BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25809_g2_i9 len=1548 path=[7657:0-781 8438:782-787 4265:788-860
8516:861-866 5978:867-898 8553:899-910 8565:911-938 8592:939-944
8598:945-948 4317:949-953 5502:954-994 8646:995-1003 26276:1004-1080
8731:1081-1289 6799:1290-1547]

Length=1548
                                                                      Score     E

ref|XP_009607716.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    413   4e-138   
ref|XP_009804918.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    404   3e-134   
ref|XP_002268908.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    403   3e-134   Vitis vinifera
ref|XP_006358470.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    402   1e-133   
ref|XP_010314187.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    400   8e-133   
gb|AFS28673.1|  putative 2-C-methyl-D-erythritol 2,4-cyclodiphosp...    398   1e-132   
emb|CAN80766.1|  hypothetical protein VITISV_013863                     398   5e-132   Vitis vinifera
gb|ABV02019.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...    397   7e-132   Nicotiana langsdorffii x Nicotiana sanderae
gb|AFS28674.1|  putative 2-C-methyl-D-erythritol 2,4-cyclodiphosp...    396   1e-131   
ref|XP_009410727.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    396   3e-131   
emb|CDO97659.1|  unnamed protein product                                393   6e-130   
gb|ACD70398.1|  putative chloroplast 2-C-methyl-D-erythritol 4-ph...    389   9e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006600264.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    392   1e-129   
ref|XP_007023792.1|  Nucleotide-diphospho-sugar transferases supe...    391   2e-129   
dbj|BAF98291.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    390   3e-129   Hevea brasiliensis [Para rubber tree]
dbj|BAF98292.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    390   4e-129   Hevea brasiliensis [Para rubber tree]
ref|XP_006385101.1|  hypothetical protein POPTR_0004s23930g             390   8e-129   
ref|XP_011028435.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    389   1e-128   
ref|XP_006600265.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    389   2e-128   
gb|EYU33225.1|  hypothetical protein MIMGU_mgv1a010477mg                387   1e-127   
ref|XP_004499358.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    385   4e-127   
ref|XP_010088695.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    385   4e-127   
ref|XP_006292733.1|  hypothetical protein CARUB_v10018977mg             384   8e-127   
gb|ACI16377.1|  4-diphosphocytidyl-methylerythritol 2-phosphate s...    382   5e-126   Catharanthus roseus [chatas]
ref|XP_010502265.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    382   9e-126   
ref|XP_010030242.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    382   9e-126   
gb|AEM42975.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    382   9e-126   
gb|AFK34060.1|  unknown                                                 382   1e-125   
gb|ABB88837.2|  4-diphosphocytidyl-2-C-methyl-D-erythritol synthase     382   1e-125   Stevia rebaudiana
gb|AFM93780.1|  plastid 2-C-methyl-D-erythritol 4-phosphate cytid...    382   1e-125   
ref|XP_010907549.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    381   2e-125   
ref|XP_009341250.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    382   2e-125   
ref|XP_009355454.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    381   3e-125   
ref|XP_008218628.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    380   3e-125   
ref|XP_011087604.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    380   6e-125   
ref|XP_008218627.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    380   6e-125   
ref|XP_010425029.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    380   6e-125   
ref|XP_010514024.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    380   7e-125   
gb|AFI71456.1|  2-C-methyl-D-erythritol 4-phosphatecytidyltransfe...    379   9e-125   
gb|AEZ55666.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    379   1e-124   
ref|XP_002876821.1|  predicted protein                                  379   1e-124   
ref|XP_008452188.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    376   2e-124   
ref|XP_011087603.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    378   2e-124   
gb|EPS72731.1|  4-diphosphocytidyl-methylerythritol 2-phosphate s...    375   3e-124   
ref|XP_008339487.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    377   8e-124   
ref|XP_010523431.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    377   8e-124   
ref|XP_004133739.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    376   1e-123   
ref|XP_008452187.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    376   1e-123   
ref|XP_004155221.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    376   1e-123   
ref|XP_008379014.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    376   7e-123   
ref|XP_004300034.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    374   7e-123   
ref|XP_010252286.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    374   7e-123   
ref|XP_006470808.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    374   8e-123   
ref|XP_006431390.1|  hypothetical protein CICLE_v10002035mg             374   8e-123   
ref|XP_009129141.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    374   1e-122   
gb|ACN40114.1|  unknown                                                 374   2e-122   Picea sitchensis
ref|XP_006836933.1|  hypothetical protein AMTR_s00099p00152040          374   2e-122   
emb|CDY15838.1|  BnaC02g34570D                                          372   4e-122   
emb|CDY09365.1|  BnaA02g26450D                                          372   4e-122   
pdb|1W77|A  Chain A, 2c-methyl-d-erythritol 4-phosphate Cytidylyl...    367   2e-121   
ref|XP_006395780.1|  hypothetical protein EUTSA_v10004647mg             370   4e-121   
pdb|2YC3|A  Chain A, Inhibitors Of The Herbicidal Target Ispd           367   5e-121   
pdb|2YCM|A  Chain A, Inhibitors Of Herbicidal Target Ispd               367   5e-121   
gb|AAZ80386.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    370   7e-121   Ginkgo biloba [ginkgo]
gb|KHN03574.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    369   1e-120   
gb|AID51430.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    363   4e-119   
ref|XP_010523433.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    358   5e-118   
ref|XP_010682094.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    361   1e-117   
ref|NP_565286.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltr...    360   3e-117   Arabidopsis thaliana [mouse-ear cress]
gb|AFB70980.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    355   8e-117   
ref|XP_011087605.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    357   2e-116   
gb|KDO41350.1|  hypothetical protein CISIN_1g022657mg                   354   3e-116   
ref|XP_004970838.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    357   4e-116   
ref|XP_007225800.1|  hypothetical protein PRUPE_ppa011267mg             352   1e-115   
gb|KCW57180.1|  hypothetical protein EUGRSUZ_I02806                     350   6e-115   
gb|AGP04988.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...    353   1e-114   
gb|KDO41351.1|  hypothetical protein CISIN_1g022657mg                   349   2e-114   
gb|ABU48538.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...    352   3e-114   
ref|XP_010314195.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    350   6e-114   
ref|XP_003564801.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    350   1e-113   
gb|KEH32738.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    347   4e-112   
ref|XP_010907551.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    344   8e-112   
dbj|BAJ91237.1|  predicted protein                                      342   1e-110   
ref|XP_006646546.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    340   2e-110   
ref|XP_008656994.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    339   2e-109   
sp|Q5N8G1.1|ISPD_ORYSJ  RecName: Full=2-C-methyl-D-erythritol 4-p...    337   1e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002456761.1|  hypothetical protein SORBIDRAFT_03g042160          334   3e-107   Sorghum bicolor [broomcorn]
ref|XP_002983421.1|  hypothetical protein SELMODRAFT_117940             331   4e-107   
ref|NP_001140440.1|  uncharacterized protein LOC100272499               333   5e-107   Zea mays [maize]
ref|XP_002960618.1|  hypothetical protein SELMODRAFT_73567              330   1e-106   
gb|KHF99643.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    332   4e-106   
ref|XP_010907550.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    331   5e-106   
gb|KCW57178.1|  hypothetical protein EUGRSUZ_I02806                     330   9e-106   
emb|CDM85383.1|  unnamed protein product                                328   4e-105   
gb|AFW84350.1|  hypothetical protein ZEAMMB73_109111                    328   5e-105   
gb|KDP32436.1|  hypothetical protein JCGZ_13361                         321   4e-103   
gb|AIY22673.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    320   5e-102   
ref|XP_001767079.1|  predicted protein                                  322   7e-102   
ref|XP_001776808.1|  predicted protein                                  311   3e-99    
ref|XP_011028436.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    306   1e-96    
gb|KHF99642.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    305   2e-95    
gb|KCW57181.1|  hypothetical protein EUGRSUZ_I02806                     300   1e-94    
ref|XP_002519366.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    298   2e-93    Ricinus communis
dbj|BAF52631.1|  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythrito...    294   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006395779.1|  hypothetical protein EUTSA_v10004647mg             288   6e-90    
ref|XP_002503621.1|  predicted protein                                  286   3e-89    Micromonas commoda
ref|XP_005649705.1|  2-C-methyl-D-erythritol 4-phosphate cy             285   6e-89    
ref|XP_002958218.1|  hypothetical protein VOLCADRAFT_84386              283   2e-87    
ref|XP_007023793.1|  Nucleotide-diphospho-sugar transferases supe...    280   2e-87    
ref|XP_001698942.1|  4-diphosphocytidyl-2C-methyl-D-erythritol sy...    283   2e-87    Chlamydomonas reinhardtii
ref|XP_007023794.1|  Nucleotide-diphospho-sugar transferases supe...    280   5e-87    
ref|XP_007023795.1|  Nucleotide-diphospho-sugar transferases supe...    279   5e-87    
gb|KFM29052.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    272   8e-83    
ref|XP_001418750.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    268   5e-82    Ostreococcus lucimarinus CCE9901
emb|CEF98811.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    266   8e-82    
ref|XP_007513665.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    256   2e-77    
ref|XP_003055525.1|  predicted protein                                  253   4e-77    
ref|XP_005705241.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    240   1e-70    
ref|WP_013924196.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    233   5e-69    
gb|EWM22399.1|  2-c-methyl-d-erythritol 4-phosphate cytidylyltran...    235   6e-69    
ref|WP_006340611.1|  hypothetical protein                               231   2e-68    
emb|CBJ33583.1|  4-diphosphocytidyl-2C-methyl-D-erythritol syntha...    232   3e-67    
ref|WP_013944231.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    227   4e-67    
emb|CDZ79584.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    227   5e-67    
ref|XP_005820482.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    223   5e-65    
ref|XP_008789176.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...    222   2e-64    
gb|KDO41349.1|  hypothetical protein CISIN_1g022657mg                   216   6e-63    
ref|WP_032125060.1|  hypothetical protein                               215   2e-62    
ref|WP_039356540.1|  hypothetical protein                               209   6e-60    
ref|WP_011174877.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    208   1e-59    
ref|WP_039386375.1|  hypothetical protein                               208   1e-59    
gb|KIC75399.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    207   2e-59    
ref|XP_002288420.1|  predicted protein                                  209   3e-59    Thalassiosira pseudonana CCMP1335
ref|XP_005536078.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    209   1e-58    
ref|XP_009034896.1|  hypothetical protein AURANDRAFT_23670              205   4e-58    
ref|XP_002182074.1|  predicted protein                                  202   4e-57    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007154106.1|  hypothetical protein PHAVU_003G0909001g            193   2e-55    
emb|CDR34199.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    195   8e-55    
gb|EJK72911.1|  hypothetical protein THAOC_05511                        196   2e-53    
ref|XP_005776753.1|  hypothetical protein EMIHUDRAFT_443903             184   9e-51    
ref|WP_011876577.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    174   4e-47    
ref|WP_015755935.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    173   1e-46    
ref|WP_014517588.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    170   9e-46    
ref|WP_038699059.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    171   1e-45    
ref|WP_012446656.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    171   2e-45    
ref|WP_010883217.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    168   4e-45    
ref|WP_013150817.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    168   7e-45    
ref|WP_028991974.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    168   9e-45    
ref|WP_032079542.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    168   9e-45    
ref|WP_009052846.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    166   3e-44    
ref|WP_012995939.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    166   4e-44    
ref|WP_013809471.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    165   1e-43    
ref|WP_018590463.1|  hypothetical protein                               165   1e-43    
ref|WP_011229596.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    165   1e-43    
ref|WP_027434722.1|  hypothetical protein                               165   2e-43    
ref|WP_003545202.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    165   2e-43    
ref|WP_012268983.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    164   2e-43    
ref|WP_025950551.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    164   2e-43    
ref|WP_015373720.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    164   3e-43    
ref|WP_014968447.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    164   3e-43    
ref|WP_003464566.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    164   4e-43    
ref|WP_006569578.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    164   4e-43    
ref|WP_022738833.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    163   4e-43    
ref|WP_012101144.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    163   5e-43    
ref|WP_035355787.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    163   6e-43    
gb|AHM55464.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    163   6e-43    
ref|WP_029687922.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    163   7e-43    
ref|WP_031406247.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
dbj|BAQ15118.1|  putative 2-C-methyl-D-erythritol 4-phosphate cyt...    163   1e-42    
ref|WP_007063030.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_013143975.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_004404883.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    162   1e-42    
ref|WP_006342838.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_014946445.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_012048363.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_026478127.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_014521984.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   1e-42    
ref|WP_003868427.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   2e-42    
ref|WP_014357294.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   2e-42    
ref|WP_003357598.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    162   2e-42    
ref|WP_033066501.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    161   2e-42    
ref|WP_029761777.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    161   3e-42    
ref|WP_011593147.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    161   3e-42    
ref|WP_013658306.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    161   3e-42    
ref|WP_007051024.1|  hypothetical protein                               161   3e-42    
ref|WP_002582597.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   4e-42    
ref|WP_012820472.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    161   4e-42    
ref|WP_005828905.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    161   4e-42    
gb|EPJ27003.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    160   4e-42    
ref|WP_027636994.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   4e-42    
ref|WP_016205918.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   4e-42    
ref|WP_003459324.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   4e-42    
gb|EIA15942.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    160   6e-42    
ref|WP_038092207.1|  hypothetical protein                               160   6e-42    
ref|WP_012343863.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   8e-42    
ref|WP_003360173.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    160   9e-42    
ref|WP_038267415.1|  hypothetical protein [                             160   9e-42    
ref|WP_006522896.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   1e-41    
ref|WP_021127538.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   1e-41    
ref|WP_034305081.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   1e-41    
ref|WP_007085315.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   2e-41    
sp|Q824I4.2|ISPD_CHLCV  RecName: Full=2-C-methyl-D-erythritol 4-p...    158   2e-41    Chlamydia caviae
ref|WP_027322682.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   2e-41    
emb|CEK31265.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    159   2e-41    
ref|WP_011006134.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    158   2e-41    
ref|WP_017889075.1|  hypothetical protein                               159   2e-41    
ref|WP_008681225.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   2e-41    
ref|WP_022248342.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   2e-41    
ref|WP_021121689.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    158   3e-41    
ref|WP_032123645.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    158   3e-41    
ref|WP_013840343.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    158   3e-41    
ref|WP_014253910.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   3e-41    
ref|WP_008882046.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    158   4e-41    
ref|WP_003404303.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    158   4e-41    
emb|CEK34466.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    158   4e-41    
ref|WP_007290337.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate...    162   6e-41    
ref|WP_034246470.1|  hypothetical protein                               158   6e-41    
gb|KGO12530.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    157   6e-41    
ref|WP_038304574.1|  hypothetical protein                               158   6e-41    
ref|WP_008517608.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   7e-41    
ref|WP_023211601.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   7e-41    
ref|WP_013779216.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   8e-41    
ref|WP_008426549.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   8e-41    
ref|WP_037996996.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   8e-41    
ref|WP_031306172.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   9e-41    
ref|WP_013276840.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   9e-41    
ref|WP_035163836.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   9e-41    
emb|CEG24703.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltrans...    157   9e-41    
ref|WP_003491256.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   9e-41    
ref|WP_006343827.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   1e-40    
emb|CAJ74506.1|  similar to 2-C-methyl-D-erythritol 4-phosphate c...    157   1e-40    Candidatus Kuenenia stuttgartiensis
ref|WP_035395250.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   1e-40    
ref|WP_026565498.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   1e-40    
gb|AIS53218.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    157   1e-40    
ref|WP_008410809.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   1e-40    
ref|WP_037465077.1|  hypothetical protein                               157   1e-40    
ref|WP_010284961.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   1e-40    
ref|WP_006212950.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   2e-40    
ref|WP_035057918.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   2e-40    
ref|WP_035135177.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   2e-40    
ref|WP_010231427.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   3e-40    
ref|WP_006691581.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    157   3e-40    
ref|WP_011026366.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   3e-40    
ref|WP_008714035.1|  IspD/IspF bifunctional enzyme                      160   3e-40    
ref|WP_021148215.1|  2-C-methyl-D-erythritol4-phosphate cytidylyl...    160   3e-40    
ref|WP_009439743.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   3e-40    
ref|WP_009710870.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   3e-40    
ref|WP_037355564.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   3e-40    
ref|WP_010073763.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   4e-40    
ref|WP_009656154.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    156   4e-40    
ref|WP_003482885.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   4e-40    
ref|WP_009592003.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   4e-40    
ref|WP_015737635.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    155   4e-40    
ref|WP_013921189.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   4e-40    
ref|WP_033842699.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   4e-40    
ref|WP_013707744.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   5e-40    
ref|WP_015357996.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    155   5e-40    
ref|WP_035274642.1|  hypothetical protein                               155   5e-40    
dbj|GAK50841.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    155   5e-40    
ref|WP_005214294.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   5e-40    
ref|WP_005008356.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   6e-40    
ref|WP_009674516.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    155   6e-40    
ref|WP_014653013.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   6e-40    
ref|WP_008601077.1|  IspD/IspF bifunctional enzyme                      159   6e-40    
ref|WP_020958337.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   7e-40    
ref|WP_012864443.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    159   7e-40    
ref|WP_033008621.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   8e-40    
ref|WP_011458392.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   8e-40    
ref|WP_006906626.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   9e-40    
ref|WP_033021059.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   9e-40    
ref|WP_016742859.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   9e-40    
ref|WP_029101096.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   9e-40    
ref|WP_039680358.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   9e-40    
ref|WP_006597477.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    155   1e-39    
ref|WP_010191455.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   1e-39    
ref|WP_015573459.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    155   1e-39    
gb|AIQ14700.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    154   1e-39    
ref|WP_008398863.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   1e-39    
dbj|GAF25724.1|  4-diphosphocytidyl-2-methyl-D-erithritol synthase      154   1e-39    
ref|WP_017247029.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   2e-39    
ref|WP_030037307.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   2e-39    
ref|WP_012683962.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   2e-39    
ref|XP_007154107.1|  hypothetical protein PHAVU_003G0909000g            152   2e-39    
ref|WP_018704404.1|  hypothetical protein                               157   2e-39    
ref|WP_035065103.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   2e-39    
ref|WP_024030903.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   2e-39    
ref|WP_022174306.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   3e-39    
ref|WP_010051984.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   3e-39    
ref|WP_028390485.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   3e-39    
ref|WP_036638416.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   3e-39    
ref|WP_014372569.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   4e-39    
emb|CBL35874.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    153   4e-39    
gb|ABC24959.1|  plastid 2-C-methyl-D-erythritol-4-phosphate cytid...    152   4e-39    
ref|WP_034406933.1|  hypothetical protein                               152   5e-39    
gb|KHE91844.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    152   5e-39    
ref|WP_022253971.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   5e-39    
ref|WP_025695487.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   5e-39    
ref|WP_003392036.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   6e-39    
ref|WP_036371531.1|  hypothetical protein                               152   6e-39    
ref|WP_006689726.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   7e-39    
ref|WP_025729883.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   7e-39    
ref|WP_025691683.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   8e-39    
gb|KEH32739.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    151   8e-39    
ref|WP_035406701.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   9e-39    
ref|WP_014096524.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   9e-39    
ref|WP_009727776.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   1e-38    
ref|WP_007223347.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_027626550.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_013176406.1|  4-diphosphocytidyl-2C-methyl-D-erythritol ki...    152   1e-38    
ref|WP_016356679.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    153   1e-38    
ref|WP_027936958.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate...    155   1e-38    
ref|WP_013350795.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_036373661.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   1e-38    
ref|WP_018888199.1|  hypothetical protein                               151   1e-38    
ref|WP_018131255.1|  hypothetical protein                               151   1e-38    
ref|WP_026561197.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_003473445.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_021683960.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    152   1e-38    
gb|AIQ38115.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    151   1e-38    
ref|WP_011641734.1|  4-diphosphocytidyl-2C-methyl-D-erythritol ki...    151   1e-38    
ref|WP_032116998.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_036652851.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_011393964.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_026888019.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   1e-38    
ref|WP_034635133.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate...    155   2e-38    
ref|WP_023482193.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   2e-38    
ref|WP_029451441.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   2e-38    
ref|WP_007724638.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    151   2e-38    
ref|WP_009245324.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   2e-38    
ref|WP_035664696.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   2e-38    
ref|WP_028406480.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   2e-38    
ref|WP_019214093.1|  hypothetical protein                               151   2e-38    
ref|WP_018708701.1|  hypothetical protein                               150   2e-38    
ref|WP_034562329.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   2e-38    
gb|AJE52219.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    150   3e-38    
ref|WP_025748547.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_023964870.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_035155171.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_006352921.1|  hypothetical protein [                             151   3e-38    
ref|WP_012158340.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_024853213.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_010295388.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_025775675.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_020370883.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    149   3e-38    
ref|WP_033170274.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   3e-38    
ref|WP_038463178.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_014471354.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_006306119.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   3e-38    
ref|WP_004840929.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    150   3e-38    
ref|WP_015847250.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   3e-38    
ref|WP_010024046.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   4e-38    
ref|WP_027415305.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   4e-38    
ref|WP_027446562.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    154   4e-38    
ref|WP_021494150.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   4e-38    
ref|WP_034676012.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   4e-38    
gb|EHL07923.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    150   4e-38    
ref|WP_013119167.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   4e-38    
ref|WP_022212430.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   4e-38    
ref|WP_006696334.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   5e-38    
ref|WP_015942744.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   5e-38    
gb|AIQ26277.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    150   5e-38    
ref|WP_036098840.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   5e-38    
ref|WP_029717425.1|  hypothetical protein                               150   5e-38    
ref|WP_028591602.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   5e-38    
ref|WP_015529911.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   5e-38    
ref|WP_036580134.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   6e-38    
gb|EZP79084.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    149   6e-38    
ref|WP_006694005.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    150   6e-38    
ref|WP_003374047.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   6e-38    
ref|WP_035147383.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   6e-38    
ref|WP_022168243.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   6e-38    
ref|WP_035050842.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   6e-38    
ref|WP_025702137.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   6e-38    
emb|CDZ23853.1|  hypothetical protein CCDG5_0724 [ [                    150   7e-38    
ref|WP_013373287.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_025680007.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_015390319.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_035031018.1|  hypothetical protein                               154   7e-38    
ref|WP_012748860.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_015563250.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_036680484.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_027433262.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    149   7e-38    
ref|WP_021800132.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_025715696.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
ref|WP_031557465.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   7e-38    
gb|KIG02003.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    149   7e-38    
ref|WP_009361473.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   8e-38    
ref|WP_008537350.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    149   8e-38    
ref|WP_039234348.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   8e-38    
ref|WP_009167792.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   8e-38    
emb|CDC14847.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    149   9e-38    
ref|WP_007132590.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   9e-38    
ref|WP_023626457.1|  MULTISPECIES: hypothetical protein                 149   9e-38    
ref|WP_038538386.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   9e-38    
ref|WP_019908194.1|  hypothetical protein                               149   1e-37    
ref|WP_028983817.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_029575199.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_026894958.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_028129052.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_013787122.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_013740688.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_038456709.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_026899735.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_004696007.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate...    153   1e-37    
ref|WP_017754888.1|  hypothetical protein                               149   1e-37    
ref|WP_004220542.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_011996188.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_007417630.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_034425119.1|  hypothetical protein                               148   1e-37    
ref|WP_003397626.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_026073723.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    149   1e-37    
ref|WP_007615226.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    148   1e-37    
ref|WP_014469612.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_004888623.1|  2-C-methyl-D-erythritol 4-phosphatecytidylyl...    148   1e-37    
ref|WP_014472432.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_022794442.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   1e-37    
ref|WP_018924696.1|  hypothetical protein                               148   1e-37    
ref|WP_032101442.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
gb|EXX84839.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    150   2e-37    
ref|WP_014757902.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    148   2e-37    
ref|WP_017434042.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_015239038.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    148   2e-37    
ref|WP_010170053.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_032872229.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
dbj|GAJ40408.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    148   2e-37    
ref|WP_012065469.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_026011879.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
gb|EEX77080.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    148   2e-37    
ref|WP_011988782.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_006037974.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_036819890.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_021876919.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   2e-37    
ref|WP_017815339.1|  hypothetical protein                               148   2e-37    
ref|WP_012573841.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_034438533.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   2e-37    
ref|WP_034745163.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_036712517.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_006314754.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   2e-37    
ref|WP_026688650.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   2e-37    
ref|WP_020252285.1|  MULTISPECIES: hypothetical protein                 148   2e-37    
ref|WP_033100636.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   2e-37    
ref|WP_027633499.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_036652570.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_029543169.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_036619472.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   3e-37    
ref|WP_027087323.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_012415332.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    151   3e-37    
dbj|GAF10222.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    147   3e-37    
ref|WP_009348873.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    148   3e-37    
ref|WP_015558455.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   3e-37    
ref|WP_026761025.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   3e-37    
ref|WP_028309173.1|  hypothetical protein                               147   3e-37    
ref|WP_014278333.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_035066588.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
ref|WP_014416743.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    147   3e-37    
ref|WP_014423913.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   3e-37    
ref|WP_039832592.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   3e-37    
gb|EGB90929.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    147   3e-37    
ref|WP_009442598.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    148   4e-37    
ref|WP_017419469.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    147   4e-37    
ref|WP_028977315.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   4e-37    
ref|WP_006322683.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   4e-37    
ref|WP_007432606.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    147   4e-37    
ref|WP_035314526.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   4e-37    
ref|WP_031587571.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   5e-37    
ref|WP_003367585.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   5e-37    
ref|WP_020250520.1|  MULTISPECIES: hypothetical protein                 147   5e-37    
ref|WP_007716197.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   5e-37    
ref|WP_004097713.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate...    152   5e-37    
gb|KFM83853.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    148   5e-37    
ref|WP_018195994.1|  MULTISPECIES: hypothetical protein                 147   5e-37    
ref|WP_023179625.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   5e-37    
ref|WP_012424611.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   5e-37    
ref|WP_003156405.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   5e-37    
ref|WP_022350989.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   6e-37    
emb|CEG25229.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...    146   6e-37    
ref|WP_021772166.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   6e-37    
ref|WP_035046915.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   6e-37    
ref|WP_023511480.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   6e-37    
gb|ETI94961.1|  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synt...    150   6e-37    
gb|ETW99229.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...    146   7e-37    
ref|WP_020955218.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   7e-37    
ref|WP_022743529.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   7e-37    
ref|WP_031462307.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   8e-37    
ref|WP_013712070.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   8e-37    
ref|WP_008976575.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   8e-37    
ref|WP_022449513.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   8e-37    
ref|WP_027437105.1|  hypothetical protein                               146   8e-37    
ref|WP_026574065.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   8e-37    
ref|WP_013399824.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   9e-37    
ref|WP_034839416.1|  hypothetical protein [                             146   9e-37    
ref|WP_035189305.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   9e-37    
ref|WP_025365934.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   9e-37    
ref|WP_016818637.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   9e-37    
ref|WP_009658530.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    147   1e-36    
ref|WP_018307177.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   1e-36    
ref|WP_039062470.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    146   1e-36    
ref|WP_035786110.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    145   1e-36    
ref|WP_007410391.1|  MULTISPECIES: 2-C-methyl-D-erythritol 4-phos...    146   1e-36    
ref|WP_034630893.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...    145   1e-36    



>ref|XP_009607716.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Nicotiana tomentosiformis]
Length=309

 Score =   413 bits (1062),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 253/318 (80%), Gaps = 22/318 (7%)
 Frame = +1

Query  352   MSHLQLGLP---NSPLFLKTH---PQKSFLLHYSISYCPKVPSFLHP-RTGKIVPLRSS-  507
             MS LQLG+    +SP+FL +H   P+  F         PK  S  +P R    +    S 
Sbjct  1     MSTLQLGVTLSCSSPMFLPSHSLTPRNGF-------PAPKNNSLKNPFRLAHCICRTYSH  53

Query  508   ---RRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
                R +L KITC+A    + +L+K   D  V+EKSVSVILLAGG GKRMG SMPKQYLPL
Sbjct  54    GDPRMTLFKITCTA---TSPNLNKS-TDAVVEEKSVSVILLAGGKGKRMGASMPKQYLPL  109

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++PQVKEI+VVCDP Y D+FEDA +   ++LKFALPGKERQDSVY+
Sbjct  110   LGQPIALYSFFTFSRMPQVKEIIVVCDPSYQDIFEDAKENIQVDLKFALPGKERQDSVYS  169

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QEVD +S+L+CIHD+ARPLV   DVEKVLKDGWLVGAAVLGVPAK+TIKEAN+ESFVV
Sbjct  170   GLQEVDSNSKLVCIHDSARPLVWTEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVV  229

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQVIKPELLKKGFE++NREGLEVTDDVSIVE LKHPVYIT+GSY+NI
Sbjct  230   KTLDRKTLWEMQTPQVIKPELLKKGFELVNREGLEVTDDVSIVEHLKHPVYITDGSYTNI  289

Query  1219  KVTTPDDMLLAERILNAR  1272
             KVTTPDD+LLAERILN+ 
Sbjct  290   KVTTPDDLLLAERILNSE  307



>ref|XP_009804918.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Nicotiana sylvestris]
Length=309

 Score =   404 bits (1037),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 219/313 (70%), Positives = 251/313 (80%), Gaps = 12/313 (4%)
 Frame = +1

Query  352   MSHLQLGL---PNSPLFLKTH---PQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRR  513
             MS LQ G+    +SP+FL +H   P+  F    + S   K PS L   T +       R 
Sbjct  1     MSTLQFGVTLCSSSPIFLPSHSLTPRNGFPTPKTNSL--KNPSRLAHCTCRTYSHGVPRM  58

Query  514   SLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             SL  ITCSA    + +L+K   D+ V+EKSVSVILLAGG GKRMG SMPKQYLPLLGQPI
Sbjct  59    SLFNITCSA---TSPNLNKS-TDVVVEEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPI  114

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF TFS++PQVKEI+VVCDP Y D+FEDA +   +ELKFALPGKERQDSVY+G QEV
Sbjct  115   ALYSFFTFSRMPQVKEIIVVCDPSYQDIFEDAKENIQVELKFALPGKERQDSVYSGLQEV  174

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D +S+L+CIHD+ARPLV   DVEKVLKDGWLVGAAVLGVPAK+TIKEAN+ESFVV+TL+R
Sbjct  175   DSNSKLVCIHDSARPLVWTEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDR  234

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             KTLWEMQTPQVIKPELLKKGFE++NREG+EVTDDVSIVE LKHPVYITEGSY+NIKVTTP
Sbjct  235   KTLWEMQTPQVIKPELLKKGFELVNREGVEVTDDVSIVEYLKHPVYITEGSYTNIKVTTP  294

Query  1234  DDMLLAERILNAR  1272
             DD+LLAERILN  
Sbjct  295   DDLLLAERILNTE  307



>ref|XP_002268908.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Vitis vinifera]
 emb|CBI29624.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   403 bits (1036),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 239/302 (79%), Gaps = 18/302 (6%)
 Frame = +1

Query  379   NSPLFLKT-----HPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRS-LSKITCSA  540
             +SPL L T     H   SFL  +S       PS L P  G  + +R   RS  SKI+CSA
Sbjct  13    SSPLLLPTISQIPHKPLSFLSTFS-------PSKLSPFPGCQIEVRRRGRSGSSKISCSA  65

Query  541   LYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFS  720
               G   +      DL VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS
Sbjct  66    NAGQLNE-----TDLVVKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFS  120

Query  721   KLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICI  900
             ++  VKEIVVVCDP Y D+FEDA +  HI++KF LPGKERQDSVY+G Q VDL+SEL+CI
Sbjct  121   RMSAVKEIVVVCDPSYKDIFEDAKENIHIDVKFTLPGKERQDSVYSGLQAVDLNSELVCI  180

Query  901   HDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTP  1080
             HD+ARPLV  GD+E+VLKDG L GAAVLGVP K+TIKEAN+ESFVVRTL+RKTLWEMQTP
Sbjct  181   HDSARPLVSTGDIEQVLKDGQLNGAAVLGVPVKATIKEANSESFVVRTLDRKTLWEMQTP  240

Query  1081  QVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERI  1260
             QVIKPELL+KGFE++NRE LEVTDDVSIVE LKHPV+ITEGSY+NIKVTTPDD+LLAERI
Sbjct  241   QVIKPELLRKGFELVNRECLEVTDDVSIVEHLKHPVFITEGSYTNIKVTTPDDLLLAERI  300

Query  1261  LN  1266
             LN
Sbjct  301   LN  302



>ref|XP_006358470.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Solanum tuberosum]
Length=307

 Score =   402 bits (1033),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 249/308 (81%), Gaps = 8/308 (3%)
 Frame = +1

Query  352   MSHLQLGL---PNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRSLS  522
             MS LQLG+    +SP+FL ++      +  SIS  P   +F+     +       RR L 
Sbjct  1     MSTLQLGIILSSSSPMFLPSNSHIPKNVFPSISLFPT--NFVKNTCRRTYSHGDPRRGLF  58

Query  523   KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALY  702
             KI+CS+    + +L+K    + V+EKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALY
Sbjct  59    KISCSS---TSANLNKGSDVVVVEEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALY  115

Query  703   SFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
             SF TFSK+PQVKEI+VVCDP Y D+FEDA +   ++LKFALPGKERQDSVY+G QEVD +
Sbjct  116   SFYTFSKMPQVKEIIVVCDPSYQDIFEDAKEYIQVDLKFALPGKERQDSVYSGLQEVDSN  175

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
             S+L CIHD+ARPLV   DVEKVLKDGWLVGAAVLGVPAK+TIKEAN+ESFVV+TL+RKTL
Sbjct  176   SKLACIHDSARPLVQTEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKTL  235

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQ+IKPELLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+
Sbjct  236   WEMQTPQIIKPELLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDL  295

Query  1243  LLAERILN  1266
             LLAERILN
Sbjct  296   LLAERILN  303



>ref|XP_010314187.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=307

 Score =   400 bits (1027),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 214/308 (69%), Positives = 248/308 (81%), Gaps = 8/308 (3%)
 Frame = +1

Query  352   MSHLQLGL---PNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRSLS  522
             MS LQLG+    +SP+FL ++      +  SIS  P    F+     +       RR L 
Sbjct  1     MSTLQLGIILSSSSPMFLASNSHIPKNVLPSISLFPTY--FVKNPCRRTYSHADPRRGLF  58

Query  523   KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALY  702
             KI+CS+    + +L+K    + V+EKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALY
Sbjct  59    KISCSS---TSENLNKESDVVVVEEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALY  115

Query  703   SFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
             SF TFSK+PQVKEI+VVCDP Y D+FEDA +   ++LKFALPGKERQDSVY+G QEVD +
Sbjct  116   SFYTFSKMPQVKEIIVVCDPSYQDIFEDAKEYIQVDLKFALPGKERQDSVYSGLQEVDSN  175

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
             S+L CIHD+ARPLV   DVEKVLKDGWLVGAAVLGVPAK+TIKEAN+ESFVV+TL+RKTL
Sbjct  176   SKLACIHDSARPLVQIEDVEKVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKTL  235

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQ+IKPELLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+
Sbjct  236   WEMQTPQIIKPELLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDL  295

Query  1243  LLAERILN  1266
             LLAERILN
Sbjct  296   LLAERILN  303



>gb|AFS28673.1| putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, 
partial [Olea europaea]
Length=277

 Score =   398 bits (1022),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 203/263 (77%), Positives = 228/263 (87%), Gaps = 7/263 (3%)
 Frame = +1

Query  478   TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSM  657
               KI  LR+     S+ITCSA          + +DL VKEKSVSV+LLAGG GKRMG SM
Sbjct  14    ANKIKSLRTHNFFRSRITCSAKAA-------QGSDLVVKEKSVSVVLLAGGKGKRMGASM  66

Query  658   PKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKE  837
             PKQYLPLLGQPIALYSF TFSK+P+VKEIVVVCDP Y D+FEDA    H++LKFALPGKE
Sbjct  67    PKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDAKDSIHVDLKFALPGKE  126

Query  838   RQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEA  1017
             RQDSVY+G QE+DL+SEL+CIHD+ARPLVLA DV KVLKDGWL+GAAVLGVPAK+TIKEA
Sbjct  127   RQDSVYSGLQEIDLNSELVCIHDSARPLVLAEDVAKVLKDGWLIGAAVLGVPAKATIKEA  186

Query  1018  NNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYIT  1197
             N ESFVV+TL+RKTLWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSI+E LKHPVYIT
Sbjct  187   NGESFVVKTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIIEHLKHPVYIT  246

Query  1198  EGSYSNIKVTTPDDMLLAERILN  1266
             EGSY+NIKVTTPDD+LLAERILN
Sbjct  247   EGSYTNIKVTTPDDLLLAERILN  269



>emb|CAN80766.1| hypothetical protein VITISV_013863 [Vitis vinifera]
Length=312

 Score =   398 bits (1022),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 197/256 (77%), Positives = 221/256 (86%), Gaps = 5/256 (2%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R  R   SKI+CSA  G    L++   DL VKEKSVSVILLAGG GKRMG SMPKQYLPL
Sbjct  56    RRGRSGSSKISCSANAG---QLNE--TDLVVKEKSVSVILLAGGKGKRMGASMPKQYLPL  110

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++  VKEIVVVCDP Y D+FEDA +  HI++KF LPGKERQDSVY+
Sbjct  111   LGQPIALYSFYTFSRMSAVKEIVVVCDPSYKDIFEDAKENIHIDVKFTLPGKERQDSVYS  170

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G Q VDL+SEL+CIHD+ARPLV  GD+E+VLKDG L GAAVLGVP K+TIKEAN+ESFVV
Sbjct  171   GLQAVDLNSELVCIHDSARPLVSTGDIEQVLKDGQLNGAAVLGVPVKATIKEANSESFVV  230

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             RTL+RKTLWEMQTPQVIKPELL+KGFE++NRE LEVTDDVSIVE LKHPV+ITEGSY+NI
Sbjct  231   RTLDRKTLWEMQTPQVIKPELLRKGFELVNRECLEVTDDVSIVEHLKHPVFITEGSYTNI  290

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+LLAERILN
Sbjct  291   KVTTPDDLLLAERILN  306



>gb|ABV02019.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Nicotiana 
langsdorffii x Nicotiana sanderae]
Length=306

 Score =   397 bits (1021),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 248/313 (79%), Gaps = 16/313 (5%)
 Frame = +1

Query  352   MSHLQLGLP---NSPLFLKTHPQKSFLLHYSISYCPKVPSFLHP-----RTGKIVPLRSS  507
             MS LQLG+     SP+ L +H Q    +  ++   PK+ S  +P      T K       
Sbjct  1     MSTLQLGVTLSFPSPMLLPSHSQ----IPTNVFPTPKINSLKNPFRLAHSTCKTYSRSDP  56

Query  508   RRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQ  687
             R  L +ITCSA    +  L+K   D+ V+EKSVSVILLAGG GKR+G SMPKQYLPLLGQ
Sbjct  57    RMPLFRITCSA---TSSKLNK-STDVVVEEKSVSVILLAGGKGKRIGASMPKQYLPLLGQ  112

Query  688   PIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQ  867
             P ALYSF TFS++PQVKEI+VVCDP Y D+FEDA +   +ELKFALPGKERQDSVY+G Q
Sbjct  113   PTALYSFFTFSRMPQVKEIIVVCDPSYQDIFEDAKENIQVELKFALPGKERQDSVYSGLQ  172

Query  868   EVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTL  1047
             EVD  S+L+CIHD+ARPLV   D+EKVLKDGW+VGAAVLGVPAK+TIKEAN+ESFVV+TL
Sbjct  173   EVDSISKLVCIHDSARPLVWTEDIEKVLKDGWVVGAAVLGVPAKATIKEANSESFVVKTL  232

Query  1048  NRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVT  1227
             +RKTLWEMQTPQVIKPELLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVT
Sbjct  233   DRKTLWEMQTPQVIKPELLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVT  292

Query  1228  TPDDMLLAERILN  1266
             TPDD+LLAERILN
Sbjct  293   TPDDLLLAERILN  305



>gb|AFS28674.1| putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, 
partial [Olea europaea]
Length=277

 Score =   396 bits (1017),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/263 (77%), Positives = 227/263 (86%), Gaps = 7/263 (3%)
 Frame = +1

Query  478   TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSM  657
               KI  LR+     S+ITCSA          + +DL VKEKSVSV+LLAGG GKRMG SM
Sbjct  14    ANKIKSLRTHNFFRSRITCSAKAA-------QGSDLVVKEKSVSVVLLAGGKGKRMGASM  66

Query  658   PKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKE  837
             PKQYLPLLGQPIALYSF TFSK+P+VKEIVVVCDP Y D+FEDA    H++LKFALPGKE
Sbjct  67    PKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDAKDSIHVDLKFALPGKE  126

Query  838   RQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEA  1017
             RQDSVY+G QE+DL+SEL+CIHD+ARPLVLA DV KVLKDGWL+GAAVLGVPAK+TIKEA
Sbjct  127   RQDSVYSGLQEIDLNSELVCIHDSARPLVLAEDVAKVLKDGWLIGAAVLGVPAKATIKEA  186

Query  1018  NNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYIT  1197
             N ESFVV+TL+RK LWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSI+E LKHPVYIT
Sbjct  187   NGESFVVKTLDRKMLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIIEHLKHPVYIT  246

Query  1198  EGSYSNIKVTTPDDMLLAERILN  1266
             EGSY+NIKVTTPDD+LLAERILN
Sbjct  247   EGSYTNIKVTTPDDLLLAERILN  269



>ref|XP_009410727.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=305

 Score =   396 bits (1017),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 190/258 (74%), Positives = 224/258 (87%), Gaps = 6/258 (2%)
 Frame = +1

Query  511   RSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQP  690
             R+ S+I C A     GD   R  + AVKE+SVSV+LLAGG GKRMG SMPKQYLPLLGQP
Sbjct  53    RTRSRINCIA----EGD--GRSQNEAVKERSVSVVLLAGGQGKRMGASMPKQYLPLLGQP  106

Query  691   IALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQE  870
             IALYSF TFS++ +VKEIVVVCDP Y DVFEDA +K +++LKFALPGKERQDSV++GFQE
Sbjct  107   IALYSFYTFSQMTEVKEIVVVCDPSYKDVFEDASEKLNVDLKFALPGKERQDSVFSGFQE  166

Query  871   VDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLN  1050
             +D SSEL+CIHD+ARPLV +GD++KV++D W+VGAAVLGVP K+TIKEAN +SFVV+TL+
Sbjct  167   IDGSSELVCIHDSARPLVSSGDIKKVVQDAWVVGAAVLGVPVKATIKEANKDSFVVKTLD  226

Query  1051  RKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTT  1230
             RKTLWEMQTPQVIKPELL+ GFE++NR+GLEVTDDVSIVE LKHPV+ITEGSY+NIKVTT
Sbjct  227   RKTLWEMQTPQVIKPELLRSGFEVVNRDGLEVTDDVSIVEHLKHPVFITEGSYTNIKVTT  286

