena cimarrona]
gb|KCW55693.1|  hypothetical protein EUGRSUZ_I01544                   81.3    3e-16   
gb|AHB64333.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       81.3    4e-16   
gb|KDP47034.1|  hypothetical protein JCGZ_10761                       81.3    4e-16   
gb|AIY26014.1|  HMGR                                                  80.5    7e-16   
gb|ABB52629.1|  3-hydroxy-3-methylglutaryl-CoA reductase              77.0    8e-16   Solanum torvum [berenjena cimarrona]
ref|XP_010028873.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  80.1    9e-16   
gb|AHI58914.1|  3-hydroxy-3-methylgutary coenzyme A reductase         77.4    1e-15   
ref|XP_010489363.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.7    1e-15   
sp|Q03163.1|HMDH_CATRO  RecName: Full=3-hydroxy-3-methylglutaryl-...  79.3    2e-15   Catharanthus roseus [chatas]
gb|AAT52222.1|  hydroxymethylglutaryl-CoA reductase                   79.3    2e-15   Catharanthus roseus [chatas]
ref|XP_010515116.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  79.0    2e-15   
dbj|BAF98281.1|  hydroxymethylglutaryl-CoA reductase                  79.0    2e-15   Hevea brasiliensis [jebe]
dbj|BAJ51945.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase      78.2    2e-15   
ref|XP_002300544.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...  79.0    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_002514400.1|  hmg-CoA reductase, putative                      79.0    2e-15   Ricinus communis
ref|XP_011038101.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  78.6    3e-15   
ref|XP_006409321.1|  hypothetical protein EUTSA_v10022614mg           78.6    3e-15   
ref|XP_006384871.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...  78.6    3e-15   
gb|AAU08214.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       78.6    3e-15   Hevea brasiliensis [jebe]
dbj|BAF98282.1|  hydroxymethylglutaryl-CoA reductase                  78.6    3e-15   Hevea brasiliensis [jebe]
ref|NP_001289522.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase  78.6    3e-15   
sp|P29057.1|HMDH1_HEVBR  RecName: Full=3-hydroxy-3-methylglutaryl...  78.6    3e-15   Hevea brasiliensis [jebe]
ref|XP_009601069.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  78.6    3e-15   
ref|XP_008348952.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  78.6    3e-15   
gb|AAB69726.1|  3-hydroxy-3-methylglutaryl coenzyme a reductase       78.2    4e-15   Camptotheca acuminata
gb|ABD59788.1|  3-hydroxy-3-methylglutaryl-CoA reductase              75.9    4e-15   Arnebia euchroma
emb|CDP01752.1|  unnamed protein product                              78.2    4e-15   
gb|EYU40486.1|  hypothetical protein MIMGU_mgv1a003590mg              78.2    4e-15   
gb|ADR51242.1|  3-hydroxy-3-methylglutaryl-CoA reductase              78.2    4e-15   
gb|ABB16439.1|  3-hydroxy-3-methyl glutaryl CoA reductase             74.3    5e-15   Solanum nigrum
ref|XP_006297340.1|  hypothetical protein CARUB_v10013360mg           77.8    5e-15   
gb|ACE80213.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     77.8    6e-15   Pyrus pyrifolia [sha li]
ref|XP_009780786.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    6e-15   
ref|XP_004234589.2|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    6e-15   
gb|ADJ18178.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       77.4    6e-15   
ref|XP_008235831.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    6e-15   
ref|XP_002528521.1|  hmg-CoA reductase, putative                      77.8    6e-15   Ricinus communis
gb|AAO85554.1|  3-hydroxy-3-methylglutaryl-CoA reductase              77.8    6e-15   Nicotiana attenuata
gb|ACV65036.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       77.8    6e-15   Panax quinquefolius
ref|XP_011000849.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    7e-15   
gb|AGL08682.1|  HMGR2                                                 77.8    7e-15   
ref|XP_011000847.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.8    7e-15   
ref|XP_010317674.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.4    7e-15   
gb|ABX82838.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       77.4    7e-15   Cyclocarya paliurus [qing qian liu]
gb|AAL54879.1|AF004233_1  hydroxy-methyl-glutaryl-coenzyme A redu...  77.4    8e-15   Nicotiana tabacum [American tobacco]
gb|AAL54878.1|AF004232_1  hydroxy-methyl-glutaryl-coenzyme A redu...  77.4    8e-15   Nicotiana tabacum [American tobacco]
dbj|BAE92730.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase      77.4    8e-15   Gentiana lutea
gb|AEA92686.1|  3-hydroxy-3-methylglutaryl coenzyme A                 77.4    8e-15   
gb|KDP24920.1|  hypothetical protein JCGZ_24298                       77.4    8e-15   
gb|AAB04043.1|  HMGR CoA reductase                                    75.9    8e-15   Solanum lycopersicum
ref|XP_004231636.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.4    9e-15   
sp|P48022.1|HMDH2_SOLLC  RecName: Full=3-hydroxy-3-methylglutaryl...  77.4    9e-15   Solanum lycopersicum
ref|XP_002313569.2|  hypothetical protein POPTR_0009s17090g           77.4    9e-15   Populus trichocarpa [western balsam poplar]
dbj|BAF98280.1|  hydroxymethylglutaryl-CoA reductase                  77.0    1e-14   Hevea brasiliensis [jebe]
ref|XP_004290090.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  77.0    1e-14   
ref|XP_007199742.1|  hypothetical protein PRUPE_ppa002715mg           77.0    1e-14   
gb|KFK42070.1|  hypothetical protein AALP_AA2G207200                  76.6    1e-14   
ref|XP_003617066.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  76.6    1e-14   
ref|XP_002884053.1|  3-hydroxy-3-methylglutaryl-CoA reductase 2       76.6    1e-14   
sp|Q9XEL8.1|HMDH2_CAPAN  RecName: Full=3-hydroxy-3-methylglutaryl...  76.6    1e-14   Capsicum annuum
ref|XP_003612422.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  76.3    1e-14   
ref|XP_010530977.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  76.6    2e-14   
gb|AFN89599.1|  3-hydro-3-methylglutary CoA reductase                 76.6    2e-14   
gb|AEH58930.1|  HMG-CoA reductase                                     76.6    2e-14   
gb|AIX87980.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       76.6    2e-14   
dbj|BAB20771.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase      76.6    2e-14   Solanum tuberosum [potatoes]
ref|XP_006350440.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  76.6    2e-14   
gb|ADM87300.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       76.6    2e-14   
ref|XP_004290091.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  76.6    2e-14   
ref|NP_179329.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2   76.3    2e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADC44451.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     76.3    2e-14   Salvia miltiorrhiza [Chinese salvia]
gb|ACT65734.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       76.3    2e-14   Salvia miltiorrhiza [Chinese salvia]
dbj|BAE92731.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase      76.3    2e-14   Gentiana lutea
gb|ADN39417.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       76.3    2e-14   
gb|ABG73435.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       73.2    2e-14   Litchi chinensis [litchi]
ref|XP_010467508.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  76.3    2e-14   
gb|ABE27875.1|  hydroxymethylglutaryl-coenzyme A reductase            76.3    2e-14   Arnebia euchroma
ref|XP_002301898.1|  hydroxymethylglutaryl-CoA reductase family p...  76.3    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_006390187.1|  hypothetical protein EUTSA_v10018320mg           75.5    2e-14   
gb|ABV25900.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       76.3    2e-14   Antirrhinum majus [garden snapdragon]
gb|KHG10514.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2     75.5    2e-14   
ref|XP_006364832.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.9    3e-14   
ref|NP_001275461.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  75.9    3e-14   
ref|XP_004232593.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.9    3e-14   
ref|NP_001275084.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  75.9    3e-14   
ref|XP_006390188.1|  hypothetical protein EUTSA_v10018320mg           75.9    3e-14   
ref|XP_002306999.1|  hydroxymethylglutaryl-CoA reductase family p...  75.5    3e-14   Populus trichocarpa [western balsam poplar]
gb|AAC15476.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       75.1    4e-14   Tagetes erecta [big marigold]
gb|AIM19608.1|  3-hydroxy-3-methyl-glutaryl-CoA reductase             75.5    4e-14   
gb|KDP36739.1|  hypothetical protein JCGZ_08030                       75.5    4e-14   
ref|XP_010094509.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  75.5    4e-14   
ref|XP_003612421.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  75.5    4e-14   
ref|XP_009599355.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.5    4e-14   
gb|AGA83240.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       75.5    4e-14   
emb|CDY71344.1|  BnaAnng37030D                                        74.3    4e-14   
ref|XP_010266284.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.5    4e-14   
gb|AGZ15318.1|  3-hydroxy-3-methylglutaryl CoA reductase              72.8    4e-14   
ref|NP_001274940.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  75.5    4e-14   
gb|KHG00733.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     75.5    5e-14   
ref|XP_003519474.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.1    5e-14   
ref|XP_008448157.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.1    5e-14   
ref|XP_011092919.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.1    6e-14   
ref|XP_004290088.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.1    6e-14   
ref|XP_007043108.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  75.1    6e-14   
gb|ABK56831.1|  3-hydroxy-3-methylglutaryl-CoA reductase              75.1    6e-14   Euphorbia pekinensis
ref|XP_002317026.1|  3-hydroxy-3-methylglutaryl coenzyme A reduct...  75.1    6e-14   Populus trichocarpa [western balsam poplar]
gb|ABK88909.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       75.1    6e-14   
ref|XP_010270571.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  75.1    6e-14   
ref|XP_011034792.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    6e-14   
ref|XP_004512291.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    7e-14   
ref|XP_010471802.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    7e-14   
ref|XP_002510732.1|  hmg-CoA reductase, putative                      74.7    7e-14   Ricinus communis
ref|XP_010416569.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    8e-14   
gb|AEH95323.1|  HMG-CoA reductase 3                                   74.3    8e-14   
ref|XP_010428711.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    8e-14   
ref|XP_010428712.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.7    8e-14   
gb|KGN46640.1|  hypothetical protein Csa_6G117710                     74.7    9e-14   
ref|XP_008778179.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  74.3    9e-14   
sp|O64967.1|HMDH2_GOSHI  RecName: Full=3-hydroxy-3-methylglutaryl...  74.3    9e-14   Gossypium hirsutum [American cotton]
ref|XP_006302045.1|  hypothetical protein CARUB_v10020027mg           73.9    1e-13   
gb|AEX26934.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     74.3    1e-13   
gb|AAC15475.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       74.3    1e-13   Tagetes erecta [big marigold]
ref|XP_002887642.1|  3-hydroxy-3-methylglutaryl CoA reductase         74.3    1e-13   
ref|XP_004139979.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    1e-13   
ref|XP_006302046.1|  hypothetical protein CARUB_v10020027mg           73.9    1e-13   
ref|XP_010534322.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    1e-13   
ref|XP_010537243.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    1e-13   
ref|XP_004491163.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    1e-13   
gb|AET72045.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2     73.9    1e-13   
ref|XP_004154522.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    1e-13   
sp|P14891.1|HMDH1_ARATH  RecName: Full=3-hydroxy-3-methylglutaryl...  73.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177775.2|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1   73.9    1e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128179.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.9    2e-13   
ref|XP_003612561.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.6    2e-13   
ref|XP_003612563.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.6    2e-13   
gb|AAD03789.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       73.6    2e-13   Morus alba
ref|XP_010061229.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.6    2e-13   
emb|CDY20406.1|  BnaC02g24100D                                        73.6    2e-13   
gb|AAY68034.1|  3-hydroxy-methylglutaryl coenzyme A reductase         73.6    2e-13   Tilia miqueliana
gb|AID51436.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     73.6    2e-13   
ref|XP_003617390.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.6    2e-13   
emb|CAA48610.1|  hydroxymethylglutaryl-CoA reductase (NADPH)          73.6    2e-13   Raphanus sativus
ref|XP_003612565.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  73.2    2e-13   
emb|CDX88285.1|  BnaC06g37290D                                        73.6    2e-13   
ref|XP_011041288.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  73.6    2e-13   
gb|AET72043.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2     73.2    2e-13   
ref|XP_006297478.1|  hypothetical protein CARUB_v10013498mg           72.8    3e-13   
gb|AAV54051.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       73.2    3e-13   Eucommia ulmoides
gb|AIK21780.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       73.2    3e-13   
gb|AET72044.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     72.8    3e-13   
gb|AID51438.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     72.8    3e-13   
gb|KHG04251.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2     72.4    3e-13   
gb|ABF56518.2|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     72.8    3e-13   Litchi chinensis [litchi]
gb|AFZ93642.1|  hydroxymethylglutaryl coenzyme A reductase            72.8    3e-13   
emb|CAA48611.1|  hydroxymethylglutaryl-CoA reductase (NADPH)          72.8    3e-13   Raphanus sativus
gb|AAL37041.1|AF303583_1  3-hydroxy-3-methylglutaryl coenzyme A       72.8    4e-13   Pisum sativum [garden pea]
emb|CAN72217.1|  hypothetical protein VITISV_039086                   72.4    5e-13   Vitis vinifera
gb|AIG55301.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       72.0    6e-13   
ref|XP_010910988.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  72.0    6e-13   
gb|KFK40113.1|  hypothetical protein AALP_AA3G332100                  72.0    6e-13   
sp|O64966.1|HMDH1_GOSHI  RecName: Full=3-hydroxy-3-methylglutaryl...  72.0    7e-13   Gossypium hirsutum [American cotton]
gb|AEO12148.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       72.0    7e-13   
gb|ABP04052.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       72.0    7e-13   Corylus avellana [European hazelnut]
gb|AGW82424.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       72.0    7e-13   
ref|XP_004300101.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  72.0    7e-13   
emb|CDP07253.1|  unnamed protein product                              72.0    7e-13   
gb|AHX36946.1|  3-hydroxy-3-methyl glutaryl coenzyme a reductase      72.0    7e-13   
gb|AFU75319.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       71.6    9e-13   