Query  1231  PDDMLLAERILNARFNYA  1284
             PDD+LLAERILN     A
Sbjct  287   PDDLLLAERILNMEIAVA  304



>emb|CDO97659.1| unnamed protein product [Coffea canephora]
Length=319

 Score =   393 bits (1009),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 225/257 (88%), Gaps = 4/257 (2%)
 Frame = +1

Query  496   LRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLP  675
             L++SR +  +ITC+A   ++G+  K   D+ VKEK VSVILLAGG GKRMG SMPKQYLP
Sbjct  60    LQNSRLAHLRITCAA---ISGEFEK-SPDIVVKEKCVSVILLAGGTGKRMGASMPKQYLP  115

Query  676   LLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVY  855
             LLGQPIALYSF TF  LP+V+EIVVVCDP Y D+FEDA +K H+++KFALPGKERQDSVY
Sbjct  116   LLGQPIALYSFFTFCALPEVREIVVVCDPSYQDIFEDAKEKIHVDMKFALPGKERQDSVY  175

Query  856   NGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFV  1035
             +G Q VDLS+EL+CIHD+ARPLVLA DV KVLKD   VGAAVLGVP+K+TIKEA+++ FV
Sbjct  176   SGLQAVDLSTELVCIHDSARPLVLAEDVGKVLKDALRVGAAVLGVPSKATIKEADSKYFV  235

Query  1036  VRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSN  1215
             V+TL+RKTLWEMQTPQVIKP+LL+KGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+N
Sbjct  236   VKTLDRKTLWEMQTPQVIKPDLLRKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTN  295

Query  1216  IKVTTPDDMLLAERILN  1266
             IKVTTPDD+LLAERIL 
Sbjct  296   IKVTTPDDLLLAERILK  312



>gb|ACD70398.1| putative chloroplast 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Populus trichocarpa]
Length=240

 Score =   389 bits (1000),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 211/227 (93%), Gaps = 0/227 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG +MPKQYLPLLGQPIALYS  TFS++ +VKEI+VVCDP Y
Sbjct  12    VKEKSVSVILLAGGQGKRMGANMPKQYLPLLGQPIALYSLYTFSEMDEVKEIIVVCDPSY  71

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED+ ++ +++LKFALPGKERQDSVY+G QEVDL+SEL+CIHD+ARPLVL+ DVEKV
Sbjct  72    KDIFEDSQEQINVDLKFALPGKERQDSVYSGLQEVDLNSELVCIHDSARPLVLSEDVEKV  131

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW+ GAAVLGVP K+TIKEA+ ESFVVRTL+RKTLWEMQTPQV+KPELLKKGFE++N
Sbjct  132   LKDGWINGAAVLGVPVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVN  191

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             REGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERIL+ 
Sbjct  192   REGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILST  238



>ref|XP_006600264.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X1 [Glycine max]
Length=314

 Score =   392 bits (1006),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/310 (66%), Positives = 238/310 (77%), Gaps = 14/310 (5%)
 Frame = +1

Query  352   MSHLQLGLPNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHP--RTGK-IVPLRSSRRSLS  522
             M  +  G P SPL         F L  + S  P     +H     GK ++ + S + + S
Sbjct  1     MVAIGFGAPPSPL--------PFHLRLASSPSPLAFPIIHKFQNAGKSVITICSKKNAKS  52

Query  523   KIT--CSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIA  696
             ++   CSA   V+    +  +D+ ++E+SVSV+LLAGG GKRMG SMPKQYLPL GQPIA
Sbjct  53    RVVTLCSAPVQVDMQ-EQEVSDITLRERSVSVVLLAGGQGKRMGASMPKQYLPLFGQPIA  111

Query  697   LYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVD  876
             LYSF TF  L QVKEI+VVCDP Y D+FEDA   +  ELKFALPGKERQDSVYNGFQ VD
Sbjct  112   LYSFHTFFHLVQVKEIIVVCDPSYKDIFEDAKGDYQAELKFALPGKERQDSVYNGFQAVD  171

Query  877   LSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRK  1056
              +SEL+CIHD+ARPLVL+ DV+KVLKDG L GAAVLGVP K+TIKEAN ESFVV+TL+RK
Sbjct  172   PNSELVCIHDSARPLVLSADVKKVLKDGLLNGAAVLGVPVKATIKEANRESFVVKTLDRK  231

Query  1057  TLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPD  1236
             TLWEMQTPQVIKPELL+KGFE++NREGLEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPD
Sbjct  232   TLWEMQTPQVIKPELLRKGFELVNREGLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPD  291

Query  1237  DMLLAERILN  1266
             DMLLAERILN
Sbjct  292   DMLLAERILN  301



>ref|XP_007023792.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY26414.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=308

 Score =   391 bits (1005),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 207/308 (67%), Positives = 237/308 (77%), Gaps = 22/308 (7%)
 Frame = +1

Query  349   TMSHLQLGLPNSP-LFLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRSLS-  522
             T S   L +P+ P +  K+ P   F  H  I++         P  G+ V LR   R  S 
Sbjct  13    TCSTSSLLVPSKPHVAAKSSP---FFSHIHINF---------PSPGRNVELRRRARIGSC  60

Query  523   KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALY  702
             +I CSA    NG          VKE+SVSVILLAGG GKRMG SMPKQYLPLLGQPIALY
Sbjct  61    RIKCSAEVD-NGSA-------KVKERSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALY  112

Query  703   SFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
             S  TFS++ +VKEIVVVCDP YND+FE+   K +++LKF LPGKERQDSVY+G Q VD +
Sbjct  113   SLYTFSRMIEVKEIVVVCDPSYNDIFEETKDKINVDLKFTLPGKERQDSVYSGLQAVDSN  172

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
              EL+CIHD+ARPLV +GDVEKVLKDGWLVGAAVLGVP K+TIKEAN+ S+VVRTL RKTL
Sbjct  173   CELVCIHDSARPLVTSGDVEKVLKDGWLVGAAVLGVPVKATIKEANSHSYVVRTLERKTL  232

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQVIKPELL+KGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+
Sbjct  233   WEMQTPQVIKPELLRKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDL  292

Query  1243  LLAERILN  1266
             LLAERILN
Sbjct  293   LLAERILN  300



>dbj|BAF98291.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Hevea 
brasiliensis]
Length=311

 Score =   390 bits (1003),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 201/297 (68%), Positives = 234/297 (79%), Gaps = 18/297 (6%)
 Frame = +1

Query  406   PQKSFLLHYSISYC--PKVP--SFLHPRTGKIVPLRSS------RRSLSKITCSALYGVN  555
             P  SF    S+  C  P++P  SF  P   K    + S      R + + I CSA     
Sbjct  15    PSASFKSSNSLFPCNHPQIPTNSFHLPSLSKSSVHKISWIQKLPRIATATIKCSAKI---  71

Query  556   GDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQV  735
                    +  A KEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFSK+ +V
Sbjct  72    -----ENSSAAAKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMIEV  126

Query  736   KEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAAR  915
             KEIVVVCDP Y D+FEDA +  +++LKFALPGKERQDSVY+G  EVDL+SEL+C+HD+AR
Sbjct  127   KEIVVVCDPSYQDIFEDAKENINVDLKFALPGKERQDSVYSGLHEVDLNSELVCVHDSAR  186

Query  916   PLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKP  1095
             PLV + DV+KV++D W+ GAAVLGVPAK+TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP
Sbjct  187   PLVSSADVKKVIEDAWINGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKP  246

Query  1096  ELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             +LLKKGFE++NR+GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  247   DLLKKGFELVNRDGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILN  303



>dbj|BAF98292.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Hevea 
brasiliensis]
Length=311

 Score =   390 bits (1003),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/227 (81%), Positives = 212/227 (93%), Gaps = 0/227 (0%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFSK+ +VKEIVVVCDP 
Sbjct  77    AVKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMIEVKEIVVVCDPS  136

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             Y D+FEDA +  +++LKFALPGKERQDSVY+G QEVDL+SEL+C+HD+ARPLV + DV+K
Sbjct  137   YQDIFEDAKENINVDLKFALPGKERQDSVYSGLQEVDLNSELVCVHDSARPLVSSADVKK  196

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             V++D W+ GAAVLGVPAK+TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP+LLKKGFE++
Sbjct  197   VIEDAWINGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELV  256

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             +R+GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  257   SRDGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILN  303



>ref|XP_006385101.1| hypothetical protein POPTR_0004s23930g [Populus trichocarpa]
 gb|ERP62898.1| hypothetical protein POPTR_0004s23930g [Populus trichocarpa]
Length=309

 Score =   390 bits (1001),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 211/227 (93%), Gaps = 0/227 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG +MPKQYLPLLGQPIALYS  TFS++ +VKEI+VVCDP Y
Sbjct  81    VKEKSVSVILLAGGQGKRMGANMPKQYLPLLGQPIALYSLYTFSEMDEVKEIIVVCDPSY  140

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED+ ++ +++LKFALPGKERQDSVY+G QEVDL+SEL+CIHD+ARPLVL+ DVEKV
Sbjct  141   KDIFEDSQEQINVDLKFALPGKERQDSVYSGLQEVDLNSELVCIHDSARPLVLSEDVEKV  200

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW+ GAAVLGVP K+TIKEA+ ESFVVRTL+RKTLWEMQTPQV+KPELLKKGFE++N
Sbjct  201   LKDGWINGAAVLGVPVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVN  260

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             REGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERIL+ 
Sbjct  261   REGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILST  307



>ref|XP_011028435.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Populus euphratica]
Length=309

 Score =   389 bits (1000),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/227 (81%), Positives = 211/227 (93%), Gaps = 0/227 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG +MPKQYLPLLGQPIALYS  TFS++ +VKEI+VVCDP Y
Sbjct  81    VKEKSVSVILLAGGQGKRMGANMPKQYLPLLGQPIALYSLYTFSEMDEVKEIIVVCDPSY  140

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED+ ++ +++LKFALPGKERQDSVY+G QEVDL+SEL+CIHD+ARPLVL+ DVEKV
Sbjct  141   KDIFEDSQEQINVDLKFALPGKERQDSVYSGLQEVDLNSELVCIHDSARPLVLSEDVEKV  200

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW+ GAAVLGVP K+TIKEA+ ESFVVRTL+RKTLWEMQTPQV+KPELLKKGFE++N
Sbjct  201   LKDGWINGAAVLGVPVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVN  260

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             REGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERIL+ 
Sbjct  261   REGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILST  307



>ref|XP_006600265.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X2 [Glycine max]
Length=310

 Score =   389 bits (999),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 236/310 (76%), Gaps = 18/310 (6%)
 Frame = +1

Query  352   MSHLQLGLPNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHP--RTGK-IVPLRSSRRSLS  522
             M  +  G P SPL         F L  + S  P     +H     GK ++ + S + + S
Sbjct  1     MVAIGFGAPPSPL--------PFHLRLASSPSPLAFPIIHKFQNAGKSVITICSKKNAKS  52

Query  523   KIT--CSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIA  696
             ++   CSA         +  +D+ ++E+SVSV+LLAGG GKRMG SMPKQYLPL GQPIA
Sbjct  53    RVVTLCSAPVQ-----EQEVSDITLRERSVSVVLLAGGQGKRMGASMPKQYLPLFGQPIA  107

Query  697   LYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVD  876
             LYSF TF  L QVKEI+VVCDP Y D+FEDA   +  ELKFALPGKERQDSVYNGFQ VD
Sbjct  108   LYSFHTFFHLVQVKEIIVVCDPSYKDIFEDAKGDYQAELKFALPGKERQDSVYNGFQAVD  167

Query  877   LSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRK  1056
              +SEL+CIHD+ARPLVL+ DV+KVLKDG L GAAVLGVP K+TIKEAN ESFVV+TL+RK
Sbjct  168   PNSELVCIHDSARPLVLSADVKKVLKDGLLNGAAVLGVPVKATIKEANRESFVVKTLDRK  227

Query  1057  TLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPD  1236
             TLWEMQTPQVIKPELL+KGFE++NREGLEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPD
Sbjct  228   TLWEMQTPQVIKPELLRKGFELVNREGLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPD  287

Query  1237  DMLLAERILN  1266
             DMLLAERILN
Sbjct  288   DMLLAERILN  297



>gb|EYU33225.1| hypothetical protein MIMGU_mgv1a010477mg [Erythranthe guttata]
Length=311

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/258 (74%), Positives = 220/258 (85%), Gaps = 8/258 (3%)
 Frame = +1

Query  499   RSSRRSLS-KITCSA-LYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYL  672
             RS R  ++ +I CSA     +G      ++  VKEKSVSVILLAGG GKRMG SMPKQY+
Sbjct  57    RSLRHPITFRINCSAEAAAADG------SEETVKEKSVSVILLAGGKGKRMGASMPKQYI  110

Query  673   PLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSV  852
             PLLGQPIALYSF TFSK+ +VKEI+VVCDP Y D+FED+    H++LKFALPGKERQDSV
Sbjct  111   PLLGQPIALYSFYTFSKMREVKEIIVVCDPSYTDIFEDSKDDIHVDLKFALPGKERQDSV  170

Query  853   YNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESF  1032
             Y+G + +D +SEL+CIHD+ARPLVL  DVEKVLKDG  +GAAVLGVPAK+TIKEAN+ESF
Sbjct  171   YSGLEAIDSNSELVCIHDSARPLVLTEDVEKVLKDGRRIGAAVLGVPAKATIKEANSESF  230

Query  1033  VVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYS  1212
             VV+TL+RK LWEMQTPQVIKPELLKKGFE +NREGLEVTDDVSIVE LKHPVYIT+GSY+
Sbjct  231   VVKTLDRKMLWEMQTPQVIKPELLKKGFEYVNREGLEVTDDVSIVEHLKHPVYITQGSYT  290

Query  1213  NIKVTTPDDMLLAERILN  1266
             NIKVTTPDD+LLAERILN
Sbjct  291   NIKVTTPDDLLLAERILN  308



>ref|XP_004499358.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Cicer arietinum]
Length=303

 Score =   385 bits (989),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/297 (66%), Positives = 227/297 (76%), Gaps = 16/297 (5%)
 Frame = +1

Query  421   LLHYSISYCPKVPSFLHPRTGKIVP------LRSSRRSLSKITCSALYGVNGDLHKRCAD  582
             ++   +  C    S   P   K+ P      +R  +  L+K   S +   N  L   C+ 
Sbjct  1     MIELQLQQCCPALSLAFPTINKVAPYTSRATIRGHKVCLNKNVLS-IPKSNSRLTTFCSA  59

Query  583   LA---------VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQV  735
             LA         VKE+SVSV+LLAGG GKRMG +MPKQYLPLLGQPIALYSF TF+++ +V
Sbjct  60    LASQESKSESPVKERSVSVVLLAGGKGKRMGANMPKQYLPLLGQPIALYSFYTFTQMLEV  119

Query  736   KEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAAR  915
             KEIVVVCDP Y DVFED      ++LKFALPGKERQDSVYNG Q VD +SEL+C+HD+AR
Sbjct  120   KEIVVVCDPSYKDVFEDVKGNSQVQLKFALPGKERQDSVYNGLQAVDSNSELVCVHDSAR  179

Query  916   PLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKP  1095
             PLVL GDV+KVLKDG L GAAVLGVP K+TIKEAN ESFVVRTL+RKTLWEMQTPQVIKP
Sbjct  180   PLVLQGDVQKVLKDGLLNGAAVLGVPVKATIKEANTESFVVRTLDRKTLWEMQTPQVIKP  239

Query  1096  ELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              LL++GFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  240   NLLREGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILN  296



>ref|XP_010088695.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Morus 
notabilis]
 gb|EXB36876.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Morus 
notabilis]
Length=292

 Score =   385 bits (988),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/226 (82%), Positives = 208/226 (92%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VK+KSVSVILLAGG GKRMG +MPKQYLPLLGQPIALYSF TFS+L +VKEIVVVCDP Y
Sbjct  59    VKKKSVSVILLAGGKGKRMGANMPKQYLPLLGQPIALYSFYTFSELDEVKEIVVVCDPSY  118

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED  +K H+ELKF LPGKERQDSV++G Q VDLSSEL+CIHD+ARPLV +G+V KV
Sbjct  119   QDIFEDTKEKIHVELKFTLPGKERQDSVFSGLQAVDLSSELVCIHDSARPLVTSGEVGKV  178

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L+DGWL GAAVLGVPAK+TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP+LLKKGFE +N
Sbjct  179   LQDGWLHGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFEFVN  238

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L HPVYITEG+Y+NIKVTTPDDMLLAERIL+
Sbjct  239   REGLEVTDDVSIVEHLGHPVYITEGAYTNIKVTTPDDMLLAERILS  284



>ref|XP_006292733.1| hypothetical protein CARUB_v10018977mg [Capsella rubella]
 gb|EOA25631.1| hypothetical protein CARUB_v10018977mg [Capsella rubella]
Length=303

 Score =   384 bits (987),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 243/311 (78%), Gaps = 17/311 (5%)
 Frame = +1

Query  352   MSHLQ--LGLPNSPLFLKTHPQ---KSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRS  516
             M+ LQ  LG   SP FL   P+   KS  +    +Y  +V      R    V    +R +
Sbjct  1     MAMLQANLGFITSPTFL--CPKLAFKSSSVSLGFTYRSQVQKLDFSRR---VDRSYNRDA  55

Query  517   LS-KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             LS  I CS+  G++       ++  VKEKSVSVILLAGG GKRM ++MPKQY+PLLGQPI
Sbjct  56    LSFSIKCSSSTGLDN------SNTIVKEKSVSVILLAGGQGKRMKMTMPKQYIPLLGQPI  109

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF TFS++P+VKEIVVVCDPF+ D+FE+  +   ++L+FALPGKERQDSVY+G QE+
Sbjct  110   ALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIEVDLRFALPGKERQDSVYSGLQEI  169

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D++SEL+CIHD+ARPLV   DVEKVLKDG+ VGAAVLGVPAK+TIKE N+ES VV+TL+R
Sbjct  170   DVNSELVCIHDSARPLVNTEDVEKVLKDGYTVGAAVLGVPAKATIKEVNSESLVVKTLDR  229

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             KTLWEMQTPQVIKPELLK+GFE++ REGLEVTDDVSIVE LKHPVY+T+GSY+NIKVTTP
Sbjct  230   KTLWEMQTPQVIKPELLKRGFELVKREGLEVTDDVSIVEYLKHPVYVTQGSYTNIKVTTP  289

Query  1234  DDMLLAERILN  1266
             DD+LLAERIL+
Sbjct  290   DDLLLAERILS  300



>gb|ACI16377.1| 4-diphosphocytidyl-methylerythritol 2-phosphate synthase [Catharanthus 
roseus]
Length=311

 Score =   382 bits (982),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/257 (76%), Positives = 225/257 (88%), Gaps = 4/257 (2%)
 Frame = +1

Query  496   LRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLP  675
             LRS + S  +ITC A+ G  G+     +D+ VKEKSVSVILLAGG GKRMG SMPKQYLP
Sbjct  55    LRSPKLSPLRITCFAVTGEPGE----SSDVVVKEKSVSVILLAGGKGKRMGASMPKQYLP  110

Query  676   LLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVY  855
             LLGQPIALYS  TFS++P+VKEIVVVCDP Y D+FED   K  ++LKFALPGKERQDSVY
Sbjct  111   LLGQPIALYSLYTFSRMPEVKEIVVVCDPSYQDIFEDTKAKIQVDLKFALPGKERQDSVY  170

Query  856   NGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFV  1035
             +G Q VDLS+EL+CIHD+ARPLVLA DVEKVLKDG  +GAAVLGVPAK+TIKEA+++SFV
Sbjct  171   SGLQAVDLSAELVCIHDSARPLVLAEDVEKVLKDGLSIGAAVLGVPAKATIKEADSKSFV  230

Query  1036  VRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSN  1215
             V+TL+RKTLWEMQTPQVIKP+LLKKGFE++NRE LEVTDDVSIVE LKHPVYITEGSY+N
Sbjct  231   VKTLDRKTLWEMQTPQVIKPDLLKKGFELVNRENLEVTDDVSIVEYLKHPVYITEGSYTN  290

Query  1216  IKVTTPDDMLLAERILN  1266
             IKVTTPDD+L+AERILN
Sbjct  291   IKVTTPDDLLVAERILN  307



>ref|XP_010502265.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Camelina sativa]
Length=315

 Score =   382 bits (981),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 234/316 (74%), Gaps = 16/316 (5%)
 Frame = +1

Query  349   TMSHLQLGLPNSPLFL----KTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPL----RS  504
              M    LG   SP FL       P    L     S      + L P    +  L    R 
Sbjct  2     AMLQANLGFITSPAFLCPKFAVKPSSVSLGFSYRSQGNLSHTLLFPNVASVQKLDLSRRV  61

Query  505   SRRSLSKIT--CSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             SRR    I+  CS+  G +       ++  VKEKSVSVILLAGG GKRM +SMPKQY+PL
Sbjct  62    SRRDAQSISIRCSSSTGFDN------SNTVVKEKSVSVILLAGGQGKRMKMSMPKQYIPL  115

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++P+VKEIVVVCDPF+ D+FE+  +   + L+FALPGKERQDSVY+
Sbjct  116   LGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESVDVNLRFALPGKERQDSVYS  175

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D++SEL+CIHD+ARPLV   DVEKVLKDG  VGAAVLGVPAK+TIKE N+ES VV
Sbjct  176   GLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGCAVGAAVLGVPAKATIKEVNSESLVV  235

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQVIKPELLK+GFE++ REGLEVTDDVSIVE LKHPVY+T+GSY+NI
Sbjct  236   KTLDRKTLWEMQTPQVIKPELLKRGFELVKREGLEVTDDVSIVEYLKHPVYVTQGSYTNI  295

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+LLAERIL+
Sbjct  296   KVTTPDDLLLAERILS  311



>ref|XP_010030242.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW57179.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=308

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 189/268 (71%), Positives = 218/268 (81%), Gaps = 15/268 (6%)
 Frame = +1

Query  466   LHPR-TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKR  642
             +HPR T KIV       S +++ CS             +   V+E SVSVILLAGG GKR
Sbjct  47    IHPRRTAKIVA------SSTRVHCSG--------KDDNSVTVVREGSVSVILLAGGKGKR  92

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+VVCDP Y D+FED  ++  ++LKF 
Sbjct  93    MGASMPKQYLPLLGQPIALYSFYTFSQMREVKEIIVVCDPSYKDIFEDTKEEIQVDLKFT  152

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q VD  SEL+CIHD+ARPLV  GD+EKVLKDGW  GAAVLGVP K+
Sbjct  153   LPGKERQDSVYSGLQAVDSGSELVCIHDSARPLVSRGDIEKVLKDGWENGAAVLGVPVKA  212

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP LLK+GFE++NREGLEVTDDVSIVE L+H
Sbjct  213   TIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNREGLEVTDDVSIVEHLRH  272

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVY+TEGSY+NIKVTTPDD+LLAERILN
Sbjct  273   PVYVTEGSYTNIKVTTPDDLLLAERILN  300



>gb|AEM42975.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Siraitia 
grosvenorii]
Length=303

 Score =   382 bits (980),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIA+YS  TFS+L +VKEI+VVCDP Y
Sbjct  75    VKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIAMYSLYTFSRLVEVKEIIVVCDPSY  134

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FEDA +K  IELKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLVLA D++KV
Sbjct  135   QDIFEDAKEKIDIELKFTLPGKERQDSVYSGLQAIDLNSELVCIHDSARPLVLAEDIKKV  194

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKD  L GAAVLGVP K+TIKEANN+ FV RTL+RKTLWEMQTPQVIKPELL+KGFE++N
Sbjct  195   LKDARLNGAAVLGVPVKATIKEANNDRFVQRTLDRKTLWEMQTPQVIKPELLRKGFELVN  254

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L+HPV+ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  255   REGLEVTDDVSIVEYLEHPVFITEGSYTNIKVTTPDDLLLAERILN  300



>gb|AFK34060.1| unknown [Lotus japonicus]
Length=314

 Score =   382 bits (981),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/226 (81%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VK+ SVSV+LLAGG GKRMG SMPKQYLPLLGQPIALYSF TF  + QVKE++VVCDP Y
Sbjct  82    VKDNSVSVVLLAGGKGKRMGASMPKQYLPLLGQPIALYSFFTFCHMLQVKEVIVVCDPSY  141

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+F+DA   +  ELKFALPGKERQDSVYNG Q VD +SEL+CIHD+ARPLVL+GDV+KV
Sbjct  142   QDIFQDAKGNYQAELKFALPGKERQDSVYNGLQAVDSNSELVCIHDSARPLVLSGDVKKV  201

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKPELL+KGFE++N
Sbjct  202   LKDGLLNGAAVLGVPVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVN  261

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVYITEGSYSNIKVTTPDD+LLAE+IL+
Sbjct  262   REGLEVTDDVSIVEHLKHPVYITEGSYSNIKVTTPDDLLLAEKILH  307



>gb|ABB88837.2| 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase [Stevia rebaudiana]
Length=317

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/286 (68%), Positives = 225/286 (79%), Gaps = 16/286 (6%)
 Frame = +1

Query  442   YCPKVPSFLHPRTGKIVPLRSSRRSLSK---------ITCSALYGVNGDLHKRCADLA--  588
             Y P V  + HPR         S  +L +         +TCSA      D  K   +    
Sbjct  30    YLPAVDLYRHPRLSSCYSSSKSNFNLVRKHSICSGFTVTCSA-----NDSAKTTNEKPEY  84

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V+EKSVSV+LLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP Y
Sbjct  85    VREKSVSVVLLAGGQGKRMGASMPKQYLPLLGQPIALYSFYTFSRMREVKEIVVVCDPSY  144

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FEDA     ++LKFALPGKERQDSV++G Q +DL+SEL+CIHD+ARPLV +GDV KV
Sbjct  145   QDIFEDARDNISVDLKFALPGKERQDSVFSGLQSIDLASELVCIHDSARPLVTSGDVLKV  204

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L DG  VGA+VLGVPAK+TIKE N+ESFVV+TL+RKTLWEMQTPQVIKP+LLKKGFE++N
Sbjct  205   LNDGLRVGASVLGVPAKATIKEGNSESFVVKTLDRKTLWEMQTPQVIKPDLLKKGFELVN  264

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPDD+LLAERILN
Sbjct  265   REGLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPDDLLLAERILN  310



>gb|AFM93780.1| plastid 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Picrorhiza kurrooa]
Length=311

 Score =   382 bits (980),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 247/319 (77%), Gaps = 25/319 (8%)
 Frame = +1

Query  352   MSHLQLG--LPNS--PLFLKTHPQKSFLLHYSISYCP---------KVPSFLHPRTGKIV  492
             M  +QLG  LP S  PLFL+T+  K     + I  C          K  SF    T KI 
Sbjct  1     MPTIQLGASLPTSSFPLFLETNSIK-----FPIKLCSLFSLNPNSYKNYSFNAKYTHKIS  55

Query  493   PLRSSRRSLSK-ITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQY  669
               ++ R   ++ ITCSA      D   + +++ VKEKSVSV+LLAGG GKRMG SMPKQY
Sbjct  56    SFKNPRFFHARNITCSA------DAAAQGSEVVVKEKSVSVVLLAGGKGKRMGASMPKQY  109

Query  670   LPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDS  849
             LPLLGQPIALYSF TFSK+P+VKEIVVVCDP Y D+FEDA     ++LKFALPGKERQDS
Sbjct  110   LPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDAKDNIQVDLKFALPGKERQDS  169

Query  850   VYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNES  1029
             VY+G + +D +SEL+C+HD+ARPLVL  DV KVLKDGWL+GAAV+GVPAK+TIKEAN ES
Sbjct  170   VYSGLEAIDSNSELVCVHDSARPLVLTEDVAKVLKDGWLIGAAVVGVPAKATIKEANTES  229

Query  1030  FVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSY  1209
             FVV+TL+RKTLWEMQTPQVIKP+LLKKGFE +NREGLEVTDDVSIVE LKHPVYITEGSY
Sbjct  230   FVVKTLDRKTLWEMQTPQVIKPDLLKKGFEHVNREGLEVTDDVSIVEHLKHPVYITEGSY  289

Query  1210  SNIKVTTPDDMLLAERILN  1266
             +NI+VTTPDD+LLAERILN
Sbjct  290   TNIEVTTPDDLLLAERILN  308



>ref|XP_010907549.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=316

 Score =   381 bits (979),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 207/229 (90%), Gaps = 0/229 (0%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKEKSVSV+LLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP 
Sbjct  83    AVKEKSVSVVLLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSQISEVKEIVVVCDPS  142

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             Y DVFE A ++  + +KFALPGKERQDSV+NGFQE++ SSEL+CIHD+ARPLV +GD++K
Sbjct  143   YKDVFEGASEEIQVGIKFALPGKERQDSVFNGFQEIEGSSELVCIHDSARPLVTSGDIKK  202

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VLKD WL GAAVLGVP K+TIKEAN++SFVV+TL+RKTLWEM TPQVIKP LL+ GFE++
Sbjct  203   VLKDAWLNGAAVLGVPVKATIKEANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFELV  262

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             NR GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN R
Sbjct  263   NRNGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILNMR  311



>ref|XP_009341250.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Pyrus x bretschneideri]
Length=325

 Score =   382 bits (980),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 182/226 (81%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+VVCDP Y
Sbjct  91    VKEKSVSVILLAGGQGKRMGASMPKQYLPLLGQPIALYSFYTFSQMIEVKEIIVVCDPSY  150

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              DVFEDA  K   ELKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLV +GDV KV
Sbjct  151   KDVFEDAKHKIQKELKFTLPGKERQDSVYSGLQAIDLTSELVCIHDSARPLVSSGDVAKV  210

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEAN+ESFVV+TL+R+TLWEMQTPQVIKP+LL++GFE++N
Sbjct  211   LKDGCLNGAAVLGVPVKATIKEANSESFVVKTLDRRTLWEMQTPQVIKPQLLREGFELVN  270

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVYI+EGSY+NIKVTTPDD+LLAERIL+
Sbjct  271   REGLEVTDDVSIVEHLKHPVYISEGSYTNIKVTTPDDLLLAERILS  316



>ref|XP_009355454.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Pyrus x bretschneideri]
Length=320

 Score =   381 bits (978),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 194/268 (72%), Positives = 222/268 (83%), Gaps = 10/268 (4%)
 Frame = +1

Query  460   SFLHPRTGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGK  639
             SF H    K  P R     ++  TC +   VN D  K  + L VKEKSVSVILLAGG GK
Sbjct  53    SFRH--KAKAPPTR-----IATFTCFSAR-VNAD--KPESRLIVKEKSVSVILLAGGQGK  102

Query  640   RMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKF  819
             RMG SMPKQYLPLLGQPIALYSF TFS++ +V+EI+VVCDP Y DVFEDA  K   ELKF
Sbjct  103   RMGASMPKQYLPLLGQPIALYSFYTFSQMIEVREIIVVCDPSYKDVFEDAKPKIQKELKF  162

Query  820   ALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAK  999
              LPGKERQDSVYNG Q +DL+SEL+CIHD+ARPL+ +GDVEKVLKDG L GAAVLGVP K
Sbjct  163   TLPGKERQDSVYNGLQAIDLTSELVCIHDSARPLLSSGDVEKVLKDGCLNGAAVLGVPVK  222

Query  1000  STIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLK  1179
             +TIKEAN ES+VV+TL+R+TLWEMQTPQVIKP+LLK+GFE++NREGLEVTDDVSIVE L+
Sbjct  223   ATIKEANTESYVVKTLDRRTLWEMQTPQVIKPQLLKEGFELVNREGLEVTDDVSIVEHLQ  282

Query  1180  HPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             HPVYITEGSY+NIKVTTPDD+LLAER+L
Sbjct  283   HPVYITEGSYTNIKVTTPDDLLLAERML  310



>ref|XP_008218628.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Prunus mume]
Length=305

 Score =   380 bits (976),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/258 (71%), Positives = 213/258 (83%), Gaps = 0/258 (0%)
 Frame = +1

Query  493   PLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYL  672
             P     ++ ++I  S     +  +  +     VKE SVSVILLAGG GKRMG SMPKQYL
Sbjct  40    PFNFRLKAEARIASSTFTTCSAKVVNKPESKIVKENSVSVILLAGGKGKRMGASMPKQYL  99

Query  673   PLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSV  852
             PLL QPIALYSF TFS++ +VKEI+VVCDP Y D+FE+   K   ELKF LPGKERQDSV
Sbjct  100   PLLSQPIALYSFYTFSQMTEVKEIIVVCDPSYKDIFEETKHKIQKELKFTLPGKERQDSV  159

Query  853   YNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESF  1032
             Y+G Q +DLSSEL+CIHD+ARPLV +GDVEKVLKD WL GAAVLGVP K+TIKEAN+ESF
Sbjct  160   YSGLQAIDLSSELVCIHDSARPLVSSGDVEKVLKDAWLNGAAVLGVPVKATIKEANSESF  219

Query  1033  VVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYS  1212
             VV+TL+R+TLWEMQTPQVIKP+LL+KGFE++NREGLEVTDDVSIVE L HPVYITEGSY+
Sbjct  220   VVKTLDRRTLWEMQTPQVIKPQLLRKGFELVNREGLEVTDDVSIVEHLPHPVYITEGSYT  279

Query  1213  NIKVTTPDDMLLAERILN  1266
             NIKVTTPDD+LLAERIL+
Sbjct  280   NIKVTTPDDLLLAERILS  297



>ref|XP_011087604.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Sesamum indicum]
Length=311

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 202/292 (69%), Positives = 233/292 (80%), Gaps = 20/292 (7%)
 Frame = +1

Query  391   FLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRSLSKITCSALYGVNGDLHK  570
             F  + P K      S+ Y  K  S  +PR             L +I+CSA   V      
Sbjct  37    FRPSLPNKFKNCCVSVRYSEKFRSLENPR-------------LFRISCSAEGAVG-----  78

Query  571   RCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVV  750
               +++ VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFSK+P+VKEIVV
Sbjct  79    --SEVVVKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMPEVKEIVV  136

Query  751   VCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLA  930
             VCDP Y D+FEDA +  HI++KFALPGKERQDSVY+G + +D  SEL+CIHD+ARPLVLA
Sbjct  137   VCDPSYQDIFEDAKENIHIDMKFALPGKERQDSVYSGLEAIDSDSELVCIHDSARPLVLA  196

Query  931   GDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKK  1110
             GDV KVLKDG  VGAAVLGVPAK+TIKEAN++SFVV+TL+RKTLWEMQTPQVI+P+LLKK
Sbjct  197   GDVAKVLKDGQRVGAAVLGVPAKATIKEANSDSFVVKTLDRKTLWEMQTPQVIRPDLLKK  256

Query  1111  GFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             GFE++NREGLEVTDDVSIVE L+HPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  257   GFELVNREGLEVTDDVSIVEHLRHPVYITEGSYTNIKVTTPDDLLLAERILN  308



>ref|XP_008218627.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Prunus mume]
Length=307

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 187/246 (76%), Positives = 211/246 (86%), Gaps = 4/246 (2%)
 Frame = +1

Query  529   TCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSF  708
             TCSA   VN D   +     VKE SVSVILLAGG GKRMG SMPKQYLPLL QPIALYSF
Sbjct  58    TCSAKV-VNVD---KPESKIVKENSVSVILLAGGKGKRMGASMPKQYLPLLSQPIALYSF  113

Query  709   DTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSE  888
              TFS++ +VKEI+VVCDP Y D+FE+   K   ELKF LPGKERQDSVY+G Q +DLSSE
Sbjct  114   YTFSQMTEVKEIIVVCDPSYKDIFEETKHKIQKELKFTLPGKERQDSVYSGLQAIDLSSE  173

Query  889   LICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWE  1068
             L+CIHD+ARPLV +GDVEKVLKD WL GAAVLGVP K+TIKEAN+ESFVV+TL+R+TLWE
Sbjct  174   LVCIHDSARPLVSSGDVEKVLKDAWLNGAAVLGVPVKATIKEANSESFVVKTLDRRTLWE  233

Query  1069  MQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLL  1248
             MQTPQVIKP+LL+KGFE++NREGLEVTDDVSIVE L HPVYITEGSY+NIKVTTPDD+LL
Sbjct  234   MQTPQVIKPQLLRKGFELVNREGLEVTDDVSIVEHLPHPVYITEGSYTNIKVTTPDDLLL  293

Query  1249  AERILN  1266
             AERIL+
Sbjct  294   AERILS  299



>ref|XP_010425029.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Camelina sativa]
Length=315

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 234/311 (75%), Gaps = 6/311 (2%)
 Frame = +1

Query  352   MSHLQ--LGLPNSP-LFLKTHPQKSFLLHYSISYCPK---VPSFLHPRTGKIVPLRSSRR  513
             M+ LQ  LG   SP  F      KS  +    SY  +     + L      +  L  SRR
Sbjct  1     MAMLQASLGFITSPTFFCPKFAVKSSSVSLGFSYRSQGNLSHTLLFSNVASVQKLDLSRR  60

Query  514   SLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
                +   S     +       ++  VKEKSVSVILLAGG GKRM +SMPKQY+PLLGQPI
Sbjct  61    VSRRYAQSFAIKCSSSTEFDNSNTVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPI  120

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF TFS++P+VKEIVVVCDPF+ D+FE+  +   ++L+FALPGKERQDSVY+G QE+
Sbjct  121   ALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIEVDLRFALPGKERQDSVYSGLQEI  180

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D++SEL+CIHD+ARPLV   DVEKVLKDG  VGAAVLGVPAK+TIKE N+ES VV+TL+R
Sbjct  181   DVNSELVCIHDSARPLVNTEDVEKVLKDGCAVGAAVLGVPAKATIKEVNSESLVVKTLDR  240

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             KTLWEMQTPQVIKPELLK+GFE++ R+GLEVTDDVSIVE LKHPVY+T+GSY+NIKVTTP
Sbjct  241   KTLWEMQTPQVIKPELLKRGFELVKRQGLEVTDDVSIVEYLKHPVYVTQGSYTNIKVTTP  300

Query  1234  DDMLLAERILN  1266
             DD+LLAERIL+
Sbjct  301   DDLLLAERILS  311



>ref|XP_010514024.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Camelina sativa]
Length=309

 Score =   380 bits (975),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 218/258 (84%), Gaps = 8/258 (3%)
 Frame = +1

Query  499   RSSRRSLSK--ITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYL  672
             R SRR      I CS+    +       ++  VKEKSVSVILLAGG GKRM +SMPKQY+
Sbjct  54    RFSRRDAQSFSIKCSSSTEFDN------SNTVVKEKSVSVILLAGGQGKRMKMSMPKQYI  107

Query  673   PLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSV  852
             PLLGQPIALYSF TFS++P+VKEIVVVCDPF+ D+FE+  +   ++L+FALPGKERQDSV
Sbjct  108   PLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIEVDLRFALPGKERQDSV  167

Query  853   YNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESF  1032
             Y+G QE+D++SEL+CIHD+ARPLV   DVEKVLKDG  VGAAVLGVPAK+TIKE N+ES 
Sbjct  168   YSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGCAVGAAVLGVPAKATIKEVNSESL  227

Query  1033  VVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYS  1212
             VV+TL+RKTLWEMQTPQVIKPELLK+GFE++ REGLEVTDDVSIVE LKHPVY+T+GSY+
Sbjct  228   VVKTLDRKTLWEMQTPQVIKPELLKRGFELVKREGLEVTDDVSIVEYLKHPVYVTQGSYT  287

Query  1213  NIKVTTPDDMLLAERILN  1266
             NIKVTTPDD+LLAERIL+
Sbjct  288   NIKVTTPDDLLLAERILS  305



>gb|AFI71456.1| 2-C-methyl-D-erythritol 4-phosphatecytidyltransferase [Rauvolfia 
verticillata]
 gb|AFO10121.1| chloroplast 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Rauvolfia verticillata]
Length=314

 Score =   379 bits (974),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 196/263 (75%), Positives = 223/263 (85%), Gaps = 5/263 (2%)
 Frame = +1

Query  478   TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSM  657
             T K    RS   SL ++TCSA+ G       +  D+ VKEKSVSVILLAGG GKRMG SM
Sbjct  50    TEKSNSFRSPELSLLRVTCSAVPG-----ESKSPDVVVKEKSVSVILLAGGKGKRMGASM  104

Query  658   PKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKE  837
             PKQYLPLLGQPIALYSF TF+++ +VKEIVVVCDP Y D+FE A +K  ++LKFALPGKE
Sbjct  105   PKQYLPLLGQPIALYSFYTFARMLEVKEIVVVCDPSYQDIFEGAKEKIEVDLKFALPGKE  164

Query  838   RQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEA  1017
             RQDSVY+G Q VDLS+EL+CIHD ARPLVLA D EKVLKDG L+GAAVLGVPAK+TIKEA
Sbjct  165   RQDSVYSGVQAVDLSAELVCIHDTARPLVLAEDAEKVLKDGLLIGAAVLGVPAKATIKEA  224

Query  1018  NNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYIT  1197
             +++ FVVRTL+RK LWEMQTPQVIKP+LLKKGFE++NRE LEVTDDVSIVE LKHPVYIT
Sbjct  225   DSKFFVVRTLDRKKLWEMQTPQVIKPDLLKKGFELVNRENLEVTDDVSIVEHLKHPVYIT  284

Query  1198  EGSYSNIKVTTPDDMLLAERILN  1266
             EGSY+NIKVTTPDD+LLAERILN
Sbjct  285   EGSYTNIKVTTPDDLLLAERILN  307



>gb|AEZ55666.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Salvia 
miltiorrhiza]
Length=304

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/261 (76%), Positives = 224/261 (86%), Gaps = 10/261 (4%)
 Frame = +1

Query  484   KIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPK  663
             KI  L++ R   S+I+CSA  G +         + VKEKSVSVILLAGG GKRMG SMPK
Sbjct  51    KIDSLKNPR--FSRISCSA-GGTD-------TQVVVKEKSVSVILLAGGKGKRMGASMPK  100

Query  664   QYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQ  843
             QYLPLLGQPIALYSF TFSK+P+VKEI+VVCDP Y D+FEDA    HI+LKFALPGKERQ
Sbjct  101   QYLPLLGQPIALYSFYTFSKMPEVKEIIVVCDPSYQDIFEDARDNIHIDLKFALPGKERQ  160

Query  844   DSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANN  1023
             DSVY+G +E+DL SEL+CIHD+ARPLVL  DV KVLKDG  +GAAVLGVPAK+TIKEAN+
Sbjct  161   DSVYSGLEEIDLDSELVCIHDSARPLVLTSDVTKVLKDGKRIGAAVLGVPAKATIKEANS  220

Query  1024  ESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEG  1203
             ESFVV+TL+RKTLWEMQTPQVI+P+LLKKGFE +NREGLEVTDDVSIVE LKHPVYITEG
Sbjct  221   ESFVVKTLDRKTLWEMQTPQVIEPDLLKKGFEYVNREGLEVTDDVSIVEHLKHPVYITEG  280