gb|ABY20972.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     71.6    9e-13   Medicago truncatula
ref|XP_009106317.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  71.6    9e-13   
ref|XP_003612568.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  71.2    1e-12   
ref|XP_010063168.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  71.2    1e-12   
gb|AAB69727.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       71.2    1e-12   Camptotheca acuminata
ref|XP_010548185.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  71.2    1e-12   
gb|AID51437.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 2     71.2    1e-12   
gb|ABC74565.1|  3-hydroxy-3-methylglutaryl-CoA reductase              70.9    1e-12   Picrorhiza kurrooa
ref|XP_009386797.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.9    2e-12   
ref|XP_004509470.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.9    2e-12   
ref|NP_001130818.1|  hypothetical protein                             70.9    2e-12   Zea mays [maize]
gb|AEZ55673.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 4     70.5    2e-12   
ref|XP_002275827.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.9    2e-12   Vitis vinifera
ref|XP_009588198.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.5    2e-12   
gb|ACD37361.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       70.5    2e-12   Salvia miltiorrhiza [Chinese salvia]
sp|Q00583.1|HMDH3_HEVBR  RecName: Full=3-hydroxy-3-methylglutaryl...  70.1    3e-12   Hevea brasiliensis [jebe]
ref|XP_008451185.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.1    3e-12   
ref|XP_011030717.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  70.1    3e-12   
ref|XP_002460459.1|  hypothetical protein SORBIDRAFT_02g028630        70.1    3e-12   Sorghum bicolor [broomcorn]
emb|CBI40773.3|  unnamed protein product                              69.7    3e-12   
ref|XP_009785805.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.7    4e-12   
ref|XP_004169656.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.7    4e-12   
ref|XP_010690585.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.7    4e-12   
gb|EPS64817.1|  hypothetical protein M569_09963                       69.7    4e-12   
tpg|DAA62078.1|  TPA: hypothetical protein ZEAMMB73_122013            69.7    4e-12   
ref|XP_004144569.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.7    5e-12   
emb|CBI37502.3|  unnamed protein product                              69.3    5e-12   
gb|EYU36597.1|  hypothetical protein MIMGU_mgv1a003864mg              69.3    5e-12   
ref|XP_002265638.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  69.3    6e-12   Vitis vinifera
ref|XP_003629056.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase  69.3    6e-12   
gb|AHZ59734.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       69.3    6e-12   
gb|AHI88624.1|  3-hydroxy-3-methylglutary CoA reductase               68.9    7e-12   
ref|XP_008344180.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.9    7e-12   
ref|XP_007018657.1|  Hydroxy methylglutaryl CoA reductase 1           68.9    7e-12   
gb|AGF87122.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     68.9    7e-12   
ref|XP_009369771.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.9    7e-12   
ref|XP_007158038.1|  hypothetical protein PHAVU_002G118900g           68.9    7e-12   
gb|AIX87979.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       68.9    7e-12   
gb|AFD23288.1|  3-hydroxy-3-methylglutary CoA reductase               68.6    7e-12   
gb|AEU08408.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       68.9    8e-12   
ref|XP_010029551.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.9    8e-12   
ref|XP_009410341.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.6    1e-11   
ref|XP_007046440.1|  Hydroxy methylglutaryl CoA reductase 1 isofo...  68.6    1e-11   
emb|CDY50207.1|  BnaC07g06390D                                        68.6    1e-11   
ref|XP_007046441.1|  Hydroxy methylglutaryl CoA reductase 1 isofo...  68.6    1e-11   
gb|ADI80346.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       68.6    1e-11   
ref|XP_006342182.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.6    1e-11   
ref|XP_009395908.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.6    1e-11   
ref|NP_001062221.1|  Os08g0512700                                     67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003578341.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.2    1e-11   
ref|XP_009121127.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  68.2    1e-11   
ref|XP_002445887.1|  hypothetical protein SORBIDRAFT_07g027480        68.2    1e-11   Sorghum bicolor [broomcorn]
sp|Q9XHL5.2|HMDH3_ORYSJ  RecName: Full=3-hydroxy-3-methylglutaryl...  67.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
gb|AHY03303.1|  HMG-CoA reductase 2                                   67.8    2e-11   
ref|XP_006849945.1|  hypothetical protein AMTR_s00022p00133290        67.8    2e-11   
gb|AAD38873.1|AF110382_1  3-hydroxy-3-methylglutaryl-coenzyme A r...  67.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008799136.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.8    2e-11   
gb|AGN32409.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     67.8    2e-11   
gb|AEC33260.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       67.8    2e-11   
ref|XP_004146762.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.8    2e-11   
gb|AGT78194.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       67.8    2e-11   
gb|AAQ82685.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       67.8    2e-11   Taxus x media [hybrid yew]
gb|EEE68986.1|  hypothetical protein OsJ_27912                        67.8    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008677153.1|  PREDICTED: uncharacterized protein LOC100280...  67.8    2e-11   
sp|O24594.1|HMDH_MAIZE  RecName: Full=3-hydroxy-3-methylglutaryl-...  67.8    2e-11   Zea mays [maize]
ref|XP_004957224.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.4    2e-11   
ref|XP_004287703.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.4    2e-11   
emb|CDY24329.1|  BnaA07g02540D                                        67.4    2e-11   
gb|AEM42971.1|  HMG-CoA reductase                                     67.4    3e-11   
ref|XP_003537699.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.4    3e-11   
gb|AFW65233.1|  hypothetical protein ZEAMMB73_893790                  66.6    3e-11   
ref|XP_008357165.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.0    3e-11   
ref|XP_008782826.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  67.0    3e-11   
ref|NP_001284380.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  67.0    4e-11   
gb|AAY87014.1|  3-hydroxy-methylglutaryl coenzyme A reductase         66.6    4e-11   Magnolia chapensis
ref|XP_008666319.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.5    5e-11   
gb|AIX10146.1|  hydroxymethylglutaryl-CoA reductase                   66.6    5e-11   
gb|ADP94147.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       66.6    5e-11   
ref|XP_011074058.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  66.6    5e-11   
tpg|DAA46962.1|  TPA: hypothetical protein ZEAMMB73_781636            65.5    6e-11   
gb|AIZ09174.1|  3-hydroxy-3-methyl-glutaryl-CoA reductase             66.2    7e-11   
sp|P48021.1|HMDH_CAMAC  RecName: Full=3-hydroxy-3-methylglutaryl-...  66.2    8e-11   Camptotheca acuminata
ref|XP_004973895.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.9    8e-11   
gb|ABJ16394.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       65.9    9e-11   Ligularia fischeri
ref|XP_009387500.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  65.9    9e-11   
gb|AHC72041.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       65.9    9e-11   
ref|XP_010932149.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  65.9    9e-11   
gb|AGI56083.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 1     65.9    9e-11   
gb|AGA18962.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       65.9    9e-11   
dbj|BAJ89341.1|  predicted protein                                    65.5    1e-10   
gb|KHG17968.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 1     63.2    1e-10   
gb|EYU41201.1|  hypothetical protein MIMGU_mgv1a003775mg              65.5    1e-10   
gb|AFM77981.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       65.1    2e-10   
gb|AGN32411.1|  3-hydroxy-3-methylglutaryl-CoA reductase 1            65.1    2e-10   
gb|ABV25901.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       65.1    2e-10   Antirrhinum majus [garden snapdragon]
gb|ACN40476.1|  unknown                                               64.7    2e-10   Picea sitchensis
ref|XP_003572378.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  64.7    2e-10   
gb|AFW73089.1|  hypothetical protein ZEAMMB73_623392                  64.7    2e-10   
dbj|BAJ91127.1|  predicted protein                                    64.7    2e-10   
ref|XP_008646164.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  64.7    2e-10   
ref|XP_003517117.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  64.7    2e-10   
ref|NP_001146733.1|  uncharacterized protein LOC100280335             64.7    2e-10   Zea mays [maize]
gb|EMT29532.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     64.3    3e-10   
ref|XP_008242165.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  63.9    4e-10   
ref|XP_006605576.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  63.9    4e-10   
gb|AFN89600.1|  3-hydro-3-methylglutary CoA reductase                 63.9    5e-10   
ref|XP_010928980.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  63.5    6e-10   
gb|EEE69968.1|  hypothetical protein OsJ_29860                        63.2    6e-10   
ref|XP_007156265.1|  hypothetical protein PHAVU_003G271800g           63.5    7e-10   
ref|NP_001063541.1|  Os09g0492700                                     63.2    8e-10   
gb|EAZ09593.1|  hypothetical protein OsI_31874                        63.2    8e-10   
ref|XP_008796235.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  62.8    1e-09   
ref|XP_003547886.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  62.8    1e-09   
ref|XP_003534226.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  62.8    1e-09   
gb|EYU20588.1|  hypothetical protein MIMGU_mgv1a026071mg              60.5    1e-09   
gb|ABV25902.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       62.4    2e-09   
ref|XP_006660783.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  61.6    2e-09   
gb|AGB06349.1|  HMG-CoA reductase                                     62.0    2e-09   
gb|AAB53748.1|  3-hydroxy-3-methylglutaryl-CoA reductase              62.0    2e-09   
emb|CAA92821.1|  3-hydroxy-3-methylglutaryl-CoA reductase             62.0    2e-09   
gb|AEZ55672.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase 3     62.0    2e-09   
ref|NP_001275402.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  61.6    3e-09   
gb|ADX31914.1|  HMG CoA reductase                                     61.2    4e-09   
gb|ADX31913.1|  HMG CoA reductase                                     61.2    4e-09   
gb|AFW62832.1|  hypothetical protein ZEAMMB73_935848                  61.6    4e-09   
ref|XP_001751461.1|  predicted protein                                60.8    5e-09   
ref|XP_001771547.1|  predicted protein                                60.1    8e-09   
gb|AAL03986.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       59.3    2e-08   
gb|AAK95406.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       58.9    2e-08   
ref|XP_009358901.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  58.9    2e-08   
ref|XP_008347553.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  58.9    2e-08   
gb|AHI85949.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       58.9    2e-08   
gb|AIA62198.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       58.9    3e-08   
ref|XP_003545556.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  58.5    3e-08   
ref|XP_006660782.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  58.2    3e-08   
gb|AAL28015.2|AF389879_1  3-hydroxy-3-methylglutaryl-coenzyme A r...  58.5    4e-08   
gb|AAA68965.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       56.6    1e-07   
gb|AAA68966.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       56.6    2e-07   
emb|CBI37717.3|  unnamed protein product                              56.2    2e-07   
gb|AAK64657.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       56.2    2e-07   
ref|XP_002283183.2|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  56.2    2e-07   
gb|AAD47596.1|  HMG-CoA reductase                                     55.8    3e-07   
ref|XP_006435453.1|  hypothetical protein CICLE_v10000761mg           55.1    4e-07   
ref|XP_010025658.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  55.5    4e-07   
gb|KDO85246.1|  hypothetical protein CISIN_1g011423mg                 55.1    5e-07   
gb|KDO85245.1|  hypothetical protein CISIN_1g011423mg                 55.1    5e-07   
ref|XP_009369772.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  55.1    5e-07   
ref|XP_008392877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-...  55.1    5e-07   
ref|XP_010090727.1|  3-hydroxy-3-methylglutaryl-coenzyme A reduct...  55.1    5e-07   
gb|KDO38001.1|  hypothetical protein CISIN_1g007956mg                 54.7    8e-07   
ref|XP_006486561.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  54.7    8e-07   
ref|XP_006422382.1|  hypothetical protein CICLE_v10028082mg           54.7    8e-07   
gb|ADX01170.1|  putative 3-hydroxy-3-methyl-glutaryl-CoA reductase    54.3    1e-06   
gb|AAP14352.2|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       54.3    1e-06   
ref|XP_006435454.1|  hypothetical protein CICLE_v10000761mg           54.3    1e-06   
ref|XP_006473861.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  54.3    1e-06   
ref|XP_010025657.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  53.5    2e-06   
ref|XP_007146046.1|  hypothetical protein PHAVU_006G008200g           52.8    3e-06   
ref|XP_002988517.1|  hypothetical protein SELMODRAFT_272011           52.4    4e-06   
ref|XP_002979148.1|  hypothetical protein SELMODRAFT_177513           52.4    5e-06   
gb|AER00469.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       50.1    3e-05   
ref|XP_008357826.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  50.1    3e-05   
ref|XP_008242335.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  49.7    3e-05   
gb|ABQ52378.1|  3-hydroxy-3-methylglutaryl-CoA reductase              49.7    3e-05   
gb|AEL30660.1|  3-hydroxy-3-methylglutaryl-CoA reductase              49.7    4e-05   
ref|XP_009359638.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  49.7    4e-05   
ref|XP_007204578.1|  hypothetical protein PRUPE_ppa003613mg           49.7    4e-05   
ref|XP_010927300.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  49.3    5e-05   
ref|XP_008242115.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-coenzy...  48.9    6e-05   
ref|XP_007204574.1|  hypothetical protein PRUPE_ppa003627mg           48.9    7e-05   
gb|ACE80254.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase 2     48.9    8e-05   
ref|XP_007141592.1|  hypothetical protein PHAVU_008G208900g           48.5    9e-05   
gb|ACR02667.1|  3-hydroxy-3-methylglutaryl-coenzyme A reductase       48.1    1e-04   
gb|EFA83453.1|  hmg CoA reductase A                                   48.1    2e-04   
ref|XP_001526520.1|  hypothetical protein LELG_01348                  48.1    2e-04   
ref|XP_004367086.1|  hypothetical protein DFA_07220                   47.0    3e-04   
gb|AAU89123.1|  3-hydroxy-3-methylglutaryl coenzyme A reductase       47.0    3e-04   
ref|XP_003291033.1|  hydroxymethylglutaryl CoA reductase              45.8    7e-04   



>dbj|BAF79624.1| 3-hydroxy-3-methylglutaryl CoA reductase [Solanum melongena]
Length=213

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IRR+AL+RITGKSL+GLPLE
Sbjct  58   IIKSVVQGKMPSYSLESKLGDCKRAASIRREALQRITGKSLEGLPLE  104



>gb|AGQ04159.1| hydroxymethylglutaryl-CoA reductase [Lavandula angustifolia]
Length=565

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+IPSY+LESKLGDC RAAAIRR+AL+R+TGKSLDGLPLE
Sbjct  157  IVKSVVEGKIPSYALESKLGDCLRAAAIRREALQRVTGKSLDGLPLE  203



>dbj|BAF79618.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Fragaria x ananassa]
Length=131

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKLGDCKRAA+IRR+AL+R+TGKSL+GLPLE
Sbjct  28   IIKAVVAGTIPSYSLESKLGDCKRAASIRREALQRVTGKSLEGLPLE  74



>gb|ABB51072.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum torvum]
Length=233

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IRR+AL+RITGKSL+GLPLE
Sbjct  78   IIKSVVQGKMPSYSLESKLGDCKRAASIRREALQRITGKSLEGLPLE  124



>gb|KCW55693.1| hypothetical protein EUGRSUZ_I01544 [Eucalyptus grandis]
Length=626

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EG++PSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  215  IIKSVVEGKMPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLE  261



>gb|AHB64333.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=573

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDCKRAAAIRR ALER+TGKSLDGLPLE
Sbjct  161  IIKSVVDGKTPSYSLESKLGDCKRAAAIRRVALERVTGKSLDGLPLE  207



>gb|KDP47034.1| hypothetical protein JCGZ_10761 [Jatropha curcas]
Length=596

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++N V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  183  LINSVVSGTIPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLE  229



>gb|AIY26014.1| HMGR [Jasminum sambac]
Length=594

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+ PSYSLESKLGDCKRAA+IRR+AL+RITGKSL+GLPLE
Sbjct  183  IVRSVVEGKTPSYSLESKLGDCKRAASIRREALQRITGKSLEGLPLE  229



>gb|ABB52629.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Solanum torvum]
Length=191

 Score = 77.0 bits (188),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  84   IIQSVVQGKIPSYSLESKLGDCTRAASIRKEALQRITGKSLEGLPLE  130



>ref|XP_010028873.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-methylglutaryl-coenzyme 
A reductase 1 [Eucalyptus grandis]
Length=603

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EG++PSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  192  IIKSVVEGKMPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLE  238



>gb|AHI58914.1| 3-hydroxy-3-methylgutary coenzyme A reductase, partial [Centella 
asiatica]
Length=259

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G  PSYSLESKLGDC +AAAIRR+AL+RITGKSLDGLPL+
Sbjct  178  IINAVVAGTTPSYSLESKLGDCLKAAAIRREALQRITGKSLDGLPLD  224



>ref|XP_010489363.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Camelina sativa]
Length=552

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG IPSYSLE+KLGDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  140  IVKSVVEGTIPSYSLETKLGDCKRAAAIRREAVQRITGKSLTGLPLE  186



>sp|Q03163.1|HMDH_CATRO RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Catharanthus roseus]
 gb|AAA33108.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
 prf||1909368A hydroxy methylglutaryl CoA reductase [Catharanthus roseus]
Length=601

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+IPSYSLESKLGDCKRAA IRR+AL+RITGKSL+GLPLE
Sbjct  183  IIKAVVAGKIPSYSLESKLGDCKRAAGIRREALQRITGKSLEGLPLE  229



>gb|AAT52222.1| hydroxymethylglutaryl-CoA reductase [Catharanthus roseus]
Length=601

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+IPSYSLESKLGDCKRAA IRR+AL+RITGKSL+GLPLE
Sbjct  183  IIKAVVAGKIPSYSLESKLGDCKRAAGIRREALQRITGKSLEGLPLE  229



>ref|XP_010515116.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=557

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EG IPSYSLE+KLGDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  145  IIKSVVEGTIPSYSLETKLGDCKRAAAIRREAVQRITGKSLTGLPLE  191



>dbj|BAF98281.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=606

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  193  IIKSVVAGTIPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLE  239



>dbj|BAJ51945.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana benthamiana]
Length=410

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  239



>ref|XP_002300544.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|EEE85349.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=577

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++ GV  G IPSYSLESKLGDCKRAAAIRR+AL+R+TG+S++GLPLE
Sbjct  166  VIKGVVSGTIPSYSLESKLGDCKRAAAIRREALQRMTGRSMEGLPLE  212



>ref|XP_002514400.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF47996.1| hmg-CoA reductase, putative [Ricinus communis]
Length=586

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDCKRAAAIRR ALERITGKSL GLPLE
Sbjct  173  IIRSVVDGKTPSYSLESKLGDCKRAAAIRRLALERITGKSLSGLPLE  219



>ref|XP_011038101.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Populus euphratica]
Length=576

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++ GV  G IPSYSLESKLGDCKRAAAIRR+AL+R+TG+S++GLPLE
Sbjct  165  VIKGVVSGTIPSYSLESKLGDCKRAAAIRREALQRMTGRSMEGLPLE  211



>ref|XP_006409321.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
 gb|ESQ50774.1| hypothetical protein EUTSA_v10022614mg [Eutrema salsugineum]
Length=582

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG IPSYSLE+KLGDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  168  IVKSVIEGTIPSYSLETKLGDCKRAAAIRREAVQRITGKSLAGLPLE  214



>ref|XP_006384871.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|ERP62668.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=594

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G+ PSYSLESKLGDCKRAAAIRR+AL+RIT KSL GLPLE
Sbjct  183  IINSVVAGKTPSYSLESKLGDCKRAAAIRREALQRITSKSLSGLPLE  229



>gb|AAU08214.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Hevea brasiliensis]
Length=575

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V +G+IPSYSLESKLGDCKRAAAIRR+AL+R+T +SL+GLP+E
Sbjct  164  IVNSVVDGKIPSYSLESKLGDCKRAAAIRREALQRMTRRSLEGLPVE  210



>dbj|BAF98282.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=575

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V +G+IPSYSLESKLGDCKRAAAIRR+AL+R+T +SL+GLP+E
Sbjct  164  IVNSVVDGKIPSYSLESKLGDCKRAAAIRREALQRMTRRSLEGLPVE  210



>ref|NP_001289522.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana sylvestris]
 sp|Q01559.1|HMDH_NICSY RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Nicotiana sylvestris]
 emb|CAA45181.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana sylvestris]
Length=604

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  239



>sp|P29057.1|HMDH1_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1 [Hevea brasiliensis]
 gb|AAL18929.1|AF429388_1 hydroxymethylglutaryl coenzyme A reductase [Hevea brasiliensis]
 emb|CAA38467.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 emb|CAA38469.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
 gb|AAQ63055.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea brasiliensis]
Length=575

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V +G+IPSYSLESKLGDCKRAAAIRR+AL+R+T +SL+GLP+E
Sbjct  164  IVNSVVDGKIPSYSLESKLGDCKRAAAIRREALQRMTRRSLEGLPVE  210



>ref|XP_009601069.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Nicotiana 
tomentosiformis]
Length=605

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  194  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  240



>ref|XP_008348952.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=605

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  193  VVKSVVAGTIPSYSLESKLGDCKRAAAIRREALQRITGKSLTGLPLE  239



>gb|AAB69726.1| 3-hydroxy-3-methylglutaryl coenzyme a reductase [Camptotheca 
acuminata]
Length=575

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  GRIPSYSLE++LGDCKRAAAIRR+AL+R+TGKSL+GLPLE
Sbjct  165  MIKSVVAGRIPSYSLETRLGDCKRAAAIRREALQRLTGKSLEGLPLE  211



>gb|ABD59788.1| 3-hydroxy-3-methylglutaryl-CoA reductase, partial [Arnebia euchroma]
Length=271

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR+AL+R+TGKSL+GLPLE
Sbjct  64   IVQSVVQGNTPSYSLESKLGDCFRAAAIRREALQRLTGKSLEGLPLE  110



>emb|CDP01752.1| unnamed protein product [Coffea canephora]
Length=604

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+IPSYSLESKLGDCK+AA IRR+AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVSGKIPSYSLESKLGDCKKAAGIRREALQRITGKSLEGLPLE  239



>gb|EYU40486.1| hypothetical protein MIMGU_mgv1a003590mg [Erythranthe guttata]
Length=575

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+ PSYSLESKLGDC+RAA IRR+AL+RITGKSL GLPLE
Sbjct  166  IVKSVVEGKTPSYSLESKLGDCRRAAVIRREALQRITGKSLTGLPLE  212



>gb|ADR51242.1| 3-hydroxy-3-methylglutaryl-CoA reductase, partial [Coffea arabica]
Length=604

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+IPSYSLESKLGDCK+AA IRR+AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVSGKIPSYSLESKLGDCKKAAGIRREALQRITGKSLEGLPLE  239



>gb|ABB16439.1| 3-hydroxy-3-methyl glutaryl CoA reductase [Solanum nigrum]
Length=142

 Score = 74.3 bits (181),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  32   IIQSVVQGKTPSYSLESKLGDCLRAASIRKEALQRITGKSLEGLPLE  78



>ref|XP_006297340.1| hypothetical protein CARUB_v10013360mg [Capsella rubella]
 gb|EOA30238.1| hypothetical protein CARUB_v10013360mg [Capsella rubella]
Length=563

 Score = 77.8 bits (190),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG IPSYSLE+K GDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  151  IVKSVIEGTIPSYSLETKFGDCKRAAAIRREAVQRITGKSLTGLPLE  197



>gb|ACE80213.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Pyrus pyrifolia]
Length=609

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKSL+GLPLE
Sbjct  196  MIKSVLAGTIPSYSLESKLGDCKRAAAIRREALQRITGKSLEGLPLE  242



>ref|XP_009780786.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nicotiana sylvestris]
Length=605

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDCKRAA++RR+AL+RITGKSL+GLPLE
Sbjct  194  IIQSVVQGKTPSYSLESKLGDCKRAASVRREALQRITGKSLEGLPLE  240



>ref|XP_004234589.2| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 
[Solanum lycopersicum]
Length=574

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EGRIPSYSLESKLGDCKRAA IR++AL+R +GKSLDGLPL+
Sbjct  166  IIKSVVEGRIPSYSLESKLGDCKRAAFIRKEALQRSSGKSLDGLPLD  212



>gb|ADJ18178.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucalyptus grandis 
x Eucalyptus urophylla]
Length=519

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EG++PSYSLE+KLGDCKRAAAIRR+AL+R+TGKSL GLPLE
Sbjct  108  IIKSVVEGKMPSYSLEAKLGDCKRAAAIRREALQRMTGKSLSGLPLE  154



>ref|XP_008235831.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Prunus mume]
Length=605

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  193  VIKAVLSGTIPSYSLESKLGDCKRAAAIRREALQRITGKSLGGLPLE  239



>ref|XP_002528521.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF33833.1| hmg-CoA reductase, putative [Ricinus communis]
Length=576