Query  1204  SYSNIKVTTPDDMLLAERILN  1266
             SY+NIKVTTPDD+LLAERILN
Sbjct  281   SYTNIKVTTPDDLLLAERILN  301



>ref|XP_002876821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53080.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/311 (65%), Positives = 241/311 (77%), Gaps = 20/311 (6%)
 Frame = +1

Query  352   MSHLQLGLPNSPLFLKTHPQ---KSFLLHYSISYCPKVP--SFLHPRTGKIVPLRSSRRS  516
             M+ LQ  L  SP FL   P+   KS  +    SY  +V    FL     K V  R  R  
Sbjct  1     MAMLQANL-TSPTFL--CPKLVVKSISVSLGFSYRSQVQKLDFL-----KRVNRRYKRDG  52

Query  517   LS-KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             L   I CS+  G +       ++  VKEKSVSVILLAGG GKRM +SMPKQY+PLLGQPI
Sbjct  53    LLLSIKCSSSTGFDN------SNAVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPI  106

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF TFS++P+VKEIVVVCDPF+ D+FE+  +   ++L+FA+PGKERQDSVY+G QEV
Sbjct  107   ALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIDVDLRFAIPGKERQDSVYSGLQEV  166

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D++SEL+CIHD+ARPLV + DVEKVLKDG  VGAAVLGVPAK+TIKE N+ES VV+TL+R
Sbjct  167   DVNSELVCIHDSARPLVNSEDVEKVLKDGSAVGAAVLGVPAKATIKEVNSESLVVKTLDR  226

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             KTLWEMQTPQVIKPELLK+GFE++ REGLEVTDDVSIVE LKHPV++T+GSY+NIKVTTP
Sbjct  227   KTLWEMQTPQVIKPELLKRGFELVKREGLEVTDDVSIVEYLKHPVFVTQGSYTNIKVTTP  286

Query  1234  DDMLLAERILN  1266
             DD+LLAERIL+
Sbjct  287   DDLLLAERILS  297



>ref|XP_008452188.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Cucumis melo]
Length=254

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKE+SVSVILLAGG GKRMG SMPKQYLPLLGQPIALYS  TFS+L +VKEI+VVCDP Y
Sbjct  26    VKERSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRLIEVKEIIVVCDPSY  85

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED  +K  I+LKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPL+LAGD+++V
Sbjct  86    QDIFEDTKEKIDIQLKFTLPGKERQDSVYSGLQAIDLNSELVCIHDSARPLILAGDIQQV  145

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEANN+ FV +TL+RKTLWEMQTPQVI+PELL+KGFE++N
Sbjct  146   LKDGRLNGAAVLGVPVKATIKEANNDRFVQKTLDRKTLWEMQTPQVIEPELLRKGFELVN  205

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L+HPV+ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  206   REGLEVTDDVSIVEHLRHPVFITEGSYTNIKVTTPDDLLLAERILN  251



>ref|XP_011087603.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Sesamum indicum]
Length=313

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 202/218 (93%), Gaps = 0/218 (0%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             ILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFSK+P+VKEIVVVCDP Y D+FEDA 
Sbjct  93    ILLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDAK  152

Query  793   KKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVG  972
             +  HI++KFALPGKERQDSVY+G + +D  SEL+CIHD+ARPLVLAGDV KVLKDG  VG
Sbjct  153   ENIHIDMKFALPGKERQDSVYSGLEAIDSDSELVCIHDSARPLVLAGDVAKVLKDGQRVG  212

Query  973   AAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTD  1152
             AAVLGVPAK+TIKEAN++SFVV+TL+RKTLWEMQTPQVI+P+LLKKGFE++NREGLEVTD
Sbjct  213   AAVLGVPAKATIKEANSDSFVVKTLDRKTLWEMQTPQVIRPDLLKKGFELVNREGLEVTD  272

Query  1153  DVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             DVSIVE L+HPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  273   DVSIVEHLRHPVYITEGSYTNIKVTTPDDLLLAERILN  310



>gb|EPS72731.1| 4-diphosphocytidyl-methylerythritol 2-phosphate synthase, partial 
[Genlisea aurea]
Length=236

 Score =   375 bits (963),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 203/230 (88%), Gaps = 0/230 (0%)
 Frame = +1

Query  577   ADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC  756
              D+ +KE+SVSVILLAGG GKRMG SMPKQY+PLLGQPIALYSF TF  L +VKEIVVVC
Sbjct  3     TDVGLKERSVSVILLAGGKGKRMGASMPKQYIPLLGQPIALYSFYTFGSLSEVKEIVVVC  62

Query  757   DPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             DP Y D+FED       ++KFALPGKERQDSVYNG +E+  SSEL+CIHD+ARPLVL  D
Sbjct  63    DPSYRDIFEDVKDSIQADVKFALPGKERQDSVYNGLKEIASSSELVCIHDSARPLVLVQD  122

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             + KVL DGW +GAAVLGVPAK+TIKEA+++SFVV+TL+RKTLWEMQTPQVIKP+LL +GF
Sbjct  123   IAKVLNDGWRIGAAVLGVPAKATIKEADSDSFVVKTLDRKTLWEMQTPQVIKPQLLNEGF  182

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             E++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  183   ELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILN  232



>ref|XP_008339487.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Malus domestica]
Length=320

 Score =   377 bits (969),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 203/226 (90%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG S PKQYLPL GQPIALYSF TFS++ +VKEI+VVCDP Y
Sbjct  89    VKEKSVSVILLAGGQGKRMGASXPKQYLPLXGQPIALYSFYTFSQMIEVKEIIVVCDPSY  148

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              DVFEDA  K   ELKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLV +GD  KV
Sbjct  149   KDVFEDAKHKIQKELKFTLPGKERQDSVYSGLQAIDLTSELVCIHDSARPLVASGDXAKV  208

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEAN+ESFVV+TL+R+TLWEMQTPQVIKP+LL++GFE++N
Sbjct  209   LKDGCLNGAAVLGVPVKATIKEANSESFVVKTLDRRTLWEMQTPQVIKPZLLREGFELVN  268

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPDD+LLAERIL+
Sbjct  269   REGLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPDDLLLAERILS  314



>ref|XP_010523431.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=304

 Score =   377 bits (967),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 203/218 (93%), Gaps = 0/218 (0%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             ILLAGG GKRMG+S+PKQYLPLLGQPIA+YSF TFS++ +VKEIVVVCDPFY DVFEDA 
Sbjct  84    ILLAGGQGKRMGMSIPKQYLPLLGQPIAVYSFFTFSRMNEVKEIVVVCDPFYRDVFEDAQ  143

Query  793   KKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVG  972
             +   I+LKFALPGKERQDSVYNG QEVDL+SEL+CIHD+ARPLV   DVEKVLKDG +VG
Sbjct  144   ELVDIDLKFALPGKERQDSVYNGLQEVDLNSELVCIHDSARPLVTTEDVEKVLKDGSVVG  203

Query  973   AAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTD  1152
             AAVLGVPAK+TIKEAN+ESFVV+TL+RKTLWEMQTPQVIKPELLK+GFE++N+E LEVTD
Sbjct  204   AAVLGVPAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKRGFELVNKEALEVTD  263

Query  1153  DVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             DVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERIL+
Sbjct  264   DVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILS  301



>ref|XP_004133739.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Cucumis sativus]
 gb|KGN56290.1| hypothetical protein Csa_3G113320 [Cucumis sativus]
Length=304

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKE+SVSVILLAGG GKRMG SMPKQYLPLLGQPIALYS  TFS++ +VKEI+VVCDP Y
Sbjct  76    VKERSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRMIEVKEIIVVCDPSY  135

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FEDA +K  I+LKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLVLAGD+++V
Sbjct  136   QDIFEDAKEKIDIQLKFTLPGKERQDSVYSGLQAIDLNSELVCIHDSARPLVLAGDIQQV  195

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEAN++ FV +TL+RKTLWEMQTPQVI+PELL+KGFE++N
Sbjct  196   LKDGRLNGAAVLGVPVKATIKEANDDRFVQKTLDRKTLWEMQTPQVIEPELLRKGFELVN  255

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L+HPV+ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  256   REGLEVTDDVSIVEHLRHPVFITEGSYTNIKVTTPDDLLLAERILN  301



>ref|XP_008452187.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Cucumis melo]
Length=304

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKE+SVSVILLAGG GKRMG SMPKQYLPLLGQPIALYS  TFS+L +VKEI+VVCDP Y
Sbjct  76    VKERSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRLIEVKEIIVVCDPSY  135

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED  +K  I+LKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPL+LAGD+++V
Sbjct  136   QDIFEDTKEKIDIQLKFTLPGKERQDSVYSGLQAIDLNSELVCIHDSARPLILAGDIQQV  195

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEANN+ FV +TL+RKTLWEMQTPQVI+PELL+KGFE++N
Sbjct  196   LKDGRLNGAAVLGVPVKATIKEANNDRFVQKTLDRKTLWEMQTPQVIEPELLRKGFELVN  255

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L+HPV+ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  256   REGLEVTDDVSIVEHLRHPVFITEGSYTNIKVTTPDDLLLAERILN  301



>ref|XP_004155221.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Cucumis sativus]
Length=304

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 207/226 (92%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKE+SVSVILLAGG GKRMG SMPKQYLPLLGQPIALYS  TFS+L +VKEI+VVCDP Y
Sbjct  76    VKERSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRLIEVKEIIVVCDPSY  135

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FEDA +K  I+L+F LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLVLAGD+++V
Sbjct  136   QDIFEDAKEKIDIQLQFTLPGKERQDSVYSGLQAIDLNSELVCIHDSARPLVLAGDIQQV  195

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDG L GAAVLGVP K+TIKEAN++ FV +TL+RKTLWEMQTPQVI+PELL+KGFE++N
Sbjct  196   LKDGRLNGAAVLGVPVKATIKEANDDRFVQKTLDRKTLWEMQTPQVIEPELLRKGFELVN  255

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE L+HPV+ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  256   REGLEVTDDVSIVEHLRHPVFITEGSYTNIKVTTPDDLLLAERILN  301



>ref|XP_008379014.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Malus domestica]
Length=341

 Score =   376 bits (965),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 193/268 (72%), Positives = 220/268 (82%), Gaps = 10/268 (4%)
 Frame = +1

Query  460   SFLHPRTGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGK  639
             SF H    K  P R     ++  TC +   VN D  K  + L VKEKSVSVILLAGG GK
Sbjct  74    SFRH--KAKAPPTR-----IATFTCFSAR-VNAD--KPESRLIVKEKSVSVILLAGGQGK  123

Query  640   RMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKF  819
             RMG SMPKQYLPLLGQPIALYSF TFS+  +VKEI+VVCDP   DVFEDA  K   ELKF
Sbjct  124   RMGASMPKQYLPLLGQPIALYSFYTFSQXIEVKEIIVVCDPSXKDVFEDAKPKIQKELKF  183

Query  820   ALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAK  999
              LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLV +GDVEKVLKDG L GAAVLGVP K
Sbjct  184   TLPGKERQDSVYSGLQAIDLTSELVCIHDSARPLVSSGDVEKVLKDGCLNGAAVLGVPVK  243

Query  1000  STIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLK  1179
             +TIKEAN+ES+VV+TL+R+TLWEMQTPQVIK +LLK+GFE++NREGLEVTDDVSIVE L+
Sbjct  244   ATIKEANSESYVVKTLDRRTLWEMQTPQVIKTQLLKEGFELVNREGLEVTDDVSIVEHLQ  303

Query  1180  HPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             HPVYITEGSY+NIKVTTPDD+LLAER+L
Sbjct  304   HPVYITEGSYTNIKVTTPDDLLLAERML  331



>ref|XP_004300034.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=303

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             ILLAGG G RMG SMPKQYLPLL QPIALYSF TFS++PQVKEI+VVCDP Y DVFEDA 
Sbjct  78    ILLAGGKGTRMGASMPKQYLPLLSQPIALYSFYTFSRMPQVKEIIVVCDPSYRDVFEDAK  137

Query  793   KKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVG  972
              K    LKF LPGKERQDSVY+G Q +DL+SEL+CIHD+ARPLV + +VEKVLKDGWL G
Sbjct  138   YKIQTALKFTLPGKERQDSVYSGLQAIDLTSELVCIHDSARPLVSSENVEKVLKDGWLNG  197

Query  973   AAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTD  1152
             AAVLGVP K+TIKEANNESFVVRTL+R+TLWEMQTPQVIKPELLKKGFE++NREGLEVTD
Sbjct  198   AAVLGVPVKATIKEANNESFVVRTLDRRTLWEMQTPQVIKPELLKKGFELVNREGLEVTD  257

Query  1153  DVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             DVSIVE L HPVYITEGSY+NIKVTTPDD+LLAERIL+
Sbjct  258   DVSIVEHLPHPVYITEGSYTNIKVTTPDDLLLAERILS  295



>ref|XP_010252286.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Nelumbo nucifera]
Length=309

 Score =   374 bits (961),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 182/260 (70%), Positives = 220/260 (85%), Gaps = 6/260 (2%)
 Frame = +1

Query  490   VPLRSSRRSLS-KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQ  666
             +P R +R   + +I+C   Y   G+  +   +  VK++S+SV+LLAGG GKRMG SMPKQ
Sbjct  48    IPGRRTRFGRNVRISC---YAKTGEAIQNSEN--VKDRSISVVLLAGGKGKRMGASMPKQ  102

Query  667   YLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQD  846
             YLPLLGQPIALYSF TFS++ +VKEIVVVCDP Y D+FED   K  ++LKFALPGKERQD
Sbjct  103   YLPLLGQPIALYSFYTFSRMMEVKEIVVVCDPSYRDIFEDTKDKIAVDLKFALPGKERQD  162

Query  847   SVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNE  1026
             SV++G Q VD+ SEL+CIHD+ARPLV + DV+KV+ DGWL GAAVLGVP K+TIKEAN+E
Sbjct  163   SVFSGLQAVDVQSELVCIHDSARPLVSSRDVKKVINDGWLNGAAVLGVPVKATIKEANSE  222

Query  1027  SFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGS  1206
             SFVVRTL+RKTLWEMQTPQVIKP LL++GFE++N++GLEVTDDVSIVE LKHPVYITEGS
Sbjct  223   SFVVRTLDRKTLWEMQTPQVIKPSLLREGFELVNKKGLEVTDDVSIVEHLKHPVYITEGS  282

Query  1207  YSNIKVTTPDDMLLAERILN  1266
             Y+NIKVTTPDD+LLAERIL+
Sbjct  283   YTNIKVTTPDDLLLAERILS  302



>ref|XP_006470808.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Citrus sinensis]
Length=294

 Score =   374 bits (959),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 223/256 (87%), Gaps = 8/256 (3%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +R + S+I CSA    NG +        VK+KSVSVILLAGG GKRMG +MPKQYLPL
Sbjct  41    RKARLATSRIRCSAKVD-NGSV-------VVKDKSVSVILLAGGKGKRMGANMPKQYLPL  92

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++ +VKEIVVVCDP Y+D+FE+  +K +++LKF+LPGKERQDSVY+
Sbjct  93    LGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYS  152

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QEVD +SEL+CIHD+ARPLVL+ DV+KVL D   VGAAVLGVPAK+TIKEAN+ESFVV
Sbjct  153   GLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEANSESFVV  212

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             RTL+RKTLWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  213   RTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNI  272

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+L+AERILN
Sbjct  273   KVTTPDDLLIAERILN  288



>ref|XP_006431390.1| hypothetical protein CICLE_v10002035mg [Citrus clementina]
 gb|ESR44630.1| hypothetical protein CICLE_v10002035mg [Citrus clementina]
 gb|KDO41348.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=294

 Score =   374 bits (959),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 191/256 (75%), Positives = 223/256 (87%), Gaps = 8/256 (3%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +R + S+I CSA    NG +        VK+KSVSVILLAGG GKRMG +MPKQYLPL
Sbjct  41    RRARLATSRIRCSAKVD-NGSV-------VVKDKSVSVILLAGGRGKRMGANMPKQYLPL  92

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++ +VKEIVVVCDP Y+D+FE+  +K +++LKF+LPGKERQDSVY+
Sbjct  93    LGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYS  152

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QEVD +SEL+CIHD+ARPLVL+ DV+KVL D   VGAAVLGVPAK+TIKEAN+ESFVV
Sbjct  153   GLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEANSESFVV  212

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             RTL+RKTLWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  213   RTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNI  272

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+L+AERILN
Sbjct  273   KVTTPDDLLIAERILN  288



>ref|XP_009129141.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Brassica rapa]
 ref|XP_009129142.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Brassica rapa]
Length=310

 Score =   374 bits (960),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 217/262 (83%), Gaps = 9/262 (3%)
 Frame = +1

Query  508   RRSLSKITCSALYGVNGDLHK-RCADL--------AVKEKSVSVILLAGGMGKRMGVSMP  660
             R   SK   S  Y  +  +H  RC+           VKEKSVSVILLAGG GKRM +++P
Sbjct  46    RLDFSKRVSSRSYRRDALIHSVRCSSSSESDNSNAVVKEKSVSVILLAGGQGKRMKMTIP  105

Query  661   KQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKER  840
             KQY+PLLGQPIALYSF TFS++P+VKEIVVVCDPF+ D+FE+      ++LKFALPGKER
Sbjct  106   KQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEDSIDVDLKFALPGKER  165

Query  841   QDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEAN  1020
             QDSV++G QE+D+++EL+CIHD+ARPLV   DVEKVLKDGW VGAAVLGVPAK+TIKE N
Sbjct  166   QDSVHSGLQEIDVNAELVCIHDSARPLVDTEDVEKVLKDGWAVGAAVLGVPAKATIKEVN  225

Query  1021  NESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITE  1200
             ++S VV+TL+RKTLWEMQTPQVIKPELLK+GFE++ REGLEVTDDVSIVE LKHPVY+T+
Sbjct  226   SDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKREGLEVTDDVSIVEYLKHPVYVTQ  285

Query  1201  GSYSNIKVTTPDDMLLAERILN  1266
             GSY+NIKVTTPDD+LLAERIL 
Sbjct  286   GSYTNIKVTTPDDLLLAERILG  307



>gb|ACN40114.1| unknown [Picea sitchensis]
Length=319

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/253 (72%), Positives = 213/253 (84%), Gaps = 0/253 (0%)
 Frame = +1

Query  514   SLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             S S++   A+   + D     A+  V +KSVSVILLAGG GKRMG ++PKQYLPLLGQPI
Sbjct  67    SKSRLRARAVLDKDADDISSQANELVPKKSVSVILLAGGKGKRMGANIPKQYLPLLGQPI  126

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF  FS + +VKEIVVVCDP Y D+FE+A     + LKFA PGKERQDSV+NG QEV
Sbjct  127   ALYSFHIFSLMSEVKEIVVVCDPSYRDIFEEARNSMTVYLKFASPGKERQDSVFNGLQEV  186

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D ++EL+C+HD+ARPLVL+G+V+KVLKD W+ GAAVLGVP K+TIKEA+N+SFV RTLNR
Sbjct  187   DQTTELVCVHDSARPLVLSGNVKKVLKDAWVHGAAVLGVPVKATIKEASNDSFVTRTLNR  246

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             +TLWEMQTPQVIKP LL+KGFE+++REGLEVTDDVSIVE LKHPVYITEGSYSNIKVTTP
Sbjct  247   QTLWEMQTPQVIKPSLLRKGFEVVHREGLEVTDDVSIVEHLKHPVYITEGSYSNIKVTTP  306

Query  1234  DDMLLAERILNAR  1272
             DD+LLAERILN R
Sbjct  307   DDILLAERILNQR  319



>ref|XP_006836933.1| hypothetical protein AMTR_s00099p00152040 [Amborella trichopoda]
 gb|ERM99786.1| hypothetical protein AMTR_s00099p00152040 [Amborella trichopoda]
Length=325

 Score =   374 bits (960),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 195/311 (63%), Positives = 234/311 (75%), Gaps = 19/311 (6%)
 Frame = +1

Query  370   GLPNSPLFL---KTHPQKSFLLHYSISYCPKVPSF---------LHPRTGKIVPLRSSRR  513
              LP +P  L    T  Q   + +YS++   K   F            R G    +  +RR
Sbjct  15    ALPLTPFTLHSLSTVVQNQAICNYSLTLSAKKKGFGFWSSSDLLFGSRVGSPSNVIGTRR  74

Query  514   SLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             +L      A    +G+      +  V+EK+VSV+LLAGG GKRMGV+MPKQYLPLLGQPI
Sbjct  75    TLRFGAIKA--STDGE-----TNTGVREKTVSVVLLAGGQGKRMGVNMPKQYLPLLGQPI  127

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF TFS+L +VKEIVVVCDP Y D+FED  ++  ++LKFALPGKERQDSV+NG QE+
Sbjct  128   ALYSFYTFSRLLEVKEIVVVCDPSYEDIFEDTTQEICVDLKFALPGKERQDSVFNGLQEI  187

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D SSEL+CIHD+ARPLV +GDV+KVLKDG L GAAVLGVP K+TIKEAN+E FVV+TL+R
Sbjct  188   DRSSELVCIHDSARPLVSSGDVKKVLKDGLLNGAAVLGVPVKATIKEANSELFVVKTLDR  247

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             KTLWEMQTPQVIKPELL+KGFE+++ +GLEVTDDVSIVE L HPVYIT GSY+NIKVTTP
Sbjct  248   KTLWEMQTPQVIKPELLRKGFELVHSKGLEVTDDVSIVEYLNHPVYITVGSYTNIKVTTP  307

Query  1234  DDMLLAERILN  1266
             DD+LLAERILN
Sbjct  308   DDLLLAERILN  318



>emb|CDY15838.1| BnaC02g34570D [Brassica napus]
Length=309

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 205/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRM +++PKQY+PLLGQPIALYSF TFS++ QVKEIVVVCDPF+
Sbjct  81    VKEKSVSVILLAGGQGKRMKMTIPKQYIPLLGQPIALYSFFTFSRMSQVKEIVVVCDPFF  140

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FE+  +   ++LKFALPGKERQDSV++G QE+D ++EL+CIHD+ARPLV   DVEKV
Sbjct  141   RDIFEEYEESIDVDLKFALPGKERQDSVHSGLQEIDANAELVCIHDSARPLVDTEDVEKV  200

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW VGAAVLGVPAK+TIKE N +S VV+TL+RKTLWEMQTPQVIKPELLK+GFE++ 
Sbjct  201   LKDGWAVGAAVLGVPAKATIKEVNADSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVK  260

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVY+T+GSY+NIKVTTPDD+LLAERIL+
Sbjct  261   REGLEVTDDVSIVEYLKHPVYVTQGSYTNIKVTTPDDLLLAERILS  306



>emb|CDY09365.1| BnaA02g26450D [Brassica napus]
Length=308

 Score =   372 bits (956),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/226 (77%), Positives = 206/226 (91%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRM +++PKQY+PLLGQPIALYSF TFS +P+VKEIVVVCDPF+
Sbjct  80    VKEKSVSVILLAGGQGKRMKMTIPKQYIPLLGQPIALYSFFTFSHMPEVKEIVVVCDPFF  139

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FE+      ++LKFALPGKERQDSV++G QE+D+++EL+CIHD+ARPLV   DVEKV
Sbjct  140   RDIFEEYEDSIDVDLKFALPGKERQDSVHSGLQEIDVNAELVCIHDSARPLVDTEDVEKV  199

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLK+GFE++ 
Sbjct  200   LKDGWAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVK  259

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             REGLEVTDDVSIVE LKHPVY+T+GSY+NIKVTTPDD+LLAERIL+
Sbjct  260   REGLEVTDDVSIVEYLKHPVYVTQGSYTNIKVTTPDDLLLAERILS  305



>pdb|1W77|A Chain A, 2c-methyl-d-erythritol 4-phosphate Cytidylyltransferase 
(ispd) From Arabidopsis Thaliana
 pdb|4NAI|A Chain A, Arabidopsis Thaliana Ispd Apo
Length=228

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 204/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  595   EKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYND  774
             EKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALYSF TFS++P+VKEIVVVCDPF+ D
Sbjct  2     EKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRD  61

Query  775   VFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +FE+  +   ++L+FA+PGKERQDSVY+G QE+D++SEL+CIHD+ARPLV   DVEKVLK
Sbjct  62    IFEEYEESIDVDLRFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLK  121

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
             DG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLKKGFE++  E
Sbjct  122   DGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKKGFELVKSE  181

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             GLEVTDDVSIVE LKHPVY+++GSY+NIKVTTPDD+LLAERIL+
Sbjct  182   GLEVTDDVSIVEYLKHPVYVSQGSYTNIKVTTPDDLLLAERILS  225



>ref|XP_006395780.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
 gb|ESQ33066.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
Length=310

 Score =   370 bits (949),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 207/230 (90%), Gaps = 0/230 (0%)
 Frame = +1

Query  577   ADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC  756
             ++  VKEKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALYSF TFS++P+VKEIVVVC
Sbjct  78    SNTVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVC  137

Query  757   DPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             DPF+ D F +  +   ++LKFALPGKERQDSV++G QE+D++SEL+CIHD+ARPLV   D
Sbjct  138   DPFFRDYFGEYEETIDVDLKFALPGKERQDSVHSGLQEIDVNSELVCIHDSARPLVDTED  197

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             V+KVLKDG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLK+GF
Sbjct  198   VKKVLKDGLAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGF  257

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             E++ REGLEVTDDVSIVE LKHPVY+T+GSY+NIKVTTPDD+LLAERIL+
Sbjct  258   ELVKREGLEVTDDVSIVEYLKHPVYVTQGSYTNIKVTTPDDLLLAERILS  307



>pdb|2YC3|A Chain A, Inhibitors Of The Herbicidal Target Ispd
 pdb|2YC5|A Chain A, Inhibitors Of The Herbicidal Target Ispd
 pdb|4NAK|A Chain A, Arabidopsis Thaliana Ispd In Complex With Pentabromo-pseudilin
 pdb|4NAL|A Chain A, Arabidopsis Thaliana Ispd In Complex With Tribromodichloro-pseudilin
 pdb|4NAN|A Chain A, Arabidopsis Thaliana Ispd In Complex With Tetrabromo-pseudilin
Length=228

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  595   EKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYND  774
             EKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALYSF TFS++P+VKEIVVVCDPF+ D
Sbjct  2     EKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRD  61

Query  775   VFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +FE+  +   ++L FA+PGKERQDSVY+G QE+D++SEL+CIHD+ARPLV   DVEKVLK
Sbjct  62    IFEEYEESIDVDLSFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLK  121

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
             DG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLKKGFE++  E
Sbjct  122   DGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKKGFELVKSE  181

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             GLEVTDDVSIVE LKHPVY+++GSY+NIKVTTPDD+LLAERIL+
Sbjct  182   GLEVTDDVSIVEYLKHPVYVSQGSYTNIKVTTPDDLLLAERILS  225



>pdb|2YCM|A Chain A, Inhibitors Of Herbicidal Target Ispd
Length=227

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 172/224 (77%), Positives = 203/224 (91%), Gaps = 0/224 (0%)
 Frame = +1

Query  595   EKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYND  774
             EKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALYSF TFS++P+VKEIVVVCDPF+ D
Sbjct  1     EKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRD  60

Query  775   VFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +FE+  +   ++L FA+PGKERQDSVY+G QE+D++SEL+CIHD+ARPLV   DVEKVLK
Sbjct  61    IFEEYEESIDVDLSFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLK  120

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
             DG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLKKGFE++  E
Sbjct  121   DGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKKGFELVKSE  180

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             GLEVTDDVSIVE LKHPVY+++GSY+NIKVTTPDD+LLAERIL+
Sbjct  181   GLEVTDDVSIVEYLKHPVYVSQGSYTNIKVTTPDDLLLAERILS  224



>gb|AAZ80386.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Ginkgo 
biloba]
Length=327

 Score =   370 bits (950),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 202/228 (89%), Gaps = 0/228 (0%)
 Frame = +1

Query  580   DLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCD  759
             D+ V EK VSV+LLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+ VCD
Sbjct  97    DVVVPEKGVSVVLLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSRMSEVKEIITVCD  156

Query  760   PFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDV  939
             P Y D+FE+A     I LKFALPGKERQDSV+NG QEVD ++EL+C+HD+ARPLVL+ DV
Sbjct  157   PSYRDIFEEARNSVKINLKFALPGKERQDSVFNGLQEVDQATELVCVHDSARPLVLSEDV  216

Query  940   EKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFE  1119
             EK L+D W+ GAAVLGVP K+TIKEA+++ FVV+TLNR+TLWEMQTPQVIKP LL+KGFE
Sbjct  217   EKALQDAWIHGAAVLGVPVKATIKEASSDGFVVKTLNRQTLWEMQTPQVIKPNLLRKGFE  276

Query  1120  IINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +++REGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERIL
Sbjct  277   LVHREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERIL  324



>gb|KHN03574.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Glycine soja]
Length=304

 Score =   369 bits (947),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 197/310 (64%), Positives = 230/310 (74%), Gaps = 24/310 (8%)
 Frame = +1

Query  352   MSHLQLGLPNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHP--RTGK-IVPLRSSRRSLS  522
             M  +  G P SPL         F L  + S  P     +H     GK ++ + S + + S
Sbjct  1     MVAIGFGAPPSPL--------PFHLRLASSPSPLAFPIIHKFQNAGKSVITICSKKNAKS  52

Query  523   KIT--CSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIA  696
             ++   CSA         +  +D+ ++E+SVSV+LLAGG GKRMG SMPKQYLPL GQPIA
Sbjct  53    RVVTLCSAPVQ-----EQEVSDITLRERSVSVVLLAGGQGKRMGASMPKQYLPLFGQPIA  107

Query  697   LYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVD  876
             LYSF TF  L QVKEI+VVCDP Y D+FEDA   +  ELKFALPGKERQDS       VD
Sbjct  108   LYSFHTFFHLVQVKEIIVVCDPSYKDIFEDAKGDYQAELKFALPGKERQDSA------VD  161

Query  877   LSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRK  1056
              +SEL+CIHD+ARPLVL+ DV+KVLKDG L GAAVLGVP K+TIKEAN ESFVV+TL+RK
Sbjct  162   PNSELVCIHDSARPLVLSADVKKVLKDGLLNGAAVLGVPVKATIKEANRESFVVKTLDRK  221

Query  1057  TLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPD  1236
             TLWEMQTPQVIKPELL+KGFE++NREGLEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPD
Sbjct  222   TLWEMQTPQVIKPELLRKGFELVNREGLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPD  281

Query  1237  DMLLAERILN  1266
             DMLLAERILN
Sbjct  282   DMLLAERILN  291



>gb|AID51430.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Astragalus 
membranaceus]
Length=263

 Score =   363 bits (932),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/217 (80%), Positives = 194/217 (89%), Gaps = 0/217 (0%)
 Frame = +1

Query  616   LLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGK  795
             LLAGG GKRMG +MPKQYL L  QPIALYSF TFS + +VKEI+VVCDP Y D+F+DA  
Sbjct  39    LLAGGKGKRMGATMPKQYLLLFDQPIALYSFHTFSAMLEVKEIIVVCDPSYKDIFQDAKG  98

Query  796   KFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGA  975
              +  ELKFALPGKERQDSV+NG Q VD SSEL+C+HD+ARPLVL  DV+KVLKDG L GA
Sbjct  99    NYQAELKFALPGKERQDSVFNGLQAVDSSSELVCVHDSARPLVLQEDVKKVLKDGLLNGA  158

Query  976   AVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDD  1155
             AVLGVPAK+TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKPELL+KGFE++NR+GLEVTDD
Sbjct  159   AVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVNRKGLEVTDD  218

Query  1156  VSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             VSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN
Sbjct  219   VSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILN  255



>ref|XP_010523433.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Tarenaya hassleriana]
 ref|XP_010523434.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=211

 Score =   358 bits (919),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG+S+PKQYLPLLGQPIA+YSF TFS++ +VKEIVVVCDPFY DVFEDA +   I+LKFA
Sbjct  1     MGMSIPKQYLPLLGQPIAVYSFFTFSRMNEVKEIVVVCDPFYRDVFEDAQELVDIDLKFA  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVYNG QEVDL+SEL+CIHD+ARPLV   DVEKVLKDG +VGAAVLGVPAK+
Sbjct  61    LPGKERQDSVYNGLQEVDLNSELVCIHDSARPLVTTEDVEKVLKDGSVVGAAVLGVPAKA  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVV+TL+RKTLWEMQTPQVIKPELLK+GFE++N+E LEVTDDVSIVE LKH
Sbjct  121   TIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKRGFELVNKEALEVTDDVSIVEHLKH  180

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVYITEGSY+NIKVTTPDD+LLAERIL+
Sbjct  181   PVYITEGSYTNIKVTTPDDLLLAERILS  208



>ref|XP_010682094.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
 ref|XP_010682095.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=307

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/253 (70%), Positives = 206/253 (81%), Gaps = 8/253 (3%)
 Frame = +1

Query  508   RRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQ  687
             R S  +I CSA        +    +  VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQ
Sbjct  58    RWSALRIHCSA--------NSTEGNAIVKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQ  109

Query  688   PIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQ  867
             PIALYS  TFS++ +VKEIVVVCDP Y D+FE+   K H++LKF  PGKERQDSVYNG Q
Sbjct  110   PIALYSLYTFSQMVEVKEIVVVCDPSYKDIFEEMRDKIHVDLKFTEPGKERQDSVYNGLQ  169

Query  868   EVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTL  1047
              +   ++L+CIHD+ARPLVL+ D+EKVLKDG + GAAVLGVP K+TIKEANNESFVV+TL
Sbjct  170   AIASGADLVCIHDSARPLVLSQDIEKVLKDGKVHGAAVLGVPVKATIKEANNESFVVKTL  229

Query  1048  NRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVT  1227
             +RKTLWEMQTPQVI P LLK GF+++NR GLEVTDDVSIVE L H VYITEGSY+NIK+T
Sbjct  230   DRKTLWEMQTPQVILPALLKDGFDLVNRRGLEVTDDVSIVEHLGHRVYITEGSYTNIKIT  289

Query  1228  TPDDMLLAERILN  1266
             TPDD+L+AERILN
Sbjct  290   TPDDLLVAERILN  302



>ref|NP_565286.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Arabidopsis 
thaliana]
 sp|P69834.1|ISPD_ARATH RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic; AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; 
Short=AtMECT; Short=AtMEPCT; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF61714.1|AF230737_1 4-Diphosphocytidyl-2C-methyl-D-erythritol synthase [Arabidopsis 
thaliana]
 dbj|BAB21592.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Arabidopsis 
thaliana]
 gb|AAC18936.2| putative sugar nucleotide phosphorylase [Arabidopsis thaliana]
 dbj|BAC42737.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Arabidopsis thaliana]
 gb|AAP04105.1| putative sugar nucleotide phosphorylase [Arabidopsis thaliana]
 gb|AEC05588.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Arabidopsis 
thaliana]
Length=302

 Score =   360 bits (923),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 234/308 (76%), Gaps = 12/308 (4%)
 Frame = +1

Query  349   TMSHLQLGLPNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRS--LS  522
              M    LG   SP FL    +     +   SY  +V      +       RS +R   L 
Sbjct  2     AMLQTNLGFITSPTFLCPKLKVKLNSYLWFSYRSQVQKLDFSKRVN----RSYKRDALLL  57

Query  523   KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALY  702
              I CS+  G +       +++ VKEKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALY
Sbjct  58    SIKCSSSTGFDN------SNVVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALY  111

Query  703   SFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
             SF TFS++P+VKEIVVVCDPF+ D+FE+  +   ++L+FA+PGKERQDSVY+G QE+D++
Sbjct  112   SFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIDVDLRFAIPGKERQDSVYSGLQEIDVN  171

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
             SEL+CIHD+ARPLV   DVEKVLKDG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTL
Sbjct  172   SELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTL  231

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQVIKPELLKKGFE++  EGLEVTDDVSIVE LKHPVY+++GSY+NIKVTTPDD+
Sbjct  232   WEMQTPQVIKPELLKKGFELVKSEGLEVTDDVSIVEYLKHPVYVSQGSYTNIKVTTPDDL  291

Query  1243  LLAERILN  1266
             LLAERIL+
Sbjct  292   LLAERILS  299



>gb|AFB70980.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, partial 
[Mitragyna speciosa]
Length=212

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             KSVSVILLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS LP+VKEIVVVCDP Y D+
Sbjct  1     KSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYSFFTFSTLPEVKEIVVVCDPSYQDI  60

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             FED  +K H+++KFALPGKERQDSVY+G Q  D S+EL+CIHD+ARPLVLA DV KVL D
Sbjct  61    FEDVKEKIHVDMKFALPGKERQDSVYSGLQAADSSAELVCIHDSARPLVLAEDVRKVLMD  120

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
             G  +GAAVLGVP+K+TIKEA+++ FVVRTL+RKTLWEMQTPQVIKP+LLK GFE++NREG
Sbjct  121   GLRIGAAVLGVPSKATIKEADSKYFVVRTLDRKTLWEMQTPQVIKPDLLKMGFELVNREG  180

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTP  1233
             LEVTDDVSIVE LKHPVYITEGSY+NIKVTTP
Sbjct  181   LEVTDDVSIVEHLKHPVYITEGSYTNIKVTTP  212



>ref|XP_011087605.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X3 [Sesamum indicum]
Length=286

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/205 (82%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = +1

Query  652   SMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPG  831
             SMPKQYLPLLGQPIALYSF TFSK+P+VKEIVVVCDP Y D+FEDA +  HI++KFALPG
Sbjct  79    SMPKQYLPLLGQPIALYSFYTFSKMPEVKEIVVVCDPSYQDIFEDAKENIHIDMKFALPG  138

Query  832   KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIK  1011
             KERQDSVY+G + +D  SEL+CIHD+ARPLVLAGDV KVLKDG  VGAAVLGVPAK+TIK
Sbjct  139   KERQDSVYSGLEAIDSDSELVCIHDSARPLVLAGDVAKVLKDGQRVGAAVLGVPAKATIK  198

Query  1012  EANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVY  1191
             EAN++SFVV+TL+RKTLWEMQTPQVI+P+LLKKGFE++NREGLEVTDDVSIVE L+HPVY
Sbjct  199   EANSDSFVVKTLDRKTLWEMQTPQVIRPDLLKKGFELVNREGLEVTDDVSIVEHLRHPVY  258

Query  1192  ITEGSYSNIKVTTPDDMLLAERILN  1266
             ITEGSY+NIKVTTPDD+LLAERILN
Sbjct  259   ITEGSYTNIKVTTPDDLLLAERILN  283



>gb|KDO41350.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=214

 Score =   354 bits (908),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 193/208 (93%), Gaps = 0/208 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG +MPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP Y+D+FE+  +K +++LKF+
Sbjct  1     MGANMPKQYLPLLGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFS  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G QEVD +SEL+CIHD+ARPLVL+ DV+KVL D   VGAAVLGVPAK+
Sbjct  61    LPGKERQDSVYSGLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKA  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSIVE LKH
Sbjct  121   TIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKH  180

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVYITEGSY+NIKVTTPDD+L+AERILN
Sbjct  181   PVYITEGSYTNIKVTTPDDLLIAERILN  208



>ref|XP_004970838.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Setaria italica]
Length=297

 Score =   357 bits (915),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 211/258 (82%), Gaps = 8/258 (3%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +RRS   I  S   G  G        +AVKE+SVSVILL+GG GKRMG SMPKQYLPL
Sbjct  48    RPTRRSNPAIRASEADGAPG--------VAVKERSVSVILLSGGQGKRMGASMPKQYLPL  99

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LG PIAL+S  TF +L ++KE+VVVCDP Y+DVFE + +   I LKFA PGKERQDSV+N
Sbjct  100   LGLPIALHSLKTFCQLKEMKEVVVVCDPDYSDVFEGSIENLQIPLKFACPGKERQDSVFN  159

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKEAN++SFVV
Sbjct  160   GLQEIDGDSELVCVHDSARPLVSSEDVKKVLQDAAVHGAAVLGVPVKATIKEANSDSFVV  219

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQV+KP+LLK GFE++ R+GLEVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  220   KTLDRKTLWEMQTPQVMKPDLLKAGFELVKRDGLEVTDDVSIVEYLKHPVYITEGSYTNI  279

Query  1219  KVTTPDDMLLAERILNAR  1272
             KVTTPDDMLLAER+++ +
Sbjct  280   KVTTPDDMLLAERLMSGK  297



>ref|XP_007225800.1| hypothetical protein PRUPE_ppa011267mg [Prunus persica]
 gb|EMJ26999.1| hypothetical protein PRUPE_ppa011267mg [Prunus persica]
Length=216

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG SMPKQYLPLL QPIALYSF TFS++ +VKEI+VVCDP Y D+FE+   K   ELKF 
Sbjct  1     MGASMPKQYLPLLSQPIALYSFYTFSQMTEVKEIIVVCDPSYKDIFEETKHKIQKELKFT  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q +DLSSEL+CIHD+ARPLV +GDVEKVLKDGWL GAAVLGVP K+
Sbjct  61    LPGKERQDSVYSGLQAIDLSSELVCIHDSARPLVSSGDVEKVLKDGWLNGAAVLGVPVKA  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVV+TL+R+TLWEMQTPQVIKP+LL+KGFE++NREGLEVTDDVSIVE L H
Sbjct  121   TIKEANSESFVVKTLDRRTLWEMQTPQVIKPQLLRKGFELVNREGLEVTDDVSIVEHLPH  180

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVYITEGSY+NIKVTTPDD+LLAERIL+
Sbjct  181   PVYITEGSYTNIKVTTPDDLLLAERILS  208



>gb|KCW57180.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=216

 Score =   350 bits (899),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+VVCDP Y D+FED  ++  ++LKF 
Sbjct  1     MGASMPKQYLPLLGQPIALYSFYTFSQMREVKEIIVVCDPSYKDIFEDTKEEIQVDLKFT  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q VD  SEL+CIHD+ARPLV  GD+EKVLKDGW  GAAVLGVP K+
Sbjct  61    LPGKERQDSVYSGLQAVDSGSELVCIHDSARPLVSRGDIEKVLKDGWENGAAVLGVPVKA  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP LLK+GFE++NREGLEVTDDVSIVE L+H
Sbjct  121   TIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNREGLEVTDDVSIVEHLRH  180

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVY+TEGSY+NIKVTTPDD+LLAERILN
Sbjct  181   PVYVTEGSYTNIKVTTPDDLLLAERILN  208



>gb|AGP04988.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Taxus 
wallichiana var. chinensis]
Length=313

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V +KSVSVILLAGG GKRMG SMPKQYLPLLG PIALYSF TF ++P+VKEI+ VCD  Y
Sbjct  86    VTKKSVSVILLAGGQGKRMGASMPKQYLPLLGVPIALYSFFTFGRIPEVKEIIAVCDSSY  145

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+F+DA +   + LKFA PGKERQDSVYNG QE+D  ++L+C+HD+ARPLV   DVEKV
Sbjct  146   RDIFQDAKESVMVNLKFASPGKERQDSVYNGLQEIDPLADLVCVHDSARPLVSPEDVEKV  205