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G +PSYSLESKLGDCKRAAAIRR+AL+R+TG+SL+GLPL+
Sbjct  165  IINSVLSGSLPSYSLESKLGDCKRAAAIRREALQRMTGRSLEGLPLD  211



>gb|AAO85554.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Nicotiana attenuata]
Length=604

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  239



>gb|ACV65036.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax quinquefolius]
Length=589

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G  PSYSLESKLGDC +AAAIRR+AL+RITGKSLDGLPL+
Sbjct  178  IINAVVAGTTPSYSLESKLGDCLKAAAIRREALQRITGKSLDGLPLD  224



>ref|XP_011000849.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X3 [Populus euphratica]
Length=617

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G+ PSYSLESKLGDCKRAAAIRR+AL+RIT KSL GLPLE
Sbjct  206  IINSVVAGKTPSYSLESKLGDCKRAAAIRREALQRITCKSLSGLPLE  252



>gb|AGL08682.1| HMGR2 [Panax ginseng]
Length=589

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G  PSYSLESKLGDC +AAAIRR+AL+RITGKSLDGLPL+
Sbjct  178  IINAVVAGTTPSYSLESKLGDCLKAAAIRREALQRITGKSLDGLPLD  224



>ref|XP_011000847.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X1 [Populus euphratica]
 ref|XP_011000848.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X2 [Populus euphratica]
Length=631

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G+ PSYSLESKLGDCKRAAAIRR+AL+RIT KSL GLPLE
Sbjct  220  IINSVVAGKTPSYSLESKLGDCKRAAAIRREALQRITCKSLSGLPLE  266



>ref|XP_010317674.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Solanum lycopersicum]
Length=574

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V EGRIPSYSLESKLGDCKRAA IR++AL+R +GKSLDGLPL+
Sbjct  166  VIKSVVEGRIPSYSLESKLGDCKRAAFIRKEALQRTSGKSLDGLPLD  212



>gb|ABX82838.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Cyclocarya paliurus]
Length=583

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V EG++PSYSLESKLGDCKRAA+IRR+AL+R TGKSL GLPLE
Sbjct  172  IIKSVVEGKMPSYSLESKLGDCKRAASIRREALQRTTGKSLAGLPLE  218



>gb|AAL54879.1|AF004233_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  239



>gb|AAL54878.1|AF004232_1 hydroxy-methyl-glutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G++PSYSLESKLGDCKRAA+IR++AL+RITGKSL+GLPLE
Sbjct  193  IIKSVVQGKMPSYSLESKLGDCKRAASIRKEALQRITGKSLEGLPLE  239



>dbj|BAE92730.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea]
Length=586

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+ PSYSLESKLGDCKRAA IRR+AL+RITGKSL+GLPLE
Sbjct  173  IIESVVSGKTPSYSLESKLGDCKRAAKIRREALQRITGKSLEGLPLE  219



>gb|AEA92686.1| 3-hydroxy-3-methylglutaryl coenzyme A [Taraxacum kok-saghyz]
Length=582

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G+ PSYSLESKLGDCKRAA IRR ALERITGKSLDGLPLE
Sbjct  173  VIQSVVSGKTPSYSLESKLGDCKRAAFIRRVALERITGKSLDGLPLE  219



>gb|KDP24920.1| hypothetical protein JCGZ_24298 [Jatropha curcas]
Length=572

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G IPSYSLESKLGDC+RAAAIRR++L+R+TG+SL+GLPL+
Sbjct  161  IINSVVSGSIPSYSLESKLGDCRRAAAIRRESLQRMTGRSLEGLPLD  207



>gb|AAB04043.1| HMGR CoA reductase [Solanum lycopersicum]
Length=343

 Score = 75.9 bits (185),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  188  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  234



>ref|XP_004231636.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Solanum lycopersicum]
 gb|AAB62581.1| 3-hydroxy-3-methylglutaryl CoA reductase 2 [Solanum lycopersicum]
Length=601

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDCKRAA+IR++ ++RITGKSL+GLPLE
Sbjct  190  IIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLE  236



>sp|P48022.1|HMDH2_SOLLC RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Solanum lycopersicum]
 gb|AAA34169.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum lycopersicum]
Length=602

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDCKRAA+IR++ ++RITGKSL+GLPLE
Sbjct  191  IIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLE  237



>ref|XP_002313569.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
 gb|EEE87524.2| hypothetical protein POPTR_0009s17090g [Populus trichocarpa]
Length=646

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G+ PSYSLESKLGDCKRAAAIRR+AL+RIT KSL GLPLE
Sbjct  235  IINSVVAGKTPSYSLESKLGDCKRAAAIRREALQRITCKSLSGLPLE  281



>dbj|BAF98280.1| hydroxymethylglutaryl-CoA reductase [Hevea brasiliensis]
Length=526

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  193  IIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLE  239



>ref|XP_004290090.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=596

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLE+KLGDCKRAA+IRR+AL+R+TGKSL+GLPLE
Sbjct  184  IIKAVVAGTIPSYSLETKLGDCKRAASIRREALQRVTGKSLEGLPLE  230



>ref|XP_007199742.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
 gb|EMJ00941.1| hypothetical protein PRUPE_ppa002715mg [Prunus persica]
Length=641

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G IPSYSLESKLGDCKRAAAIRR+AL+RITGKS+ GLPLE
Sbjct  229  VIKAVVSGTIPSYSLESKLGDCKRAAAIRREALQRITGKSMGGLPLE  275



>gb|KFK42070.1| hypothetical protein AALP_AA2G207200 [Arabis alpina]
Length=572

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA IRR+AL+RITG+S+DGLPL+
Sbjct  157  IVKSVIDGEIPSYSLESRLGDCKRAALIRRQALQRITGRSIDGLPLD  203



>ref|XP_003617066.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|AET00025.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=565

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V EG IPSYSLES+LGDC RAAAIRR+AL+R +G+SL+GLPLE
Sbjct  154  IVNSVVEGTIPSYSLESQLGDCFRAAAIRREALQRTSGRSLEGLPLE  200



>ref|XP_002884053.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60312.1| 3-hydroxy-3-methylglutaryl-CoA reductase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=564

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSY+LE+KLGDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  152  IVKSVIDGTIPSYTLETKLGDCKRAAAIRREAVQRITGKSLTGLPLE  198



>sp|Q9XEL8.1|HMDH2_CAPAN RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Capsicum annuum]
 gb|AAD28179.1|AF110383_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Capsicum annuum]
Length=604

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDCKRAA+IR++ L+RITGKSL+GLPL+
Sbjct  193  IIKSVVQGKIPSYSLESKLGDCKRAASIRKEVLQRITGKSLEGLPLD  239



>ref|XP_003612422.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|AES95380.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=488

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDCKRAAAIR +A+ER+TGKSL GLP+E
Sbjct  156  VVRAVVTGTIPSYSLESKLGDCKRAAAIRNQAVERVTGKSLSGLPME  202



>ref|XP_010530977.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010530978.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
isoform X2 [Tarenaya hassleriana]
Length=579

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG IPSYSLE+KLGDCKRAAAIRR+AL+R TGKSL GLPL+
Sbjct  166  IVKSVVEGTIPSYSLETKLGDCKRAAAIRREALQRTTGKSLIGLPLD  212



>gb|AFN89599.1| 3-hydro-3-methylglutary CoA reductase [Gentiana macrophylla]
Length=587

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G+ PSYSLESKLGDCKRAA IRR+AL+RITGKSL+GLPLE
Sbjct  174  VIESVVSGKTPSYSLESKLGDCKRAAIIRREALQRITGKSLEGLPLE  220



>gb|AEH58930.1| HMG-CoA reductase [Glycyrrhiza uralensis]
Length=573

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  32   VNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            VN V  G IPSYSLES+LGDC+RAAAIR +A++RITGKSL+GLPLE
Sbjct  163  VNSVVSGSIPSYSLESRLGDCRRAAAIRHEAVQRITGKSLEGLPLE  208



>gb|AIX87980.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=594

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSYSLESKLGDCK+AA+IRR+AL+RITGKSL GLPL+
Sbjct  183  IVKSVVTGKIPSYSLESKLGDCKKAASIRREALQRITGKSLAGLPLD  229



>dbj|BAB20771.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=595

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDCKRAA+IR++ ++RITGKSL+GLPLE
Sbjct  188  IIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLE  234



>ref|XP_006350440.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Solanum tuberosum]
Length=596

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+IPSYSLESKLGDCKRAA+IR++ ++RITGKSL+GLPLE
Sbjct  185  IIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLE  231



>gb|ADM87300.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Glycyrrhiza 
uralensis]
Length=573

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  32   VNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            VN V  G IPSYSLES+LGDC+RAAAIR +A++RITGKSL+GLPLE
Sbjct  163  VNSVVSGSIPSYSLESRLGDCRRAAAIRHEAVQRITGKSLEGLPLE  208



>ref|XP_004290091.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=595

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLE+KLGDCKRAA+IRR+AL+R+TGKSL+GLPLE
Sbjct  183  IIKAVVAGTIPSYSLETKLGDCKRAASIRREALQRVTGKSLEGLPLE  229



>ref|NP_179329.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Arabidopsis 
thaliana]
 sp|P43256.1|HMDH2_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=AtHMGR2; Short=HMG-CoA reductase 2 [Arabidopsis thaliana]
 gb|AAA67317.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Arabidopsis thaliana]
 gb|AAL15311.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gb|AAN28869.1| At2g17370/F15M4.1 [Arabidopsis thaliana]
 gb|AEC06618.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Arabidopsis 
thaliana]
Length=562

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLE+KLGDCKRAAAIRR+A++RITGKSL GLPLE
Sbjct  150  IVKLVIDGTIPSYSLETKLGDCKRAAAIRREAVQRITGKSLTGLPLE  196



>gb|ADC44451.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Salvia miltiorrhiza]
Length=550

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+IPSY+LESKLGDC+RAA +RR+AL+R TGKSL+GLPLE
Sbjct  139  IVKAVVEGKIPSYALESKLGDCRRAAFVRREALQRTTGKSLEGLPLE  185



>gb|ACT65734.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza]
Length=550

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+IPSY+LESKLGDC+RAA +RR+AL+R TGKSL+GLPLE
Sbjct  139  IVKAVVEGKIPSYALESKLGDCRRAAFVRREALQRTTGKSLEGLPLE  185



>dbj|BAE92731.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Gentiana lutea]
Length=549

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I++ V  G+ PSYSLESKLGDCKRAA IRR+AL+RITGKSL+GLPL+
Sbjct  138  IIDSVVAGKTPSYSLESKLGDCKRAAKIRREALQRITGKSLEGLPLD  184



>gb|ADN39417.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Withania somnifera]
Length=599

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G IPSYSLESKLGDCKRAA+IR++A++R+TGKSL+GLPLE
Sbjct  188  IIKSVVQGTIPSYSLESKLGDCKRAASIRKEAVQRLTGKSLEGLPLE  234



>gb|ABG73435.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase, partial [Litchi 
chinensis]
Length=163

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG  PSYSLESKLGDC+RAA IRR+AL+R+TGKSL GLPL+
Sbjct  76   IVKSVVEGTTPSYSLESKLGDCRRAAGIRREALQRLTGKSLVGLPLD  122



>ref|XP_010467508.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Camelina sativa]
Length=559

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLE+KLGDCKRAA IRR+A++RITGKSL GLPLE
Sbjct  147  IVKSVVQGTIPSYSLETKLGDCKRAAVIRREAVQRITGKSLTGLPLE  193



>gb|ABE27875.1| hydroxymethylglutaryl-coenzyme A reductase [Arnebia euchroma]
Length=562

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR+AL+R+TGKSL+GLPLE
Sbjct  159  IVQSVVQGNTPSYSLESKLGDCFRAAAIRREALQRLTGKSLEGLPLE  205



>ref|XP_002301898.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE81171.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
Length=588

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG +PSYSLESKLGDCKRAA IRR+AL+R TG+SL+GLP+E
Sbjct  177  IVKSVTEGTLPSYSLESKLGDCKRAAVIRREALQRTTGRSLEGLPIE  223



>ref|XP_006390187.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27473.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=431

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+RITGKS++GLPL+
Sbjct  179  IVKSVLDGAIPSYSLESRLGDCKRAASIRREALQRITGKSIEGLPLD  225



>gb|ABV25900.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Antirrhinum 
majus]
Length=586

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
             V  V EG+IPSY+LESKLGDC RAA+IRR+AL+RITGKSL G+PLE
Sbjct  175  FVRSVVEGKIPSYALESKLGDCHRAASIRREALQRITGKSLAGMPLE  221



>gb|KHG10514.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Gossypium 
arboreum]
Length=449

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDCKRAAAIRR+AL+R+TGKSL+GLPL+
Sbjct  38   IIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLEGLPLD  84



>ref|XP_006364832.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Solanum tuberosum]
Length=600

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  187  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  233