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L+D W+ GAAVLGVP K+TIKEANN+SFVV+TL+R+ LWEMQTPQV+KP LL+KGFE++ 
Sbjct  206   LQDAWVHGAAVLGVPVKATIKEANNDSFVVKTLDRQMLWEMQTPQVVKPGLLRKGFELVQ  265

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             R+ LEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPDD+L+AERILN
Sbjct  266   RDSLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPDDLLVAERILN  311



>gb|KDO41351.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=210

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = +1

Query  655   MPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGK  834
             MPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP Y+D+FE+  +K +++LKF+LPGK
Sbjct  1     MPKQYLPLLGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGK  60

Query  835   ERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKE  1014
             ERQDSVY+G QEVD +SEL+CIHD+ARPLVL+ DV+KVL D   VGAAVLGVPAK+TIKE
Sbjct  61    ERQDSVYSGLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKE  120

Query  1015  ANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYI  1194
             AN+ESFVVRTL+RKTLWEMQTPQVIKP+LLKKGFE++NREGLEVTDDVSIVE LKHPVYI
Sbjct  121   ANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFELVNREGLEVTDDVSIVEHLKHPVYI  180

Query  1195  TEGSYSNIKVTTPDDMLLAERILN  1266
             TEGSY+NIKVTTPDD+L+AERILN
Sbjct  181   TEGSYTNIKVTTPDDLLIAERILN  204



>gb|ABU48538.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Taxus 
x media]
Length=312

 Score =   352 bits (904),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/226 (73%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V +KSVSVILLAGG GKRMG SMPKQYLPLLG PIALYSF TF+++P+VKEI+ VCD  Y
Sbjct  85    VTKKSVSVILLAGGQGKRMGASMPKQYLPLLGVPIALYSFFTFARIPEVKEIIAVCDSSY  144

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FEDA +   + LKFA PGKERQDSVYNG QE+D  ++L+C+HD+ARPLV   DVEKV
Sbjct  145   RDIFEDAKESVMVNLKFASPGKERQDSVYNGLQEIDPLADLVCVHDSARPLVSPKDVEKV  204

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L+D W+ GAAVLGV  K+TIKEANN+SFVV+TL+R+ LWEMQTPQV+KP LL+KGFE++ 
Sbjct  205   LQDAWVHGAAVLGVSVKATIKEANNDSFVVKTLDRQMLWEMQTPQVVKPGLLRKGFELVQ  264

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             R+ LEVTDDVSIVE LKHPVYIT+GSY+NIKVTTPDD+L+AERILN
Sbjct  265   RDSLEVTDDVSIVEHLKHPVYITQGSYTNIKVTTPDDLLVAERILN  310



>ref|XP_010314195.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=281

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 196/308 (64%), Positives = 227/308 (74%), Gaps = 34/308 (11%)
 Frame = +1

Query  352   MSHLQLGL---PNSPLFLKTHPQKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRRSLS  522
             MS LQLG+    +SP+FL ++      +  SIS  P    F+     +       RR L 
Sbjct  1     MSTLQLGIILSSSSPMFLASNSHIPKNVLPSISLFPTY--FVKNPCRRTYSHADPRRGLF  58

Query  523   KITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALY  702
             KI+CS+    + +L+K    + V+EKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALY
Sbjct  59    KISCSS---TSENLNKESDVVVVEEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALY  115

Query  703   SFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
             SF TFSK+PQVKEI+VVCDP Y D+FEDA +   ++LKFALPGKERQDSVY+G Q     
Sbjct  116   SFYTFSKMPQVKEIIVVCDPSYQDIFEDAKEYIQVDLKFALPGKERQDSVYSGLQ-----  170

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
                                  VLKDGWLVGAAVLGVPAK+TIKEAN+ESFVV+TL+RKTL
Sbjct  171   ---------------------VLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKTL  209

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQ+IKPELLKKGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+
Sbjct  210   WEMQTPQIIKPELLKKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDL  269

Query  1243  LLAERILN  1266
             LLAERILN
Sbjct  270   LLAERILN  277



>ref|XP_003564801.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Brachypodium distachyon]
Length=294

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/287 (61%), Positives = 225/287 (78%), Gaps = 9/287 (3%)
 Frame = +1

Query  424   LHYSISYCPK---VPS---FLHPRTGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADL  585
             LH  +   PK   +PS    L P +G++    S   +  +I  SA++ V  D  +   D 
Sbjct  9     LHARLPSAPKRSRLPSPAMVLLPASGRLRIGWSCGDAPRRIPNSAIFAVRADGAQ--GD-  65

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKE+SVSVILL+GG GKRMG +MPKQY+PLLG PIAL+S  TF ++ +VKE++VVCDP 
Sbjct  66    AVKERSVSVILLSGGQGKRMGANMPKQYIPLLGTPIALHSLRTFCRMKEVKEVIVVCDPS  125

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             Y +VFED+ +   I +KFA PGKERQDSV+NG QE+D  SEL+C+HD+ARPLV + DV+K
Sbjct  126   YRNVFEDSIENLQIPIKFACPGKERQDSVFNGLQEIDRDSELVCVHDSARPLVSSKDVKK  185

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VL+D  + GAAVLGVP K+TIKEA+++SFVV+TL+RKTLWEMQTPQV++P LLK GF+++
Sbjct  186   VLEDAAVHGAAVLGVPVKATIKEASSDSFVVKTLDRKTLWEMQTPQVMEPNLLKDGFDLV  245

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              R+GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAER++N
Sbjct  246   KRDGLEVTDDVSIVEYLKHPVYITEGSYTNIKVTTPDDLLLAERLMN  292



>gb|KEH32738.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Medicago 
truncatula]
Length=299

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 213/284 (75%), Gaps = 11/284 (4%)
 Frame = +1

Query  409   QKSFLLHYSISYCPKVPSFLHPRTGKIVPLRSSRR-------SLSKITCSALYGVNGDLH  567
             Q S LLH  + + P + S      GK  P  S          S S    +AL       +
Sbjct  8     QHSPLLHLGLPF-PTLKSLTTTAKGKSGPQISINNNNKNVLSSTSICYAAALPTAQEQDN  66

Query  568   KRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV  747
                + + VK++SVSV+LLAGG GKRMG +MPKQYLPLLGQPIALYSF TFS++ QVKEI+
Sbjct  67    DSHSHVVVKDRSVSVVLLAGGKGKRMGATMPKQYLPLLGQPIALYSFYTFSRMLQVKEII  126

Query  748   VVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQE---VDLSSELICIHDAARP  918
             VVCDP YN +F+DA      +LKFALPGKERQDSVYNG QE   VD +SEL+C+HD+ARP
Sbjct  127   VVCDPSYNHIFQDAKGNCQPDLKFALPGKERQDSVYNGLQECATVDPNSELVCVHDSARP  186

Query  919   LVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPE  1098
             LVL  DV+KVLKDG L GA+VLGVP K+TIKEAN ESFVVRTL+RKTLWEMQTPQ+IKPE
Sbjct  187   LVLQEDVKKVLKDGLLNGASVLGVPVKATIKEANTESFVVRTLDRKTLWEMQTPQIIKPE  246

Query  1099  LLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTT  1230
             LL+KGFE++NREGLEVTDDVSIVE LKHPVYITEGSY+NIKV  
Sbjct  247   LLRKGFELVNREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVAN  290



>ref|XP_010907551.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X3 [Elaeis guineensis]
Length=256

 Score =   344 bits (882),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  652   SMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPG  831
             SMPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP Y DVFE A ++  + +KFALPG
Sbjct  45    SMPKQYLPLLGQPIALYSFYTFSQISEVKEIVVVCDPSYKDVFEGASEEIQVGIKFALPG  104

Query  832   KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIK  1011
             KERQDSV+NGFQE++ SSEL+CIHD+ARPLV +GD++KVLKD WL GAAVLGVP K+TIK
Sbjct  105   KERQDSVFNGFQEIEGSSELVCIHDSARPLVTSGDIKKVLKDAWLNGAAVLGVPVKATIK  164

Query  1012  EANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVY  1191
             EAN++SFVV+TL+RKTLWEM TPQVIKP LL+ GFE++NR GLEVTDDVSIVE LKHPVY
Sbjct  165   EANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFELVNRNGLEVTDDVSIVEHLKHPVY  224

Query  1192  ITEGSYSNIKVTTPDDMLLAERILNAR  1272
             ITEGSY+NIKVTTPDD+LLAERILN R
Sbjct  225   ITEGSYTNIKVTTPDDLLLAERILNMR  251



>dbj|BAJ91237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/266 (65%), Positives = 212/266 (80%), Gaps = 7/266 (3%)
 Frame = +1

Query  475   RTGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVS  654
             R+  + P RS+RRS S I  +   G  G         AVKE+SVSVILL+GG GKRMG +
Sbjct  40    RSCGVAPRRSTRRSHSAICAAEPDGAQGGE-------AVKERSVSVILLSGGQGKRMGAN  92

Query  655   MPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGK  834
             MPKQYLPLLG PIAL+S  TF  + +VKE+VVVCDP Y +VFE + +   I +KF  PGK
Sbjct  93    MPKQYLPLLGVPIALHSLKTFCAMKEVKEVVVVCDPSYKNVFEGSAENLQIPIKFTTPGK  152

Query  835   ERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKE  1014
             ERQDSV+NG QE++  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKE
Sbjct  153   ERQDSVFNGLQEINGDSELVCVHDSARPLVSSEDVKKVLEDAAVHGAAVLGVPVKATIKE  212

Query  1015  ANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYI  1194
             AN++SFVV+TL+RKTLWEMQTPQV+KP LL+ GFE++ R+GLEVTDDVSIVE LKHPVYI
Sbjct  213   ANSDSFVVKTLDRKTLWEMQTPQVMKPNLLRDGFELVKRDGLEVTDDVSIVEYLKHPVYI  272

Query  1195  TEGSYSNIKVTTPDDMLLAERILNAR  1272
             TEGSY+NIKVTTPDDMLLAER++N +
Sbjct  273   TEGSYTNIKVTTPDDMLLAERLMNDK  298



>ref|XP_006646546.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Oryza brachyantha]
Length=237

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKE+SVSV+LL+GG GKRMG SMPKQYLPLLG PIAL+S  TF ++ +VKE+VVVCDP 
Sbjct  9     AVKERSVSVVLLSGGQGKRMGASMPKQYLPLLGLPIALHSLKTFCQMKEVKEVVVVCDPG  68

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             Y DVFED+ +   I +KFALPGKERQDSV+NG QE+D  SEL+C+HD+ARPLV + DV+K
Sbjct  69    YKDVFEDSIENVQIPIKFALPGKERQDSVFNGLQEIDGGSELVCVHDSARPLVSSEDVKK  128

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VL+D  + GAAVLGVP K+TIKEA+N+SFVV+TL+RKTLWEMQTPQV+KP LLK GFE++
Sbjct  129   VLEDAAVHGAAVLGVPVKATIKEADNDSFVVKTLDRKTLWEMQTPQVMKPNLLKDGFELV  188

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              R+GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAER++N +
Sbjct  189   KRDGLEVTDDVSIVEYLKHPVYITEGSYTNIKVTTPDDLLLAERLMNEK  237



>ref|XP_008656994.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Zea mays]
 gb|AFW84349.1| hypothetical protein ZEAMMB73_109111 [Zea mays]
Length=295

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/256 (68%), Positives = 205/256 (80%), Gaps = 8/256 (3%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +RRS   I  S   G  G        +AVKE+SVSVILL+GG GKRMG +MPKQYLPL
Sbjct  46    RHTRRSSPAICASITDGEQG--------VAVKERSVSVILLSGGQGKRMGANMPKQYLPL  97

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LG PIALYS  TF +L +VKE+VVVCDP Y+DVFE +     I LKFA PGKERQDSV+N
Sbjct  98    LGLPIALYSLKTFCQLKEVKEVVVVCDPDYSDVFEGSIDNLQIPLKFARPGKERQDSVFN  157

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKEAN  SFVV
Sbjct  158   GLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAAVHGAAVLGVPVKATIKEANTNSFVV  217

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQ +KP LL+ GFE++ R+GLEVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  218   KTLDRKTLWEMQTPQAMKPNLLRDGFELVKRDGLEVTDDVSIVEYLKHPVYITEGSYTNI  277

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+LLAER++N
Sbjct  278   KVTTPDDLLLAERLMN  293



>sp|Q5N8G1.1|ISPD_ORYSJ RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic; AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; Short=OsCMS; AltName: Full=MEP 
cytidylyltransferase; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD82245.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAD82130.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Oryza sativa Japonica Group]
 gb|EAZ14419.1| hypothetical protein OsJ_04342 [Oryza sativa Japonica Group]
 gb|EEC71920.1| hypothetical protein OsI_04715 [Oryza sativa Indica Group]
Length=297

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 213/269 (79%), Gaps = 11/269 (4%)
 Frame = +1

Query  475   RTG---KIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRM  645
             RTG    + P R +R+  S +  +   G  G+        AVKE+SVSV+LL+GG GKRM
Sbjct  37    RTGGSCAVAPRRHARKWGSAVCAAKADGAQGE--------AVKERSVSVVLLSGGQGKRM  88

Query  646   GVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFAL  825
             G SMPKQYLPLLG PIAL+S  TF +L +VKE+VVVCDP Y D+FE + +   I +KFAL
Sbjct  89    GASMPKQYLPLLGLPIALHSLKTFCQLKEVKEVVVVCDPDYKDIFEGSIENVQIPIKFAL  148

Query  826   PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKST  1005
             PGKERQDSVYNG QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+T
Sbjct  149   PGKERQDSVYNGLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAIVHGAAVLGVPVKAT  208

Query  1006  IKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHP  1185
             IKEA++ SFVV+TL+RKTLWEMQTPQV++P LL+ GFE++ R+GLEVTDDVSIVE LKH 
Sbjct  209   IKEADSNSFVVKTLDRKTLWEMQTPQVMRPSLLRDGFELVKRDGLEVTDDVSIVEYLKHS  268

Query  1186  VYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             VYITEGSY+NIKVTTPDD+LLAER++N +
Sbjct  269   VYITEGSYTNIKVTTPDDLLLAERLMNEK  297



>ref|XP_002456761.1| hypothetical protein SORBIDRAFT_03g042160 [Sorghum bicolor]
 gb|EES01881.1| hypothetical protein SORBIDRAFT_03g042160 [Sorghum bicolor]
Length=295

 Score =   334 bits (856),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/258 (67%), Positives = 209/258 (81%), Gaps = 8/258 (3%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +RRS   I  S   G  G        ++VKE+SVSVILL+GG GKRMG +MPKQYLPL
Sbjct  46    RHTRRSSPVIRASIADGEQG--------VSVKERSVSVILLSGGQGKRMGANMPKQYLPL  97

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LG PIAL+S  TF +L +VKE+VVVCD  Y+DVFE + +   I LKFA PGKERQDSV+N
Sbjct  98    LGLPIALHSLKTFCQLKEVKEVVVVCDSDYSDVFEGSIENLQIPLKFARPGKERQDSVFN  157

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKEAN++SFVV
Sbjct  158   GLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAAVHGAAVLGVPVKATIKEANSDSFVV  217

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQV+KP+LLK GFE++ R+G EVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  218   KTLDRKTLWEMQTPQVMKPKLLKDGFELVKRDGHEVTDDVSIVEYLKHPVYITEGSYTNI  277

Query  1219  KVTTPDDMLLAERILNAR  1272
             KVTTPDD+LLAER++N +
Sbjct  278   KVTTPDDLLLAERLMNEK  295



>ref|XP_002983421.1| hypothetical protein SELMODRAFT_117940, partial [Selaginella 
moellendorffii]
 gb|EFJ15763.1| hypothetical protein SELMODRAFT_117940, partial [Selaginella 
moellendorffii]
Length=230

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V E SVSVILLAGG+GKRMG  MPKQYLPLLGQPIALYSF TF+ +P+VKE+VVVCDP +
Sbjct  2     VPEHSVSVILLAGGVGKRMGADMPKQYLPLLGQPIALYSFYTFANMPEVKEVVVVCDPSF  61

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
               +FE+A K   I +KFALPG+ERQDSV++G Q +   S+L CIHD+ARPLVL  D+++V
Sbjct  62    KHLFEEASKNIKIVVKFALPGRERQDSVFSGLQAISDDSKLACIHDSARPLVLGHDIQRV  121

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L+D W+ GAAVLGV  K+TIKEA ++ FV +TLNR+ LWEMQTPQ I+P LL++GF ++ 
Sbjct  122   LRDAWVHGAAVLGVRVKATIKEAGSDHFVKKTLNRQNLWEMQTPQAIEPSLLRQGFGLVE  181

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             R+GLEVTDDVSIVE LK PV+ITEGSYSN+KVTTPDDML+AERIL +
Sbjct  182   RDGLEVTDDVSIVEFLKRPVFITEGSYSNLKVTTPDDMLVAERILQS  228



>ref|NP_001140440.1| uncharacterized protein LOC100272499 [Zea mays]
 gb|ACF83844.1| unknown [Zea mays]
 tpg|DAA56460.1| TPA: hypothetical protein ZEAMMB73_967384 [Zea mays]
Length=298

 Score =   333 bits (855),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/258 (67%), Positives = 207/258 (80%), Gaps = 5/258 (2%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +RRS   I  S   G  G      A  AVKE+SVSVILL+GG GKRMG SMPKQYLPL
Sbjct  46    RHTRRSNRAIHTSLADGEQG-----VAVDAVKERSVSVILLSGGQGKRMGASMPKQYLPL  100

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LG PIAL+S  TF +L +VKE+VVVCDP Y DVFE + K   + LKFA PGKERQDSV+N
Sbjct  101   LGLPIALHSLKTFCQLKEVKEVVVVCDPDYIDVFEGSIKNLQLPLKFARPGKERQDSVFN  160

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKEAN++SFV+
Sbjct  161   GLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAAVHGAAVLGVPVKATIKEANSDSFVI  220

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQV+KP LLK GFE++ R+  EVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  221   KTLDRKTLWEMQTPQVMKPNLLKDGFELVKRDNHEVTDDVSIVEYLKHPVYITEGSYTNI  280

Query  1219  KVTTPDDMLLAERILNAR  1272
             KVTTP+D+LLAER++N +
Sbjct  281   KVTTPEDLLLAERLMNEK  298



>ref|XP_002960618.1| hypothetical protein SELMODRAFT_73567, partial [Selaginella moellendorffii]
 gb|EFJ38157.1| hypothetical protein SELMODRAFT_73567, partial [Selaginella moellendorffii]
Length=230

 Score =   330 bits (845),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V E SVSVILLAGG+GKRMG  MPKQYL LLGQPIALYSF TF+ +P+VKE+VVVCDP Y
Sbjct  2     VPEHSVSVILLAGGVGKRMGADMPKQYLRLLGQPIALYSFYTFANMPEVKEVVVVCDPSY  61

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
               +FE+A K   I +KFALPG+ERQDSV++G Q +   S+L CIHD+ARPLVL  D+++V
Sbjct  62    KHLFEEASKNIKIVVKFALPGRERQDSVFSGLQAISDDSKLACIHDSARPLVLGHDIQRV  121

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             L+D W+ GAAVLGV  K+TIKEA ++ FV +TLNR+ LWEMQTPQ I+P LL++GF ++ 
Sbjct  122   LRDAWVHGAAVLGVRVKATIKEAGSDHFVKKTLNRQNLWEMQTPQAIEPSLLRQGFGLVE  181

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             R+GLEVTDDVSIVE LK PV+ITEGSYSN+KVTTPDDML+AERIL +
Sbjct  182   RDGLEVTDDVSIVEFLKRPVFITEGSYSNLKVTTPDDMLVAERILQS  228



>gb|KHF99643.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Gossypium arboreum]
Length=314

 Score =   332 bits (850),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/248 (67%), Positives = 194/248 (78%), Gaps = 7/248 (3%)
 Frame = +1

Query  544   YGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSK  723
             YG+            V EKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALY       
Sbjct  59    YGIKCSAKVDYGSAVVNEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYRLVVNVV  118

Query  724   LPQVKEIVVVCDPFYNDV-------FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
                +  +++       D          +A  K +++LKF LPGKERQDSVY+G Q VDL+
Sbjct  119   FVYLFLMMIFDSSSSGDTSCNMMIFVAEAIDKINVDLKFTLPGKERQDSVYSGLQAVDLN  178

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
             SEL+CIHD+ARPLV +GDVEKVLKDGWL+GAAVLGVP K+TIKEAN++S+VV+TL+RKTL
Sbjct  179   SELVCIHDSARPLVRSGDVEKVLKDGWLIGAAVLGVPVKATIKEANSDSYVVKTLDRKTL  238

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDM  1242
             WEMQTPQVIKPELL+KGFE+++REGLEVTDDVSIVE LKHPVY+TEG Y+NIKVTTPDD+
Sbjct  239   WEMQTPQVIKPELLRKGFELVHREGLEVTDDVSIVEHLKHPVYVTEGCYTNIKVTTPDDL  298

Query  1243  LLAERILN  1266
             LLAERILN
Sbjct  299   LLAERILN  306



>ref|XP_010907550.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=299

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/229 (71%), Positives = 191/229 (83%), Gaps = 17/229 (7%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKEKSVSV+LLAGG GKRMG SMPKQYLPLLGQPIAL +++                P 
Sbjct  83    AVKEKSVSVVLLAGGKGKRMGASMPKQYLPLLGQPIALRNWN----------------PL  126

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             ++ +F  A ++  + +KFALPGKERQDSV+NGFQE++ SSEL+CIHD+ARPLV +GD++K
Sbjct  127   FS-MFAGASEEIQVGIKFALPGKERQDSVFNGFQEIEGSSELVCIHDSARPLVTSGDIKK  185

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VLKD WL GAAVLGVP K+TIKEAN++SFVV+TL+RKTLWEM TPQVIKP LL+ GFE++
Sbjct  186   VLKDAWLNGAAVLGVPVKATIKEANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFELV  245

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             NR GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDD+LLAERILN R
Sbjct  246   NRNGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDLLLAERILNMR  294



>gb|KCW57178.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=282

 Score =   330 bits (845),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 171/268 (64%), Positives = 197/268 (74%), Gaps = 41/268 (15%)
 Frame = +1

Query  466   LHPR-TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKR  642
             +HPR T KIV       S +++ CS             +   V+E SVSVILLAGG GKR
Sbjct  47    IHPRRTAKIVA------SSTRVHCSG--------KDDNSVTVVREGSVSVILLAGGKGKR  92

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+VVCDP Y D+FED  ++  ++LKF 
Sbjct  93    MGASMPKQYLPLLGQPIALYSFYTFSQMREVKEIIVVCDPSYKDIFEDTKEEIQVDLKFT  152

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q                          VLKDGW  GAAVLGVP K+
Sbjct  153   LPGKERQDSVYSGLQ--------------------------VLKDGWENGAAVLGVPVKA  186

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP LLK+GFE++NREGLEVTDDVSIVE L+H
Sbjct  187   TIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNREGLEVTDDVSIVEHLRH  246

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILN  1266
             PVY+TEGSY+NIKVTTPDD+LLAERILN
Sbjct  247   PVYVTEGSYTNIKVTTPDDLLLAERILN  274



>emb|CDM85383.1| unnamed protein product [Triticum aestivum]
Length=301

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVKE+SVSV+LL+GG GKRMG +MPKQYLPLLG PIAL+S  TF  + +VKE+VVVCDP 
Sbjct  73    AVKERSVSVVLLSGGQGKRMGANMPKQYLPLLGVPIALHSLRTFCGMKEVKEVVVVCDPS  132

Query  766   YNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             Y +VFE   +   I +KF  PGKERQDSV+NG QE+D  SEL+C+HD+ARPLV + DV+K
Sbjct  133   YKNVFEGFVENLQIPMKFTTPGKERQDSVFNGLQEIDGDSELVCVHDSARPLVSSEDVKK  192

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VL+D  + GAAVLGVP K+TIKEAN++SFVV+TL+RKTLWEMQTPQV+KP LLK GFE++
Sbjct  193   VLEDAAVHGAAVLGVPVKATIKEANSDSFVVKTLDRKTLWEMQTPQVMKPNLLKDGFELV  252

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              R+GLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDDMLLAER++N +
Sbjct  253   KRDGLEVTDDVSIVEYLKHPVYITEGSYTNIKVTTPDDMLLAERLMNDK  301



>gb|AFW84350.1| hypothetical protein ZEAMMB73_109111 [Zea mays]
Length=293

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/256 (67%), Positives = 202/256 (79%), Gaps = 10/256 (4%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +RRS   I  S   G  G        +AVKE+SVSVILL+GG GKRMG +MPKQYLPL
Sbjct  46    RHTRRSSPAICASITDGEQG--------VAVKERSVSVILLSGGQGKRMGANMPKQYLPL  97

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LG PIA     TF +L +VKE+VVVCDP Y+DVFE +     I LKFA PGKERQDSV+N
Sbjct  98    LGLPIAF--LKTFCQLKEVKEVVVVCDPDYSDVFEGSIDNLQIPLKFARPGKERQDSVFN  155

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKEAN  SFVV
Sbjct  156   GLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAAVHGAAVLGVPVKATIKEANTNSFVV  215

Query  1039  RTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNI  1218
             +TL+RKTLWEMQTPQ +KP LL+ GFE++ R+GLEVTDDVSIVE LKHPVYITEGSY+NI
Sbjct  216   KTLDRKTLWEMQTPQAMKPNLLRDGFELVKRDGLEVTDDVSIVEYLKHPVYITEGSYTNI  275

Query  1219  KVTTPDDMLLAERILN  1266
             KVTTPDD+LLAER++N
Sbjct  276   KVTTPDDLLLAERLMN  291



>gb|KDP32436.1| hypothetical protein JCGZ_13361 [Jatropha curcas]
Length=240

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG +MPKQYLPLLGQPIALYSF TFSK+  VKEIVVVCDP Y D+FE A +  +++LKFA
Sbjct  1     MGANMPKQYLPLLGQPIALYSFYTFSKMAAVKEIVVVCDPSYQDIFEGARESINVDLKFA  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q +DL+SEL+C+HD+ARPLV + DVEKVLKD W+ GAAVLGVP K+
Sbjct  61    LPGKERQDSVYSGLQAIDLNSELVCVHDSARPLVTSADVEKVLKDAWINGAAVLGVPVKA  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKEAN +SFVVRTL+RKTLWEMQTPQV+KPELL+KGFE++NR GLEVTDDVSIVE LKH
Sbjct  121   TIKEANTDSFVVRTLDRKTLWEMQTPQVMKPELLRKGFELVNRGGLEVTDDVSIVEHLKH  180

Query  1183  PVYITEGSYSNIK  1221
             PV+ITEGSY+NIK
Sbjct  181   PVFITEGSYTNIK  193



>gb|AIY22673.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, partial 
[Pinus kesiya var. langbianensis]
Length=293

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 183/229 (80%), Gaps = 0/229 (0%)
 Frame = +1

Query  514   SLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPI  693
             S S++   A+   + D      +  V +KSVSVILLAGG GKRMG SMPKQYLPLLGQPI
Sbjct  65    SKSRLRAKAVSDKDADDISSQTNELVPKKSVSVILLAGGKGKRMGASMPKQYLPLLGQPI  124

Query  694   ALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV  873
             ALYSF  FS +P+VKEIVVVCDP Y D+FE+A     + LKFA PGKERQDSV+NG QE+
Sbjct  125   ALYSFRIFSLMPEVKEIVVVCDPSYRDIFEEAQNSVTVYLKFASPGKERQDSVFNGLQEI  184

Query  874   DLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNR  1053
             D  +EL+C+HD+ARPLVL  DV+KVL D W+ GAAVLGVP K+TIKEA+N++FV RTLNR
Sbjct  185   DQMTELVCVHDSARPLVLNEDVKKVLNDAWVHGAAVLGVPVKATIKEASNDNFVTRTLNR  244

Query  1054  KTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITE  1200
             +TLWEM TPQVIKP LL+KGFE++ REGLEVTDDVSIVE LKHP YITE
Sbjct  245   QTLWEMHTPQVIKPSLLRKGFEVVYREGLEVTDDVSIVEHLKHPGYITE  293



>ref|XP_001767079.1| predicted protein [Physcomitrella patens]
 gb|EDQ68000.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   322 bits (824),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 189/223 (85%), Gaps = 0/223 (0%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             ++VSV+LLAGG G RMG +MPKQYLPLLG+PIAL+SF TF+ + +V EIVVVCDP Y  +
Sbjct  107   QTVSVVLLAGGKGTRMGANMPKQYLPLLGRPIALHSFQTFAHMMEVLEIVVVCDPSYRGI  166

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             FE+A K   + +KFA+PGKERQDSV +G  E+  S++L+CIHD+ARPLVLA D+ KVLKD
Sbjct  167   FEEAAKDVAVPVKFAIPGKERQDSVRSGLNEISSSAKLVCIHDSARPLVLAKDIRKVLKD  226

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
               + GAAVLGVP K+TIKEA ++ FV +TL+RK LWEMQTPQVI+PELL++GFE++ RE 
Sbjct  227   AAIHGAAVLGVPVKATIKEAASDGFVSKTLDRKYLWEMQTPQVIEPELLRRGFELVEREH  286

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             LEVTDDVSIVE LKH V+ITEGSY+N+KVTTPDD+L+AERIL+
Sbjct  287   LEVTDDVSIVEHLKHLVFITEGSYTNLKVTTPDDLLVAERILH  329



>ref|XP_001776808.1| predicted protein [Physcomitrella patens]
 gb|EDQ58358.1| predicted protein [Physcomitrella patens]
Length=232

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 183/223 (82%), Gaps = 7/223 (3%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             +SVSVILLAGG G RMG +MPKQYLPLLG+PIAL+SF TF+ + +V EIVVVCDP Y DV
Sbjct  7     QSVSVILLAGGKGTRMGANMPKQYLPLLGRPIALHSFQTFAHMMEVLEIVVVCDPSYRDV  66

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             FE+A K   + +KFA+PGKERQDSV +G         L+C+HD+ARPLVL  D+ KVL D
Sbjct  67    FEEAAKDVAVPVKFAMPGKERQDSVRSGLN-------LVCVHDSARPLVLVKDIRKVLND  119

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
               + GAAVLGVP K+TIKEA ++ FV +TL+RK LWEMQTPQVI+PELL++GFE++ RE 
Sbjct  120   AAVHGAAVLGVPVKATIKEAASDGFVTKTLDRKYLWEMQTPQVIEPELLRRGFELVEREH  179

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             LEVTDDVSIVE LKH V+ITEGSY+N+KVTTPDD+L+AERIL+
Sbjct  180   LEVTDDVSIVEHLKHMVFITEGSYTNLKVTTPDDLLVAERILH  222



>ref|XP_011028436.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Populus euphratica]
Length=285

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VKEKSVSVILLAGG GKRMG +MPKQYLPLLGQPIALYS  TFS++ +VKEI+VVCDP Y
Sbjct  81    VKEKSVSVILLAGGQGKRMGANMPKQYLPLLGQPIALYSLYTFSEMDEVKEIIVVCDPSY  140

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              D+FED+ ++ +++LKFALPGKERQDSVY+G QEVDL+SEL+CIHD+ARPLVL+ DVEKV
Sbjct  141   KDIFEDSQEQINVDLKFALPGKERQDSVYSGLQEVDLNSELVCIHDSARPLVLSEDVEKV  200

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             LKDGW+ GAAVLGVP K+TIKEA+ ESFVVRTL+RKTLWEMQTPQV+KPELLKKGFE++N
Sbjct  201   LKDGWINGAAVLGVPVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVN  260

Query  1129  R  1131
             R
Sbjct  261   R  261



>gb|KHF99642.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Gossypium arboreum]
Length=335

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 181/235 (77%), Gaps = 7/235 (3%)
 Frame = +1

Query  544   YGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSK  723
             YG+            V EKSVSVILLAGG GKRMG SMPKQYLPLLGQPIALY       
Sbjct  59    YGIKCSAKVDYGSAVVNEKSVSVILLAGGKGKRMGASMPKQYLPLLGQPIALYRLVVNVV  118

Query  724   LPQVKEIVVVCDPFYNDV-------FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLS  882
                +  +++       D          +A  K +++LKF LPGKERQDSVY+G Q VDL+
Sbjct  119   FVYLFLMMIFDSSSSGDTSCNMMIFVAEAIDKINVDLKFTLPGKERQDSVYSGLQAVDLN  178

Query  883   SELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTL  1062
             SEL+CIHD+ARPLV +GDVEKVLKDGWL+GAAVLGVP K+TIKEAN++S+VV+TL+RKTL
Sbjct  179   SELVCIHDSARPLVRSGDVEKVLKDGWLIGAAVLGVPVKATIKEANSDSYVVKTLDRKTL  238

Query  1063  WEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVT  1227
             WEMQTPQVIKPELL+KGFE+++REGLEVTDDVSIVE LKHPVY+TEG Y+NIKV+
Sbjct  239   WEMQTPQVIKPELLRKGFELVHREGLEVTDDVSIVEHLKHPVYVTEGCYTNIKVS  293



>gb|KCW57181.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=256

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 177/223 (79%), Gaps = 15/223 (7%)
 Frame = +1

Query  466   LHPR-TGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKR  642
             +HPR T KIV       S +++ CS   G + +     +   V+E SVSVILLAGG GKR
Sbjct  47    IHPRRTAKIVA------SSTRVHCS---GKDDN-----SVTVVREGSVSVILLAGGKGKR  92

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             MG SMPKQYLPLLGQPIALYSF TFS++ +VKEI+VVCDP Y D+FED  ++  ++LKF 
Sbjct  93    MGASMPKQYLPLLGQPIALYSFYTFSQMREVKEIIVVCDPSYKDIFEDTKEEIQVDLKFT  152

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPGKERQDSVY+G Q VD  SEL+CIHD+ARPLV  GD+EKVLKDGW  GAAVLGVP K+
Sbjct  153   LPGKERQDSVYSGLQAVDSGSELVCIHDSARPLVSRGDIEKVLKDGWENGAAVLGVPVKA  212

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             TIKEAN+ESFVVRTL+RKTLWEMQTPQVIKP LLK+GFE++NR
Sbjct  213   TIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNR  255



>ref|XP_002519366.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF42983.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplast 
precursor, putative [Ricinus communis]
Length=285

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/253 (62%), Positives = 184/253 (73%), Gaps = 17/253 (7%)
 Frame = +1

Query  508   RRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQ  687
             R + + I CSA            +   VKEKSVSVILLAGG GKRMG SMPKQYLPLLGQ
Sbjct  47    RIATTTIKCSA--------KTENSSATVKEKSVSVILLAGGKGKRMGASMPKQYLPLLGQ  98

Query  688   PIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQ  867
             PIALYS  TFSK+ +VKEIVVVCDP Y DVFEDA +  +++LKFALPGKERQDSVY+G Q
Sbjct  99    PIALYSLYTFSKMIEVKEIVVVCDPSYQDVFEDAKENINVDLKFALPGKERQDSVYSGLQ  158

Query  868   EVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTL  1047
              VD +SEL+C+HD+ARPLV + D+EKVLKD W+ GAAVLGVP K+TIKE    +     L
Sbjct  159   AVDSNSELVCVHDSARPLVSSADIEKVLKDAWVNGAAVLGVPVKATIKENALGNAYPTGL  218

Query  1048  NRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVT  1227
               K     +   +++   +         +GLEVTDDVSIVE LKHPV+ITEGSY+NIKVT
Sbjct  219   KLKDFTSSKGTSILEQLFI---------DGLEVTDDVSIVEHLKHPVFITEGSYTNIKVT  269

Query  1228  TPDDMLLAERILN  1266
             TPDD+LLAERILN
Sbjct  270   TPDDLLLAERILN  282



>dbj|BAF52631.1| 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol synthase [Oryza 
sativa Japonica Group]
Length=206

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 177/206 (86%), Gaps = 0/206 (0%)
 Frame = +1

Query  655   MPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGK  834
             MPKQYLPLLG PIAL+S  TF +L +VKE+VVVCDP Y D+FE + +   I +KFALPGK
Sbjct  1     MPKQYLPLLGLPIALHSLKTFCQLKEVKEVVVVCDPDYKDIFEGSIENVQIPIKFALPGK  60

Query  835   ERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKE  1014
             ERQDSVYNG QE+D  SEL+C+HD+ARPLV + DV+KVL+D  + GAAVLGVP K+TIKE
Sbjct  61    ERQDSVYNGLQEIDGDSELVCVHDSARPLVSSEDVKKVLEDAIVHGAAVLGVPVKATIKE  120

Query  1015  ANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYI  1194
             A++ SFVV+TL+RKTLWEMQTPQV++P LL+ GFE++ R+GLEVTDDVSIVE LKH VYI
Sbjct  121   ADSNSFVVKTLDRKTLWEMQTPQVMRPSLLRDGFELVKRDGLEVTDDVSIVEYLKHSVYI  180

Query  1195  TEGSYSNIKVTTPDDMLLAERILNAR  1272
             TEGSY+NIKVTTPDD+LLAER++N +
Sbjct  181   TEGSYTNIKVTTPDDLLLAERLMNEK  206



>ref|XP_006395779.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
 gb|ESQ33065.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
Length=279

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = +1

Query  577   ADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC  756
             ++  VKEKSVSVILLAGG GKRM +SMPKQY+PLLGQPIALYSF TFS++P+VKEIVVVC
Sbjct  78    SNTVVKEKSVSVILLAGGQGKRMKMSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVC  137

Query  757   DPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             DPF+ D F +  +   ++LKFALPGKERQDSV++G QE+D++SEL+CIHD+ARPLV   D
Sbjct  138   DPFFRDYFGEYEETIDVDLKFALPGKERQDSVHSGLQEIDVNSELVCIHDSARPLVDTED  197

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             V+KVLKDG  VGAAVLGVPAK+TIKE N++S VV+TL+RKTLWEMQTPQVIKPELLK+GF
Sbjct  198   VKKVLKDGLAVGAAVLGVPAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGF  257

Query  1117  EIINR  1131
             E++ R
Sbjct  258   ELVKR  262



>ref|XP_002503621.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64879.1| predicted protein [Micromonas sp. RCC299]
Length=271

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 174/233 (75%), Gaps = 3/233 (1%)
 Frame = +1

Query  571   RC-ADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV  747
             RC A  AV++ SVSV+LLAGG+GKRM   MPKQYLPLLG PIALYS   F+++ +V EIV
Sbjct  35    RCVAAAAVEKDSVSVVLLAGGVGKRMKADMPKQYLPLLGTPIALYSLKKFAEMEEVGEIV  94

Query  748   VVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVL  927
             VVCDP Y D+FE  G      +KFALPGKERQDSV+NG  EV   + L  IHD+ARPLV 
Sbjct  95    VVCDPSYRDIFE--GCPVSKPVKFALPGKERQDSVFNGLSEVREGAALAAIHDSARPLVD  152

Query  928   AGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLK  1107
               DV +   D    GAAVL V  K+T+KEAN++  + +TL+R  LWEMQTPQVIKP+LLK
Sbjct  153   LADVRRCCADAMEHGAAVLAVRCKATVKEANDDLSIAKTLDRSKLWEMQTPQVIKPDLLK  212

Query  1108  KGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             +GF+++N +G EVTDDVSIVE +   V ITEGSY NIKVTTP+DM +AER+LN
Sbjct  213   EGFKLVNEKGYEVTDDVSIVEFMGERVQITEGSYVNIKVTTPEDMFIAERLLN  265



>ref|XP_005649705.1| 2-C-methyl-D-erythritol 4-phosphate cy [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25161.1| 2-C-methyl-D-erythritol 4-phosphate cy [Coccomyxa subellipsoidea 
C-169]
Length=259

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 176/232 (76%), Gaps = 2/232 (1%)
 Frame = +1

Query  577   ADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC  756
             AD  V+  +VS ILLAGG+GKRMG S+PKQYL LLGQPIA+YS  T S +P++ E+V+VC
Sbjct  17    ADYLVEPGTVSFILLAGGVGKRMGASIPKQYLELLGQPIAMYSLQTMSSMPEIGEVVIVC  76

Query  757   DPFYNDVFEDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLA  930
             DP Y ++F+    +  ++  L FA PGKERQDSVYNGF   +  S L+ IHD+ARPLV  
Sbjct  77    DPSYRELFQGYYDRLPVKPLLVFAEPGKERQDSVYNGFAASNPDSVLVAIHDSARPLVTV  136

Query  931   GDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKK  1110
              DV + LKDG  VGAAVLGVP K TIKE +++  VV+TL R  LWE+QTPQVI+P LLK+
Sbjct  137   QDVRRCLKDGLEVGAAVLGVPVKPTIKEVDSDRNVVKTLARAALWEVQTPQVIRPALLKE  196

Query  1111  GFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             GFE++  + LEVTDDVSI+E L  PV +T+GSY+NIKVTTPDDM +AER L+
Sbjct  197   GFELVREKSLEVTDDVSIIEALGRPVRVTQGSYTNIKVTTPDDMSVAERFLS  248



>ref|XP_002958218.1| hypothetical protein VOLCADRAFT_84386 [Volvox carteri f. nagariensis]
 gb|EFJ40752.1| hypothetical protein VOLCADRAFT_84386 [Volvox carteri f. nagariensis]
Length=323

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 191/280 (68%), Gaps = 17/280 (6%)
 Frame = +1

Query  430   YSISYCPKVPSFLHPRTGKIVPLRSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVS  609
             +S + C   P+    R+ ++ P R  R  L    C ++               +++ S+S
Sbjct  34    FSSARCCARPAG---RSHRLAPGREGRTMLIVRACGSVAAT------------LEKGSIS  78

Query  610   VILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED-  786
             V+LLAGG+GKRMG ++PKQYL L GQPIA YS +TF+++P+V EIV+VCDP + DVFE  
Sbjct  79    VVLLAGGVGKRMGAAIPKQYLELRGQPIATYSLETFARMPEVGEIVIVCDPSWRDVFEKR  138

Query  787   -AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
               G   H++ K+ALPG ERQDSV+NG Q+VD  + ++ +HD+ARPLV   D  K + DG 
Sbjct  139   FPGLPSHMKFKWALPGPERQDSVFNGLQQVDAGAAIVAVHDSARPLVTPADAAKCMSDGL  198

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
             +VGAAVLGV  K TIKE + +  V++TL R  LWE+QTPQ I+P LL++GF+++  + LE
Sbjct  199   VVGAAVLGVQVKPTIKEVDKDLMVIKTLQRSKLWEVQTPQCIRPALLREGFDLVKSQNLE  258

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             VTDDVSI+E +  PV IT GSY+NIKVTTPDDM +AE+ L
Sbjct  259   VTDDVSIIEAMGKPVKITPGSYTNIKVTTPDDMAVAEKFL  298



>ref|XP_007023793.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
 gb|EOY26415.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
2, partial [Theobroma cacao]
Length=232

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 166/216 (77%), Gaps = 8/216 (4%)
 Frame = +1

Query  457   PSFLH-----PRTGKIVPLRSSRRSLS-KITCSALYGVNGDLHKRCADLAVKEKSVSVIL  618
             P F H     P  G+ V LR   R  S +I CSA   V+  L        VKE+SVSVIL
Sbjct  14    PFFSHIHINFPSPGRNVELRRRARIGSCRIKCSA--EVDNLLVCTQGSAKVKERSVSVIL  71

Query  619   LAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKK  798
             LAGG GKRMG SMPKQYLPLLGQPIALYS  TFS++ +VKEIVVVCDP YND+FE+   K
Sbjct  72    LAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRMIEVKEIVVVCDPSYNDIFEETKDK  131

Query  799   FHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAA  978
              +++LKF LPGKERQDSVY+G Q VD + EL+CIHD+ARPLV +GDVEKVLKDGWLVGAA
Sbjct  132   INVDLKFTLPGKERQDSVYSGLQAVDSNCELVCIHDSARPLVTSGDVEKVLKDGWLVGAA  191

Query  979   VLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQV  1086
             VLGVP K+TIKEAN+ S+VVRTL RKTLWEMQTPQV
Sbjct  192   VLGVPVKATIKEANSHSYVVRTLERKTLWEMQTPQV  227



>ref|XP_001698942.1| 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Chlamydomonas 
reinhardtii]
 gb|EDO99224.1| 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Chlamydomonas 
reinhardtii]
Length=319

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 172/227 (76%), Gaps = 8/227 (4%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             SVSV+LLAGG+GKRMG ++PKQYL L GQPIA YS +TF+ +P+V EIV+VCDP + DVF
Sbjct  84    SVSVVLLAGGVGKRMGAAIPKQYLELRGQPIATYSLETFAHMPEVGEIVIVCDPSWRDVF  143

Query  781   EDAGKKF-----HIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             E   K+F     H++ K+ALPG ERQDSV+NG Q+VD  + ++ +HD+ARPLV A D  +
Sbjct  144   E---KRFPGLPDHLKFKWALPGAERQDSVFNGLQQVDAGAAIVAVHDSARPLVTAADALR  200

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
              + DG  +GAAVLGV  K TIKE +    V++TL R  LWE+QTPQ I+P LLK+GF+++
Sbjct  201   CMLDGASIGAAVLGVQVKPTIKEVDKSGMVIQTLQRSKLWEVQTPQCIRPALLKEGFDLV  260

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              R  LEVTDDVSI+E +  PV IT G+Y+NIKVTTPDDM +AE+ L+
Sbjct  261   KRNNLEVTDDVSIIEAMGKPVKITPGAYTNIKVTTPDDMAVAEKFLD  307



>ref|XP_007023794.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3, partial [Theobroma cacao]
 gb|EOY26416.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
3, partial [Theobroma cacao]
Length=238

 Score =   280 bits (715),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 165/216 (76%), Gaps = 14/216 (6%)
 Frame = +1

Query  457   PSFLH-----PRTGKIVPLRSSRRSLS-KITCSALYGVNGDLHKRCADLAVKEKSVSVIL  618
             P F H     P  G+ V LR   R  S +I CSA    NG          VKE+SVSVIL
Sbjct  14    PFFSHIHINFPSPGRNVELRRRARIGSCRIKCSAEVD-NGSAK-------VKERSVSVIL  65

Query  619   LAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKK  798
             LAGG GKRMG SMPKQYLPLLGQPIALYS  TFS++ +VKEIVVVCDP YND+FE+   K
Sbjct  66    LAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRMIEVKEIVVVCDPSYNDIFEETKDK  125

Query  799   FHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAA  978
              +++LKF LPGKERQDSVY+G Q VD + EL+CIHD+ARPLV +GDVEKVLKDGWLVGAA
Sbjct  126   INVDLKFTLPGKERQDSVYSGLQAVDSNCELVCIHDSARPLVTSGDVEKVLKDGWLVGAA  185

Query  979   VLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQV  1086
             VLGVP K+TIKEAN+ S+VVRTL RKTLWEMQTPQV
Sbjct  186   VLGVPVKATIKEANSHSYVVRTLERKTLWEMQTPQV  221



>ref|XP_007023795.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
4, partial [Theobroma cacao]
 gb|EOY26417.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
4, partial [Theobroma cacao]
Length=226

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 165/216 (76%), Gaps = 14/216 (6%)
 Frame = +1

Query  457   PSFLH-----PRTGKIVPLRSSRRSLS-KITCSALYGVNGDLHKRCADLAVKEKSVSVIL  618
             P F H     P  G+ V LR   R  S +I CSA    NG          VKE+SVSVIL
Sbjct  14    PFFSHIHINFPSPGRNVELRRRARIGSCRIKCSAEVD-NGSAK-------VKERSVSVIL  65

Query  619   LAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKK  798
             LAGG GKRMG SMPKQYLPLLGQPIALYS  TFS++ +VKEIVVVCDP YND+FE+   K
Sbjct  66    LAGGKGKRMGASMPKQYLPLLGQPIALYSLYTFSRMIEVKEIVVVCDPSYNDIFEETKDK  125

Query  799   FHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAA  978
              +++LKF LPGKERQDSVY+G Q VD + EL+CIHD+ARPLV +GDVEKVLKDGWLVGAA
Sbjct  126   INVDLKFTLPGKERQDSVYSGLQAVDSNCELVCIHDSARPLVTSGDVEKVLKDGWLVGAA  185

Query  979   VLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQV  1086
             VLGVP K+TIKEAN+ S+VVRTL RKTLWEMQTPQV
Sbjct  186   VLGVPVKATIKEANSHSYVVRTLERKTLWEMQTPQV  221



>gb|KFM29052.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Auxenochlorella protothecoides]
Length=340

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 164/223 (74%), Gaps = 2/223 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSV+LL+GG GKRMG ++PKQYL +LG+PI  YSF TF  +P+V E+VVVCDP +  VFE
Sbjct  97    VSVVLLSGGTGKRMGAAIPKQYLKILGEPICTYSFRTFLAMPEVAEVVVVCDPSWRHVFE  156

Query  784   DA--GKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             +A  G   H  L F+ PG ERQDSV+NGFQ +  SS L+ IHD+ARPLV    V   L+D
Sbjct  157   EAYAGSTQHAALVFSQPGVERQDSVFNGFQVIRPSSTLVAIHDSARPLVKPEHVRLCLQD  216

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
                VGAAVLGV AK+TIKE +    VVRTL R  LWE+QTPQVI P LL+ GF+++ R G
Sbjct  217   AAQVGAAVLGVQAKATIKEVDGALGVVRTLRRDALWEVQTPQVIAPVLLRAGFDLVRRRG  276

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             LEVTDDVSIVE L  PV +T GSY+NIKVTTP D+L+AER L 
Sbjct  277   LEVTDDVSIVEALGEPVRVTSGSYTNIKVTTPSDILIAERFLK  319



>ref|XP_001418750.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (4-diphosphocytidyl-2C-methyl-D-erythritol 
 synthase) (MEP cytidylyltransferase) 
 (MCT) (ISPD) [Ostreococcus lucimarinus CCE9901]
 gb|ABO97043.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase) (MEP cytidylyltransferase) 
(MCT) (ISPD) [Ostreococcus lucimarinus CCE9901]
Length=275

 Score =   268 bits (685),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 164/226 (73%), Gaps = 2/226 (1%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V + +VS +LLAGG+GKRMG  MPKQYLPL+G PIAL+S   F+K+ +V EIVVVCDP Y
Sbjct  45    VADGAVSFVLLAGGVGKRMGADMPKQYLPLMGTPIALWSLRKFAKMAEVGEIVVVCDPSY  104

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
             +DVF+   +     L FA PGKERQDSVYNG Q     +EL+ IHD+ARPL  A D  + 
Sbjct  105   DDVFQ--SEAIDKPLVFARPGKERQDSVYNGMQAARAGAELLAIHDSARPLCAATDARRC  162

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
               D    GAAVL V +K+TIKE N +  + + L+R  LWEMQTPQV++PELL+ G++++N
Sbjct  163   FNDAKKYGAAVLAVQSKATIKEVNKDLSIDKGLDRSRLWEMQTPQVMRPELLRAGYDLVN  222

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              +GLEVTDDVSIVE L   V +T GSY N+KVTTP+DM +AER++ 
Sbjct  223   SKGLEVTDDVSIVEALGERVQVTPGSYFNLKVTTPEDMFIAERLMT  268



>emb|CEF98811.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, partial 
[Ostreococcus tauri]
Length=253

 Score =   266 bits (681),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 164/225 (73%), Gaps = 2/225 (1%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             VK+ +VS +LLAGG+GKRMG  +PKQYLPL+G PIA++S   F+ +P+V EIVVVCDP Y
Sbjct  23    VKDGAVSFVLLAGGVGKRMGADVPKQYLPLMGTPIAIWSLKKFATMPEVGEIVVVCDPSY  82

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
             +DVF          L FA PGKERQDSVYNG Q     +EL+ IHD+ARPL    D  + 
Sbjct  83    DDVFSSVA--IEKPLTFARPGKERQDSVYNGMQAAREGAELLAIHDSARPLCALADARRC  140

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
               D    GAAVL V +K+TIKE N +  + +TL+R  LWEMQTPQV++PELL++G++++N
Sbjct  141   FNDAKTHGAAVLAVQSKATIKEVNADLSIDKTLDRSRLWEMQTPQVMRPELLRRGYDLVN  200

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              +GLEVTDDVSIVE L   V +T GSY N+KVTTP+DM +AER++
Sbjct  201   SKGLEVTDDVSIVEHLGERVQVTPGSYFNLKVTTPEDMFIAERLM  245



>ref|XP_007513665.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bathycoccus 
prasinos]
 emb|CCO16190.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bathycoccus 
prasinos]
Length=286

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 163/226 (72%), Gaps = 2/226 (1%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFY  768
             V++ SV+++LLAGG+GKRMG +MPKQYLPLL  PIA+YS   F+ + ++ EIVVVC+  Y
Sbjct  55    VEDNSVTLVLLAGGVGKRMGANMPKQYLPLLDVPIAVYSLRKFATMREIGEIVVVCNEEY  114

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
             +DVF    +K    L  A PG ERQDSVYNG  +    ++L+ IHD+ARPL    D  + 
Sbjct  115   DDVF--TSEKISKPLVIARPGAERQDSVYNGITKARKETKLLAIHDSARPLTDLEDARRC  172

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
              +DG   GAAVL V  K+TIK+AN +  + +TL+R  LWEMQTPQVI+P LLK+GF+ + 
Sbjct  173   FEDGAKFGAAVLAVKCKATIKQANKDGSIDKTLDRSLLWEMQTPQVIEPNLLKEGFQYVK  232

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
               GLEVTDDVS+VE L   V ITEGSY NIKVTTP+DM +AER+LN
Sbjct  233   ENGLEVTDDVSVVEHLGKRVQITEGSYYNIKVTTPEDMFIAERLLN  278



>ref|XP_003055525.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60777.1| predicted protein [Micromonas pusilla CCMP1545]
Length=205

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = +1

Query  655   MPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGK  834
             MPKQYLPLLG PIALYS   F+++ +V EIVVVCDP Y DVFE+        +KFALPGK
Sbjct  1     MPKQYLPLLGTPIALYSLKKFAEMDEVGEIVVVCDPSYRDVFEECA--VSKPVKFALPGK  58

Query  835   ERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKE  1014
             ERQDSV+NG  EV   + L  IHD+ARPLV   D  +  +D    GAAVL V  K+T+KE
Sbjct  59    ERQDSVFNGLSEVRDGAALAAIHDSARPLVSLDDARRCFQDAMEHGAAVLAVKCKATVKE  118

Query  1015  ANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYI  1194
             AN++  + +TL+R  LWEMQTPQVIKPE+LK+GF+++N +G EVTDDVSIVE +   V I
Sbjct  119   ANDDLSIAKTLDRSKLWEMQTPQVIKPEILKEGFKLVNEKGYEVTDDVSIVEFMGRRVQI  178

Query  1195  TEGSYSNIKVTTPDDMLLAERILN  1266
             TEGSY NIKVTTP+DM +AER++N
Sbjct  179   TEGSYVNIKVTTPEDMFIAERLMN  202



>ref|XP_005705241.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Galdieria 
sulphuraria]
 gb|EME28721.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Galdieria 
sulphuraria]
Length=322

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/227 (56%), Positives = 162/227 (71%), Gaps = 1/227 (0%)
 Frame = +1

Query  592   KEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYN  771
             +E S SVILLAGG GKRM  ++PKQYL L G+P+  YS + F  + QV ++++V D  Y 
Sbjct  86    RESSCSVILLAGGSGKRMNSNIPKQYLLLHGKPVLEYSLELFLSVKQVFQVIIVMDLHYK  145

Query  772   DVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              VF          ++FA PGKERQDSVYNG Q+V  + +L+CIHDAARPLV    +EK  
Sbjct  146   -VFLCPHLIQDPRVEFACPGKERQDSVYNGLQKVKNNVDLVCIHDAARPLVSKETIEKCF  204

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
              D  + GAAV+GVP+KSTIKE+ + SFV RTL+R  LWE+QTPQVI+PELL++GF  +N 
Sbjct  205   SDAAVYGAAVVGVPSKSTIKESVDGSFVYRTLDRTRLWEIQTPQVIRPELLRRGFVRVND  264

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             E + VTDDVSIVE L  PV +T G YSNIK+TT +D+ +AE IL +R
Sbjct  265   ENVTVTDDVSIVEKLGEPVKLTLGEYSNIKLTTEEDLKVAEYILLSR  311



>ref|WP_013924196.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Parachlamydia 
acanthamoebae]
 ref|YP_004651001.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Parachlamydia 
acanthamoebae UV-7]
 emb|CCB85147.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Parachlamydia acanthamoebae UV-7]
Length=229

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 162/224 (72%), Gaps = 2/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VSVILLAGG+G RM  ++PKQ+LPL+ +P+A YS + F +L +V EIVVVCDP Y+ +F
Sbjct  2     TVSVILLAGGIGARMRQNLPKQFLPLVEKPVAFYSLECFMELSEVGEIVVVCDPAYHALF  61

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
              D  +   I   FALPG  RQDSV++G Q +  +S+++CIHDAARP +    +++VL   
Sbjct  62    ADYAQDTRIH--FALPGVRRQDSVWSGLQAIKQASQIVCIHDAARPFIDHALIKRVLSAA  119

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA +G+P K T+K++    FV +TL+R  LWE+QTPQ +   LL +GF+ +++ G+
Sbjct  120   SEHGAATVGMPIKFTLKQSTATGFVDKTLDRSLLWEIQTPQAVDFHLLYQGFDKVHQMGI  179

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             +VTDDVSI+ELL+ PV + EG Y+N+K+TTP+DM++AE+ L  +
Sbjct  180   DVTDDVSIIELLEKPVKLVEGDYANLKITTPEDMVVAEQWLAKK  223



>gb|EWM22399.1| 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase [Nannochloropsis 
gaditana]
Length=310

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 159/225 (71%), Gaps = 1/225 (0%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             + VSV+LLAGG+GKRM    PKQ++ LLG+P+ L+S + FS LP V  IV+V D  Y   
Sbjct  82    EGVSVVLLAGGVGKRMKADRPKQFIELLGKPVLLHSLEIFSTLPGVNRIVIVLDKSYRQE  141

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             F    ++    + FA PGKERQDSV+NGF +    + ++CIHD+ARPLV    V   L+D
Sbjct  142   FSFLQEE-DPRIVFADPGKERQDSVFNGFSQTLPDASVVCIHDSARPLVSQSAVLASLRD  200

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
             G + GAAVLGVP K+T+KE+ +  FV+RT+NR  LWE+QTPQVIKP++L + F ++  +G
Sbjct  201   GSVHGAAVLGVPMKATVKESADGEFVLRTMNRSRLWEIQTPQVIKPDILSEAFALVTEKG  260

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             LEVTDDVS+VE +  PV +T G Y+NIK+TTP+D+ +AE  L  R
Sbjct  261   LEVTDDVSMVEQVGRPVKLTMGEYTNIKLTTPEDIGVAEGFLRER  305



>ref|WP_006340611.1| hypothetical protein [Parachlamydia acanthamoebae]
 gb|EFB42233.1| hypothetical protein pah_c014o180 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=229

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 162/224 (72%), Gaps = 2/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VSVILLAGG+G RM  ++PKQ+LPL+ +P+A YS + F +L +V EIVVVCDP Y+ +F
Sbjct  2     TVSVILLAGGIGARMRQNLPKQFLPLVEKPVAFYSLECFMELSEVGEIVVVCDPAYHALF  61

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
              D  +   +   FALPG  RQDSV++G Q +  +S+++CIHDAARP +    +++VL   
Sbjct  62    ADYTQDTRVH--FALPGVRRQDSVWSGLQAIKQASQIVCIHDAARPFIDHALIKRVLSAA  119

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA +G+P K T+K++    FV +TL+R  LWE+QTPQ +   LL +GF+ +++ G+
Sbjct  120   SEHGAATVGMPIKFTLKQSTATGFVDKTLDRSLLWEIQTPQAVDFHLLYQGFDKVHQMGI  179

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             +VTDDVSI+ELL+ PV + EG Y+N+K+TTP+DM++AE+ L  +
Sbjct  180   DVTDDVSIIELLEKPVKLVEGDYANLKITTPEDMVVAEQWLAKK  223



>emb|CBJ33583.1| 4-diphosphocytidyl-2C-methyl-D-erythritol synthase, chloroplast 
precursor [Ectocarpus siliculosus]
Length=366

 Score =   232 bits (592),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/228 (51%), Positives = 161/228 (71%), Gaps = 1/228 (0%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             ++V+ ++LAGG+GKRM   MPKQ+L L G+ +  +S   F +L  V ++++V D  Y  +
Sbjct  57    ENVAAVVLAGGVGKRMEAGMPKQFLELQGETVLEHSLKLFLRLKGVSQLILVLDEQYRPM  116

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
              +D  K+    L FA PG ERQ SVYN  Q+V+  S L+CIHDAARPLV    V+KV+ D
Sbjct  117   LQDLQKR-EGRLVFADPGLERQHSVYNALQKVEDGSSLVCIHDAARPLVTKAAVKKVIAD  175

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
                 GAAVLGVP K+T+KE+ +  FV RT++R  LW++QTPQV+KP+LL++GF+ +  E 
Sbjct  176   ADEYGAAVLGVPMKATVKESADGQFVQRTIDRSRLWDIQTPQVVKPDLLRRGFDKVMSER  235

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFNY  1281
              EVTDDVSIVE L  PV +TEG Y+N+K+TTP+D+++A RIL AR  Y
Sbjct  236   WEVTDDVSIVEQLGLPVKLTEGDYTNLKLTTPEDLVVASRILEARRLY  283



>ref|WP_013944231.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Simkania 
negevensis]
 ref|YP_004672256.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Simkania 
negevensis Z]
 emb|CCB89765.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Simkania negevensis Z]
Length=226

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 156/221 (71%), Gaps = 3/221 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +++ ILLAGG G RMG  +PKQ+LPL GQPI  YSFD F  LP++ EI+VVC P +   F
Sbjct  7     TIAAILLAGGTGSRMGGPIPKQFLPLKGQPIVQYSFDLFLSLPEISEIIVVCKPQFQTFF  66

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
             E +  K    ++FALPGKERQDSV +GF  V  S E + IHD+ARPL+   +V K++++G
Sbjct  67    EKSPLK---PIQFALPGKERQDSVASGFAHVSPSCEYVLIHDSARPLIQEEEVRKLIEEG  123

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
              L+GAA LGVP K T+KE +    V +TL+R  L+ +QTPQ+++ ++L KG +   ++GL
Sbjct  124   LLIGAATLGVPMKYTVKEVDENGIVKKTLDRSRLYNIQTPQLLRRDILSKGLKKAQKQGL  183

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              +TDDVS+ EL+ HPV I  GS  N+K+TTP+D  +A++++
Sbjct  184   TLTDDVSLAELIHHPVKIVYGSDENLKITTPEDFEVAKQLV  224



>emb|CDZ79584.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
sp. 'Rubis']
Length=233

 Score =   227 bits (579),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 152/221 (69%), Gaps = 2/221 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             S +VILLAGG+GKRM    PKQ+L + G+PIA YSFD F KLP VKEIVVVC P Y   F
Sbjct  6     STAVILLAGGIGKRMKTVTPKQFLLIEGKPIARYSFDIFMKLPYVKEIVVVCAPKYRHFF  65

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
              ++     I++ F  PG+ RQDSV NG + ++  +++ICIHD+ARP + +  + +V +  
Sbjct  66    PNSHSS--IKVNFTDPGERRQDSVKNGLEAMETKTDIICIHDSARPFIDSEMITRVHESA  123

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
             + +GAA  G+P K T+KE + +  V +T NR   WE+QTPQ IK +L + GF+ +    +
Sbjct  124   YELGAATTGMPLKFTVKEHDGQGIVFKTHNRDLFWEVQTPQAIKRDLFQDGFKFVQENQI  183

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             EVTDDVSIVE +K PV + EGSY N K+TTP+D+LLA+ ++
Sbjct  184   EVTDDVSIVEYIKAPVKLVEGSYQNFKITTPEDLLLAKHLI  224



>ref|XP_005820482.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Guillardia 
theta CCMP2712]
 gb|EKX33502.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Guillardia 
theta CCMP2712]
Length=270

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 148/226 (65%), Gaps = 7/226 (3%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSVILLAGG+G RM    PKQ+L L G+PI  +S + F K+  V  IV+V  P Y D   
Sbjct  46    VSVILLAGGVGSRMKADRPKQFLELEGKPILRHSLELFMKIQGVTRIVIVIAPEYRDSLA  105

Query  784   DAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
             D  KK    + FA PGKERQDSV+NG QE  L + LICIHDAARPLV   ++   + D  
Sbjct  106   DVTKK-DARICFAEPGKERQDSVFNGLQETALDTSLICIHDAARPLVTEQEILSCMNDAL  164

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQV------IKPELLKKGFEII  1125
               GAAVL VP K+T+KE+ +  FV+RT+ R  LWE+ TPQV      I+P LL++GF+ +
Sbjct  165   EHGAAVLAVPMKATVKESEDGKFVLRTIERSRLWEIHTPQVREKEQIIRPALLREGFKKV  224

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
                 L VTDDVSI+E L  PV IT G Y+NIK+TTP+DM +A  IL
Sbjct  225   KELNLAVTDDVSIIEQLPAPVKITVGEYTNIKITTPEDMPMARSIL  270



>ref|XP_008789176.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Phoenix dactylifera]
Length=263

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 129/166 (78%), Gaps = 23/166 (14%)
 Frame = +1

Query  586   AVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPF  765
             AVK+KSVSV+LLAGG GKRMG SMPKQYLPLLGQPIALYSF TFS++ +VKEIVVVCDP 
Sbjct  83    AVKDKSVSVVLLAGGKGKRMGASMPKQYLPLLGQPIALYSFYTFSQMSEVKEIVVVCDPS  142

Query  766   YNDVFE-----------------------DAGKKFHIELKFALPGKERQDSVYNGFQEVD  876
             Y D+FE                       DA ++  I ++FALPGKERQDSV+NGFQE+D
Sbjct  143   YKDIFEGSESLLDPFKVFFLIYVEIGFPFDASEEIQIGVRFALPGKERQDSVFNGFQEID  202

Query  877   LSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKE  1014
              SSEL+CIHD+ARPLV++GD++KVLKD WL GAAVLGVP K+TIKE
Sbjct  203   GSSELVCIHDSARPLVMSGDIKKVLKDAWLNGAAVLGVPVKATIKE  248



>gb|KDO41349.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=228

 Score =   216 bits (551),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 148/191 (77%), Gaps = 14/191 (7%)
 Frame = +1

Query  499   RSSRRSLSKITCSALYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPL  678
             R +R + S+I CSA    NG +        VK+KSVSVILLAGG GKRMG +MPKQYLPL
Sbjct  41    RRARLATSRIRCSAKVD-NGSV-------VVKDKSVSVILLAGGRGKRMGANMPKQYLPL  92

Query  679   LGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYN  858
             LGQPIALYSF TFS++ +VKEIVVVCDP Y+D+FE+  +K +++LKF+LPGKERQDSVY+
Sbjct  93    LGQPIALYSFYTFSRMVEVKEIVVVCDPSYSDIFEETKEKINVDLKFSLPGKERQDSVYS  152

Query  859   GFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVV  1038
             G QEVD +SEL+CIHD+ARPLVL+ DV+KVL D   VGAAVLGVPAK+TIKE +      
Sbjct  153   GLQEVDFNSELVCIHDSARPLVLSKDVQKVLMDALRVGAAVLGVPAKATIKEVHI-----  207

Query  1039  RTLNRKTLWEM  1071
              +L   T+W++
Sbjct  208   -SLCTCTIWDL  217



>ref|WP_032125060.1| hypothetical protein [Chlamydia sp. 'Diamant']
Length=228

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 151/220 (69%), Gaps = 5/220 (2%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE-  783
             +V+ LAGGMG RMG S+PKQYL +  +P+AL+SF+ F+ +P+V +IVVVC+  Y D+F+ 
Sbjct  7     AVVFLAGGMGTRMGGSVPKQYLTIHNKPLALHSFEIFASMPEVHQIVVVCESAYEDLFKL  66

Query  784   DAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
               G K    L FA PG  RQDS++NG Q ++    L+C+HD+ARP + A  + + ++   
Sbjct  67    YEGSK---PLLFARPGLRRQDSLWNGIQFLE-GDPLVCVHDSARPFIGASLIRRAVESAE  122

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
              +GAA +GV  K+TIK  N+E  +V T +R  LWEMQTPQV++  LLK+GF I     + 
Sbjct  123   EIGAAAIGVRVKATIKVCNSEQMIVNTPDRSQLWEMQTPQVVRLNLLKEGFAIAQETNMT  182

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             VTDDV++ EL   P  + EGSY NIKVTTP+D+L+A++ L
Sbjct  183   VTDDVALAELAGKPAKVIEGSYINIKVTTPEDLLVAQKFL  222



>ref|WP_039356540.1| hypothetical protein [Candidatus Protochlamydia amoebophila]
 gb|KIC73593.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Candidatus 
Protochlamydia amoebophila]
Length=230

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 150/219 (68%), Gaps = 3/219 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             +V+LLAGGMG RM   +PKQYL +  +PIAL+SF+  + +P++++++VVC+P Y  +F  
Sbjct  9     TVVLLAGGMGTRMKNLIPKQYLTIQEKPIALHSFEKLASMPEIEQMIVVCEPQYEQLF--  66

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                K +  L FA PG  RQDS++NG + +   + L+CIHD+ARP +    + + + +   
Sbjct  67    TVYKLNKPLTFARPGLRRQDSLWNGIKLIA-GNPLVCIHDSARPFIEIDRIRQTVAEAEK  125

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAAVLGV  K+TIK    + F+V T NR  LWEMQTPQ+++ +LL  GF +  +  L V
Sbjct  126   WGAAVLGVRVKATIKICEEKQFIVNTPNRAFLWEMQTPQIVRLKLLYDGFSVAQKNELTV  185

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +DDVS+VEL+  PV + EGSY NIK+TTP+D+L+A+ IL
Sbjct  186   SDDVSLVELIDKPVKVVEGSYLNIKITTPEDLLIAQSIL  224



>ref|WP_011174877.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Candidatus 
Protochlamydia amoebophila]
 ref|YP_007326.1| 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Candidatus 
Protochlamydia amoebophila UWE25]
 sp|Q6MEE8.1|ISPD_PARUW RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Candidatus Protochlamydia amoebophila UWE25]
 emb|CAF23051.1| putative 4-diphosphocytidyl-2C-methyl-D-erythritol synthase [Candidatus 
Protochlamydia amoebophila UWE25]
Length=230

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/219 (47%), Positives = 150/219 (68%), Gaps = 3/219 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             +V+LLAGGMG RM   +PKQYL +  +PIAL+SF+  + +P++++++VVC+P Y  +F  
Sbjct  9     TVVLLAGGMGTRMKNLIPKQYLTIQEKPIALHSFEKLASMPEIEQMIVVCEPQYEQLF--  66

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                K +  L FA PG  RQDS++NG + +   + L+CIHD+ARP +    + + + +   
Sbjct  67    TVYKLNKPLIFARPGLRRQDSLWNGIKLIA-GNPLVCIHDSARPFIEIDRIRQTVAEAEK  125

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAAVLGV  K+TIK    + F+V T NR  LWEMQTPQ+++ +LL  GF +  +  L V
Sbjct  126   WGAAVLGVRVKATIKICEEKQFIVNTPNRAFLWEMQTPQIVRLKLLYDGFSVAQKNELTV  185

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +DDVS+VEL+  PV + EGSY NIK+TTP+D+L+A+ IL
Sbjct  186   SDDVSLVELIDKPVKVVEGSYLNIKITTPEDLLIAQSIL  224



>ref|WP_039386375.1| hypothetical protein [Neochlamydia sp. TUME1]
 gb|KIC72537.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Neochlamydia 
sp. TUME1]
Length=227

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 150/223 (67%), Gaps = 2/223 (1%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             + VSVILL GG G RM  + PKQ+L L  + IA YS D F  LP+V EIVVVCDP Y   
Sbjct  4     QEVSVILLCGGQGLRMQNATPKQFLTLHNKIIATYSLDVFKTLPEVIEIVVVCDPAYQKF  63

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             F     +  + LKFA PG+ RQDSV+NG + +   +  +CIHD+ARP++    V++VLK 
Sbjct  64    F--TSPELSVPLKFACPGRHRQDSVFNGLKALTSQAGFVCIHDSARPIITPPLVQRVLKA  121

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
              +  GAA  G+P K TIKE +    V +T +R T WE+QTPQV++ ++L++GF    +  
Sbjct  122   AFQHGAAAAGMPIKFTIKEHDGNHIVKQTPDRSTYWEVQTPQVVRKDILEQGFAYALKNH  181

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             L+VTDDVS+VE L HPV + EG Y+N+K+TT +D++LA+ +L+
Sbjct  182   LKVTDDVSLVEHLGHPVKLVEGCYTNLKITTAEDLILAKYLLH  224



>gb|KIC75399.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Neochlamydia sp. EPS4]
Length=228

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/223 (48%), Positives = 149/223 (67%), Gaps = 2/223 (1%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             + VSVILL GG G RM  + PKQ+L L  + IA YS D F  LP+V EIVVVCD  Y   
Sbjct  5     QEVSVILLCGGQGLRMQNATPKQFLTLHNKIIATYSLDVFKALPEVIEIVVVCDLAYQKF  64

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             F  A  +  + LKFA PG+ RQDSV+NG + +   +  +CIHD+ARP++    V++VLK 
Sbjct  65    F--ASPELSVPLKFACPGRHRQDSVFNGLKALTSQAGFVCIHDSARPIITPPLVQRVLKA  122

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
              +  GAA  G+P K TIKE +    V  T +R T WE+QTPQV++ ++L++GF    +  
Sbjct  123   AFQHGAAAAGMPIKFTIKEHDGNHIVKHTPDRSTYWEVQTPQVVRKDILEQGFAYALKNH  182

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             L+VTDDVS+VE L HPV + EG Y+N+K+TT +D++LA+ +LN
Sbjct  183   LKVTDDVSLVEHLGHPVKLVEGCYTNLKITTAEDLILAKYLLN  225



>ref|XP_002288420.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93856.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=313

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/238 (48%), Positives = 153/238 (64%), Gaps = 14/238 (6%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTF-SKLPQV---------KEIVV  750
             +V  ++LAGG G RM  +MPKQ+L L   P+  YS   F  KLP            ++V+
Sbjct  68    NVGFLILAGGTGSRMKANMPKQFLTLKSAPVLHYSLHLFLEKLPSYCKEHGLSSPSQVVL  127

Query  751   VCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQE-VDL---SSELICIHDAARP  918
             V DP Y   ++    K+   L FA PGKERQ SV NG  + V+L   S E + +HD+ARP
Sbjct  128   VMDPKYQPEYQPIVDKYEGRLAFANPGKERQGSVENGLNKLVELAGPSCEFVAVHDSARP  187

Query  919   LVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPE  1098
             LV   ++E V+ D   VGAAVLGVP K+TIKE+++   V RT+ R  LWE+ TPQV+K E
Sbjct  188   LVTIAEIEAVVSDAQSVGAAVLGVPCKATIKESDDGVLVQRTIPRARLWEVHTPQVVKVE  247

Query  1099  LLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              L +GFE + +EGLEVTDDVSI+E L  PV +T+G Y+N+K+TTP+DM +A  IL+ R
Sbjct  248   ALLRGFEKVEKEGLEVTDDVSIIEALGEPVKLTKGEYTNLKITTPEDMDVAGAILSDR  305



>ref|XP_005536078.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79792.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Cyanidioschyzon 
merolae strain 10D]
Length=353

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 154/237 (65%), Gaps = 12/237 (5%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             + VSVILLAGG+G RM    PKQ+L L G+ ++  S   F  LP+V +I++V +  Y + 
Sbjct  99    QPVSVILLAGGLGSRMRADRPKQFLQLCGKTVSERSLLLFLGLPEVTQIIIVVEKRYREA  158

Query  778   FEDAGKKFHIELKFALPGKERQDSVYNGF--------QEVDLSSE-LICIHDAARPLVLA  930
             +          + FA PG ERQDSV +G         +E D + + L+C+HDAARPLV  
Sbjct  159   YFGNYVLRDKRILFADPGLERQDSVRSGLALVPDTVDREKDETDDILVCVHDAARPLVSR  218

Query  931   GDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKK  1110
               +   L+D  + GAA +GVP K+TIKE+ +  FV RT++R  LWE+QTPQV++  LL++
Sbjct  219   SCIRSCLRDASIYGAAAIGVPVKATIKESEDGQFVRRTIDRSRLWEIQTPQVVRARLLRQ  278

Query  1111  GFEIINREGLEVTDDVSIVELL--KH-PVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             GFE   R GL VTDDVS+VELL  KH PV IT G Y+NIK+TTP+DM+LAE I+  R
Sbjct  279   GFENAMRRGLRVTDDVSVVELLDDKHYPVKITMGEYANIKITTPEDMILAEMIIRER  335



>ref|XP_009034896.1| hypothetical protein AURANDRAFT_23670 [Aureococcus anophagefferens]
 gb|EGB10061.1| hypothetical protein AURANDRAFT_23670 [Aureococcus anophagefferens]
Length=266

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 144/220 (65%), Gaps = 4/220 (2%)
 Frame = +1

Query  625   GGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFH  804
             GG+G RM    PKQ L   G+P+  +S D F  L  V  +V+V +  Y   F        
Sbjct  49    GGVGSRMKADRPKQRLA--GKPVLYHSLDLFLGLEGVSSLVLVINEQYRGEFAPYAADGR  106

Query  805   IELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVL  984
             +   FA PG ERQDSV +G       + L+CIHDAARPLV   ++ KV+ D    GAAVL
Sbjct  107   V--TFADPGAERQDSVRSGLDACPADAALVCIHDAARPLVTPEEIFKVIGDARDHGAAVL  164

Query  985   GVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSI  1164
             GVP K+T+KE+++  FV+RT++R  LWE+ TPQVIKP LL++GF+ + +EGLEVTDDVSI
Sbjct  165   GVPVKATVKESDDGEFVLRTVDRSRLWEVHTPQVIKPALLREGFDKVAKEGLEVTDDVSI  224

Query  1165  VELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFNYA  1284
             +E L  PV +T G Y+N+KVTTPDDM++A +IL+ R   A
Sbjct  225   IEQLGLPVKLTLGEYTNLKVTTPDDMVVATQILDQRAAAA  264



>ref|XP_002182074.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46614.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=271

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 116/237 (49%), Positives = 153/237 (65%), Gaps = 14/237 (6%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTF-SKLPQVKE---------IVVV  753
             V  +LLAGG G RM  +MPKQ+L L G P+  +S D F  +LP+  +         +V+V
Sbjct  25    VGFVLLAGGTGSRMKATMPKQFLELRGVPVLHHSLDLFLERLPEHLKAQNKAPPPYVVLV  84

Query  754   CDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQE-VDLSS---ELICIHDAARPL  921
              DP Y + ++    ++   L FA PG ERQ SV NG  + V++S+   + I IHD+ARPL
Sbjct  85    MDPIYQEEYQAIVNRYDGRLVFANPGVERQGSVENGLNKLVEVSNGNCKYIAIHDSARPL  144

Query  922   VLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPEL  1101
             V   ++ KV+ D    GAAVLGVP K+TIKE  + S V+RTL R  LWE+ TPQVIK E 
Sbjct  145   VTIPELCKVVHDAKEYGAAVLGVPCKATIKETEDGSTVLRTLPRARLWEVHTPQVIKIET  204

Query  1102  LKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             L++GF  + RE LEVTDDVSIVE L  PV +T G Y+N+K+TTP+DM +AE IL  R
Sbjct  205   LQRGFVKVARENLEVTDDVSIVEALGEPVKLTLGEYTNLKITTPEDMDVAEAILEER  261



>ref|XP_007154106.1| hypothetical protein PHAVU_003G0909001g, partial [Phaseolus vulgaris]
 gb|ESW26100.1| hypothetical protein PHAVU_003G0909001g, partial [Phaseolus vulgaris]
Length=120

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +1

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             VLKDG   GAAVLGVP K+TIKEAN+ESFVV+TL+RKTLWEMQTPQVIKPELL+KGFE++
Sbjct  1     VLKDGLSNGAAVLGVPVKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLRKGFELV  60

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             NREGLEVTDDVSIVE LKHPVYITEGSY+NIKVTTPDDMLLAERILN
Sbjct  61    NREGLEVTDDVSIVEHLKHPVYITEGSYTNIKVTTPDDMLLAERILN  107



>emb|CDR34199.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Criblamydia 
sequanensis CRIB-18]
Length=230

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/226 (44%), Positives = 141/226 (62%), Gaps = 2/226 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
              S ILL+GG G RMG   PKQYL + GQPIALYSF T +K P ++E+VVV D  +  +F+
Sbjct  3     ASAILLSGGKGLRMGHETPKQYLKIQGQPIALYSFLTLAKHPLIQEVVVVLDEEWEPLFQ  62

Query  784   DAGK--KFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
             +     K  I + FA PGK RQDS+++G ++VD +++LI +HDAARP +   DV   ++ 
Sbjct  63    NFSNENKISIRIAFASPGKRRQDSLHSGLKKVDQTTDLILVHDAARPFIDEKDVTAAIEA  122

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
                 GAA L  P K+TI+ AN     V T  R   +E+QTPQ ++ ++L KGFE   +  
Sbjct  123   AKAHGAATLSTPVKATIRIANESKVAVHTPERDRTFEIQTPQALRFDILLKGFERAIKNN  182

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             + VTDDV++ EL  HP+ + +G   N K+TT  D++LAE +    F
Sbjct  183   ITVTDDVALAELAGHPIRLIDGKEENFKITTRKDLILAEELAKTFF  228



>gb|EJK72911.1| hypothetical protein THAOC_05511 [Thalassiosira oceanica]
Length=389

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/238 (47%), Positives = 146/238 (61%), Gaps = 14/238 (6%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTF-SKLPQVKE---------IVV  750
             +   ++LAGG G RM  SMPKQ+L L   PI  YS   F  KLP   E         +V+
Sbjct  82    NTGFLILAGGTGSRMKASMPKQFLELQSAPILHYSLHLFLEKLPAYCEASGLTSPPQVVL  141

Query  751   VCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEV----DLSSELICIHDAARP  918
             V DP Y   ++    K+   L FA PG ERQ SV NG  ++    D + E I +HD+ARP
Sbjct  142   VLDPKYQPEYQPIVDKYEGRLAFANPGVERQGSVENGLNKLVELSDGACEYIAVHDSARP  201

Query  919   LVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPE  1098
             LV   ++  V+ D   VGAAVLGVP K+TIKE+++   V RT+ R  LWE+ TPQV+K E
Sbjct  202   LVTIEEICNVVSDAHNVGAAVLGVPCKATIKESDDGVTVQRTIPRARLWEVHTPQVVKVE  261

Query  1099  LLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              L  GF+ + +E LEVTDDVSI+E L  PV +T G Y+N+K+TTP+DM +A  IL+ R
Sbjct  262   ALLHGFDKVAKEDLEVTDDVSIIEALGEPVKLTRGEYTNLKITTPEDMDVAGAILSDR  319



>ref|XP_005776753.1| hypothetical protein EMIHUDRAFT_443903 [Emiliania huxleyi CCMP1516]
 gb|EOD24324.1| hypothetical protein EMIHUDRAFT_443903 [Emiliania huxleyi CCMP1516]
Length=214

 Score =   184 bits (466),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 131/210 (62%), Gaps = 0/210 (0%)
 Frame = +1

Query  643   MGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFA  822
             M    PKQ+L LLG+P+  +  +    + +++ IV+V    Y D+           L  A
Sbjct  1     MKADRPKQFLELLGKPVLQWDLELLLSMERLERIVLVIADEYRDLPFLQPFLSDPRLALA  60

Query  823   LPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKS  1002
             LPG ERQ+SV NG   V  +  L+ IHDAARPLV    +E+   D    GAAVL VP K 
Sbjct  61    LPGAERQNSVENGLAAVGDACTLVAIHDAARPLVTIDAIERCFADAAQHGAAVLAVPCKP  120

Query  1003  TIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVTDDVSIVELLKH  1182
             TIKE+ +  FV RTL+R  LW++QTPQ+++P++L+ GF   N   L VTDDVS+VEL+  
Sbjct  121   TIKESADGEFVSRTLDRSKLWDVQTPQILRPQMLRDGFANANANQLAVTDDVSVVELMGE  180

Query  1183  PVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             PV +T G Y+N+K+TTP+DM++AE IL  R
Sbjct  181   PVKLTVGEYTNLKLTTPEDMIIAETILRDR  210



>ref|WP_011876577.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
reducens]
 ref|YP_001111561.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
reducens MI-1]
 sp|A4J0Y3.1|ISPD_DESRM RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Desulfotomaculum reducens MI-1]
 gb|ABO48736.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
reducens MI-1]
Length=234

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 134/227 (59%), Gaps = 3/227 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             ++  ++ A GMG RMG  + KQYL L  +PI  ++ D   ++P +  IV+V  P    + 
Sbjct  3     NIVAVIPAAGMGSRMGTEVKKQYLKLQDRPILAHTIDALEQVPDITGIVLVVSPGEETLC  62

Query  781   ED---AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
             ++    G  F+  +     G  RQ SVY+G   +   +EL+ IHD ARPLV   ++  ++
Sbjct  63    QELILKGNLFNKIMAVVPGGDHRQTSVYHGLCSLPGDTELVVIHDGARPLVQRAEISHII  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+   VGAA L VP K T+K  N++ +V+ T NR+ LW +QTPQV   EL+ K  +    
Sbjct  123   KEARRVGAAALAVPVKDTVKLVNDQGYVIATPNREKLWAVQTPQVFNYELILKAHQDARE  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             +G+  TDD ++VE L  PV + +GSY NIK+TTP+DM++A+  L  R
Sbjct  183   KGVYATDDCALVEALGQPVKLVQGSYENIKITTPEDMVMAQAFLKRR  229