>ref|NP_001275461.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Solanum tuberosum]
 sp|P48020.1|HMDH1_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1; Short=HMGR; Short=HMGR1 [Solanum 
tuberosum]
 gb|AAA93498.1| hydroxymethylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=596

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  188  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  234



>ref|XP_004232593.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Solanum lycopersicum]
Length=601

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  188  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  234



>ref|NP_001275084.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like [Solanum 
tuberosum]
 gb|AEX26933.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Solanum tuberosum]
Length=601

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  188  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  234



>ref|XP_006390188.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
 gb|ESQ27474.1| hypothetical protein EUTSA_v10018320mg [Eutrema salsugineum]
Length=594

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+RITGKS++GLPL+
Sbjct  179  IVKSVLDGAIPSYSLESRLGDCKRAASIRREALQRITGKSIEGLPLD  225



>ref|XP_002306999.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
 gb|EEE93995.1| hydroxymethylglutaryl-CoA reductase family protein [Populus trichocarpa]
Length=563

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG +PSYSLE+KLGDCKRAA IRR+AL+R TG+SL+GLP+E
Sbjct  152  IVKSVTEGTLPSYSLETKLGDCKRAAVIRREALQRTTGRSLEGLPIE  198



>gb|AAC15476.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
Length=483

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  47   EGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            EG +PSY+LESKLGDCKRAA+IRR+ALE+ITGKSL GLPLE
Sbjct  165  EGSLPSYALESKLGDCKRAASIRREALEQITGKSLSGLPLE  205



>gb|AIM19608.1| 3-hydroxy-3-methyl-glutaryl-CoA reductase, partial [Centella 
asiatica]
Length=595

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDC++AAAIRR+AL+RITGKSLDGLPL+
Sbjct  184  IIRAVVAGTTPSYSLESKLGDCRQAAAIRREALQRITGKSLDGLPLD  230



>gb|KDP36739.1| hypothetical protein JCGZ_08030 [Jatropha curcas]
Length=584

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA IRR+AL+R TG+SLDGLP++
Sbjct  173  IVKSVVNGTIPSYSLESKLGDCKRAATIRREALQRTTGRSLDGLPVD  219



>ref|XP_010094509.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis]
 gb|EXB56263.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Morus notabilis]
Length=548

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G IPSYSLES+LGDCKRAAAIRR+AL+R+TG+S++GLP+E
Sbjct  137  IIKSVVDGTIPSYSLESRLGDCKRAAAIRREALQRMTGRSIEGLPIE  183



>ref|XP_003612421.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|ABY20974.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 3 [Medicago truncatula]
 gb|AES95379.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=567

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDCKRAAAIR +A+ER+TGKSL GLP+E
Sbjct  156  VVRAVVTGTIPSYSLESKLGDCKRAAAIRNQAVERVTGKSLSGLPME  202



>ref|XP_009599355.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nicotiana tomentosiformis]
 gb|AAB87727.1| hydroxy-methylglutaryl-coenzyme A reductase [Nicotiana tabacum]
Length=604

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKL DCKRAA++RR+AL+RITGKSL+GLPLE
Sbjct  193  IIQSVVQGKTPSYSLESKLADCKRAASVRREALQRITGKSLEGLPLE  239



>gb|AGA83240.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aquilaria sinensis]
Length=582

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+ GV  G  PSYSLE+KLG+CKRAAAIRR+AL+R+TGKSL GLPLE
Sbjct  171  IIKGVVAGTTPSYSLEAKLGNCKRAAAIRREALQRLTGKSLSGLPLE  217



>emb|CDY71344.1| BnaAnng37030D, partial [Brassica napus]
Length=356

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES+LGDCKRAA IRR+AL+RITG+S++GLPL+
Sbjct  168  IVKSVIHGAIPSYSLESRLGDCKRAATIRREALQRITGRSIEGLPLD  214



>ref|XP_010266284.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nelumbo nucifera]
Length=608

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKLGDCKRAAAIRR+AL+R+TG SL GLPLE
Sbjct  197  IIKSVVAGTIPSYSLESKLGDCKRAAAIRREALQRMTGSSLAGLPLE  243



>gb|AGZ15318.1| 3-hydroxy-3-methylglutaryl CoA reductase, partial [Platycodon 
grandiflorus]
Length=240

 Score = 72.8 bits (177),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G +PSY+LESKLG+CKRAAAIRR+AL+RITGKSL GLPLE
Sbjct  14   IVKLVVSGAMPSYALESKLGNCKRAAAIRREALQRITGKSLVGLPLE  60



>ref|NP_001274940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Solanum tuberosum]
 sp|Q41438.1|HMDH3_SOLTU RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
3; Short=HMG-CoA reductase 3; AltName: Full=HMG3.3 [Solanum 
tuberosum]
 gb|AAB52552.1| HMG-CoA reductase [Solanum tuberosum]
 dbj|BAA93631.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Solanum tuberosum]
Length=574

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V EGRIPSYSLESKLGDCKRAA IR++AL+R +GKSL+GLPL+
Sbjct  166  VIKSVVEGRIPSYSLESKLGDCKRAAFIRKEALQRSSGKSLEGLPLD  212



>gb|KHG00733.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium 
arboreum]
Length=585

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDCKRAAAIRR+AL+RITGKSL GLPL+
Sbjct  174  IIRSVVNGMTPSYSLESKLGDCKRAAAIRREALQRITGKSLSGLPLD  220



>ref|XP_003519474.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Glycine max]
Length=556

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V EG  PSY+LES+LGDC RAAAIRR AL+R+TG+SL+GLPLE
Sbjct  146  IVNSVVEGVTPSYALESRLGDCGRAAAIRRGALQRLTGRSLEGLPLE  192



>ref|XP_008448157.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis melo]
Length=597

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR+AL+R+TGKSL GLPLE
Sbjct  185  IVKSVVDGTTPSYSLESKLGDCGRAAAIRREALQRVTGKSLSGLPLE  231



>ref|XP_011092919.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Sesamum 
indicum]
Length=582

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG+ PSYSLESKLGDC RAA+IRR+AL+R TGKSL GLPL+
Sbjct  171  IVKSVVEGKTPSYSLESKLGDCHRAASIRREALQRTTGKSLSGLPLD  217



>ref|XP_004290088.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Fragaria vesca subsp. vesca]
Length=578

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKL DCKRAA+IRR+AL+R+TGKSL+GLPLE
Sbjct  166  IIKAVVAGTIPSYSLESKLRDCKRAASIRREALQRVTGKSLEGLPLE  212



>ref|XP_007043108.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043109.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007043110.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98939.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98940.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
 gb|EOX98941.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 isoform 1 [Theobroma 
cacao]
Length=584

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDCKRAAAIRR+AL+R+TGKSL GLPL+
Sbjct  173  IIKSVVAGTTPSYSLESKLGDCKRAAAIRREALQRLTGKSLSGLPLD  219



>gb|ABK56831.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Euphorbia pekinensis]
Length=583

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA IRR+AL+R+TG+SL+GLP+E
Sbjct  171  IVKSVVNGTIPSYSLESKLGDCKRAAEIRREALQRMTGRSLEGLPVE  217



>ref|XP_002317026.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
 gb|EEE97638.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase family protein 
[Populus trichocarpa]
Length=588

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++ GV  G IPSYSLESKL DCKRAA IRR+AL+R+TG+SL+GLPLE
Sbjct  175  VIKGVVSGDIPSYSLESKLADCKRAAVIRREALQRMTGRSLEGLPLE  221



>gb|ABK88909.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Atractylodes 
lancea]
Length=583

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSY+LE+KLGDCKRAA++RR+ALERITGKSL G+PLE
Sbjct  173  IVKQVVGGSIPSYALETKLGDCKRAASVRREALERITGKSLTGMPLE  219



>ref|XP_010270571.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Nelumbo nucifera]
Length=605

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKLGDCKRAAAIRR++L+R+TG+SL GLPLE
Sbjct  194  IIKSVVAGTIPSYSLESKLGDCKRAAAIRRESLQRMTGRSLAGLPLE  240



>ref|XP_011034792.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Populus euphratica]
Length=588

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG +PSYSLESKLGDCKRAA IRR+AL+R TG+SL+GLP++
Sbjct  177  IVKSVTEGTLPSYSLESKLGDCKRAAVIRREALQRTTGRSLEGLPIQ  223



>ref|XP_004512291.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cicer arietinum]
Length=569

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDC+RAAAIR +A++R+TGKSL+GLP+E
Sbjct  158  IVQAVVSGSIPSYSLESKLGDCRRAAAIRHEAVQRVTGKSLEGLPME  204



>ref|XP_010471802.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Camelina sativa]
Length=590

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  176  IVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  222



>ref|XP_002510732.1| hmg-CoA reductase, putative [Ricinus communis]
 gb|EEF52919.1| hmg-CoA reductase, putative [Ricinus communis]
Length=576

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA IRR+AL+R+ G+SL+GLPLE
Sbjct  165  IVKSVVNGTIPSYSLESKLGDCKRAATIRREALQRMMGRSLEGLPLE  211



>ref|XP_010416569.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Camelina sativa]
Length=594

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  176  IVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  222



>gb|AEH95323.1| HMG-CoA reductase 3 [Glycyrrhiza uralensis]
Length=475

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAAAIR +A+ER+TG+SL+GLP+E
Sbjct  143  VVKAVVSGSIPSYSLESKLGDCRRAAAIRHEAVERVTGRSLEGLPVE  189



>ref|XP_010428711.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X1 [Camelina sativa]
Length=574

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  176  IVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  222



>ref|XP_010428712.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
isoform X2 [Camelina sativa]
Length=595

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  176  IVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  222



>gb|KGN46640.1| hypothetical protein Csa_6G117710 [Cucumis sativus]
Length=665

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR AL+R+TGKSL GLPLE
Sbjct  253  IVKSVVDGSTPSYSLESKLGDCGRAAAIRRVALQRVTGKSLSGLPLE  299



>ref|XP_008778179.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
[Phoenix dactylifera]
Length=566

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G++PSYSLESKLGDC+RAA IRR+AL RITG+++DGLPL+
Sbjct  155  LVHAVVAGKVPSYSLESKLGDCRRAAGIRREALRRITGRAMDGLPLD  201



>sp|O64967.1|HMDH2_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
2; Short=HMG-CoA reductase 2 [Gossypium hirsutum]
 gb|AAC05089.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Gossypium 
hirsutum]
Length=628

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G +PSYSLESKLGDCKRAAAIRR+AL+R+TG+SL GLPL+
Sbjct  217  IIKSVVAGTLPSYSLESKLGDCKRAAAIRREALQRLTGRSLSGLPLD  263



>ref|XP_006302045.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
 gb|EOA34943.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
Length=515

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  175  VVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  221



>gb|AEX26934.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Solanum chacoense]
Length=601

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G+ PSYSLESKLGDC RAA+IR++AL+RITGKSL+GLPLE
Sbjct  188  IIQSVVQGKTPSYSLESKLGDCMRAASIRKEALQRITGKSLEGLPLE  234



>gb|AAC15475.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Tagetes erecta]
Length=574

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/41 (83%), Positives = 39/41 (95%), Gaps = 0/41 (0%)
 Frame = +2

Query  47   EGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            EG +PSY+LESKLGDCKRAA+IRR+ALE+ITGKSL GLPLE
Sbjct  165  EGSLPSYALESKLGDCKRAASIRREALEQITGKSLSGLPLE  205



>ref|XP_002887642.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63901.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis lyrata 
subsp. lyrata]
Length=635

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  220  IVKSVIDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSMEGLPLD  266



>ref|XP_004139979.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR AL+R+TGKSL GLPLE
Sbjct  185  IVKSVVDGSTPSYSLESKLGDCGRAAAIRRVALQRVTGKSLSGLPLE  231



>ref|XP_006302046.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
 gb|EOA34944.1| hypothetical protein CARUB_v10020027mg [Capsella rubella]
Length=592

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+SL+GLPL+
Sbjct  175  VVKSVLDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSLEGLPLD  221



>ref|XP_010534322.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Tarenaya hassleriana]
Length=589

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAAAIRR+AL+R TG+SL GLPLE
Sbjct  178  IVRSVLDGGIPSYSLESRLGDCKRAAAIRREALQRATGRSLKGLPLE  224



>ref|XP_010537243.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Tarenaya hassleriana]
Length=603

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAAAIRR+AL+R TG+SL+GLPL+
Sbjct  179  IVRSVLDGAIPSYSLESRLGDCKRAAAIRREALQRATGRSLEGLPLD  225



>ref|XP_004491163.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cicer arietinum]
Length=575

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V EG  PSY+LES+LGDC RAAAIRR+AL+R +G+SL+GLPLE
Sbjct  164  IINSVVEGTTPSYALESRLGDCFRAAAIRRQALQRTSGRSLEGLPLE  210



>gb|AET72045.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Dimocarpus 
longan]
Length=568