>ref|WP_015755935.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
acetoxidans]
 ref|YP_003189837.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
acetoxidans DSM 771]
 gb|ACV61214.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
acetoxidans DSM 771]
Length=232

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/226 (42%), Positives = 127/226 (56%), Gaps = 3/226 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             +S I+ A G G RMG    KQYL L G+PI  Y+ +TF  +P V  I++V  P       
Sbjct  4     ISTIITAAGQGLRMGTDTRKQYLSLQGKPILSYAIETFIGMPAVNNIILVVSPGDESFCL  63

Query  784   DAGKKFHIELKF---ALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +     H   K       G  RQ+SVYNG   +   + L+ IHD  RPL    +++ +L+
Sbjct  64    ENIIPIHGRSKVQAVVAGGASRQESVYNGLLALPQGTNLVIIHDGVRPLFEGNEIDALLE  123

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                + GAA L VP K T+K  N  + VVRTL R+ LW  QTPQV K +++    +   R 
Sbjct  124   AAAVNGAATLAVPPKDTVKLVNEYNKVVRTLPRERLWLTQTPQVFKYDIIMNAHQKARRH  183

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             G E TDD S+VE+    V + EGSY NIK+TTP+DM++AE ILN R
Sbjct  184   GFEATDDASLVEVSGQQVRVIEGSYENIKITTPEDMIIAEAILNRR  229



>ref|WP_014517588.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
pneumoniae]
 ref|YP_005661761.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae LPCoLN]
 gb|ACZ33557.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae LPCoLN]
 gb|ETR80485.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
pneumoniae B21]
Length=211

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 131/219 (60%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G R G  +PKQYLPL G P+ L+S    S LPQ+ E++VVCDP Y + F++
Sbjct  5     SLILLSGGQGTRFGSKIPKQYLPLNGTPLVLHSLKILSSLPQIAEVIVVCDPSYQETFQE  64

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     + FA+PG+ RQDSV++G Q+V  S   + IHD ARP +   ++  +L+    
Sbjct  65    ------YPVSFAIPGERRQDSVFSGLQQV--SYPWVIIHDGARPFIYPDEIHDLLETAEK  116

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
             +GAA L  P   TIK+ N     VRTL+R  L  + TPQ IK E+L++G  +   + L +
Sbjct  117   IGAAALASPIPYTIKQRNP----VRTLDRDNLAIIHTPQCIKTEILREGLALAKEKQLTL  172

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD+   E++  P  +    +  IK++ P+D+ +A+ +L
Sbjct  173   VDDIEAAEIIGKPSQLVFNKHPQIKISYPEDLTIAQALL  211



>ref|WP_038699059.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Paenibacillus 
stellifer]
 gb|AIQ65754.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Paenibacillus 
stellifer]
Length=232

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 132/223 (59%), Gaps = 4/223 (2%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             +SV V+++A G G RMG    KQYL L G+PI +++ + F + P + EIV+V      + 
Sbjct  3     ESVGVVIVAAGRGTRMGTEESKQYLLLRGRPIIVHTLEIFQQHPLISEIVLVTGAEDVER  62

Query  778   FEDAGKKFHI-ELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
                  +++ I +LK  + G  ERQ SVY G   +D  SE + +HD  RP V + D+E   
Sbjct  63    CRKWAEEYGITKLKAVVTGGAERQHSVYKGLGRLD--SEWVMVHDGVRPFVRSRDIEACY  120

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             ++    GA+VL VP K TIK+ + E  V  T +R+TLW +QTPQ  +   LK+ +E   R
Sbjct  121   EEAKRTGASVLAVPVKDTIKQVSGEGLVTATPDRRTLWAIQTPQTFRLSRLKQAYEAAER  180

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERI  1260
             +G   TDD S+ E    PV + EGSY+NIK+TTPDD+  AE I
Sbjct  181   DGFLGTDDSSLAERAGMPVAVVEGSYTNIKITTPDDLAYAEFI  223



>ref|WP_012446656.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Natranaerobius 
thermophilus]
 ref|YP_001916353.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Natranaerobius 
thermophilus JW/NM-WN-LF]
 gb|ACB83765.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Natranaerobius 
thermophilus JW/NM-WN-LF]
Length=252

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 138/242 (57%), Gaps = 18/242 (7%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDP------  762
             +VSVIL AGG G RMG S+ KQYL L GQPI   ++  F++LP VKEI +V         
Sbjct  7     NVSVILPAGGQGSRMGQSINKQYLNLRGQPILARTWRVFTRLPCVKEIFLVVASGEERFC  66

Query  763   FYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVE  942
             + N V+     +  + ++    GKERQDSVY G + V   S+   IHD ARPL+   ++E
Sbjct  67    WENVVYPYKDLENTVNIQVLSGGKERQDSVYEGLKRVSEESDYTIIHDGARPLITQQNIE  126

Query  943   KVLKDGWLVGAAVLGVPAKSTIKE----------ANNESF--VVRTLNRKTLWEMQTPQV  1086
               L      GA+++ VP K+TIK           +N +    V  TL R TL E+QTPQ 
Sbjct  127   NSLIQAKESGASIVAVPVKNTIKSLQYPLKVKSLSNGDEVPKVKETLPRNTLIEVQTPQT  186

Query  1087  IKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              K  L+K  ++   R+ +  TDD S+VE + H V + +GS+ NIKVTTP+D+ +AE IL 
Sbjct  187   FKSTLIKDAYQWALRQNITATDDSSLVEKMGHQVSVVQGSFENIKVTTPEDLFMAEEILK  246

Query  1267  AR  1272
              R
Sbjct  247   KR  248



>ref|WP_010883217.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
pneumoniae]
 ref|NP_224775.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae CWL029]
 ref|NP_300635.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae J138]
 ref|NP_444721.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae AR39]
 ref|NP_876875.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
pneumoniae TW-183]
 sp|Q9Z7X5.1|ISPD_CHLPN RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Chlamydia pneumoniae]
 gb|AAD18718.1| Sugar Nucleotide Phosphorylase [Chlamydophila pneumoniae CWL029]
 gb|AAF38046.1| conserved hypothetical protein [Chlamydophila pneumoniae AR39]
 dbj|BAA98786.1| sugar nucleotide phosphorylase [Chlamydophila pneumoniae J138]
 gb|AAP98532.1| CDP-ribitol pyrophosphorylase [Chlamydophila pneumoniae TW-183]
Length=211

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 130/219 (59%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G R G  +PKQYLPL G P+ L+S    S LPQ+ E++VVCDP Y + F++
Sbjct  5     SLILLSGGQGTRFGSKIPKQYLPLNGTPLVLHSLKILSSLPQIAEVIVVCDPSYQETFQE  64

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     + FA+PG+ RQDSV++G Q+V  S   + IHD ARP +   ++  +L+    
Sbjct  65    ------YPVSFAIPGERRQDSVFSGLQQV--SYPWVIIHDGARPFIYPDEIHDLLETAEK  116

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
             +GA  L  P   TIK+ N     VRTL+R  L  + TPQ IK E+L++G  +   + L +
Sbjct  117   IGATALASPIPYTIKQRNP----VRTLDRDNLAIIHTPQCIKTEILREGLALAKEKQLTL  172

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD+   E++  P  +    +  IK++ P+D+ +A+ +L
Sbjct  173   VDDIEAAEIIGKPSQLVFNKHPQIKISYPEDLTIAQALL  211



>ref|WP_013150817.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
mathranii]
 ref|YP_003677645.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
 gb|ADH61634.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
mathranii subsp. mathranii str. A3]
Length=230

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 136/224 (61%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VS +++A G G RMG ++ K YLP+ G+P+  YS  TF ++  +KEIVVV      +  
Sbjct  2     NVSAVIVAAGKGIRMGHTVNKVYLPIAGKPVLYYSLKTFDEIDWIKEIVVVVSKEEIEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  K++  +  +K    G ERQ SVYNG    + + E+I IHD ARPL+    V K L
Sbjct  62    KENVIKRYFFKKPVKLVEGGSERQYSVYNGIINTERNCEIITIHDGARPLIEKEVVLKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLYKAVALGVPVKDTIKVVDEKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_028991974.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
thermocopriae]
Length=230

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 136/224 (61%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV-VVCDPFYNDV  777
             +VS +++A G G RMG ++ K YLP+ G+P+  YS  TF ++  +KEIV VV        
Sbjct  2     NVSAVIVAAGKGIRMGHTVNKVYLPIAGKPVLYYSLKTFDEIDWIKEIVAVVSKEEIEYC  61

Query  778   FEDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  K++  +  +K    G ERQ SVYNG    + + E+I IHD ARPL+    V K L
Sbjct  62    KENVIKRYFFKKPVKLVEGGSERQYSVYNGIINTERNCEIITIHDGARPLIEKEVVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  AA +GVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLYKAAAVGVPVKDTIKVVDEKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_032079542.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
drakei]
Length=228

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 134/220 (61%), Gaps = 4/220 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF-EDA  789
             I+LA G GKRMG  + KQ+L +  +PI  YS  TFS  P + EI++VC     D   E  
Sbjct  7     IILAAGKGKRMGAGINKQFLNIKSKPILYYSLKTFSDNPLIDEIILVCSSSEIDYCREQV  66

Query  790   GKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
              +K+ I+  LK    G+ERQDSV NG + + +  +++ IHD ARP V    +E  +K   
Sbjct  67    VRKYGIKKVLKIVSGGEERQDSVINGLRSI-IDCDIVLIHDGARPFVNFSIIENGIKYAE  125

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
               GA   G+  K TIK   N+ F + TL+R  L+ +QTPQ  K +L+ K  E + ++ + 
Sbjct  126   TYGACTCGINPKDTIKIKGNDGFSLDTLDRSKLFCVQTPQCFKYDLIMKCHEKLIQDNIF  185

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             VTDD S+VE   + VY+ EGSY+NIK+TT +D+++AERIL
Sbjct  186   VTDDTSVVEFYGNKVYLYEGSYNNIKITTQEDLVVAERIL  225



>ref|WP_009052846.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Thermoanaerobacter]
 ref|YP_001662478.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. X514]
 ref|YP_003904932.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. X513]
 gb|ABY92142.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. X514]
 gb|EFK84128.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. X561]
 gb|ADN55641.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. X513]
Length=227

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 134/224 (60%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VS +++A G G RMG ++ K YLP+ G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NVSAVIVAAGKGIRMGHTVNKVYLPIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG    +   E+I IHD ARPL+    V K L
Sbjct  62    QENVVKKYFFKKPIKLVEGGSERQYSVYNGIINTEGDCEIIAIHDGARPLIEKEIVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQRALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_012995939.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
italicus]
 ref|YP_003477800.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
italicus Ab9]
 gb|ADD03238.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
italicus Ab9]
Length=230

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/224 (42%), Positives = 133/224 (59%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV-VVCDPFYNDV  777
             +VS +++A G G RMG ++ K YLP+ G+P+  YS  TF ++  +KEIV VV        
Sbjct  2     NVSAVIVAAGKGIRMGHTVNKVYLPIAGKPVLYYSLKTFDEIDWIKEIVAVVSKEEIEYC  61

Query  778   FEDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG      + E+I IHD ARPL+    V K L
Sbjct  62    KENVIKKYFFKKPVKLVEGGSERQYSVYNGIINTKKNCEIIAIHDGARPLIEKEVVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K  +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KKAYLYKAVALGVPVKDTIKVVDEKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_013809471.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
carboxydivorans]
 ref|YP_004495997.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
carboxydivorans CO-1-SRB]
 gb|AEF93085.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
carboxydivorans CO-1-SRB]
Length=234

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 128/229 (56%), Gaps = 3/229 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +V  ++ A G+G RM  ++ KQYL L G PI   +       P++  +V+V  P   +  
Sbjct  3     NVIAVIPAAGVGSRMRANINKQYLLLEGTPIITRTIKALESCPEISNVVLVVGPGEEEFC  62

Query  781   ED---AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
                   G  F   +     G  RQ SVYNG   +   +E++ IHD ARPLV  G++ +V+
Sbjct  63    RSRILEGNGFTKVMAVVPGGDHRQSSVYNGLCALPQDTEMVVIHDGARPLVQPGEISRVV  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +    +GAA L VP K TIK  + +  VV T  R+ LW +QTPQV + EL+ +   +   
Sbjct  123   QAAGEIGAAALAVPVKDTIKVVDEQGKVVSTPPRERLWAVQTPQVFRYELIMQAHRMARA  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
              G+  TDD ++VE L HPV +  GSY N+K+TTP+D++LA  +L  R+N
Sbjct  183   AGVLATDDCALVEALGHPVKLVAGSYENLKITTPEDLVLAAALLRRRYN  231



>ref|WP_018590463.1| hypothetical protein [Terrisporobacter glycolicus]
Length=226

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SV++++ G G RM   + KQ+L + G+ +  ++ D F K   + EI++V      + F+ 
Sbjct  3     SVVIVSAGKGSRMKADINKQFLKIRGKEVIAHTIDKFYKNKNIGEIIIVIREDEEEFFQK  62

Query  787   A--GKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                 K  +  +K AL GKERQDSVYNG +++D   +++ IHD ARP V    +EK +   
Sbjct  63    NIINKYGYRNIKVALGGKERQDSVYNGLKQIDKKCKIVLIHDGARPFVTNEIIEKSIICA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 +A++GVP K TIK  N  + V  T NR TLW +QTPQV    L+ K  E    +  
Sbjct  123   KEYNSAIVGVPVKDTIKIVNKNNEVCDTPNRSTLWSIQTPQVFDYSLIIKAHEKAKHDKY  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  ++E L H V + EGSY+NIK+TTP+D+ +AE IL
Sbjct  183   YGTDDSMLMEHLGHNVKVVEGSYNNIKITTPEDLKIAEEIL  223



>ref|WP_011229596.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Geobacillus]
 ref|YP_145934.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
kaustophilus HTA426]
 ref|YP_004980523.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermoleovorans CCB_US3_UF5]
 sp|Q5L433.1|ISPD_GEOKA RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Geobacillus kaustophilus HTA426]
 dbj|BAD74366.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (MEP 
cytidylyltransferase) [Geobacillus kaustophilus HTA426]
 gb|AEV17423.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermoleovorans CCB_US3_UF5]
 dbj|GAD13847.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
kaustophilus GBlys]
 gb|EQB95823.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. A8]
 gb|ESU73515.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. MAS1]
 dbj|GAJ56931.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermoleovorans B23]
 gb|KDE50533.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. CAMR5420]
Length=228

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 130/223 (58%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + + + F +  +   IV+V +P     FE   
Sbjct  6     IVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDERCTRIVLVVNPAERSRFEQLL  65

Query  793   KKFHIELKFALP--GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
              +F I+   AL   G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ARFRIQKVAALTDGGEERQHSVYNGLQAL-AGEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             TDD S+VE +  PV I EG Y NIK+TTP+D+L AE IL +R 
Sbjct  184   TDDASLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAILASRM  226



>ref|WP_027434722.1| hypothetical protein [Lachnospiraceae bacterium AB2028]
Length=250

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 136/237 (57%), Gaps = 13/237 (5%)
 Frame = +1

Query  592   KEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYN  771
             K KS +VIL AGG GKRMG  +PKQYL L G P+  Y+ D FSK   V EIV+V  P   
Sbjct  10    KIKSAAVIL-AGGTGKRMGGDVPKQYLELCGHPLLYYAIDCFSK-SSVSEIVLVVTPGDE  67

Query  772   D-VFEDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVE  942
             D V  D  K++           GKER +S YNG + V   ++++ IHDAAR L+    +E
Sbjct  68    DKVKRDIVKEYDFAKVSSVVAGGKERYNSSYNGIRAVS-DADIVLIHDAARALITVDVIE  126

Query  943   KVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEI  1122
             + ++D +  GA+V  VP+K TIK ++ + FV  T++R   W +QTPQ  K  L+K  +E 
Sbjct  127   RTIEDAYEYGASVAAVPSKDTIKLSDADGFVESTIDRARAWIIQTPQTFKMPLIKAAYEQ  186

Query  1123  INREGLE------VTDDVSIVELLK-HPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
               +E  E       TDD  + E      V IT GSY NIKVTTPDD+ +AE IL  R
Sbjct  187   AEKEAAEKGPSGFFTDDAMVAEKYSGQKVKITMGSYENIKVTTPDDLQVAEEILMNR  243



>ref|WP_003545202.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
nigrificans]
Length=234

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 128/229 (56%), Gaps = 3/229 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +V  ++ A G+G RM  ++ KQYL L G PI   +       P++  +V+V  P   +  
Sbjct  3     NVIAVIPAAGVGSRMRANINKQYLLLEGTPIITRTIKALESCPEISNVVLVVGPGEEEFC  62

Query  781   ED---AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
                   G  F   +     G  RQ SVYNG   +   +E++ IHD ARPLV  G++ +V+
Sbjct  63    RSRILEGNGFTKVMAVVPGGDHRQSSVYNGLCALPQDTEMVVIHDGARPLVQPGEISRVV  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +    +GAA L VP K TIK  + +  VV T  R+ LW +QTPQV + EL+ +   +   
Sbjct  123   QAAGEIGAAALAVPVKDTIKVVDEQGKVVSTPPRERLWAVQTPQVFRYELIMQAHRMARA  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
              G+  TDD ++VE L HPV +  GSY N+K+TTP+D++LA  +L  R+N
Sbjct  183   AGVLATDDCALVEALGHPVKLVVGSYENLKITTPEDLVLAAALLRRRYN  231



>ref|WP_012268983.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Thermoanaerobacter]
 ref|YP_001664351.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 ref|YP_004185354.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
 gb|ABY94015.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
pseudethanolicus ATCC 33223]
 gb|ADV78971.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
brockii subsp. finnii Ako-1]
Length=227

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 132/224 (59%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VS +++A G G RMG ++ K YL + G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NVSAVIVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG        E+I IHD ARPLV    V K L
Sbjct  62    QENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKEDCEIIAIHDGARPLVEKETVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_025950551.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermocatenulatus]
Length=228

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 129/223 (58%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + + + F +  +   IV+V +P     FE   
Sbjct  6     IVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDERCTRIVLVVNPAERSRFEQLL  65

Query  793   KKFHIELKFALP--GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
              +F I    AL   G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ARFRIRKVAALTDGGEERQHSVYNGLQAL-AGEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             TDD S+VE +  PV I EG Y NIK+TTP+D+L AE IL +R 
Sbjct  184   TDDASLVERIGKPVKIIEGDYRNIKMTTPEDLLFAEAILASRM  226



>ref|WP_015373720.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Geobacillus]
 ref|YP_007400449.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. GHH01]
 gb|AGE20698.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. GHH01]
 gb|EPR29334.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. WSUCF1]
Length=228

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 129/223 (58%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + + + F +  +   IV+V +P     FE   
Sbjct  6     IVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDERCTRIVLVVNPAERSRFEQLL  65

Query  793   KKFHIELKFALP--GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
              +F I    AL   G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ARFRIRKVAALTDGGEERQHSVYNGLQAL-AGEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             TDD S+VE +  PV I EG Y NIK+TTP+D+L AE IL +R 
Sbjct  184   TDDASLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAILASRM  226



>ref|WP_014968447.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Gottschalkia 
acidurici]
 ref|YP_006789160.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
acidurici 9a]
 gb|AFS79313.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[ [[Clostridium] acidurici 9a]
Length=237

 Score =   164 bits (416),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 137/233 (59%), Gaps = 9/233 (4%)
 Frame = +1

Query  583   LAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC--  756
             ++ K   +SVI++A GMGKRM  S+ KQYL L  +PI  Y+ D F     V EI++V   
Sbjct  1     MSYKGNHISVIVVAAGMGKRMRSSINKQYLLLKDRPILSYTIDKFENNQYVDEIIIVTRE  60

Query  757   ---DPFYNDVFEDAGKKFHIELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLV  924
                +    +V E    KF  ++K  +PG  ERQDSVYNG ++V+    ++ IHD  RP +
Sbjct  61    EEIEYCMANVIERY--KFK-KVKGVIPGGNERQDSVYNGLKKVNPKCNIVLIHDGVRPFI  117

Query  925   LAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELL  1104
                D+ K+++      A V+GV  K TIK  ++E+ +V T +R TLW + TPQ    EL+
Sbjct  118   RDSDINKMIEKTMTHKACVVGVKVKDTIKVVDSENNIVDTPDRNTLWAVHTPQCFSYELI  177

Query  1105  KKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              K  E    EGL VTDD  +VE L   V + EG+Y NIK+TTP+D+ +AE IL
Sbjct  178   LKAHERCKEEGLLVTDDSMLVEKLGGKVKMIEGNYDNIKITTPEDLYIAESIL  230



>ref|WP_003464566.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens]
 gb|EDT14407.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens E str. JGS1987]
Length=225

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 129/229 (56%), Gaps = 14/229 (6%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K VSVIL AGG GKRMG  + KQ++ + G+PI  Y+   F     + EI++V   +  D 
Sbjct  3     KVVSVIL-AGGKGKRMGAEVSKQFIEINGKPIIYYTLKAFEACKGIDEIILVLPKYEIDY  61

Query  778   FEDAGKKFHIELKFALP-------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             F     K  IE +F          GKERQDSVYN    +    +++ IHD AR  V    
Sbjct  62    F-----KREIEPRFDFKISKIIEGGKERQDSVYNALNSIK-DCDIVLIHDGARAFVSNKI  115

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +E  +K     GAA  GV  K TIK  N E F V T NR +L  +QTPQ  K  L+KKG 
Sbjct  116   IEDGIKYSREFGAAAPGVMPKDTIKVKNLEGFSVDTPNRASLVAVQTPQCFKYNLIKKGH  175

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             + +  E ++VTDD  IVELL   VY+ EG Y NIKVTTP+D++LAE  +
Sbjct  176   DKVKNEKIQVTDDTMIVELLGEKVYLFEGDYKNIKVTTPEDLILAEHFV  224



>ref|WP_006569578.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Thermoanaerobacter]
 ref|YP_004820915.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
wiegelii Rt8.B1]
 gb|AEM79631.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
wiegelii Rt8.B1]
 gb|EIV99798.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
siderophilus SR4]
Length=227

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 132/224 (59%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             + S +++A G G RMG ++ K YL + G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NASAVVVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG     +  E+I IHD ARPL+    V K L
Sbjct  62    QENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKVDCEIIAIHDGARPLIEKETVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_022738833.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Laceyella 
sacchari]
Length=229

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 131/230 (57%), Gaps = 12/230 (5%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCD----PFY  768
             SV V++ A G+GKRMG    KQ+L   G+P+ +++   F   P+V EIV+          
Sbjct  2     SVGVVIPAAGLGKRMGSKESKQFLSFQGKPVLIHTLHIFETHPEVDEIVLAVREEEVARV  61

Query  769   NDVFEDAG--KKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVE  942
               + EDAG  K  H+       G+ERQDSVYNG +   LS+E + +HDA RP V    + 
Sbjct  62    RQLVEDAGLRKVTHV----VAGGRERQDSVYNGLRM--LSTEWVLVHDAVRPFVSREAIS  115

Query  943   KVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEI  1122
             ++L+   + GAA+L VP K T+K  +    V  T +RK LW +QTPQ  + ++L +  E 
Sbjct  116   RLLEAAKMHGAAILAVPVKETVKMVDAAGVVEETPDRKRLWAVQTPQAFRTDMLMEAHEQ  175

Query  1123  INREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
               + G  VTDD  +VE L   V + EG Y+NIK+TTPDD+ +AE I   R
Sbjct  176   GRKTGAAVTDDAMLVEELGIDVRVVEGEYTNIKLTTPDDLAVAEAIYQMR  225



>ref|WP_012101144.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_001392859.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum F str. Langeland]
 ref|YP_005676415.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum F str. 230613]
 sp|A7GJ99.1|ISPD_CLOBL RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum F str. Langeland]
 gb|ABS42176.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum F str. Langeland]
 gb|ADG01215.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum F str. 230613]
Length=229

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSAHESIDEIVLVTLEDKIEVCSD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRCA  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTIKIKNEKEFAIDTPNREDLFIVQTPQCFNYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_035355787.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Acetobacterium 
dehalogenans]
Length=237

 Score =   163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 138/227 (61%), Gaps = 3/227 (1%)
 Frame = +1

Query  595   EKSV-SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYN  771
             EKS+ SVI+ A G+G+RM  S+ KQYL L G+PI  Y+ D F   P + EI++V +P   
Sbjct  2     EKSLTSVIIPAAGLGRRMNASISKQYLQLNGKPILAYTLDAFENCPLIDEIILVINPDEL  61

Query  772   DVFEDA--GKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             ++ E+   G   + ++K    G  RQ+SVY G +  +  + ++ IHD ARPL+    + +
Sbjct  62    ELCEEQVIGTYPYTKVKLVAGGNTRQESVYAGLKAANPQTRIVLIHDGARPLIRESVIRR  121

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
              +++     A V+GVPAK+TIK  N + FV  T +R  L E+QTPQ    +L+++  +  
Sbjct  122   SIEETIKHRATVVGVPAKNTIKVINEDGFVEHTPDRNYLVEIQTPQTFDYDLIREAHQKA  181

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
                G+  TDD  +VE LK PV I  G Y+NIK+TTP+D+ +AE I++
Sbjct  182   LASGVAGTDDAFLVEWLKIPVKIVVGDYTNIKITTPEDLTIAESIIS  228



>gb|AHM55464.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[Eubacterium acidaminophilum DSM 3953]
Length=226

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 128/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SV+++  G GKRM   + K YL + G+P+   + + F  + ++ E+VVV      ++F +
Sbjct  3     SVVIVGAGKGKRMKSDINKVYLRVAGKPVLQLTIEKFMSMDEIDELVVVISRDDEEIFGE  62

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
               +  +I   LK A  G ER+DSVYNG + VD + +++ IHDAARPLV   D  K ++  
Sbjct  63    MQRSIYISKPLKIAYGGAERRDSVYNGLRLVDTACDVVLIHDAARPLVDKADAIKSIECA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GA  L V  K T+K A++E FV  T  R  LW +QTPQ  K +L+ + +     EGL
Sbjct  123   RENGACALAVRVKDTVKIADDEGFVESTPERDKLWAVQTPQTFKYKLIMEAYRRSIEEGL  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  + E     V + EGSY NIK+TTP+DML A+ IL
Sbjct  183   MATDDCMMAESAGFRVKLVEGSYENIKITTPEDMLFAKEIL  223



>ref|WP_029687922.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. A7A]
 gb|KHO61957.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
sp. YS13]
Length=227

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 132/224 (59%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             + S +++A G G RMG ++ K YL + G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NASAVVVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG     +  E+I IHD ARPL+    V K L
Sbjct  62    QENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKVDCEIIAIHDGARPLIEKETVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTILVERLGYNVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_031406247.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
vulcani]
Length=228

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 129/222 (58%), Gaps = 4/222 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + +   F    +   IV+V +P     FE   
Sbjct  6     IVLAAGQGKRMNAGMNKQFLELGGEPLIVRTLKVFDGDERCAGIVLVVNPAERHRFEQLL  65

Query  793   KKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
             ++  I   + FA  G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ERHRIRKVMAFANGGRERQHSVYNGLQALQ-GEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             TDD S+VE +  PV I EG Y NIK+TTP+D+L+AE IL +R
Sbjct  184   TDDASLVERIGKPVKIIEGDYRNIKLTTPEDLLVAEAILASR  225



>dbj|BAQ15118.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Clostridium botulinum]
Length=238

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  14    SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIEVCSD  73

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  74    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYT  133

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  134   NQYGAAACGVIPKDTIKIKNEKGFAIDTPNREDLFIVQTPQCFNYNIILSCHEKLKKHNK  193

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  194   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  234



>ref|WP_007063030.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
carboxidivorans]
 gb|EET85408.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
carboxidivorans P7]
 gb|EFG87552.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
carboxidivorans P7]
Length=228

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 132/220 (60%), Gaps = 4/220 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF-EDA  789
             I+LA G GKRMG  + KQ+L +  +PI  YS  TFS  P + EI++VC     D   E  
Sbjct  7     IILAAGKGKRMGAGINKQFLNIKDKPILYYSLKTFSDSPFIDEIILVCSSSEIDYCKEQV  66

Query  790   GKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
               K+ I   L+    GKERQDSV NG + +     ++ IHD ARP V +  +E  +K   
Sbjct  67    VGKYGIRKVLRIVSGGKERQDSVLNGLRSI-TDCNIVLIHDGARPFVNSSIIENGIKYAE  125

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
               GA   G+ +K TIK   ++ F + TL+R  L+ +QTPQ  K +L+ K  E + ++ + 
Sbjct  126   TYGACTCGINSKDTIKVKGSDGFSLDTLDRSKLFCVQTPQCFKYDLIIKCHEKLIQDKVS  185

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             VTDD ++VE   + VY+ EGSY+NIK+TT +D+++AER+L
Sbjct  186   VTDDTAVVERYGNKVYLYEGSYNNIKITTQEDLVVAERML  225



>ref|WP_013143975.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. C56-T3]
 ref|YP_003669732.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. C56-T3]
 gb|ADI25155.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. C56-T3]
Length=228

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 128/223 (57%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + + + F +  +   IV+V +P     FE   
Sbjct  6     IVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDERCTRIVLVVNPAERSRFEQLL  65

Query  793   KKFHIELKFALP--GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
              +F I    AL   G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ARFRIRKVAALTDGGEERQHSVYNGLQAL-AGEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             TDD  +VE +  PV I EG Y NIK+TTP+D+L AE IL +R 
Sbjct  184   TDDAGLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAILASRM  226



>ref|WP_004404883.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Thermoanaerobacter]
 gb|EMT38041.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
thermohydrosulfuricus WC1]
Length=227

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/224 (41%), Positives = 131/224 (58%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             + S +++A G G RMG ++ K YL + G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NASAVVVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG        E+I IHD ARPLV    V K L
Sbjct  62    QENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKEDCEIIAIHDGARPLVEKETVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_006342838.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci]
 ref|YP_004422019.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 6BC]
 ref|YP_005662864.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 6BC]
 ref|YP_005663867.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 01DC11]
 ref|YP_005664842.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 08DC60]
 ref|YP_005665815.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci C19/98]
 ref|YP_005666792.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC15]
 ref|YP_004064149.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydia psittaci RD1]
 ref|YP_006739163.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci CP3]
 ref|YP_006741315.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci MN]
 ref|YP_006732761.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 84/55]
 ref|YP_006733876.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci GR9]
 ref|YP_006734927.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci VS225]
 ref|YP_006736023.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci WS/RT/E30]
 ref|YP_006737067.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci M56]
 ref|YP_006738110.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci WC]
 ref|YP_006974088.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydia psittaci 01DC12]
 ref|YP_007437891.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci Mat116]
 emb|CBY16704.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydia psittaci RD1]
 gb|ADZ18590.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 6BC]
 gb|EGF85379.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci Cal10]
 gb|AEB55191.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 6BC]
 gb|AEG85219.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci C19/98]
 gb|AEG86197.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 01DC11]
 gb|AEG87171.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC15]
 gb|AEG88150.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 08DC60]
 gb|AFS19162.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 84/55]
 gb|AFS20277.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci GR9]
 gb|AFS21990.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci MN]
 gb|AFS22362.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci VS225]
 gb|AFS23540.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci WS/RT/E30]
 gb|AFS24392.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci M56]
 gb|AFS25679.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci WC]
 gb|AFS26598.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci CP3]
 emb|CCO01686.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydia psittaci 01DC12]
 gb|AGE74743.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci Mat116]
 gb|EPJ13596.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC15]
 gb|EPJ14108.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC16]
 gb|EPJ15991.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC18]
 gb|EPJ17244.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC22]
 gb|EPJ18272.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 01DC11]
 gb|EPJ19848.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC23]
 gb|EPJ20949.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC21]
 gb|EPJ22408.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 04DC42]
 gb|EPJ24236.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 03DC29]
 gb|EPJ25556.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 09DC77]
 gb|EPJ26003.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 08DC60]
 gb|EPJ27945.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci C19/98]
 gb|EPJ28314.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 99DC5]
 gb|EPJ30498.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 09DC78]
 gb|EPJ31610.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 03DC35]
 gb|EPJ32396.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 06-1683]
 gb|EPJ98538.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC24]
 gb|EPJ99705.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 02DC14]
 gb|EPL01536.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 09DC79]
 gb|EPP28959.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 08-2626_L3]
 gb|EPP33876.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci C6/98]
Length=212

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G+R G + PKQYLP  G+P+ L++     ++P++ EI+VVCD  Y  +FE 
Sbjct  6     SLILLSGGKGERFGANQPKQYLPFQGEPLVLHALKMALRIPEISEIIVVCDVNYESIFEG  65

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     +KFA PG  RQDSV++G Q+V  S   + +HD  RP +   +V +++   + 
Sbjct  66    ------YPVKFARPGTRRQDSVFSGLQQV--SHPWVLVHDGVRPFIYPDEVRELITTAYQ  117

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA L      TIK+ N     V+TL+R  L  + TPQ IK ++L +G E+ N+E + +
Sbjct  118   TGAATLVSSVPYTIKQRNP----VKTLDRDALSLVHTPQCIKTQILLEGLELANKERITL  173

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD    ELL  PV +    +  IKVT P+D+ LA  +L
Sbjct  174   VDDTQAAELLNVPVALVFNKHPQIKVTYPEDLTLAHALL  212



>ref|WP_014946445.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci]
 ref|YP_006740273.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci NJ1]
 gb|AFS27708.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci NJ1]
Length=212

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/219 (39%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G+R G + PKQYLP  G+P+ L++     ++P++ EI+VVCD  Y  +FE 
Sbjct  6     SLILLSGGKGERFGANQPKQYLPFQGEPLVLHALKMALRIPEISEIIVVCDVNYESIFEG  65

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     +KFA PG  RQDSV++G Q+V  S   + +HD  RP +   +V +++   + 
Sbjct  66    ------YPVKFARPGARRQDSVFSGLQQV--SHPWVLVHDGVRPFIYPDEVRELITTAYQ  117

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA L      TIK+ N     V+TL+R  L  + TPQ IK ++L +G E+ N+E + +
Sbjct  118   TGAATLVSSVPYTIKQRNP----VKTLDRDALSLVHTPQCIKTQILLEGLELANKERITL  173

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD    ELL  PV +    +  IKVT P+D+ LA  +L
Sbjct  174   VDDTQAAELLNVPVALVFNKHPQIKVTYPEDLTLAHALL  212



>ref|WP_012048363.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_001255987.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. ATCC 3502]
 ref|YP_001385821.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. ATCC 19397]
 ref|YP_001389228.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. Hall]
 sp|A7FZ94.1|ISPD_CLOB1 RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum A str. ATCC 19397]
 sp|A5I7N1.1|ISPD_CLOBH RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum A str. Hall]
 emb|CAL85066.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. ATCC 3502]
 gb|ABS34447.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. ATCC 19397]
 gb|ABS37853.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A str. Hall]
Length=229

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIEVCSD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKGVSKDCEVVLIHDAARPFVTSDIIENGIRYT  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTIKIKNEKGFAIDTPNREDLFIVQTPQCFNYNIILSCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_026478127.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Alkaliphilus 
transvaalensis]
Length=238

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 129/223 (58%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEI-VVVCDPFYNDVFEDA  789
             I++A G GKRMG    KQY+ L  +P+  Y+ + F   P + EI VVV         E+ 
Sbjct  10    IIVAAGKGKRMGAEGNKQYILLRDKPVLAYTLEVFQDCPDIDEIIVVVAQGEVEYCKENI  69

Query  790   GKKFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
              +K+ +    ++   GKER DSVY G  E      ++ IHD ARP +    +   +K+  
Sbjct  70    QQKYELNKIVSVIEGGKERFDSVYKGIVEAQDDCNVVVIHDGARPFISQEIIINTIKEAK  129

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
             + GA ++GVP K TIK  N +S V+ T  R+ LW +QTPQ  K  L+++ +E IN +   
Sbjct  130   VEGAVIVGVPVKDTIKLINQQSQVMETPQRENLWAIQTPQTFKYSLVRRAYEEINCDE-S  188

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             +TDD S++E   HPV +  GSY NIK+TTPDD+L+AE IL  R
Sbjct  189   ITDDASLLEKAGHPVKVIMGSYENIKLTTPDDLLMAEAILKKR  231



>ref|WP_014521984.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_005680135.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum H04402 065]
 emb|CBZ05407.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum H04402 065]
Length=238

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  14    SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIEVCGD  73

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  74    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYT  133

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  134   NQYGAAACGVIPKDTIKIKNEKGFAIDTPNREDLFIVQTPQCFNHNIILSCHEKLKKHNK  193

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  194   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  234



>ref|WP_003868427.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
ethanolicus]
 gb|EEU61676.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
ethanolicus CCSD1]
 gb|EGD51270.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoanaerobacter 
ethanolicus JW 200]
Length=227

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 131/224 (58%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             + S +++A G G RMG ++ K YL + G+P+  YS   F ++  +KEIVVV      +  
Sbjct  2     NASAVVVAAGKGIRMGHTVNKVYLTIAGKPVLYYSLKAFDEIDWIKEIVVVVSKEEMEYC  61

Query  781   -EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  KK+  +  +K    G ERQ SVYNG        E+I IHD ARPL+    V K L
Sbjct  62    QENVVKKYIFKKPIKLVEGGSERQYSVYNGITNTKEDCEIIAIHDGARPLIEKETVIKAL  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K+ +L  A  LGVP K TIK  + ++F++ T +RK LW +QTPQV +  L+ K  +    
Sbjct  122   KEAYLHKAVALGVPVKDTIKVVDGKNFILNTPDRKYLWAIQTPQVFERNLIIKAHQKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +G   TDD  +VE L + V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   DGFLGTDDTVLVERLGYKVKVVEGDYRNIKITTPEDLIVAEAFL  225



>ref|WP_014357294.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Acetobacterium 
woodii]
 ref|YP_005270586.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Acetobacterium 
woodii DSM 1030]
 gb|AFA49697.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[Acetobacterium woodii DSM 1030]
Length=243

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 135/227 (59%), Gaps = 2/227 (1%)
 Frame = +1

Query  589   VKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC--DP  762
             +K+   SVI+ A GMG+RM   + KQYL L G+PI  Y+ D F K P +KEIV+V   D 
Sbjct  4     MKKYLTSVIIPAAGMGRRMNAPINKQYLTLNGKPILAYTLDVFEKCPLIKEIVLVINQDE  63

Query  763   FYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVE  942
             F     +      + ++K    G+ RQ+SVY G + +   ++++ +HD ARP++    + 
Sbjct  64    FSLCQMQVLKPYRYTKIKLVRGGETRQESVYRGLKAIHPKTDIVMVHDGARPIIQESVIV  123

Query  943   KVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEI  1122
             + + +     A  +GVPAK+TIK  ++  FV  T NR  L E+QTPQ  + ELLKK  + 
Sbjct  124   QSIYETIEHRATTVGVPAKNTIKVISDNGFVEHTPNRDYLVEIQTPQTFEYELLKKAHDQ  183

Query  1123  INREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               R G+E TDD  +VE    PV I  G Y+NIK+TTP+D+++AE I+
Sbjct  184   AIRLGIEGTDDAFLVEQQNIPVKIVTGHYTNIKITTPEDLIIAESII  230



>ref|WP_003357598.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_002806049.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A2 str. Kyoto]
 sp|C1FMX6.1|ISPD_CLOBJ RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum A2 str. Kyoto]
 gb|EDT82177.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum NCTC 2916]
 gb|ACO85668.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A2 str. Kyoto]
 gb|EPS54650.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum Af84]
Length=229

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIEVCGD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYT  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTIKIKNEKGFAIDTPNREDLFIVQTPQCFNYNIILSCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_033066501.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 gb|KEI96929.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A2B3 87]
Length=229

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 128/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V       V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIQVCGD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYT  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  N + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTIKIKNEKGFAIDTPNREDLFIVQTPQCFNHNIILSCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_029761777.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermodenitrificans]
Length=228

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 129/222 (58%), Gaps = 4/222 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ++ L G+P+ + +   F    +   IV+V +P     FE   
Sbjct  6     IVLAAGQGKRMNAGMNKQFIELGGEPLIVRTLKVFDGDERCNGIVLVVNPTERGQFEQLF  65

Query  793   KKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
             +++ I   + FA  G+ERQ SVYNG Q +  S E++ IHD ARP V  G + ++      
Sbjct  66    ERYRIRKVVAFADGGQERQHSVYNGLQALR-SGEIVLIHDGARPFVRIGHLHELADAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+ +   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKVDG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEEAKKAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             TDD S+VE L  PV I EG Y NIK+TTP+D+L AE IL +R
Sbjct  184   TDDASLVERLGRPVKILEGDYRNIKLTTPEDLLFAEAILASR  225



>ref|WP_011593147.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens]
 ref|YP_699688.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens SM101]
 sp|Q0SQB9.1|ISPD_CLOPS RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium perfringens SM101]
 gb|ABG87076.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens SM101]
Length=225

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K VSVIL AGG GKRMG  + KQ++ + G+PI  Y+   F +   + EI++V      D 
Sbjct  3     KVVSVIL-AGGKGKRMGAEVSKQFIEINGKPIIYYTLKAFEECKDIDEIILVLPKDEIDY  61

Query  778   FEDAGKKFHIELKFALP-------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             F     K  IE +F          GKERQDSVYN    +    +++ IHD AR  V    
Sbjct  62    F-----KREIEPRFDFKISKIIEGGKERQDSVYNALNSIG-DCDIVLIHDGARAFVSNKI  115

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +E  +K     GAA  GV  K TIK  N E F V T NR +L  +QTPQ  K  L+KKG 
Sbjct  116   IEDGIKYSREFGAAAPGVMPKDTIKVKNLEGFSVDTPNRASLVAVQTPQCFKYNLIKKGH  175

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               +  E ++VTDD  IVELL   VY+ EG Y NIKVTTP+D++LAE  +
Sbjct  176   NKVKNEKIQVTDDTMIVELLGEKVYLFEGDYKNIKVTTPEDLILAEHFV  224



>ref|WP_013658306.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Cellulosilyticum 
lentocellum]
 ref|YP_004310227.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
lentocellum DSM 5427]
 gb|ADZ85029.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
lentocellum DSM 5427]
Length=232

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 129/224 (58%), Gaps = 4/224 (2%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV-VVCDPFYNDVF  780
             V+ I++AGG GKRMG+S+ KQY+ L  + +  ++ + F K   ++EI+ VV +   N V 
Sbjct  4     VTAIIVAGGSGKRMGMSIKKQYILLSNKEVLAHTIEAFDKCELIQEIILVVSEDEINKVK  63

Query  781   EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +D  +K+      K    G ERQDSVYNG       ++ + IHD ARP +    + + LK
Sbjct  64    KDIVEKYSFNKVRKIVSGGTERQDSVYNGLLATSNDTKYVMIHDGARPFIKEKIIREALK  123