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG  PSYSLESKLGDC+RAA IRR+AL+R+TGKSL GLPL+
Sbjct  157  IVKSVVEGTTPSYSLESKLGDCRRAAGIRREALQRLTGKSLAGLPLD  203



>ref|XP_004154522.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
Length=597

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G  PSYSLESKLGDC RAAAIRR AL+R+TGKSL GLPLE
Sbjct  185  IVKSVVDGTTPSYSLESKLGDCGRAAAIRRVALQRVTGKSLSGLPLE  231



>sp|P14891.1|HMDH1_ARATH RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=AtHMGR1; Short=HMG-CoA reductase 1 [Arabidopsis thaliana]
 gb|AAF16652.1|AC012394_1 hydroxy methylglutaryl CoA reductase (AA 1-592); 9510-7255 [Arabidopsis 
thaliana]
 gb|AAG51957.1|AC015450_18 3-hydroxy-3-methylglutaryl CoA reductase (AA 1-592); 32253-34508 
[Arabidopsis thaliana]
 gb|AAK60283.1|AF385690_1 At1g76490/F15M4.1 [Arabidopsis thaliana]
 emb|CAA33139.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAA76821.1| 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis thaliana]
 gb|AAA32814.1| hydroxymethylglutaryl CoA reductase [Arabidopsis thaliana]
 gb|AAN31847.1| putative 3-hydroxy-3-methylglutaryl CoA reductase [Arabidopsis 
thaliana]
 gb|AAQ65091.1| At1g76490/F15M4.1 [Arabidopsis thaliana]
Length=592

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  175  IVKSVIDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLD  221



>ref|NP_177775.2| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Arabidopsis 
thaliana]
 gb|AAR83122.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase isoform 1L [Arabidopsis 
thaliana]
 gb|AEE35849.1| hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana]
Length=642

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  225  IVKSVIDGVIPSYSLESRLGDCKRAASIRREALQRVTGRSIEGLPLD  271



>ref|XP_009128179.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Brassica rapa]
Length=581

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES+LGDCKRAA IRR+AL+RITG+S++GLPL+
Sbjct  168  IVKSVIHGAIPSYSLESRLGDCKRAATIRREALQRITGRSIEGLPLD  214



>ref|XP_003612561.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|AES95519.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=542

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP+E
Sbjct  131  VVSAVVSGSIPSYSLESKLGDCRRAANIRNQAVERVTGRSLEGLPME  177



>ref|XP_003612563.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 ref|XP_003612564.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 ref|XP_003612566.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 ref|XP_003612567.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|ABY20973.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Medicago truncatula]
 gb|AES95521.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
 gb|AES95522.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
 gb|AES95524.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
 gb|AFK33499.1| unknown [Medicago truncatula]
Length=542

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP+E
Sbjct  131  VVSAVVSGSIPSYSLESKLGDCRRAANIRNQAVERVTGRSLEGLPME  177



>gb|AAD03789.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Morus alba]
Length=548

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G IPSYSLES+LGDCKR AAIRR+AL+R+TG+S++GLP+E
Sbjct  137  IIRSVVDGTIPSYSLESRLGDCKRGAAIRREALQRMTGRSIEGLPIE  183



>ref|XP_010061229.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Eucalyptus grandis]
 gb|KCW68146.1| hypothetical protein EUGRSUZ_F01818 [Eucalyptus grandis]
Length=588

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V +G+IPSYSLES LGDCKRA +IRR+AL+R+TG+SL GLPLE
Sbjct  177  VVKSVTDGKIPSYSLESMLGDCKRATSIRREALQRMTGRSLKGLPLE  223



>emb|CDY20406.1| BnaC02g24100D [Brassica napus]
Length=581

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES+LGDCKRAA IRR+AL+RITG+S++GLPL+
Sbjct  168  IVKSVIHGAIPSYSLESRLGDCKRAATIRREALQRITGRSIEGLPLD  214



>gb|AAY68034.1| 3-hydroxy-methylglutaryl coenzyme A reductase [Tilia miqueliana]
Length=585

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKLGDCKRA AIRR+AL+R+TGKSL GLPL+
Sbjct  174  IIKSVVAGTTPSYSLESKLGDCKRATAIRREALQRLTGKSLSGLPLD  220



>gb|AID51436.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Astragalus 
membranaceus]
Length=571

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAAAIR +A+E ITGKSL+GLP+E
Sbjct  160  VVRAVVSGSIPSYSLESKLGDCRRAAAIRHEAVENITGKSLEGLPVE  206



>ref|XP_003617390.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|ABY20975.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 4 [Medicago truncatula]
 gb|AET00349.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=545

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP+E
Sbjct  134  VVGAVVSGSIPSYSLESKLGDCRRAAVIRNQAVERVTGRSLEGLPME  180



>emb|CAA48610.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
Length=583

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES LG+CKRAAAIRR+AL+RITG+S++GLPLE
Sbjct  168  IVKSVIRGVIPSYSLESSLGECKRAAAIRREALQRITGRSIEGLPLE  214



>ref|XP_003612565.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
Length=523

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP+E
Sbjct  112  VVSAVVSGSIPSYSLESKLGDCRRAANIRNQAVERVTGRSLEGLPME  158



>emb|CDX88285.1| BnaC06g37290D [Brassica napus]
Length=574

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  159  IVKSVLDGAIPSYSLESRLGDCKRAASIRREALQRLTGRSIEGLPLD  205



>ref|XP_011041288.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1, 
partial [Populus euphratica]
Length=577

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG +PSYSLE+KLGDCKRA  IRR+AL+R TG+SL+GLP+E
Sbjct  166  IVKSVTEGTLPSYSLETKLGDCKRAVVIRREALQRTTGRSLEGLPIE  212



>gb|AET72043.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 2 [Litchi chinensis]
Length=568

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG  PSYSLESKLGDC+RAA IRR+AL+R+TGKSL GLPL+
Sbjct  157  IVKSVVEGTTPSYSLESKLGDCRRAAGIRREALQRLTGKSLVGLPLD  203



>ref|XP_006297478.1| hypothetical protein CARUB_v10013498mg [Capsella rubella]
 gb|EOA30376.1| hypothetical protein CARUB_v10013498mg [Capsella rubella]
Length=504

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V EG IPS SLE+KLG+CKRAAAIRR+A++RITGKSL GLPLE
Sbjct  92   IVKSVIEGTIPSNSLEAKLGECKRAAAIRREAVQRITGKSLTGLPLE  138



>gb|AAV54051.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Eucommia ulmoides]
Length=590

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G +PSYSLESKLGDC RAA+IRR+A++RITGKSL GLPLE
Sbjct  178  MVKSVISGTVPSYSLESKLGDCYRAASIRREAIQRITGKSLSGLPLE  224



>gb|AIK21780.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax notoginseng]
Length=589

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G  PSYSLESKLGDC +AAAIRR+AL+RITGKSL GLPL+
Sbjct  178  IINAVVAGTTPSYSLESKLGDCLKAAAIRREALQRITGKSLAGLPLD  224



>gb|AET72044.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Dimocarpus 
longan]
Length=564

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPS+SLESKLGDCKRAA IRRKAL+ +TG+SL GLPL+
Sbjct  153  IVKSVVDGSIPSHSLESKLGDCKRAALIRRKALQTVTGRSLQGLPLD  199



>gb|AID51438.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Astragalus 
membranaceus]
Length=568

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAAAIR +A+E +TGKSL+GLP+E
Sbjct  157  LVQAVVSGSIPSYSLESKLGDCRRAAAIRHQAVESVTGKSLEGLPVE  203



>gb|KHG04251.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Gossypium 
arboreum]
Length=445

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  +  G  PSYSLESKLGDCKRAA+IRR+AL RITGKSL GLPL+
Sbjct  34   IIKAIVAGTTPSYSLESKLGDCKRAASIRREALGRITGKSLSGLPLD  80



>gb|ABF56518.2| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Litchi chinensis]
Length=562

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLESKLGDCKRAA IRR+AL+ +TG+SL GLPL+
Sbjct  151  IVKSVVDGSIPSYSLESKLGDCKRAALIRREALQTVTGRSLQGLPLD  197



>gb|AFZ93642.1| hydroxymethylglutaryl coenzyme A reductase [Euphorbia lathyris]
Length=582

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA IRR+AL+R+ G+SL+GLP+E
Sbjct  170  IVKSVVNGTIPSYSLESKLGDCKRAAEIRREALQRMMGRSLEGLPVE  216



>emb|CAA48611.1| hydroxymethylglutaryl-CoA reductase (NADPH) [Raphanus sativus]
Length=573

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G +PSYSLES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  160  IVKSVLDGVVPSYSLESRLGDCKRAASIRREALQRLTGRSIEGLPLD  206



>gb|AAL37041.1|AF303583_1 3-hydroxy-3-methylglutaryl coenzyme A [Pisum sativum]
Length=577

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IVN V  G IPSYSLES+L DC++AAAIRR A++ I+GKSL+GLPLE
Sbjct  166  IVNSVVSGSIPSYSLESRLADCRKAAAIRRSAVQTISGKSLEGLPLE  212



>emb|CAN72217.1| hypothetical protein VITISV_039086 [Vitis vinifera]
Length=575

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLES+LGDC+RA AIRR+AL+R+TG SL+GLPLE
Sbjct  166  IIKSVVAGAIPSYSLESRLGDCRRAVAIRREALQRMTGTSLEGLPLE  212



>gb|AIG55301.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=590

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSY+LESKLGDC RA AIRR+AL+R+TGKSLDGLPL+
Sbjct  170  IIKSVVAGTTPSYALESKLGDCYRATAIRREALQRMTGKSLDGLPLD  216



>ref|XP_010910988.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxy-3-methylglutaryl-coenzyme 
A reductase 3-like [Elaeis guineensis]
Length=572

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G++PSYSLESKLGDC+RAA IRR+AL R TG+++DGLPL+
Sbjct  161  IVRAVIAGKVPSYSLESKLGDCRRAAGIRREALRRTTGRAMDGLPLD  207



>gb|KFK40113.1| hypothetical protein AALP_AA3G332100 [Arabis alpina]
Length=541

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  + +G IPSYSLE+KLGDCKRA  IRR+A++RITGKSL GLPL 
Sbjct  128  IVKSIIDGIIPSYSLETKLGDCKRAVTIRREAIQRITGKSLTGLPLN  174



>sp|O64966.1|HMDH1_GOSHI RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
1; Short=HMG-CoA reductase 1 [Gossypium hirsutum]
 gb|AAC05088.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Gossypium 
hirsutum]
Length=585

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLESKL DCKRAAAIRR+AL+RITGKSL GLPL+
Sbjct  174  IIRSVVCGMTPSYSLESKLDDCKRAAAIRREALQRITGKSLSGLPLD  220



>gb|AEO12148.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camellia sinensis]
Length=590

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSY+LESKLGDC RA AIRR+AL+R+TGKSLDGLPL+
Sbjct  170  IIKSVVAGTTPSYALESKLGDCYRATAIRREALQRMTGKSLDGLPLD  216



>gb|ABP04052.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=567

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLE+KLGDCKRAA IRR+A++R+TGKSL GLPLE
Sbjct  156  IIKAVVAGTTPSYSLETKLGDCKRAAVIRREAVQRVTGKSLAGLPLE  202



>gb|AGW82424.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Corylus avellana]
Length=565

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLE+KLGDCKRAA IRR+A++R+TGKSL GLPLE
Sbjct  154  IIKAVVAGTTPSYSLETKLGDCKRAAVIRREAVQRVTGKSLAGLPLE  200



>ref|XP_004300101.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=568

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G +PSYSLESKLGDCKRAA IRR+ L+R TG+SL GLPLE
Sbjct  157  IIQAVLNGDVPSYSLESKLGDCKRAAVIRREWLQRTTGRSLQGLPLE  203



>emb|CDP07253.1| unnamed protein product [Coffea canephora]
Length=572

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +VN V  G IPSYSLES LGDC RAA+IRR+A++RITG+SL GLPL+
Sbjct  156  LVNSVVSGDIPSYSLESTLGDCLRAASIRREAVQRITGRSLSGLPLD  202



>gb|AHX36946.1| 3-hydroxy-3-methyl glutaryl coenzyme a reductase [Betula platyphylla]
Length=587

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V EG  PSY LESKLGDCKRAA+IRR+AL+R TG+SL GLPLE
Sbjct  176  MIKSVVEGTTPSYLLESKLGDCKRAASIRREALQRTTGRSLQGLPLE  222



>gb|AFU75319.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Aquilaria sinensis]
Length=572

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G +PSYSLE KLGDCKRAAAIRR+A+++ITG SL GLPLE
Sbjct  161  IIKSVVAGAVPSYSLELKLGDCKRAAAIRREAVQKITGNSLSGLPLE  207



>gb|ABY20972.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 1 [Medicago truncatula]
Length=550

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP++
Sbjct  139  VVGAVVSGSIPSYSLESKLGDCRRAAKIRNQAVERVTGRSLEGLPMK  185