Query  955   DGWLVGAAVLGVPAKSTIKEANNE-SFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
                   A V+ VP K TIK  +N+   V+ T NR TLW +QTPQ    ELL K +     
Sbjct  124   LTIEKEATVVAVPVKDTIKVVDNKKQMVIDTPNRTTLWSIQTPQSFSKELLLKAYAYAKS  183

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             E L VTDD  +VE     VYI +G Y+NIK+TTP+D+++ E +L
Sbjct  184   ENLAVTDDSMLVEAYGKAVYIVQGDYTNIKITTPEDLIIGEAVL  227



>ref|WP_007051024.1| hypothetical protein [Anaerofustis stercorihominis]
 gb|EDS72554.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Anaerofustis 
stercorihominis DSM 17244]
Length=232

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 138/226 (61%), Gaps = 3/226 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSVI+ A G G RMG S+ KQY+ L  + I  ++   F K P + EI++V       +F+
Sbjct  6     VSVIIPAAGRGTRMGKSINKQYISLDKKAILTHTIIAFDKCPYIDEILIVVADNEEKLFK  65

Query  784   DAG-KKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             D   K++ I+   K  + G  RQ+SVYN  ++VD    +I +HD ARPL+   ++   + 
Sbjct  66    DKVLKEYRIKKPYKLVVGGSTRQESVYNAVKKVDERCTIISVHDGARPLISNKEIINTVL  125

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  G  VLGVP K T+K+A+++ FV  T+ R TL+ ++TPQV K ++LK+ ++    +
Sbjct  126   GAKKYGGCVLGVPVKETVKKADSDGFVSATVERSTLYNIRTPQVFKADILKEAYKNAEEK  185

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             G+  TDD  +VE     V I +GSY+NIK+TTP+D++ A+ IL++R
Sbjct  186   GIIGTDDSYLVEENDIKVKIIKGSYNNIKITTPEDLIYAQEILSSR  231



>ref|WP_002582597.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum]
 gb|EDT73706.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum 5521]
 gb|EEP55214.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum E4 str. BoNT E BL5262]
 gb|EMU53204.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum DKU-01]
 gb|ENZ30459.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum 60E.3]
 gb|ETI92020.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum DORA_1]
Length=224

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 139/228 (61%), Gaps = 11/228 (5%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC-----DPFY  768
             VS I+LAGG GKRMG    KQY+ L G+PI  Y+ + F     + ++++V      +   
Sbjct  2     VSAIVLAGGRGKRMGSVQSKQYIDLNGKPILYYTLNHFINNKNIDKVILVIPEDELEFCR  61

Query  769   NDVFEDAGKKFHIEL-KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             N+V +    K+++++   A  GKERQDSVYNG ++ D  S+++ IHD ARP V    +E+
Sbjct  62    NEVLD----KYNLKIDSIAFGGKERQDSVYNGLKKAD-GSDIVLIHDGARPFVSERIIEE  116

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
              +K   + GAA  GV  K TIK  N ESF + T +R  L  +QTPQV    ++    + +
Sbjct  117   GIKYARMYGAAAPGVMPKDTIKVKNQESFSLETPDRNNLVAVQTPQVFDYNIIFGCHKKV  176

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
               + L+VTDD  +VEL  + VY+ EG Y+NIK+TTP+D++LA+ ++ +
Sbjct  177   KEKHLDVTDDTMVVELFGNDVYLYEGEYTNIKITTPEDLILAQYLVES  224



>ref|WP_012820472.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Geobacillus]
 ref|YP_003251264.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. Y412MC61]
 ref|YP_004130741.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. Y412MC52]
 gb|ACX76782.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. Y412MC61]
 gb|ADU92598.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. Y412MC52]
Length=228

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 127/223 (57%), Gaps = 4/223 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ+L L G+P+ + + + F +      IV+V +P     FE   
Sbjct  6     IVLAAGRGKRMNAGMNKQFLELGGEPLIVRTLNVFERDEWCTRIVLVVNPAERSRFEQLL  65

Query  793   KKFHIELKFALP--GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
              +F I    AL   G+ERQ SVYNG Q +    E++ IHD ARP V    + +++     
Sbjct  66    ARFRIRKVAALTDGGEERQHSVYNGLQAL-AGEEIVLIHDGARPFVRVHHLHELVNAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+AN   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKANG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEAAKQAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
             TDD  +VE +  PV I EG Y NIK+TTP+D+L AE IL +R 
Sbjct  184   TDDAGLVERIGKPVKIIEGDYRNIKLTTPEDLLFAEAILASRM  226



>ref|WP_005828905.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Bacillales]
 gb|EJL39237.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Brevibacillus 
sp. CF112]
 gb|ELK42939.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Brevibacillus 
agri BAB-2500]
Length=228

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 126/227 (56%), Gaps = 6/227 (3%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV-VVCDPFYNDV  777
             S  V+++A G GKRMG    K +LPL G+PI  ++   F+   ++ +IV VV +  Y DV
Sbjct  2     STGVVIVAAGSGKRMGGQRNKLWLPLAGEPILAHTVRLFASHQEIDQIVLVVSEADYADV  61

Query  778   FE--DAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
                 DA K   +++   L G ERQDSV NG   +  S   + +HDAARP V    +  +L
Sbjct  62    LALVDAEK---LQVTVTLGGAERQDSVRNGLASLASSCTYVLVHDAARPFVTQQQISDML  118

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +      A ++ VP K TIK       V  T  R++LW +QTPQ  +  LL++  E   +
Sbjct  119   RQVRRDQATIMAVPVKDTIKVVGATGLVEATPARESLWAVQTPQAFRMSLLREAHEAAEK  178

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              G   TDD  +VE L HPV + +GSY NIK+TTPDD+ L E I+  R
Sbjct  179   AGKLGTDDAMLVEWLGHPVSVMQGSYENIKITTPDDLWLGEEIMRKR  225



>gb|EPJ27003.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci 09DC80]
 gb|EPP32390.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
psittaci C1/97]
Length=206

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 127/218 (58%), Gaps = 12/218 (6%)
 Frame = +1

Query  610   VILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDA  789
             +ILL+GG G+R G + PKQYLP  G+P+ L++     ++P++ EI+VVCD  Y  +FE  
Sbjct  1     MILLSGGKGERFGANQPKQYLPFQGEPLVLHALKMALRIPEISEIIVVCDVNYESIFEG-  59

Query  790   GKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWLV  969
                    +KFA PG  RQDSV++G Q+V  S   + +HD  RP +   +V +++   +  
Sbjct  60    -----YPVKFARPGTRRQDSVFSGLQQV--SHPWVLVHDGVRPFIYPDEVRELITTAYQT  112

Query  970   GAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEVT  1149
             GAA L      TIK+ N     V+TL+R  L  + TPQ IK ++L +G E+ N+E + + 
Sbjct  113   GAATLVSSVPYTIKQRNP----VKTLDRDALSLVHTPQCIKTQILLEGLELANKERITLV  168

Query  1150  DDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             DD    ELL  PV +    +  IKVT P+D+ LA  +L
Sbjct  169   DDTQAAELLNVPVALVFNKHPQIKVTYPEDLTLAHALL  206



>ref|WP_027636994.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
butyricum]
Length=224

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 139/228 (61%), Gaps = 11/228 (5%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC-----DPFY  768
             VS I+LAGG GKRMG    KQY+ L G+PI  Y+ + F     + ++++V      +   
Sbjct  2     VSAIVLAGGRGKRMGSVQSKQYIDLNGKPILYYTLNHFINNKNIDKVILVIPEDELEFCR  61

Query  769   NDVFEDAGKKFHIEL-KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             N+V +    K+++++   A  GKERQDSVYNG ++ D  S+++ IHD ARP V    +E+
Sbjct  62    NEVLD----KYNLKIDSIAFGGKERQDSVYNGLKKAD-GSDIVLIHDGARPFVSERIIEE  116

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
              +K   + GAA  GV  K TIK  N ESF + T +R  L  +QTPQV    ++    + +
Sbjct  117   GIKYAGMYGAAAPGVMPKDTIKVKNQESFSLETPDRNNLVAVQTPQVFDYNIIFGCHKKV  176

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
               + L+VTDD  +VEL  + VY+ EG Y+NIK+TTP+D++LA+ ++ +
Sbjct  177   KEKHLDVTDDTMVVELFGNDVYLYEGEYTNIKITTPEDLILAQYLVES  224



>ref|WP_016205918.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sartagoforme]
 gb|EOR27905.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sartagoforme AAU1]
Length=222

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 138/230 (60%), Gaps = 19/230 (8%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVV-----CDPFY  768
             +S I+LAGG GKRM   + KQY+ L G+PI  Y+   F+   Q+ +I++V      D   
Sbjct  2     ISAIILAGGKGKRMCAKVSKQYIELRGKPILYYTLKRFADCSQIDKIILVLPKDEIDYCK  61

Query  769   NDVFEDAGKKFHIELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             N++      K+ +++   + G +ERQDSV+N  + ++ + E++ IHD ARP       E+
Sbjct  62    NEIL----NKYSLKVDMIVEGGEERQDSVFNALECIE-NCEIVLIHDGARPFT----SER  112

Query  946   VLKDGW----LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKG  1113
             ++ DG     L GAA  GV  K TIK  N E F V T +R TL  +QTPQV K  L+K+ 
Sbjct  113   IINDGIKYAKLYGAAAPGVIPKDTIKVINEEKFSVSTPDRNTLRAIQTPQVFKFNLIKEC  172

Query  1114  FEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
                I +  + VTDD  +V++  + VY+ EG Y+NIKVTTP+D++LAE+++
Sbjct  173   HNKIKKNNISVTDDTMVVDMYNNEVYLYEGEYTNIKVTTPEDLILAEKLI  222



>ref|WP_003459324.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens]
 ref|NP_563345.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens str. 13]
 ref|YP_697118.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens ATCC 13124]
 sp|Q8XHQ3.1|ISPD_CLOPE RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium perfringens str. 13]
 sp|Q0TMM2.1|ISPD_CLOP1 RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium perfringens ATCC 13124]
 dbj|BAB82135.1| conserved hypothetical protein [Clostridium perfringens str. 
13]
 gb|ABG83935.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens ATCC 13124]
 gb|EDT22942.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens B str. ATCC 3626]
 gb|EDT26020.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens CPE str. F4969]
 gb|EDT70283.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens D str. JGS1721]
 gb|EDT77520.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens NCTC 8239]
 gb|EHP46288.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens WAL-14572]
Length=225

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K VSVIL AGG GKRMG  + KQ++ + G+PI  Y+   F +   + EI++V      D 
Sbjct  3     KVVSVIL-AGGKGKRMGAEVSKQFIEINGKPIIYYTLKAFEECKGIDEIILVLPKDEIDY  61

Query  778   FEDAGKKFHIELKFALP-------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             F     K  IE +F          GKERQDSVYN    +    +++ IHD AR  V    
Sbjct  62    F-----KREIEPRFDFKISKIIEGGKERQDSVYNALNSIG-DCDIVLIHDGARAFVSNKI  115

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +E  +K     GAA  GV  K TIK  N E F V T NR +L  +QTPQ  K  L+KKG 
Sbjct  116   IEDGIKYSREFGAAAPGVMPKDTIKVKNLEGFSVDTPNRASLVAVQTPQCFKYNLIKKGH  175

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               +  E ++VTDD  IVELL   VY+ EG Y NIKVTTP+D++LAE  +
Sbjct  176   NKVKNEKIQVTDDTMIVELLGEKVYLFEGDYKNIKVTTPEDLILAEHFV  224



>gb|EIA15942.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
perfringens F262]
Length=236

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K VSVIL AGG GKRMG  + KQ++ + G+PI  Y+   F +   + EI++V      D 
Sbjct  14    KVVSVIL-AGGKGKRMGAEVSKQFIEINGKPIIYYTLKAFEECKGIDEIILVLPKDEIDY  72

Query  778   FEDAGKKFHIELKFALP-------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             F     K  IE +F          GKERQDSVYN    +    +++ IHD AR  V    
Sbjct  73    F-----KREIEPRFDFKISKIIEGGKERQDSVYNALNSIG-DCDIVLIHDGARAFVSNKI  126

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +E  +K     GAA  GV  K TIK  N E F V T NR +L  +QTPQ  K  L+KKG 
Sbjct  127   IEDGIKYSREFGAAAPGVMPKDTIKVKNLEGFSVDTPNRASLVAVQTPQCFKYNLIKKGH  186

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               +  E ++VTDD  IVELL   VY+ EG Y NIKVTTP+D++LAE  +
Sbjct  187   NKVKNEKIQVTDDTMIVELLGEKVYLFEGDYKNIKVTTPEDLILAEHFV  235



>ref|WP_038092207.1| hypothetical protein [Tumebacillus flagellatus]
 gb|KEO81710.1| hypothetical protein EL26_19025 [Tumebacillus flagellatus]
Length=232

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 127/227 (56%), Gaps = 11/227 (5%)
 Frame = +1

Query  610   VILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCD----PFYNDV  777
             VI++A G G RMG +M KQYLPL G PI + +  T +  P V  IV+V      P+  ++
Sbjct  5     VIVVAAGSGTRMGSAMKKQYLPLDGAPILVRTLQTLAACPTVHRIVLVVASEDVPYITEL  64

Query  778   FEDAGKKFHIEL--KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E     +++         G+ERQDSV NG   +   +E + +HDAARPLV   +VE VL
Sbjct  65    IE----AYYLSKIGDVVAGGRERQDSVRNGIAALLHDTEFVAVHDAARPLVTPEEVEAVL  120

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
                 + GAA LGV  K TIK  + +  V  TL R  LW + TPQ  + E L +       
Sbjct  121   TAAKMFGAATLGVKVKDTIKRVD-QGQVRETLQRSDLWAVHTPQAFRCEWLAEAHMRAWE  179

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              G   TDD S+VE   +PV + EG YSN+KVTTP+D+++AE +  AR
Sbjct  180   AGYTGTDDASLVEWAGYPVSMVEGLYSNLKVTTPEDLVIAEALWRAR  226



>ref|WP_012343863.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_001788846.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A3 str. Loch Maree]
 sp|B1KTA8.1|ISPD_CLOBM RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum A3 str. Loch Maree]
 gb|ACA55946.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A3 str. Loch Maree]
Length=229

 Score =   160 bits (405),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 128/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+ + FS    + EIV+V      +V  +
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLNKFSTHESIDEIVLVTLEDKIEVCSE  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K+ I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYSINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYA  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  G+  K TIK  N + F + T NR+ L+  QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGIIPKDTIKIKNEKGFAIDTPNREDLFIAQTPQCFNYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLEDYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_003360173.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_002864519.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum Ba4 str. 657]
 sp|C3KVS6.1|ISPD_CLOB6 RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum Ba4 str. 657]
 gb|EDT86870.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum Bf]
 gb|ACQ52648.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum Ba4 str. 657]
 gb|EPS52258.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum A1 str. CFSAN002368]
 gb|AJD26297.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum CDC_297]
 gb|AJE10130.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum CDC_1436]
Length=229

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 130/221 (59%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+ + FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLNKFSTHESIDEIVLVALEDKIEVCSD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYV  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K T+K  + + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTVKIKDEKGFAIDTPNREDLFIVQTPQCFNYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_038267415.1| hypothetical protein [[Clostridium] litorale]
 gb|KDR94332.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[ [[Clostridium] litorale DSM 5388]
Length=228

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 128/227 (56%), Gaps = 7/227 (3%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC----DPFYND  774
             S I+L  G GKRM   + K Y+ + G+P+ L + ++   +P++ E+VVV     +  +N+
Sbjct  3     SAIVLCAGRGKRMKSGINKMYMEIWGRPLVLITLESMISVPEIDELVVVISREDEALFNE  62

Query  775   -VFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              VFE    +  I + +   G ERQ+SVYNG Q+V    E++ IHD ARP      +++ +
Sbjct  63    KVFERLECRKKISIVYG--GSERQESVYNGLQKVSDGCEIVIIHDGARPFATRDMIKRTI  120

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +     GA   GVPAK TIK  + E  V+ T NRK LW +QTPQ  K +++K+ +E    
Sbjct  121   ECASAKGACAAGVPAKDTIKIVDEEGIVIDTPNRKELWCIQTPQTFKLDIIKRAYEKAVS  180

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             EG   TDD  + E     V I  G Y NIK+TTP+D+  A+ IL  R
Sbjct  181   EGYAATDDSMVAEYSGEKVQIVMGDYENIKITTPEDIPFAKAILERR  227



>ref|WP_006522896.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
gibsoniae]
 ref|YP_007943593.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
gibsoniae DSM 7213]
 gb|AGK99916.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
gibsoniae DSM 7213]
Length=224

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 123/219 (56%), Gaps = 3/219 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             SV  ++ A G   RMG  + KQ L L GQP+ ++S      +P V  +++V  P   ++F
Sbjct  3     SVYALVAAAGRSTRMGGGVNKQLLDLAGQPVVVHSLRALHAVP-VDGLILVVTPGEEEIF  61

Query  781   EDAGKKF--HIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
                  +F   + +K    G  R DSV +G   +    EL+ +HD ARPL+    + + + 
Sbjct  62    RSVLNRFMHDVVIKIVPGGASRGDSVMSGLMALPNDVELVVVHDGARPLIKPEKIREAIS  121

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  GAA L VPAK TIK A  +  V +TL R  LW++QTPQV K +LL +   +  R+
Sbjct  122   QARQWGAATLAVPAKDTIKVAGEQDLVRQTLQRDKLWQVQTPQVFKRQLLVEAHRVAARD  181

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLA  1251
             G   TDD S+VE L HPV +  G Y+NIK+TTP+D++LA
Sbjct  182   GFAGTDDASLVERLGHPVKLVRGDYANIKITTPEDIVLA  220



>ref|WP_021127538.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [[Clostridium] 
sordellii]
 gb|EPZ61323.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
sordellii VPI 9048]
 emb|CEK39892.1| 2-C-methyl-D-erythritol 4-phosphatecytidylyltransferase [ [[Clostridium] 
sordellii]
Length=225

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF-E  783
              VI++A G G RM   + KQ++ L  + I  Y+ D F    ++ +IVVV      D F E
Sbjct  3     GVIIVAAGTGSRMKKDINKQFIKLDNKEIIAYTIDKFYINNEIDDIVVVIKKDEEDYFKE  62

Query  784   DAGKKFHIE-LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
             +  +K++ + +K A  G+ERQDSVYNG Q++D + E++ +HD ARP V    +   +K+ 
Sbjct  63    NILEKYNFKNIKIAYGGEERQDSVYNGIQKLDKNCEVVLVHDGARPFVTEEIINNSIKEA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 A V+GV  K TIK    E  +V T NRK LW +QTPQV K +++ K +E    E  
Sbjct  123   KKHNAVVVGVKVKDTIKVVGEEGNIVDTPNRKYLWSVQTPQVFKYDIITKAYENAYNENY  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  +VE + + V + EGSY NIK+TT +D+   E+IL
Sbjct  183   YGTDDAMLVEKIGYDVKMIEGSYDNIKITTQEDLNFGEQIL  223



>ref|WP_034305081.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
simplex]
Length=229

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  610   VILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDA  789
             V++ A G GKRM     K ++ L G PI +Y+   F + P  + I++  +P   D F   
Sbjct  5     VVIPAAGQGKRMKAGKNKLFIELSGIPIIVYTLRVFEEDPDCRGIILSINPAEKDYFNQL  64

Query  790   GKKFHIEL--KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
                + ++   K  + GKERQ SVYNG Q  D   +++ +HD ARP +  G + ++     
Sbjct  65    IAAYGLKKVKKLVMGGKERQQSVYNGLQHAD--EDIVLVHDGARPFITLGQISELTTAAS  122

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
             L G AV+ VP K TIK+A N+  V+ T+ R +LW +QTPQ  +  +LK+ +E    EG  
Sbjct  123   LHGGAVIAVPVKDTIKKAANKK-VLETVERSSLWAVQTPQAFRVSILKRAYEQAEAEGFL  181

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              TDD S++E +   V I EG+Y NIK+TT +D+  AE IL+
Sbjct  182   GTDDASLLERINEQVVIIEGNYDNIKITTQEDLYFAEAILH  222



>ref|WP_007085315.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
bataviensis]
 gb|EKN69196.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
bataviensis LMG 21833]
Length=230

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 129/226 (57%), Gaps = 4/226 (2%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +  VIL A G GKRMG    K  L L G P+ +++   F +      I++   P     F
Sbjct  2     TYQVILPAAGQGKRMGAGRNKLLLELNGVPVLIHTLKVFDEDEGCSGIILAIHPHDEKEF  61

Query  781   EDAGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +   KK+HI+  +     G+ERQ S+YN  + V+ ++++I +HDAARP +    + ++ +
Sbjct  62    KALLKKYHIKKVMNLVRGGEERQHSIYNALKTVN-TNDIILVHDAARPFIRKEQIHRLAE  120

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  GAA++GVPAK T+K+  +   +V T+ R +LW +QTPQ  +  LL+K +E    +
Sbjct  121   TAEETGAAIIGVPAKDTMKKVQD-GVIVETVERSSLWAVQTPQAFRISLLRKAYEKAEAD  179

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
                 TDD S+VE L  PV I EG Y NIK+TTP+D+  AE IL  R
Sbjct  180   HFLGTDDASLVERLNMPVAIVEGDYDNIKLTTPEDLYFAEAILKKR  225



>sp|Q824I4.2|ISPD_CHLCV RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Chlamydophila caviae GPIC]
Length=212

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 126/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G+R G + PKQYLP  G+P+ L++  T   +P++ E++VVCD  Y  +FE 
Sbjct  6     SLILLSGGKGERFGANQPKQYLPFQGEPLILHALKTALHIPEITEVIVVCDVSYRHIFEG  65

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     +KFA  GK RQDSV++G Q V  S+  + IHD  RP +   +V +++     
Sbjct  66    ------FPVKFAESGKRRQDSVFSGLQHV--SNPWVLIHDGVRPFIYPDEVTELIAVAQQ  117

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA L      TIK+ +     V+TL+R  L  + TPQ +K E+L  G E  +REG+ +
Sbjct  118   TGAATLVSNVPYTIKQRHP----VKTLDRDALSIVHTPQCVKTEILSAGLEFASREGITL  173

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD    ELL  PV +    +  IK+T P+D+ +A  +L
Sbjct  174   VDDTQAAELLDIPVSLVSSKHPQIKITYPEDLTIAHALL  212



>ref|WP_027322682.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
sp. URHB0009]
Length=229

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 132/226 (58%), Gaps = 4/226 (2%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             S  VIL A G GKRMG    K  L L G P+ +++   F K P  ++I++  +P     F
Sbjct  2     SYQVILPAAGQGKRMGAGKNKLLLELDGIPLLIHTLKVFEKDPDCEKIILAINPQDEIEF  61

Query  781   EDAGKKFHIE-LKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +   ++F ++ +   +PG KERQ S++N  + V+ + ELI +HDAARP +    + ++ +
Sbjct  62    KGLIEQFGLKKIDGLVPGGKERQQSIHNALKTVE-NGELILVHDAARPFIQTDAISRLTE  120

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  GAA+L VP K TIK+A +   V  T+ R +LW +QTPQ  +  +LK  +E+   +
Sbjct  121   QARQTGAAILAVPVKDTIKKAED-GKVTETVERSSLWAVQTPQAFRISILKGAYELAEED  179

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
                 TDD S+VE + HPV + EG Y NIK+TTP+D+  AE IL  R
Sbjct  180   DFLGTDDASLVERIPHPVSVVEGDYDNIKLTTPEDLFFAEAILKKR  225



>emb|CEK31265.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
sordellii]
Length=225

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 126/221 (57%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
              VI++A G G RM   + KQ++ L  + I  Y+ D F    ++ +IVVV      D F++
Sbjct  3     GVIIVAAGTGSRMKKDINKQFIKLDNKEIIAYTIDKFYINDEIDDIVVVIKKDEEDYFKE  62

Query  787   A--GKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                GK     +K A  G+ERQDSVYNG Q++D + E++ +HD ARP V    +   +++ 
Sbjct  63    NILGKYNFKNIKIAYGGEERQDSVYNGIQKLDKNCEVVLVHDGARPFVTEEIINNSIQEA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 A V+GV  K TIK    E  +V T NRK LW +QTPQV K +++ K +E    E  
Sbjct  123   KKHNAVVVGVKVKDTIKVVGEEGNIVDTPNRKYLWSVQTPQVFKYDIITKAYENAYNENY  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  +VE + + V + EGSY NIK+TT +D+   E+IL
Sbjct  183   YGTDDAMLVEKIGYDVKMIEGSYDNIKITTQEDLNFGEQIL  223



>ref|WP_011006134.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
caviae]
 ref|NP_829035.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
caviae GPIC]
 gb|AAP04913.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
caviae GPIC]
Length=214

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 126/219 (58%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G+R G + PKQYLP  G+P+ L++  T   +P++ E++VVCD  Y  +FE 
Sbjct  8     SLILLSGGKGERFGANQPKQYLPFQGEPLILHALKTALHIPEITEVIVVCDVSYRHIFEG  67

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     +KFA  GK RQDSV++G Q V  S+  + IHD  RP +   +V +++     
Sbjct  68    ------FPVKFAESGKRRQDSVFSGLQHV--SNPWVLIHDGVRPFIYPDEVTELIAVAQQ  119

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA L      TIK+ +     V+TL+R  L  + TPQ +K E+L  G E  +REG+ +
Sbjct  120   TGAATLVSNVPYTIKQRHP----VKTLDRDALSIVHTPQCVKTEILSAGLEFASREGITL  175

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD    ELL  PV +    +  IK+T P+D+ +A  +L
Sbjct  176   VDDTQAAELLDIPVSLVSSKHPQIKITYPEDLTIAHALL  214



>ref|WP_017889075.1| hypothetical protein [Candidatus Caldatribacteirum californiense]
Length=241

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 132/232 (57%), Gaps = 4/232 (2%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             S   +++A G+G+RM  ++PKQYLPLLG+P+  ++ + F +   V E+ VV  P +  +F
Sbjct  7     SFFAVVVAAGVGERMNAALPKQYLPLLGKPVLAHTLEAFERFEPVAEVTVVIHPLHEKIF  66

Query  781   EDA---GKKFHIELKFALPGKERQDSVYNGFQEV-DLSSELICIHDAARPLVLAGDVEKV  948
             E       +F    ++   G  RQDSVY G +   D   + + IHD  RPLV    + + 
Sbjct  67    EREILERYRFRKVRRYVFGGATRQDSVYEGVKVYRDHPEDFVLIHDGVRPLVGEEVLWRC  126

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             ++      A  + +P+  T+K + +   V +TL+R+T+W  QTPQ  +  L+ + FE   
Sbjct  127   VEGLRKHEAICVAIPSVDTLKLSLDGQTVQKTLDRRTVWRAQTPQAFRVGLILQAFEQAR  186

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFNYA  1284
             +EG + TDD S+VE L  PVY+  GS  N+K+TTP D LLAE +L  R  ++
Sbjct  187   KEGFQGTDDASLVERLGVPVYLVLGSEENLKITTPQDFLLAEEMLRFRVRWS  238



>ref|WP_008681225.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sp. 7_2_43FAA]
 gb|EEH96400.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sp. 7_2_43FAA]
Length=222

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 134/229 (59%), Gaps = 17/229 (7%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             +S I+LAGG GKRMG  + KQY+ L G+PI  Y+   F     + +I++V      D  E
Sbjct  2     ISAIILAGGKGKRMGAKISKQYIELNGKPILYYTLKRFVDCEGIDKIILV---LPKDEIE  58

Query  784   DAGK----KFHIELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
                K    K+ +++   + G KERQDSVYN  Q+++  SE++ IHD AR  V     E+V
Sbjct  59    YCNKEILEKYSLKVDMIVEGGKERQDSVYNALQKIN-DSEIVLIHDGARAFV----SERV  113

Query  949   LKDGW----LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +KDG     + GAA  GV  K TIK  +   F   T +R  L  +QTPQ  K E++K+  
Sbjct  114   IKDGIKYAKIYGAAAPGVMPKDTIKVVDENGFSDSTPDRSKLLAIQTPQTFKLEIIKECH  173

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             E +    + VTDD  +VE+  + VY+  G Y+NIKVTTP+D++LAER++
Sbjct  174   EKVKENNISVTDDTMVVEMYNNKVYLYNGEYTNIKVTTPEDLILAERLI  222



>ref|WP_022248342.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Eubacterium 
sp. CAG:274]
 emb|CDC19936.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Eubacterium 
sp. CAG:274]
Length=231

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/229 (40%), Positives = 129/229 (56%), Gaps = 3/229 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC--DPFYND  774
             +VSVI++A G GKRM  ++ KQYL L G+ I  Y+ + F + P V EI++V   D     
Sbjct  2     NVSVIIVAAGSGKRMKSAIAKQYLDLKGRSILSYTVEVFEESPVVNEIILVTGKDEIEYV  61

Query  775   VFEDAGKKFHIELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
               E   +    ++K  + G  ERQ SV NG   V  + +++ IHD  RP +    +E + 
Sbjct  62    KSEIIDRYGFTKIKAVVEGGSERQYSVENGLNNVSDNCDIVMIHDGVRPFIDENSIEVLA  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +D    GA VLGV AK TIK  +   FVV T NRK LW  QTPQ  K +++KK +E   +
Sbjct  122   EDTAKYGACVLGVFAKDTIKICDENGFVVDTPNRKLLWHAQTPQCFKYDVIKKAYEKAKK  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
             +    TDD  +VE     + + EGSY NIK+TTP+D+ + ERIL    N
Sbjct  182   DNYLGTDDSMLVERTGQKIKMVEGSYDNIKITTPEDLYVGERILERNLN  230



>ref|WP_021121689.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [[Clostridium] 
sordellii]
 gb|EPZ62033.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
sordellii ATCC 9714]
 emb|CEJ72128.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
sordellii]
Length=225

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 130/221 (59%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF-E  783
              VI++A G G RM  ++ KQ++ L  + I  Y+ D F    ++ +IVVV      D F E
Sbjct  3     GVIIVAAGTGSRMKKNINKQFIKLDNKEIIAYTIDKFYINNEIDDIVVVIKKDEEDYFKE  62

Query  784   DAGKKFHIE-LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
             +  +K++ + +K A  G+ERQDSVYNG Q++D + E++ +HD ARP V    +   +++ 
Sbjct  63    NILEKYNFKNIKIAYGGEERQDSVYNGIQKLDKNCEVVLVHDGARPFVTEEIINNSIQEA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 A V+GV  K TIK    E  +V T NRK LW +QTPQV K +++ K +E    E  
Sbjct  123   KKHNAVVVGVKVKDTIKVVGEEGNIVDTPNRKYLWSVQTPQVFKYDIITKAYENAYNENY  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  +VE + + V + EGSY NIK+TT +D+   E+IL
Sbjct  183   YGTDDAMLVEKIGYDVKMIEGSYDNIKITTQEDLNFGEQIL  223



>ref|WP_032123645.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sp. LF2]
Length=225

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 133/223 (60%), Gaps = 4/223 (2%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             V+ ++LAGG GKRM  S+ KQ+L +  +P+  Y+ D F    +V EI +V      + F+
Sbjct  4     VNALILAGGKGKRMNKSISKQFLTIQEKPVLYYTLDKFDSCSRVDEIYLVLPEDEIEYFK  63

Query  784   DA--GK-KFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +   GK +F+  +     GKERQ SVYNG   +D + +++ IHD ARP +    + + ++
Sbjct  64    EYILGKYRFNKPIHIVKGGKERQHSVYNGLIAMD-NCDVVLIHDGARPFINEELINEGIE  122

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
               +L GAA  GV  K TIK  +N  F   TLNR  L  +QTPQ  K  ++ +G   I   
Sbjct  123   STFLYGAAAPGVKLKDTIKIVDNNGFSKTTLNRDELVAIQTPQCFKYSIILEGHNYIREN  182

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              + VTDD  +VELL + VYI +GSY+NIK+TTP+D+ +AE I+
Sbjct  183   KITVTDDTMVVELLDYNVYIYDGSYNNIKITTPEDLKIAETII  225



>ref|WP_013840343.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
ruminis]
 ref|YP_004543852.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
ruminis DSM 2154]
 gb|AEG58566.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
ruminis DSM 2154]
Length=231

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 126/227 (56%), Gaps = 3/227 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             ++  ++ A G+G RMG  + KQYL L   PI   +       P+++ IV+V  P      
Sbjct  3     NIMAVIPAAGIGSRMGSGIKKQYLMLGNMPILARTIRAMEDNPEIQGIVLVVGPGEEAYC  62

Query  781   ED---AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              D   AGK F   +     G  RQ SVYNG   +   ++L+ IHD ARPLV  G++ +V+
Sbjct  63    RDYILAGKAFSKVMAVVPGGDHRQSSVYNGLSFLPGETQLVLIHDGARPLVQPGEISRVI  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +    VGAA L VP K T+K  +   +V  T  R++LW +QTPQV +  ++ +       
Sbjct  123   EAAREVGAAALAVPLKDTVKVVDCRGWVQSTPPRESLWAVQTPQVFRYGIIMEAHRKARE  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              GL  TDD ++VE L  PV +  GSY NIK+TTP+D++LAE  L+ R
Sbjct  183   AGLLATDDCALVEFLGGPVKLVAGSYENIKITTPEDLVLAEAFLSRR  229



>ref|WP_014253910.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [[Clostridium] 
clariflavum]
 ref|YP_005045203.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
clariflavum DSM 19732]
 gb|AEV67279.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [ [[Clostridium] 
clariflavum DSM 19732]
Length=237

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 129/225 (57%), Gaps = 3/225 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVV--CDPFYNDV  777
             VS++++A G G RM + + KQY+ + G PI   + + F  L  + EIV+V  CD      
Sbjct  9     VSLVVVAAGRGTRMNMGINKQYINVGGTPILARTLNVFDALNCIDEIVLVVHCDDIMYCR  68

Query  778   FEDAGKKFHIELKFALPGKE-RQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
              +  GK  + ++K  + G E RQDSV+NG +EV  +S+++ IHD ARP V    + + ++
Sbjct  69    EKIIGKNNYRKIKSVVTGGETRQDSVFNGLKEVSQNSDIVLIHDGARPFVDEDSIVRCIE  128

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  G A + VP K TIK A+NE FV  TL+R  LW +QTPQ  +  ++    +   R+
Sbjct  129   AAKQYGVATVAVPVKDTIKSADNEGFVNSTLDRSVLWSIQTPQAFRYNIIMDSHKQARRD  188

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNA  1269
             G   TDD  + E L +   +  G+Y NIK+TT +D++ AE I N+
Sbjct  189   GFIGTDDTVLAERLGNKTKLVMGTYRNIKITTKEDLIFAESIANS  233



>ref|WP_008882046.1| MULTISPECIES: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Geobacillus]
 ref|YP_001124213.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermodenitrificans NG80-2]
 sp|A4IJG4.1|ISPD_GEOTN RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Geobacillus thermodenitrificans NG80-2]
 gb|ABO65468.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
thermodenitrificans NG80-2]
 gb|EDY04151.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Geobacillus 
sp. G11MC16]
Length=228

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 128/222 (58%), Gaps = 4/222 (2%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             I+LA G GKRM   M KQ++ L G+P+ + +   F    +   IV+V +P     FE   
Sbjct  6     IVLAAGQGKRMNAGMNKQFIELGGEPLIVRTLKVFDGDERCNGIVLVVNPTERGQFEQLF  65

Query  793   KKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
             +++ I   + FA  G+ERQ SVYNG Q +  S E++ IHD ARP V    + ++      
Sbjct  66    ERYRIRKVVAFADGGQERQHSVYNGLQALR-SGEIVLIHDGARPFVRIRHLHELADAAVQ  124

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA+  V  K TIK+ +   FV +T++R +LW +QTPQ  +  L+ +  E   + G   
Sbjct  125   YGAAIPAVRVKDTIKKVDG-LFVEQTIDRSSLWAVQTPQAFRLSLIMEAHEEAKKAGYLG  183

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             TDD S+VE L  PV I EG Y NIK+TTP+D+L AE IL +R
Sbjct  184   TDDASLVERLGRPVKILEGDYRNIKLTTPEDLLFAEAILASR  225



>ref|WP_003404303.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
 ref|YP_001783146.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum B1 str. Okra]
 sp|B1IGH9.1|ISPD_CLOBK RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Clostridium botulinum B1 str. Okra]
 gb|ACA45707.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum B1 str. Okra]
 gb|EKX78729.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum CFSAN001628]
Length=229

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+   FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSSISKQFLQIKNKPILYYTLSKFSTHESIDEIVLVTLEDKIEVCGD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQDSVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQDSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYT  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  + + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTIKIKSEKGFAIDTPNREDLFIVQTPQCFNYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EG+YSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGNYSNIKITTPEDLILGEQIL  225



>emb|CEK34466.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase,2-C-methyl-D-erythritol 
4-phosphate cytidylyltransferase,2-C-methyl-D-erythritol 
4-phosphate cytidylyltransferase,2C-methyl-D-erythritol 
2,4-cyclodiphosphate synthase,2-C-methyl-D-erythritol 
4-phosphate cytidylyltransferase,Uncharacterized protein 
family UPF0007 [ [[Clostridium] sordellii]
Length=225

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 129/221 (58%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF-E  783
              VI++A G G RM   + KQ++ L  + I  Y+ D F    ++ +IVVV      D F E
Sbjct  3     GVIIVAAGTGSRMKKDINKQFIKLDNKEIIAYTIDKFYINNEIDDIVVVIKKDEEDYFKE  62

Query  784   DAGKKFHIE-LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
             +  +K++ + +K A  G+ERQDSVYNG Q++D + E++ +HD ARP V    +   +++ 
Sbjct  63    NILEKYNFKNIKIAYGGEERQDSVYNGIQKLDKNCEVVLVHDGARPFVTEEIINNSIQEA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 A V+GV  K TIK    E  +V T NRK LW +QTPQV K +++ K +E    E  
Sbjct  123   KKHNAVVVGVKVKDTIKVVGEEGNIVDTPNRKYLWSVQTPQVFKYDIITKAYENAYNENY  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
               TDD  +VE + + V + EGSY NIK+TT +D+   E+IL
Sbjct  183   YGTDDAMLVEKIGYDVKMIEGSYDNIKITTQEDLNFGEQIL  223



>ref|WP_007290337.1| 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Thermosinus 
carboxydivorans]
 gb|EAX46661.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Thermosinus 
carboxydivorans Nor1]
Length=385

 Score =   162 bits (410),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/229 (39%), Positives = 126/229 (55%), Gaps = 14/229 (6%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             V+ I+ A G G+RMG    K  L L G P+ + +    +  PQ+ EI+VV  P      E
Sbjct  2     VTAIIAAAGQGRRMGAGSNKVLLTLAGVPLVVRTIRQLAACPQIDEIIVVSGP------E  55

Query  784   DAGKKFHIELKFALP--------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDV  939
             +  +   +    AL         G ERQ SV N    V   +E+I +HD ARPLV    +
Sbjct  56    EMAEMRSLVSAMALAPKCQVVAGGSERQYSVANALTAVSGKAEIIVVHDGARPLVDQTAI  115

Query  940   EKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFE  1119
             E V+      GAAV+ VP K TIK A++  FVV T +RKTLW +QTPQ  +  +L++ + 
Sbjct  116   ENVIAAARGYGAAVVAVPVKDTIKVADDNGFVVTTPDRKTLWAIQTPQAFRAAILRQAYA  175

Query  1120  IINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             +   EG   TDD S+VE +  PV +  GSY N+K+TTP+DM++A  +L 
Sbjct  176   LAAAEGFLGTDDASLVERMGMPVKLVPGSYRNLKITTPEDMVIAAALLG  224



>ref|WP_034246470.1| hypothetical protein [Lachnospira multipara]
Length=234

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 133/229 (58%), Gaps = 13/229 (6%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFEDAG  792
             ILL+GG GKRMG + PKQYL +LG P+  YS   F + P +  I++V  P Y + F+   
Sbjct  5     ILLSGGKGKRMGSNTPKQYLEILGHPLIYYSLKAFQESPLIDRIIIVSSPNYENYFKGII  64

Query  793   KKFHIELKFAL--PGKERQDSVYNGFQEV---DLSSELIC-IHDAARPLVLAGDVEKVLK  954
             K+++ +  + +   G+ER DSV++G   +   D+S E +C IHD ARPLV    +E  + 
Sbjct  65    KEYNFDKVYGIAKAGQERYDSVFSGLSMIPSHDISDENVCLIHDGARPLVTTDIIENCVA  124

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELL----KKGFEI  1122
             D     A+V  V AK TIK AN E F ++T +R +L+++QTPQ    +L+    KK +E 
Sbjct  125   DALKYKASVAAVKAKDTIKVANKEGFAIKTPDRASLYQIQTPQSFGLKLVIDAYKKMYEA  184

Query  1123  INREGLEVTDDVSIVELLKH-PVYITEGSYSNIKVTTPDDMLLAERILN  1266
                 G  VTDD  +V        ++TE SY NIK TTP+D+ + E  L+
Sbjct  185   QETNG--VTDDAMVVSKFAGVDPFLTESSYKNIKATTPEDLAIIECFLS  231



>gb|KGO12530.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum]
Length=229

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 130/221 (59%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  S+ KQ+L +  +PI  Y+ + FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNNSISKQFLQIKNKPILYYTLNKFSTHESIDEIVLVTLEDKIEVCSD  64

Query  787   AGKKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I    K    GKERQ+SVYNG + V    E++ IHDAARP V +  +E  ++  
Sbjct  65    IIDKYNINKVSKIVPGGKERQNSVYNGLKAVSKDCEVVLIHDAARPFVTSDIIENGIRYV  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K T+K  + + F + T NR+ L+ +QTPQ     ++    E + +   
Sbjct  125   NQYGAAACGVIPKDTVKIKDEKGFAIDTPNREDLFIVQTPQCFNYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_038304574.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]
Length=238

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 135/232 (58%), Gaps = 4/232 (2%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             S   +++A G+G+RM  ++PKQYLPLLG+P+  ++ + F +   V E+ VV  P +  +F
Sbjct  4     SFFAVVVAAGVGERMNAALPKQYLPLLGKPVLAHTLEAFERFEPVAEVTVVIHPLHERLF  63

Query  781   E-DAGKKFHIE--LKFALPGKERQDSVYNGFQEV-DLSSELICIHDAARPLVLAGDVEKV  948
             + +  +++H     ++   G  RQDSVY G +   D   + + IHD  RPLV    + + 
Sbjct  64    KREILERYHFRKVRQYVFGGTTRQDSVYEGVKVYRDHPEDFVLIHDGVRPLVGEEVLWRC  123

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             ++      A  + +P+  T+K + +   V +TL+R+T+W  QTPQ  +  L+ + FE   
Sbjct  124   VEGLRKHEAVCVAIPSVDTLKLSLDGQTVQKTLDRRTVWRAQTPQAFRVGLILQAFEQAR  183