>ref|XP_009106317.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Brassica rapa]
 emb|CDX87592.1| BnaA07g32810D [Brassica napus]
Length=576

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G +PSY+LES+LGDCKRAA+IRR+AL+R+TG+S++GLPL+
Sbjct  161  IVKSVLDGVVPSYALESRLGDCKRAASIRREALQRMTGRSIEGLPLD  207



>ref|XP_003612568.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|AES95526.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=550

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAA IR +A+ER+TG+SL+GLP++
Sbjct  139  VVGAVVSGSIPSYSLESKLGDCRRAAKIRNQAVERVTGRSLEGLPMK  185



>ref|XP_010063168.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Eucalyptus grandis]
 gb|KCW70364.1| hypothetical protein EUGRSUZ_F03606 [Eucalyptus grandis]
Length=568

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLESKLGDC+RAA +RR+AL+R TGKSL  LPLE
Sbjct  158  IVKSVVDGTIPSYSLESKLGDCRRAAFVRREALQRTTGKSLANLPLE  204



>gb|AAB69727.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Camptotheca 
acuminata]
Length=589

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G  PSYSLES+LG+CKRAAAIRR+AL+R+TGKSL GLPL+
Sbjct  179  IIKSVVAGTTPSYSLESRLGNCKRAAAIRREALQRLTGKSLAGLPLD  225



>ref|XP_010548185.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2-like 
[Tarenaya hassleriana]
Length=583

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPSYSLE+KLGDCKRAAAIRR+AL+R +GKSL  LPL+
Sbjct  169  IVKSVVDGTIPSYSLETKLGDCKRAAAIRREALQRTSGKSLACLPLD  215



>gb|AID51437.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 [Astragalus 
membranaceus]
Length=569

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC+RAAAIR + +E +TGKSL+GLP+E
Sbjct  158  VVRAVVSGSIPSYSLESKLGDCRRAAAIRHEVVESVTGKSLEGLPVE  204



>gb|ABC74565.1| 3-hydroxy-3-methylglutaryl-CoA reductase [Picrorhiza kurrooa]
Length=561

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G +PSYSLES+LGDC RAA IRR+AL+R+TG+S++GLPLE
Sbjct  150  VVMSVVSGEVPSYSLESRLGDCFRAAKIRREALQRVTGRSVEGLPLE  196



>ref|XP_009386797.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Musa acuminata subsp. malaccensis]
Length=575

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G+IPSY LES+LGDC+RAA IRR+AL RITG++L+GLPL+
Sbjct  164  IVSSVVSGKIPSYVLESRLGDCRRAAGIRREALRRITGRTLEGLPLD  210



>ref|XP_004509470.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Cicer arietinum]
Length=570

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES+L DC++AAAIRR+A++ ITGKSL+GLPLE
Sbjct  159  IVKSVVSGSIPSYSLESRLADCRKAAAIRREAVQIITGKSLEGLPLE  205



>ref|NP_001130818.1| hypothetical protein [Zea mays]
 gb|ACF79182.1| unknown [Zea mays]
 tpg|DAA40414.1| TPA: hypothetical protein ZEAMMB73_808975 [Zea mays]
Length=573

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LES+LGDC+RAA IRR+AL RITG+ +DGLPL+
Sbjct  157  IVAAVVAGKIPSYVLESRLGDCRRAAGIRREALRRITGRDMDGLPLD  203



>gb|AEZ55673.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 4 [Salvia miltiorrhiza]
Length=550

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G IPSYSLESKLGDC +AA IRR+AL+R TG+S++GLPLE
Sbjct  139  IINRVVSGEIPSYSLESKLGDCFKAAKIRREALQRQTGRSVEGLPLE  185



>ref|XP_002275827.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 
[Vitis vinifera]
Length=593

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA+IRR+AL+R+TGKSL  LP E
Sbjct  182  IVKLVVSGTIPSYSLESKLGDCKRAASIRREALQRLTGKSLLELPFE  228



>ref|XP_009588198.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana tomentosiformis]
Length=589

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLES+LGDC RAA++RR+A++RITGKSL GLPL+
Sbjct  178  LVKSVVSGDIPSYSLESRLGDCYRAASVRREAVQRITGKSLAGLPLD  224



>gb|ACD37361.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Salvia miltiorrhiza]
Length=565

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G IPSYSLES+LGDC RAA IRR+A++R+TG+ +DGLPLE
Sbjct  154  VVDRVVSGEIPSYSLESRLGDCLRAAKIRREAVQRLTGRGVDGLPLE  200



>sp|Q00583.1|HMDH3_HEVBR RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
3; Short=HMG-CoA reductase 3 [Hevea brasiliensis]
 gb|AAA33360.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Hevea brasiliensis]
Length=586

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G IPSYSLESKLG+CKRAA IRR+ L+R++G+SL+GLPL+
Sbjct  175  IIKSVVSGSIPSYSLESKLGNCKRAALIRRETLQRMSGRSLEGLPLD  221



>ref|XP_008451185.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis melo]
Length=582

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G  PSYSLE+KLGDC RAAAIRR+AL+RIT KSL GLPL+
Sbjct  170  IVKSVVVGTTPSYSLEAKLGDCGRAAAIRREALQRITSKSLSGLPLD  216



>ref|XP_011030717.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Populus euphratica]
Length=588

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G IPSYSLESKL DC RAA IRR+AL+R+TG+SL+GLPLE
Sbjct  175  VIKAVVSGDIPSYSLESKLRDCTRAAVIRREALQRMTGRSLEGLPLE  221



>ref|XP_002460459.1| hypothetical protein SORBIDRAFT_02g028630 [Sorghum bicolor]
 gb|EER96980.1| hypothetical protein SORBIDRAFT_02g028630 [Sorghum bicolor]
Length=583

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+AL RITG+ +DGLPL+
Sbjct  162  IVAAVVSGKIPSYVLETRLGDCRRAAGIRREALRRITGRDMDGLPLD  208



>emb|CBI40773.3| unnamed protein product [Vitis vinifera]
Length=541

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDCKRAA+IRR+AL+R+TGKSL  LP E
Sbjct  130  IVKLVVSGTIPSYSLESKLGDCKRAASIRREALQRLTGKSLLELPFE  176



>ref|XP_009785805.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Nicotiana sylvestris]
Length=589

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLES+LGDC RAA++RR+A++RITG+SL GLPL+
Sbjct  178  LVKSVVSGDIPSYSLESRLGDCYRAASVRREAVQRITGRSLTGLPLD  224



>ref|XP_004169656.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like, 
partial [Cucumis sativus]
Length=501

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G  PSYSLE+KLGDC RAAAIRR+AL+RIT KSL GLPL+
Sbjct  170  IVKSVVIGTTPSYSLEAKLGDCGRAAAIRREALQRITSKSLSGLPLD  216



>ref|XP_010690585.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Beta vulgaris subsp. vulgaris]
Length=581

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPL  166
            IV  V  G IPSYSLESKLGDC +AA IRR+AL+RITG+S+ GLPL
Sbjct  171  IVESVVNGTIPSYSLESKLGDCFQAAKIRREALQRITGRSISGLPL  216



>gb|EPS64817.1| hypothetical protein M569_09963, partial [Genlisea aurea]
Length=531

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLESKLGDC RAA IRR+A++R TG+SL+GLPLE
Sbjct  124  VVKCVVSGEIPSYSLESKLGDCFRAAKIRREAVQRQTGRSLEGLPLE  170



>tpg|DAA62078.1| TPA: hypothetical protein ZEAMMB73_122013 [Zea mays]
Length=578

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+AL RITG+ +DGLPL+
Sbjct  158  IVAAVVAGKIPSYVLETRLGDCRRAAGIRREALRRITGREMDGLPLD  204



>ref|XP_004144569.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 gb|KGN43374.1| hypothetical protein Csa_7G029390 [Cucumis sativus]
Length=582

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G  PSYSLE+KLGDC RAAAIRR+AL+RIT KSL GLPL+
Sbjct  170  IVKSVVIGTTPSYSLEAKLGDCGRAAAIRREALQRITSKSLSGLPLD  216



>emb|CBI37502.3| unnamed protein product [Vitis vinifera]
Length=551

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G +PSY LESKLGDCKRAAAIRR+AL+R TG+SL GLPL+
Sbjct  140  MIRSVVAGSVPSYLLESKLGDCKRAAAIRREALQRTTGRSLAGLPLD  186



>gb|EYU36597.1| hypothetical protein MIMGU_mgv1a003864mg [Erythranthe guttata]
Length=559

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +VN V  G IPSYSLESKLGDC +AA IRR+A++R TG+S++GLPLE
Sbjct  148  LVNRVVSGEIPSYSLESKLGDCFKAAKIRREAVQRQTGRSVEGLPLE  194



>ref|XP_002265638.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Vitis vinifera]
Length=572

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            ++  V  G +PSY LESKLGDCKRAAAIRR+AL+R TG+SL GLPL+
Sbjct  161  MIRSVVAGSVPSYLLESKLGDCKRAAAIRREALQRTTGRSLAGLPLD  207



>ref|XP_003629056.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Medicago truncatula]
 gb|ABY20976.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase 5 [Medicago truncatula]
 gb|AET03532.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like protein 
[Medicago truncatula]
Length=583

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I   V  G IPSYSLES+L DC++AAAIRR A++ ITGKSL+GLPLE
Sbjct  172  IAKSVVTGSIPSYSLESRLADCRKAAAIRRSAVQTITGKSLEGLPLE  218



>gb|AHZ59734.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax notoginseng]
Length=574

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+ PSYSLESKLGDC RAA+IRR+A++R TG+SL GLPL+
Sbjct  163  IVKSVVTGKTPSYSLESKLGDCYRAASIRREAVQRTTGRSLLGLPLD  209



>gb|AHI88624.1| 3-hydroxy-3-methylglutary CoA reductase [Dendrobium chrysotoxum]
Length=562

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G+IPSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  148  IVSAVVAGKIPSYVLETKLGDCRRAAGIRREAISRITGRGMEGLPLD  194



>ref|XP_008344180.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=563

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G   SY LESKLGDCKRAAAIRR+AL++ TG+SL+GLPLE
Sbjct  147  IVESVLSGTTASYELESKLGDCKRAAAIRREALQKTTGRSLEGLPLE  193



>ref|XP_007018657.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
 gb|EOY15882.1| Hydroxy methylglutaryl CoA reductase 1 [Theobroma cacao]
Length=578

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G IPS++LE KLGDCKRAA IRR+AL+RITG+SL GLP++
Sbjct  157  IVEWVIKGTIPSHALEEKLGDCKRAACIRREALQRITGRSLQGLPVD  203



>gb|AGF87122.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Litchi chinensis]
Length=545

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  VA G  PSYSLE+KLGDCKRAA IRR AL+  +GKSL+G+PLE
Sbjct  134  IVKQVASGCTPSYSLETKLGDCKRAAKIRRDALQMTSGKSLEGMPLE  180



>ref|XP_009369771.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Pyrus x bretschneideri]
Length=564

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G   SY LESKLGDCKRAAAIRR+AL++ TG+SL+GLPLE
Sbjct  148  IVESVLSGTTASYDLESKLGDCKRAAAIRREALQKTTGRSLEGLPLE  194



>ref|XP_007158038.1| hypothetical protein PHAVU_002G118900g [Phaseolus vulgaris]
 gb|ESW30032.1| hypothetical protein PHAVU_002G118900g [Phaseolus vulgaris]
Length=543

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G +PSYSLES+LGDC+RAA IRR+A+E ITG+SL GLP+E
Sbjct  132  LVLAVVSGSVPSYSLESRLGDCRRAAEIRREAVESITGRSLQGLPVE  178



>gb|AIX87979.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=573

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+ PSYSLESKLGDC RAA+IRR+A++R TG+SL GLPL+
Sbjct  162  IVKSVVSGKTPSYSLESKLGDCYRAASIRREAVQRTTGRSLLGLPLD  208



>gb|AFD23288.1| 3-hydroxy-3-methylglutary CoA reductase, partial [Dendrobium 
nobile]
Length=480

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  128  IVCAVVAGKIPSYVLEAKLGDCRRAAGIRREAISRITGRGMEGLPLD  174



>gb|AEU08408.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Clematis armandii]
Length=578

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+    +G+ PSYSLE+ LGDCKRAAAIRR+AL+RIT KSL+GLP+E
Sbjct  167  IIKSQVQGKPPSYSLEASLGDCKRAAAIRREALQRITRKSLEGLPVE  213



>ref|XP_010029551.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Eucalyptus grandis]
 gb|KCW56467.1| hypothetical protein EUGRSUZ_I02200 [Eucalyptus grandis]
Length=603

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V +G  PSYSLESKLGDCKRAAAIRR+A++R+TG+S++GL  E
Sbjct  191  IIKSVVDGMTPSYSLESKLGDCKRAAAIRREAVQRMTGRSMEGLAFE  237



>ref|XP_009410341.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Musa acuminata subsp. malaccensis]
Length=574

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I++ V  G+ PSY+LES+LGDC+RAA IRR+AL+RITG++ +GLPL+
Sbjct  163  IISSVVAGKTPSYALESRLGDCRRAAGIRREALKRITGRAFEGLPLD  209



>ref|XP_007046440.1| Hydroxy methylglutaryl CoA reductase 1 isoform 1 [Theobroma cacao]
 gb|EOX90597.1| Hydroxy methylglutaryl CoA reductase 1 isoform 1 [Theobroma cacao]
Length=569

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  41   VAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPL  166
            V  G IPSYSLESKLGDCK+AA IRR+A++R+TG+SL GLPL
Sbjct  156  VVSGSIPSYSLESKLGDCKKAAMIRREAMQRMTGRSLQGLPL  197



>emb|CDY50207.1| BnaC07g06390D [Brassica napus]
Length=550

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G   SYSLE+KLGDCKRAAAIRR+A++R+TGKSL GLP +
Sbjct  137  IVKSVIDGATSSYSLETKLGDCKRAAAIRREAVQRMTGKSLTGLPFD  183



>ref|XP_007046441.1| Hydroxy methylglutaryl CoA reductase 1 isoform 2 [Theobroma cacao]
 gb|EOX90598.1| Hydroxy methylglutaryl CoA reductase 1 isoform 2 [Theobroma cacao]
Length=564

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/42 (74%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = +2

Query  41   VAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPL  166
            V  G IPSYSLESKLGDCK+AA IRR+A++R+TG+SL GLPL
Sbjct  156  VVSGSIPSYSLESKLGDCKKAAMIRREAMQRMTGRSLQGLPL  197



>gb|ADI80346.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Panax ginseng]
Length=573

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+ PSYSLESKLGDC RAA+IRR+A++R TG+SL GLPL+
Sbjct  162  IVKSVVTGKTPSYSLESKLGDCYRAASIRREAVQRTTGRSLLGLPLD  208



>ref|XP_006342182.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Solanum tuberosum]
Length=583

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLES+LGDC RAA+IRR+A++R+TG+SL GLPL+
Sbjct  172  LVKSVVSGDIPSYSLESRLGDCHRAASIRREAVQRLTGRSLAGLPLD  218



>ref|XP_009395908.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Musa acuminata subsp. malaccensis]
Length=576

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I++ V  GR PSY LE++LGDC+RAA IRR+AL RITG++L+GLPL+
Sbjct  164  IISSVVAGRTPSYVLEARLGDCRRAAGIRREALRRITGRALEGLPLD  210



>ref|NP_001062221.1| Os08g0512700 [Oryza sativa Japonica Group]
 dbj|BAF24135.1| Os08g0512700 [Oryza sativa Japonica Group]
Length=419

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G++PSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  8    IVSSVVAGKVPSYVLETKLGDCRRAAGIRREAVRRITGRQIEGLPLD  54



>ref|XP_003578341.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Brachypodium distachyon]
Length=565

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+AL RITG+ +DGLPL+
Sbjct  154  IVAEVVAGKIPSYVLETRLGDCRRAAGIRREALRRITGREIDGLPLD  200



>ref|XP_009121127.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 
[Brassica rapa]
Length=551

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G   S+SLE+KLGDCKRAAAIRR+A++R+TGKSL GLPL+
Sbjct  138  IVKSVVDGATSSHSLETKLGDCKRAAAIRREAVQRMTGKSLTGLPLD  184



>ref|XP_002445887.1| hypothetical protein SORBIDRAFT_07g027480 [Sorghum bicolor]
 gb|EES15382.1| hypothetical protein SORBIDRAFT_07g027480 [Sorghum bicolor]
Length=576

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+A+ RITG+ +DGLPL+
Sbjct  165  IVAAVVAGKIPSYVLETRLGDCRRAAGIRREAVRRITGREIDGLPLD  211



>sp|Q9XHL5.2|HMDH3_ORYSJ RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase 
3; Short=HMG-CoA reductase 3 [Oryza sativa Japonica Group]
 dbj|BAD10066.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3 [Oryza sativa 
Japonica Group]
Length=561

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G++PSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  150  IVSSVVAGKVPSYVLETKLGDCRRAAGIRREAVRRITGRQIEGLPLD  196



>gb|AHY03303.1| HMG-CoA reductase 2 [Camellia sinensis]
Length=582

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGDC RAA+IRR+A++ +TG+SL GLPL+
Sbjct  171  IVKSVVSGSIPSYSLESKLGDCYRAASIRREAVQSLTGRSLVGLPLD  217



>ref|XP_006849945.1| hypothetical protein AMTR_s00022p00133290 [Amborella trichopoda]
 gb|ERN11526.1| hypothetical protein AMTR_s00022p00133290 [Amborella trichopoda]
Length=492

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ VA G +PSYSLE++LGDCKRAA +RR+ALE+ T K LDGLPL 
Sbjct  154  LVDLVASGSVPSYSLEARLGDCKRAALVRRRALEKSTAKILDGLPLH  200



>gb|AAD38873.1|AF110382_1 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Oryza sativa]
Length=560

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G++PSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  149  IVSSVVAGKVPSYVLETKLGDCRRAAGIRREAVRRITGRQIEGLPLD  195



>ref|XP_008799136.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Phoenix dactylifera]
Length=573

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+ PSY LESKLGDC+RAA IRR+AL R+TG+SL+GLPL+
Sbjct  159  IIFSVVAGKTPSYILESKLGDCRRAAGIRREALRRMTGRSLEGLPLD  205



>gb|AGN32409.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Dioscorea 
zingiberensis]
Length=564

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSY LESKLGDC+RAA +RR+AL+R+TG++++GLPL+
Sbjct  155  IVRSVVAGEIPSYILESKLGDCRRAAGVRREALKRMTGRAMEGLPLD  201



>gb|AEC33260.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Vanda hybrid 
cultivar]
Length=562

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+  V  G+ PSY+LES +GDC+RAA IRR+A+ RI+GK LDGLPLE
Sbjct  150  IIAAVVSGKTPSYALESAIGDCRRAAEIRREAIRRISGKGLDGLPLE  196



>ref|XP_004146762.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 ref|XP_004170898.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Cucumis sativus]
 gb|KGN47779.1| hypothetical protein Csa_6G401490 [Cucumis sativus]
Length=590

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V +G +PSYSLESKLGD KRAA+IRR+AL+R+TG+S+ GLP E
Sbjct  179  VVKMVVDGSVPSYSLESKLGDPKRAASIRREALQRMTGRSIHGLPFE  225



>gb|AGT78194.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Dendrobium huoshanense]
Length=562

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G+IPSY LE+KLGDC+RAA IRR+A+ R+TG+ ++GLPL+
Sbjct  148  IVSAVVAGKIPSYVLEAKLGDCRRAAGIRREAISRLTGRGMEGLPLD  194



>gb|AAQ82685.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Taxus x media]
Length=595

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I   V +G + SYSLES LGDCKRAA +RR ALE +TG+SLDGLPLE
Sbjct  178  IAAAVCDGTVASYSLESSLGDCKRAAFVRRSALELMTGRSLDGLPLE  224



>gb|EEE68986.1| hypothetical protein OsJ_27912 [Oryza sativa Japonica Group]
Length=608

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV+ V  G++PSY LE+KLGDC+RAA IRR+A+ RITG+ ++GLPL+
Sbjct  151  IVSSVVAGKVPSYVLETKLGDCRRAAGIRREAVRRITGRQIEGLPLD  197



>ref|XP_008677153.1| PREDICTED: uncharacterized protein LOC100280335 isoform X1 [Zea 
mays]
Length=579

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G++PSY+LE++LGDC+RAA IRR+AL RITG+ ++GLPL+
Sbjct  157  IVASVVAGKVPSYALEARLGDCRRAAGIRREALRRITGRDIEGLPLD  203



>sp|O24594.1|HMDH_MAIZE RecName: Full=3-hydroxy-3-methylglutaryl-coenzyme A reductase; 
Short=HMG-CoA reductase [Zea mays]
 emb|CAA70440.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Zea mays]
Length=579

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G++PSY+LE++LGDC+RAA IRR+AL RITG+ ++GLPL+
Sbjct  157  IVASVVAGKVPSYALEARLGDCRRAAGIRREALRRITGRDIEGLPLD  203



>ref|XP_004957224.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
isoform X1 [Setaria italica]
Length=584

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+AL RITG+ ++GLPL+
Sbjct  165  IVAAVVAGKIPSYVLETRLGDCRRAAGIRREALRRITGREMEGLPLD  211



>ref|XP_004287703.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Fragaria vesca subsp. vesca]
Length=566

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            I+N V  G  PSY+LES LGDC+RA  IRR+AL+R T +SL+GLPLE
Sbjct  155  IINSVVSGATPSYTLESNLGDCRRATGIRREALQRTTRRSLEGLPLE  201



>emb|CDY24329.1| BnaA07g02540D [Brassica napus]
Length=552

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V +G   S+SLE+KLGDCKRAAAIRR+A++R+TGKSL GLPL+
Sbjct  139  IVKSVVDGATSSHSLETKLGDCKRAAAIRREAVQRMTGKSLTGLPLD  185



>gb|AEM42971.1| HMG-CoA reductase [Siraitia grosvenorii]
Length=582

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLESKLGD KRAA+IRR AL+R+TG+S+ GLP E
Sbjct  171  IVKMVVNGSIPSYSLESKLGDPKRAASIRRVALQRMTGRSIHGLPFE  217



>ref|XP_003537699.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
[Glycine max]
Length=555

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G IPSYSLES+LGD  RAA+IRR+A+ERITG+S+ GLP+E
Sbjct  144  IVLAVVSGSIPSYSLESRLGDSHRAASIRREAVERITGRSIQGLPVE  190



>gb|AFW65233.1| hypothetical protein ZEAMMB73_893790 [Zea mays]
Length=381

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G++PSY+LE++LGDC+RAA IRR+AL RITG+ ++GLPL+
Sbjct  157  IVASVVAGKVPSYALEARLGDCRRAAGIRREALRRITGRDIEGLPLD  203



>ref|XP_008357165.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1-like 
[Malus domestica]
Length=501

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G   SY LESKL DCKRAA IRRKAL++ TG+SL+GLPLE
Sbjct  132  IVESVLSGTTASYELESKLEDCKRAAVIRRKALQKTTGRSLEGLPLE  178



>ref|XP_008782826.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase 3-like 
[Phoenix dactylifera]
Length=566

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G++PSY+LESKLGDC+RAA IRR+AL + TG++++GLPL+
Sbjct  155  IVRAVVAGKMPSYALESKLGDCRRAAGIRREALRQTTGRAMEGLPLD  201



>ref|NP_001284380.1| 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1 [Cucumis melo]
 dbj|BAA36291.1| HMG-CoA reductase [Cucumis melo]
 gb|ACZ50511.1| 3-hydroxy-3-methylglutaryl coenzyme-A reductase [Cucumis melo]
Length=587

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V +G +PSYSLESKLGD KRAA+IRR+AL+R TG+S+ GLP E
Sbjct  176  VVKMVVDGSVPSYSLESKLGDPKRAASIRREALQRTTGRSIHGLPFE  222



>gb|AAY87014.1| 3-hydroxy-methylglutaryl coenzyme A reductase [Magnolia chapensis]
Length=556

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V+ V  G +PSYSLESKLGDCKRAAAIRR A++  TG+SLDGL L+
Sbjct  145  LVSAVVSGSMPSYSLESKLGDCKRAAAIRRTAIQVKTGRSLDGLGLD  191



>ref|XP_008666319.1| PREDICTED: 3-hydroxy-3-methylglutaryl-coenzyme A reductase-like 
[Zea mays]
Length=313

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            IV  V  G+IPSY LE++LGDC+RAA IRR+ L +ITG+ +DGLPL+
Sbjct  158  IVAVVVAGKIPSYVLETRLGDCRRAAGIRREVLRKITGREMDGLPLD  204



>gb|AIX10146.1| hydroxymethylglutaryl-CoA reductase [Dioscorea composita]
Length=580

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPL  166
            IV+ V  G+ PSY LESKLGDC+RAAA+RR+AL RITG  + GLPL
Sbjct  158  IVSSVVSGKTPSYILESKLGDCQRAAAVRREALRRITGSGMQGLPL  203



>gb|ADP94147.1| 3-hydroxy-3-methylglutaryl coenzyme A reductase [Withania somnifera]
Length=575

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +2

Query  29   IVNGVAEGRIPSYSLESKLGDCKRAAAIRRKALERITGKSLDGLPLE  169
            +V  V  G IPSYSLES LGDC RAA+IRR+A++R+TG+SL GLPL+
Sbjct  164  LVKSVVSGDIPSYSLESLLGDCYRAASIRREAVQRLTGRSLAGLPLD  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 526040204904