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFNYA  1284
             +EG + TDD S+VE L  PVY+  GS  N+K+TTP D LLAE +L  R  ++
Sbjct  184   KEGFQGTDDASLVERLGVPVYLVLGSEENLKITTPQDFLLAEEMLRFRVRWS  235



>ref|WP_008517608.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Dethiobacter 
alkaliphilus]
 gb|EEG76883.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Dethiobacter 
alkaliphilus AHT 1]
Length=232

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 132/233 (57%), Gaps = 23/233 (10%)
 Frame = +1

Query  613   ILLAGGMGKRMGVSMPKQYLPLLGQPI------ALYSFDTFSKLPQVKEIVVVCDPFYND  774
             I+ A G G+RMG  + KQYL +LG+P+      A+++ D F+      +++VV  P   +
Sbjct  6     IIPAAGQGRRMGKDINKQYLQVLGKPVLSHTLAAVFAADCFT------QVIVVVTPGEEE  59

Query  775   VFED-------AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAG  933
             +F         +GK    ++     GKERQDSV+N  Q V+  ++ I IHD ARPL+   
Sbjct  60    IFRRDVLLSCFSGK----DISVVTGGKERQDSVFNALQSVEEDTDYISIHDGARPLIRPE  115

Query  934   DVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKG  1113
                + L+     GA +  VP K TIK  ++E  V  T  R+ LW +QTPQV + + L   
Sbjct  116   LFRRSLEAAKNCGAVIAAVPVKDTIKMVDSEKKVAGTPERQKLWSVQTPQVFRRDWLLDA  175

Query  1114  FEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
             ++   R+G   TDD +++E   +PV++ EG Y NIKVTTP+D++LAE +L  R
Sbjct  176   YQRARRDGYSATDDAALLEHYGYPVHVLEGDYENIKVTTPEDLILAEALLGRR  228



>ref|WP_023211601.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans]
 ref|YP_007273153.2| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans Re1]
 emb|CCP27177.2| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans Re1]
Length=235

 Score =   157 bits (398),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 128/230 (56%), Gaps = 8/230 (3%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC-----DPFY  768
             VS ++ AGG GKRM  S+ KQ+L + G PI  Y+ + F K+  +  IV+V      D   
Sbjct  5     VSAVIAAGGHGKRMNSSVSKQFLTIKGHPILYYTLNKFEKMDVISSIVLVTGVDDMDYTR  64

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
             N++    G K   ++K    GKERQDSVYNG +E+   ++++ IHD  RP V    +EK 
Sbjct  65    NEIIRKYGFK---KVKLVEGGKERQDSVYNGLRELSPQTDIVVIHDGVRPFVPIKLIEKS  121

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             +       A  + VP K TIK   + + +  T +RKTLW +QTPQ  K +L+   +E   
Sbjct  122   ITAAIKYKAVGVAVPVKDTIKIVGDGNTIKSTPDRKTLWSIQTPQTFKYDLILAAYEKAI  181

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
              EG   TDD  +VE +   V I EG+Y NIK+TTP+D++ AE  +   F 
Sbjct  182   SEGFYGTDDTVLVERMGLSVKIIEGAYENIKITTPEDIIFAEAFVALGFG  231



>ref|WP_013779216.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans]
 ref|YP_004461604.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans Re1]
 gb|AEE92297.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Tepidanaerobacter 
acetatoxydans Re1]
Length=233

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 128/230 (56%), Gaps = 8/230 (3%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC-----DPFY  768
             VS ++ AGG GKRM  S+ KQ+L + G PI  Y+ + F K+  +  IV+V      D   
Sbjct  3     VSAVIAAGGHGKRMNSSVSKQFLTIKGHPILYYTLNKFEKMDVISSIVLVTGVDDMDYTR  62

Query  769   NDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
             N++    G K   ++K    GKERQDSVYNG +E+   ++++ IHD  RP V    +EK 
Sbjct  63    NEIIRKYGFK---KVKLVEGGKERQDSVYNGLRELSPQTDIVVIHDGVRPFVPIKLIEKS  119

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             +       A  + VP K TIK   + + +  T +RKTLW +QTPQ  K +L+   +E   
Sbjct  120   ITAAIKYKAVGVAVPVKDTIKIVGDGNTIKSTPDRKTLWSIQTPQTFKYDLILAAYEKAI  179

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
              EG   TDD  +VE +   V I EG+Y NIK+TTP+D++ AE  +   F 
Sbjct  180   SEGFYGTDDTVLVERMGLSVKIIEGAYENIKITTPEDIIFAEAFVALGFG  229



>ref|WP_008426549.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sp. Maddingley MBC34-26]
 gb|EKQ52124.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sp. Maddingley MBC34-26]
Length=224

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 134/229 (59%), Gaps = 17/229 (7%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VS I+LAGG GKRMG +  KQY+ L G+PI  Y+   F K  Q+ ++++V       V E
Sbjct  2     VSAIVLAGGRGKRMGYAQSKQYIDLSGKPILYYTLKQFIKNDQIDKLILV-------VPE  54

Query  784   DAGK--KFHIELKFALP-------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGD  936
             D  +  K  +  K+ L        G ERQDSVYN   EV  SS+++ IHDA+RP V    
Sbjct  55    DEKEYCKSQVLDKYELRVDGLVAGGNERQDSVYNALVEVK-SSDIVLIHDASRPFVSQKI  113

Query  937   VEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGF  1116
             +   +K   +  AA  GV  K TIK   +++F V TL R  L  +QTPQ    +L+ +  
Sbjct  114   ISDAIKYARIYKAAAPGVMPKDTIKVKGDDNFSVETLIRSNLVAIQTPQAFNFDLIYESH  173

Query  1117  EIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             + I + G+ VTDD S+VE L + VYI EG Y+NIK+TTP+D+ LA+ ++
Sbjct  174   KEIKKRGIVVTDDTSVVEYLGNKVYIYEGDYTNIKITTPEDLALAKYLV  222



>ref|WP_037996996.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoactinomyces 
sp. Gus2-1]
 gb|KFZ39825.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermoactinomyces 
sp. Gus2-1]
Length=229

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 132/229 (58%), Gaps = 10/229 (4%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDP----FY  768
             SV V++ A G+GKRMG   PKQ+L   GQPI +++   F   P++ E+VVV D       
Sbjct  2     SVGVVVPAAGLGKRMGAREPKQFLTFHGQPILIHTLALFESFPEIDEMVVVADQKEIGRT  61

Query  769   NDVFEDAGKKFHIELKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
               +   AG +   ++   +PG KERQ+SVY G +++  S++ + +HDA RP V    + +
Sbjct  62    QKMIRGAGLQ---KVTHVVPGGKERQESVYLGLKKI--STDWVMVHDAVRPFVSHEAISR  116

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             +L++  + GAA+L VP K T+K  ++   V  T +RK LW +QTPQ  + E+L    E  
Sbjct  117   LLEEARMHGAAILAVPVKDTVKVVDDAGIVENTPDRKRLWAVQTPQAFRREVLLSAHEHF  176

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
                    TDD  +VE +   V + +G Y+NIK+TTPDD+ LAE I   R
Sbjct  177   AGRETVATDDSMLVEEMGVDVRVVQGEYTNIKLTTPDDLYLAEAIYQMR  225



>ref|WP_031306172.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Brevibacillus 
panacihumi]
Length=227

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 124/224 (55%), Gaps = 1/224 (0%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +  V+++A G GKRMG    K +LPL G+PI  ++   F+   ++ +IV+V      D  
Sbjct  2     TTGVVIVAAGSGKRMGGQRNKLWLPLAGEPILAHTVRLFASHQEIGQIVLVVSEADRDEV  61

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                 +K +I+L   L G ERQDSV NG + +   +  + +HDAARP V    + ++++  
Sbjct  62    LAWLEKDNIQLTVVLGGAERQDSVRNGLEALQDCTH-VLVHDAARPFVTPEQISQIIRQV  120

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                 A +L VP K TIK       V  T  R++LW +QTPQ  +  LLK+      R G 
Sbjct  121   QRDQATILAVPVKDTIKVVGETGVVESTPARESLWAVQTPQAFRMSLLKEAHLAAWRAGK  180

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
               TDD  +VE L HPV +  GSY NIK+TTPDD+LL E IL  R
Sbjct  181   IGTDDAMLVEWLGHPVTVMAGSYENIKITTPDDLLLGEEILRKR  224



>ref|WP_013276840.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermosediminibacter 
oceani]
 ref|YP_003826455.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermosediminibacter 
oceani DSM 16646]
 gb|ADL08832.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Thermosediminibacter 
oceani DSM 16646]
Length=232

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 134/230 (58%), Gaps = 9/230 (4%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             ++ ++ AGG G+RM  ++ KQ+L L G+PI  Y+  TF  L ++ EI++V  P  +D+F 
Sbjct  3     IAAVIAAGGRGRRMNSTLSKQFLMLKGRPILYYTLSTFESLEEIGEIILVVGP--SDIFL  60

Query  784   DAGKKFHI-----ELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
              A ++  I     ++K    G+ERQDSVYNG +     ++++ IHD  RP V    ++  
Sbjct  61    -AEQEVLIPYCFKKVKLVEGGRERQDSVYNGLRSCSPQTDIVVIHDGVRPFVTKTMIKNS  119

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             ++      A  +GVP K TIK  + +  ++ T  R TLW +QTPQ  +  L+ +  E   
Sbjct  120   IEAAVKYRAVGVGVPVKDTIKVVD-KGLIINTPARSTLWAIQTPQTFEYNLILRAHEEAR  178

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFN  1278
             + G   TDD  +VE L +PV + EG+Y NIK+TTP+DM++AE  +N  + 
Sbjct  179   KSGFYGTDDTVLVERLGYPVRMIEGAYENIKITTPEDMIVAEAFMNMGYG  228



>ref|WP_035163836.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Caloranaerobacter 
azorensis]
 gb|KGG80109.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Caloranaerobacter 
azorensis H53214]
Length=232

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 92/231 (40%), Positives = 137/231 (59%), Gaps = 13/231 (6%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K +SVI+ A GMGKRM   + KQ++ +   P+   +   F+K   + EI+VV    Y+++
Sbjct  6     KYISVIVPAAGMGKRMNSKINKQFIKIKDIPVLARTLMEFNKCDYIDEIIVVTR--YDEI  63

Query  778   FEDAGKKFHIELKFALP--------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAG  933
               D  +K  IE K+ L         GKERQDSVYNG +EV+  S+++ IHD ARP V   
Sbjct  64    --DFCQKEIIE-KYKLDKVKKVIQGGKERQDSVYNGLKEVNKKSDIVLIHDGARPFVKRN  120

Query  934   DVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKG  1113
              +E+ +K     GA V GVP K TIK+ +    ++ T NRK LW +QTPQ  + +L+ K 
Sbjct  121   IIEENIKFALEYGACVTGVPVKDTIKKVDLNGEIISTPNRKELWAIQTPQTFRYDLILKA  180

Query  1114  FEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             +E    +    TDD  +VE + + V I  G YSNIK+TTP+D+++AE +++
Sbjct  181   YEKAKLDNFLGTDDSMLVERMGYKVKIVMGDYSNIKITTPEDLIIAETLVD  231



>emb|CEG24703.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase IspD (YacM) 
[Bacillus simplex]
Length=229

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 84/221 (38%), Positives = 123/221 (56%), Gaps = 5/221 (2%)
 Frame = +1

Query  610   VILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED-  786
             V++ A G GKRM     K ++ L G PI +Y+   F + P  + I++  +P   D F   
Sbjct  5     VVIPAAGQGKRMKAGKNKLFIELSGVPIIVYTLRVFEEDPDCRGIILSINPAEKDYFNQL  64

Query  787   -AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGW  963
              A        K  + GKERQ SVYNG Q  +   +++ +HD ARP +  G + ++     
Sbjct  65    IAANGLKKVKKLVMGGKERQQSVYNGLQHAE--EDIVLVHDGARPFITLGQISELTTAAS  122

Query  964   LVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLE  1143
             L G AV+ VP K TIK+A N+  V+ T+ R +LW +QTPQ  +  +LK  +E    EG  
Sbjct  123   LNGGAVIAVPVKDTIKKAANKK-VLETVERSSLWAVQTPQAFRVSILKSAYEQAEAEGFL  181

Query  1144  VTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              TDD S++E +   V I EG+Y NIK+TT +D+  AE IL+
Sbjct  182   GTDDASLLERINEQVVIIEGNYDNIKITTQEDLYFAEAILH  222



>ref|WP_003491256.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sporogenes]
 gb|EHN16115.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sporogenes PA 3679]
 gb|KCZ66846.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[Clostridium sporogenes]
 gb|AJD31410.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
botulinum Prevot_594]
Length=229

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 132/221 (60%), Gaps = 2/221 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             SVI++A G GKRM  ++ KQ+L +  +PI  Y+ + FS    + EIV+V      +V  D
Sbjct  5     SVIIVAAGKGKRMNSNISKQFLKIKDKPILYYTLNKFSTHKSIDEIVLVTLEDKIEVCRD  64

Query  787   AGKKFHIEL--KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                K++I+   K    GKERQDSVYNG + V  + +++ IHDAARP V +  +E  +K  
Sbjct  65    IIDKYNIDKVSKIVPGGKERQDSVYNGLKAVSENCDVVLIHDAARPFVTSDIIENGIKYV  124

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA  GV  K TIK  + + F + T +R+ L+ +QTPQ     ++    E + +   
Sbjct  125   KQYGAAASGVRPKDTIKIKDKQGFAIDTPSREDLFIVQTPQCFDYNIILDCHEKLKKHNK  184

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             +VTDD  ++E     VY+ EGSYSNIK+TTP+D++L E+IL
Sbjct  185   KVTDDTMVLENYGKSVYLYEGSYSNIKITTPEDLILGEQIL  225



>ref|WP_006343827.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
abortus]
 ref|YP_219590.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
abortus S26/3]
 sp|Q5L6V2.1|ISPD_CHLAB RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Chlamydophila abortus S26/3]
 emb|CAH63618.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydophila abortus S26/3]
 gb|EGK68940.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
abortus LLG]
 emb|CED80223.1| putative 2-c-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Chlamydophila abortus]
Length=217

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 137/241 (57%), Gaps = 24/241 (10%)
 Frame = +1

Query  541   LYGVNGDLHKRCADLAVKEKSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFS  720
             +YGV+ D   +C          S+ILL+GG G+R G + PKQYLP  G+P+ L++ +   
Sbjct  1     MYGVSMD--PKC----------SLILLSGGKGERFGANQPKQYLPFRGEPLILHALNMAL  48

Query  721   KLPQVKEIVVVCDPFYNDVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICI  900
             ++P++ EI+VVCD  Y  +FE         +KFA PG  RQDSV++G Q+V  ++  + +
Sbjct  49    RIPEISEIIVVCDVNYESIFEG------YPVKFARPGTRRQDSVFSGLQQV--ANPWVLV  100

Query  901   HDAARPLVLAGDVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTP  1080
             HD  RP +   +V +++   +  GAA L      TIK+ +     V+TL+R  L  + TP
Sbjct  101   HDGVRPFIYPDEVTELVTAAYQTGAATLVSNVPYTIKQRDP----VKTLDRDALSIVHTP  156

Query  1081  QVIKPELLKKGFEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERI  1260
             Q IK ++L +G E  N+E + + DD    ELL  PV +    +  IKVT P+D+ LA  +
Sbjct  157   QCIKTQILLEGLERANQERITLVDDTQAAELLNLPVALVFNKHPQIKVTYPEDLTLAHAL  216

Query  1261  L  1263
             L
Sbjct  217   L  217



>emb|CAJ74506.1| similar to 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Candidatus Kuenenia stuttgartiensis]
Length=229

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 130/224 (58%), Gaps = 5/224 (2%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIV-VVCDPFYN---  771
             VS IL+  G+G RMG  + K ++ +  +P+ L++ D FS+   + EIV +V +P  N   
Sbjct  6     VSGILVGAGLGLRMGGDVKKPFIQINDKPVFLHTIDRFSQCSLISEIVLIVGEPEINVVL  65

Query  772   DVFEDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
             D + D+   ++I+ K    GK RQDSV+NG   VD  +E++ IHD  RPLV    +E V+
Sbjct  66    DTWRDSLNAYNIK-KIVPGGKRRQDSVFNGLCNVDADTEIVLIHDLVRPLVKKEHIEAVV  124

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
                    AA+L  P K+T+KE N++  + +T+ R  LW  QTPQ  +  L+   F     
Sbjct  125   YKTREYKAAILAAPMKATVKEVNDDLSIKKTIPRNKLWMAQTPQGFEKTLIINVFRQFQH  184

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              G E TDD  +VE   HPVYI  GS  NIK+TTPDD+ +A+ +L
Sbjct  185   TGREFTDDAQMVEEAGHPVYIVPGSDENIKITTPDDIRIAKALL  228



>ref|WP_035395250.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydophila 
abortus]
Length=212

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 129/219 (59%), Gaps = 12/219 (5%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S+ILL+GG G+R G + PKQYLP  G+P+ L++ +   ++P++ EI+VVCD  Y  +FE 
Sbjct  6     SLILLSGGKGERFGANQPKQYLPFRGEPLILHALNMALRIPEISEIIVVCDVNYESIFEG  65

Query  787   AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDGWL  966
                     +KFA PG  RQDSV++G Q+V  ++  + +HD  RP +   +V +++   + 
Sbjct  66    ------YPVKFARPGTRRQDSVFSGLQQV--ANPWVLVHDGVRPFIYPDEVTELVTAAYQ  117

Query  967   VGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGLEV  1146
              GAA L      TIK+ +     V+TL+R  L  + TPQ IK ++L +G E  N+E + +
Sbjct  118   TGAATLVSNVPYTIKQRDP----VKTLDRDALSIVHTPQCIKTQILLEGLERANQERITL  173

Query  1147  TDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
              DD    ELL  PV +    +  IKVT P+D+ LA  +L
Sbjct  174   VDDTQAAELLNLPVALVFNKHPQIKVTYPEDLTLAHALL  212



>ref|WP_026565498.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
sp. UNC41MFS5]
Length=228

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 128/226 (57%), Gaps = 4/226 (2%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +  VIL A G GKRMG    K  L L   P+ +++   F +     +I+V   P     F
Sbjct  2     TYQVILPAAGQGKRMGAGKNKLLLELNSVPVLIHTLKVFEQDNACSKIIVAIHPQDEGEF  61

Query  781   EDAGKKFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             +    K+++     L   GKERQDS++N  + V+ +  +I +HDAARP +    + ++ K
Sbjct  62    KALFTKYNVAKSIHLVPGGKERQDSIFNALKTVE-TDGIILVHDAARPFISKEHIYRLAK  120

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  GAA+LG+PAK TIK+  +   VV T+ R +LW +QTPQ  +  LLK+ +E   ++
Sbjct  121   MAEDTGAAILGIPAKDTIKKVQD-GLVVETVERSSLWAVQTPQAFRISLLKEAYEKAEKD  179

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
                 TDD S+VE L HP+ + EG Y NIK+TTP+D+  AE IL  R
Sbjct  180   SYLGTDDASLVERLGHPIAMVEGDYDNIKLTTPEDIYFAEAILEKR  225



>gb|AIS53218.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase IspD 
[Thermoanaerobacter kivui]
Length=227

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/228 (39%), Positives = 130/228 (57%), Gaps = 15/228 (7%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             S +++A G G RMG ++ K Y+ L G+P+  YS   F  +  +KEI+VV         E+
Sbjct  4     SAVVVAAGKGTRMGQTVNKVYIHLGGKPVLYYSLKVFDDIDCIKEIIVVVSK------EE  57

Query  787   AG-------KKFHIE--LKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDV  939
              G       KK+  +  +K    G ERQ SVYNG       SE++ IHD ARPL+    V
Sbjct  58    MGYCQQNVIKKYSFKKPIKLVEGGSERQHSVYNGLINTSKHSEIVAIHDGARPLIDKEIV  117

Query  940   EKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFE  1119
                L+  ++  AA +GVP K TIK  + ++F+V T +RK LW +QTPQV +  L+    +
Sbjct  118   LNTLEQAYVYKAAAVGVPVKDTIKIVDEDNFIVSTPDRKFLWAIQTPQVFERGLIIDAHQ  177

Query  1120  IINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
                +EG   TDD  +VE L + V + EG+Y NIK+TTP+D+++AE  L
Sbjct  178   KAIKEGFIGTDDSVLVERLDYKVKVVEGNYKNIKITTPEDLIVAEAFL  225



>ref|WP_008410809.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
hydrothermale]
 emb|CCO07768.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desulfotomaculum 
hydrothermale Lam5 = DSM 18033]
Length=229

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/225 (39%), Positives = 125/225 (56%), Gaps = 2/225 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             V  ++ A G+G RMG ++ KQYL L+ +P+ L++ +     P +  +V+V  P    +  
Sbjct  4     VMAVVPAAGVGSRMGTNVKKQYLNLIDKPVLLHTLEVLETCPDISGMVLVVAPGEEALCR  63

Query  784   D--AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
                 G+ F   +     G  RQ SVY+G   +   + L+ IHD ARPLV A ++ + ++ 
Sbjct  64    SMVQGRGFTKIMAVVPGGDHRQTSVYHGLMALPADTALVVIHDGARPLVRAAEISRAVQA  123

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
                 GAA L VP K T+K  N +  VV T  R TLW +QTPQV + EL+ K        G
Sbjct  124   AAENGAAALAVPVKDTVKVVNEQGLVVHTPPRSTLWAVQTPQVFRYELINKAHLAAREAG  183

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
                TDD ++VE L HPV +  GSY NIK+TTP+D++LAE  L  R
Sbjct  184   QLATDDCALVEALGHPVKLVPGSYENIKITTPEDLVLAEAFLRRR  228



>ref|WP_037465077.1| hypothetical protein [Shimazuella kribbensis]
Length=234

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/230 (39%), Positives = 132/230 (57%), Gaps = 9/230 (4%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
              + V++ A G+GKRM    PKQ+L L G+PI +++ + F + P + EI VV +       
Sbjct  2     EIGVVIPAAGVGKRMNSITPKQFLELFGKPILIHTLEVFDEHPFITEINVVTNQENVKQV  61

Query  781   EDAGKKFHIEL--KFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             E   +K++++   +    GKERQDSVY G   V   +E + +HDA R  V A ++  +++
Sbjct  62    EKLIRKYNLKKVKQVVRGGKERQDSVYAGV--VATQTEWVMVHDAVRAFVTAAEISALIR  119

Query  955   ---DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
                D  L  AA L VP K TIK  N+   VV TL R+ LW +QTPQ+   ++L    +  
Sbjct  120   AVNDQQL--AATLAVPIKDTIKRVNHAKIVVETLEREQLWSIQTPQLFHRKILLDAHQYA  177

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
               + L  TDD  +VE L  PV + EG+Y+N+K+TTP+D+LL E IL  R 
Sbjct  178   EEQNLVGTDDAMLVENLSIPVKVVEGAYTNLKITTPEDILLGETILAKRM  227



>ref|WP_010284961.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Bacillus 
timonensis]
Length=228

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/222 (37%), Positives = 131/222 (59%), Gaps = 3/222 (1%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
              V++ A G GKRM     KQ++ L  +P+ +++   F + P    I++V +     +FE+
Sbjct  4     QVVIPAAGQGKRMNAGKNKQFIELHQKPVIIHTLRVFEQDPMCSGIILVINKDEQLIFEE  63

Query  787   AGKKFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                 ++I+   +L   G ERQ SVYNG QEV   ++++ +HD ARP +    V +++   
Sbjct  64    LLHTYNIQKVISLVQGGSERQYSVYNGLQEVK-KTDIVLVHDGARPFLKKEHVHELVNVA  122

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAAVL VP K TIK A+++ +V  T+ R +LW +QTPQ     +L++  E+  +EG 
Sbjct  123   AEKGAAVLAVPVKDTIKRASSDLYVEETVERSSLWAIQTPQAFHVSILQEAHELARKEGF  182

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
               TD+ S+VE +   VYI +G Y N+K+TTPDD++ AE IL 
Sbjct  183   LGTDEASLVERIPKQVYIVKGDYLNLKLTTPDDLVFAEAILQ  224



>ref|WP_006212950.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Paenibacillus 
vortex]
 gb|EFU38292.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Paenibacillus 
vortex V453]
Length=232

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 125/217 (58%), Gaps = 4/217 (2%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
               +++A G G RMG    KQYL L G+PI +++ + FS++P ++EIV+V  P      + 
Sbjct  6     GAVIVAAGKGTRMGTRESKQYLALGGKPIIVHTLEVFSRIPWLQEIVLVTGPEDVSRCQS  65

Query  787   AGKKFHIE-LKFALPG-KERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                ++ ++ +   +PG  ERQ SVY G +++  SSE + IHD  RP V   ++E      
Sbjct  66    WVHEYGLDKVSAVIPGGSERQQSVYQGIKQI--SSEWVMIHDGVRPFVTLEEIESCRDAA  123

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GA+VLGVP K TIK+ N +  +  T +R++LW +QTPQ  +   L    E   +EG 
Sbjct  124   IREGASVLGVPVKDTIKQVNGQGLITGTPDRQSLWAVQTPQAFRLSDLLSAHEAAAKEGF  183

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLA  1251
               TDD  ++E   H V + EG YSNIK+TTP+D+  A
Sbjct  184   TGTDDAMLMERAGHSVIVVEGKYSNIKITTPEDLEYA  220



>ref|WP_035057918.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, partial 
[Desulfuromonas sp. TF]
Length=228

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/228 (40%), Positives = 128/228 (56%), Gaps = 11/228 (5%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVC-----DPF  765
             SV+V++ A GMG RMG S+ KQYL L  +P+  ++   F   P +  I +V      D  
Sbjct  2     SVTVLIPAAGMGARMGASVNKQYLLLADRPVLAHTLGLFDHHPSIDHIFIVSPEEEIDYC  61

Query  766   YNDVFEDAGKKFHIELKFALPG-KERQDSVYNGFQEVDLS-SELICIHDAARPLVLAGDV  939
               +V E  G     +++  +PG  ERQDSVYNG      S S+++ IHD  RP      +
Sbjct  62    RAEVVERFG---FTKIRDLIPGGAERQDSVYNGLSACAASNSDIVLIHDGVRPFFPYHRI  118

Query  940   EKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFE  1119
             + V+    L GA V+GVP K TIKE   E  +  T +R+ LW+ QTPQ     L++   E
Sbjct  119   KDVVTAAGLNGACVVGVPVKDTIKEVA-EGLIRNTPDRRRLWQAQTPQAFVFGLIRDAHE  177

Query  1120  IINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
                +EG   TDD S+VE   HPV + EGSY NIK+TTP+D++LAE  +
Sbjct  178   RARQEGFRGTDDASLVERNGHPVAMIEGSYRNIKITTPEDLILAEAFI  225



>ref|WP_035135177.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sulfidigenes]
 gb|KEZ85121.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
sulfidigenes]
Length=235

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 132/231 (57%), Gaps = 10/231 (4%)
 Frame = +1

Query  607   SVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFED  786
             + I+LA G GKRMG ++ KQ+L L  +P+  ++   FS    + +I+V+C     D  E 
Sbjct  5     TAIILAAGQGKRMGSNVNKQFLTLAEKPVLYHTIKAFSDNKNIDDIIVLCAE---DEMEY  61

Query  787   AGK----KFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKV  948
               K    K+ ++   AL   GKERQDSVYNG + ++   +++ IHD ARP V    +   
Sbjct  62    CKKNIIEKYDLKKVRALVKGGKERQDSVYNGLKAIE-PCDIVLIHDGARPFVTENIINDG  120

Query  949   LKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIIN  1128
             +K+    GA   GV +K TIK  + E F   TLNR+  + +QTPQ  K +++    E + 
Sbjct  121   IKNAEKYGACTCGVKSKDTIKIKDKEGFAKETLNREDTFIVQTPQCFKYDIILFCHEKLR  180

Query  1129  REGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARFNY  1281
             +   +VTDD  IVE     VY+ EGSY NIK+TTP+DM++ E IL  ++ Y
Sbjct  181   KTKEQVTDDAMIVEKFDRKVYLYEGSYLNIKLTTPEDMIIGENILKNKYKY  231



>ref|WP_010231427.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 ref|NP_297120.1| conserved hypothetical protein [Chlamydia muridarum str. Nigg]
 sp|Q9PJT1.1|ISPD_CHLMU RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Chlamydia muridarum str. Nigg]
 gb|AAF39554.1| conserved hypothetical protein [Chlamydia muridarum str. Nigg]
 gb|AHH23133.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum str. Nigg3 CMUT3-5]
 gb|AHH24058.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum str. Nigg CM972]
 gb|KDU80930.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|KDU81770.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|KDU82180.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|KDU83725.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|KDU84757.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|AID38262.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum str. Nigg 2 MCR]
 gb|AIT90905.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|AIT91794.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
 gb|AIW23673.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Chlamydia 
muridarum]
Length=218

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 123/222 (55%), Gaps = 12/222 (5%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             S S++LL GG G+R     PKQY PL G+P+ L++  ++  LP ++EIVVVC+  Y ++F
Sbjct  4     SCSLVLLGGGRGERFNSPQPKQYTPLCGEPLILHALHSYQSLPFIQEIVVVCEEHYQELF  63

Query  781   EDAGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKDG  960
                       +KFA PG  RQDSV++G Q+V L    +C+HD  RP V A +V +V    
Sbjct  64    SP------YSVKFASPGALRQDSVFSGLQQVSLP--WVCVHDGVRPFVYANEVSEVCSAA  115

Query  961   WLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREGL  1140
                GAA L   A  TIK        VRTL+R  +  + TPQ I  E+LK+G  + N    
Sbjct  116   LKTGAAALATSATYTIKSRTP----VRTLDRDAVAVIHTPQCINTEILKEGLLLANMMDF  171

Query  1141  EVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
              ++DD    ELL     +   +   +K+T P+D+L AE +L+
Sbjct  172   TLSDDSEAAELLGIEPTLVFSNRVQMKITYPEDLLFAEALLS  213



>ref|WP_006691581.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
infelix]
 gb|EHG22095.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
infelix ATCC 43532]
Length=256

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 136/226 (60%), Gaps = 10/226 (4%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSV+  A G   RM   + K +L L G+P+ L +  TFSK+ +V E++V      ++V  
Sbjct  2     VSVVFPAAGQAHRMNAGLNKVFLTLAGKPMLLRTLLTFSKVSEVGELIVAVGA--DEV--  57

Query  784   DAGKKFHIELKFALP------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             DA K     +K   P      G ERQ S+ NG   V   ++++ +HDAARPL+    +E 
Sbjct  58    DAVKGLLSRVKGLAPWQVVEGGSERQYSIRNGLAVVSEEADIVLVHDAARPLIRRETIEA  117

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             +++     GAA++ VP K+TIK A+ ++ VV T  R TLW++QTPQ  + E+L++     
Sbjct  118   LIRVVRAEGAAIVAVPEKNTIKIASEDNIVVSTPPRSTLWQVQTPQGFRKEILREANRRA  177

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             + +G   TDD S+VE +  PV+I +G YSNIKVTTP+DM++AE IL
Sbjct  178   DEDGFLGTDDASLVERIGVPVHIVKGEYSNIKVTTPEDMVVAEAIL  223



>ref|WP_011026366.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Caldanaerobacter 
subterraneus]
 ref|NP_623859.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 sp|Q8R7S6.1|ISPD_THETN RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; 
AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; AltName: Full=MEP cytidylyltransferase; Short=MCT 
[Caldanaerobacter subterraneus subsp. tengcongensis MB4]
 gb|AAM25463.1| 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Caldanaerobacter 
subterraneus subsp. tengcongensis MB4]
 gb|ERM91035.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Caldanaerobacter 
subterraneus subsp. yonseiensis KB-1]
Length=227

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/224 (41%), Positives = 134/224 (60%), Gaps = 3/224 (1%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +VS +++A G   RM  S+ K YL + G+P+  YS   F ++  +KEI+VV  P   +  
Sbjct  2     NVSAVIVAAGRSTRMNKSLNKVYLSIAGKPVLYYSIKAFDEIEWIKEIIVVTSPEETEYC  61

Query  781   -EDAGKKFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
              E+  +KF+    F +   G+ERQ SVYNG   VD   E++ IHD ARPLV    + + +
Sbjct  62    QENVLEKFYWNKPFKIVKGGEERQYSVYNGISVVDKDCEIVAIHDGARPLVTKEIIMEAI  121

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             K  +L  AA +GVP K TIK A+ ++F++ T +R+ LW +QTPQV + EL+ K       
Sbjct  122   KAAYLYKAAAVGVPVKDTIKVADEDNFILDTPDRRYLWAIQTPQVFEKELIVKAHRKALE  181

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
             EG   TDD  +VE +   V + EG Y NIK+TTP+D+++AE  L
Sbjct  182   EGFLGTDDSVLVERMGFKVKLVEGDYKNIKITTPEDLVVAELFL  225



>ref|WP_008714035.1| IspD/IspF bifunctional enzyme [Veillonella sp. 3_1_44]
 gb|EFG23756.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Veillonella 
sp. 3_1_44]
Length=391

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 127/225 (56%), Gaps = 2/225 (1%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K++S I+LA G G+RMG    K ++PL G  I   +     K+  +KEI++V      + 
Sbjct  3     KAISCIVLAAGAGRRMGYKENKIFIPLGGYSIIQRTIQNVEKIEGLKEIILVVAEGEQEY  62

Query  778   FED--AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
               +   G   HI +K  L G+ERQDSV  G + V   S ++ +HD ARPL      + V+
Sbjct  63    MSNHIQGLDLHIPVKIVLGGRERQDSVAYGLKAVSEDSNIVLVHDGARPLASTKLFDSVV  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +     GAA +GVPA  TIK  + E  V+ TL R  L+++QTPQ  + +L K+  +    
Sbjct  123   RAAIEYGAATVGVPATDTIKRVDTEHTVIETLKRSELYQIQTPQGFQKDLFKEAHQKAYD  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             E    TDDVS+VE L  PV+I  G Y NIKVTTP+D+ +A+R L 
Sbjct  183   EKYLGTDDVSLVEHLGQPVHIVSGDYCNIKVTTPNDIAVAKRYLG  227



>ref|WP_021148215.1| 2-C-methyl-D-erythritol4-phosphate cytidylyl transferase [Veillonella 
parvula]
 gb|EQC65701.1| 2-C-methyl-D-erythritol4-phosphate cytidylyl transferase [Veillonella 
parvula HSIVP1]
 gb|ETI97271.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Veillonella 
dispar DORA_11]
Length=391

 Score =   160 bits (405),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/225 (40%), Positives = 127/225 (56%), Gaps = 2/225 (1%)
 Frame = +1

Query  598   KSVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDV  777
             K++S I+LA G G+RMG    K ++PL G  I   +     K+  +KEI++V      + 
Sbjct  3     KAISCIVLAAGAGRRMGYKENKIFIPLGGYSIIQRTIQNVEKIEGLKEIILVVAEGEQEY  62

Query  778   FED--AGKKFHIELKFALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVL  951
               +   G   HI +K  L G+ERQDSV  G + V   S ++ +HD ARPL      + V+
Sbjct  63    MSNHIQGLDLHIPVKIVLGGRERQDSVAYGLKAVSEDSNIVLVHDGARPLASTKLFDSVV  122

Query  952   KDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINR  1131
             +     GAA +GVPA  TIK  + E  V+ TL R  L+++QTPQ  + +L K+  +    
Sbjct  123   RAAIEYGAATVGVPATDTIKRVDTEHTVIETLKRSELYQIQTPQGFQKDLFKEAHQKAYD  182

Query  1132  EGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             E    TDDVS+VE L  PV+I  G Y NIKVTTP+D+ +A+R L 
Sbjct  183   EKYLGTDDVSLVEYLGKPVHIVSGDYCNIKVTTPNDIAVAKRYLG  227



>ref|WP_009439743.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
sp. oral taxon 138]
 gb|EKY01894.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
sp. oral taxon 138 str. F0429]
Length=256

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 138/227 (61%), Gaps = 10/227 (4%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSV+  A G   RM + + K +L L G+P+ L +  TFSK+P+V E++V      ++V  
Sbjct  2     VSVVFPAAGQAHRMQIGLNKVFLTLAGKPMLLRTLLTFSKVPEVGELIVAVGA--DEV--  57

Query  784   DAGKKFHIELKFALP------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             DA +     +K   P      G ERQ S+ NG   V   ++++ +HDAARPL+    +E+
Sbjct  58    DAVRTLLGRVKGLAPWRVVEGGSERQYSIRNGLALVSEEADVVLVHDAARPLIRRETIEE  117

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             +++     GAA++ VP K+TIK A+ ++ VV T  R TLW++QTPQ  + E+L +     
Sbjct  118   LIRVVRAEGAAIVAVPEKNTIKIASEDNVVVSTPPRSTLWQVQTPQGFRKEILIEANRRA  177

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             + +G   TDD S+VE +  PV+I +G YSNIKVTTP+DM++AE IL 
Sbjct  178   DEDGFLGTDDASLVERIGVPVHIVKGEYSNIKVTTPEDMVVAEAILR  224



>ref|WP_009710870.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Desmospora 
sp. 8437]
 gb|EGK09702.1| 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase [Desmospora 
sp. 8437]
Length=246

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 129/233 (55%), Gaps = 17/233 (7%)
 Frame = +1

Query  601   SVSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVF  780
             +  V++ A G GKRMG ++ KQ+L L G+P+ + +   F   P V  +V+     + D  
Sbjct  18    NAGVVIPAAGKGKRMGTAISKQFLDLCGEPVLIRTLRVFLDHPAVSRLVLAV---HRD--  72

Query  781   EDAGKKFHIELKFALP---------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAG  933
              +    + +  ++ +P         GKERQDSV    QE  L++E + +HDA RP V   
Sbjct  73    -EETSVYQLLDEYGIPREKVGITPGGKERQDSVCRALQE--LATEWVLVHDAVRPFVTHE  129

Query  934   DVEKVLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKG  1113
              + ++L     VGAAVL VP K T+KE      V RTL R  LW +QTPQ  +  LL + 
Sbjct  130   QISELLIQVKRVGAAVLAVPVKDTVKEVTPGMDVARTLERSRLWAVQTPQAFRRSLLVQA  189

Query  1114  FEIINREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNAR  1272
              E   R+GL  TDD  +VE +  PV + +G YSN+K+TTP+DM+LAE I   R
Sbjct  190   HEEGRRKGLAATDDAMLVEAMGIPVRVVKGDYSNLKLTTPEDMILAEAIWKMR  242



>ref|WP_037355564.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
sp. FC4001]
Length=250

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 126/222 (57%), Gaps = 2/222 (1%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSVI  A G GKRM   + K  L L G+PI + +  TFS + +V E++VV         E
Sbjct  2     VSVIFPAAGQGKRMQAGINKVLLTLGGEPILVRTLKTFSAVEEVGELIVVVAADEVTAVE  61

Query  784   DAGKKFHIELKFAL--PGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLKD  957
                +K      F +   G ERQ S+YNG Q+V  S++++ +HDAARP+V    ++ V+  
Sbjct  62    GQLQKVSGLKPFQVVAGGSERQYSIYNGLQQVAASADVVLVHDAARPMVTVMTIQAVIDT  121

Query  958   GWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINREG  1137
                 G A+  VPAK+TIK  + E  VV T  R  LWE+QTPQ  + ++L K  E    + 
Sbjct  122   ARSKGGAIAAVPAKNTIKVVDAEGLVVDTPPRSALWEVQTPQGFRKDILIKANEAAVADN  181

Query  1138  LEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERIL  1263
                TDD S+VE +  PV + +  Y NIKVTTP+D+L+AE  L
Sbjct  182   FLGTDDASLVERIGAPVAVVQSDYRNIKVTTPEDLLVAEAFL  223



>ref|WP_010073763.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
cellulovorans]
 ref|YP_003845189.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
cellulovorans 743B]
 gb|ADL53425.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Clostridium 
cellulovorans 743B]
Length=229

 Score =   155 bits (393),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 132/227 (58%), Gaps = 5/227 (2%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VS ++LA G GKRMG ++ KQ+L L  +PI  Y+   F     V EIV+V      +  +
Sbjct  4     VSAVILAAGKGKRMGAAVNKQFLELKDKPIIYYAIKAFEDNSNVDEIVLVAAKEEVEYIK  63

Query  784   DA--GKKFHIELK-FALPGKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEKVLK  954
             ++   K F  ++K   + G ERQDSV+ G   +  + E + IHD ARP V    ++  +K
Sbjct  64    ESVVKKYFFSKVKEVVIGGTERQDSVFAGLSALK-NCEYVLIHDGARPFVTNEIIDNGIK  122

Query  955   DGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEIINRE  1134
                  GA   GV  K TIK  +  +  V TL R  L+ +QTPQ  K +++ +  EIIN++
Sbjct  123   YVKQYGATACGVTPKDTIKLKDENNISVDTLKRNELFCVQTPQTFKFDVIYRAHEIINQK  182

Query  1135  GLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILNARF  1275
              LEVTDD    E+L   VY+ EG+Y NIK+TTP+D+++AE ILN RF
Sbjct  183   SLEVTDDTMAAEILGEKVYLYEGTYENIKITTPEDIIIAENILN-RF  228



>ref|WP_009656154.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
sp. FOBRC6]
 gb|EJO22669.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Selenomonas 
sp. FOBRC6]
Length=256

 Score =   156 bits (395),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 137/227 (60%), Gaps = 10/227 (4%)
 Frame = +1

Query  604   VSVILLAGGMGKRMGVSMPKQYLPLLGQPIALYSFDTFSKLPQVKEIVVVCDPFYNDVFE  783
             VSV+  A G   RM + + K +L L G+P+ L +  TFSK+P+V E++V      ++V  
Sbjct  2     VSVVFPAAGQAHRMQIGLNKVFLTLAGKPMLLRTLLTFSKVPEVGELIVAVGA--DEV--  57

Query  784   DAGKKFHIELKFALP------GKERQDSVYNGFQEVDLSSELICIHDAARPLVLAGDVEK  945
             DA +     +K   P      G ERQ S+ NG   V   ++++ +HDAARPL+    +E+
Sbjct  58    DAVRALLGRVKGLAPWRVVEGGSERQYSIRNGLALVSEEADVVLVHDAARPLIRRETIEE  117

Query  946   VLKDGWLVGAAVLGVPAKSTIKEANNESFVVRTLNRKTLWEMQTPQVIKPELLKKGFEII  1125
             +++     GAA++ VP K+TIK A+ +  VV T  R TLW++QTPQ  + E+L +     
Sbjct  118   LIRVVRAEGAAIVAVPEKNTIKIASEDGVVVSTPPRSTLWQVQTPQGFRKEILIEANRRA  177

Query  1126  NREGLEVTDDVSIVELLKHPVYITEGSYSNIKVTTPDDMLLAERILN  1266
             + +G   TDD S+VE +  PV+I +G YSNIKVTTP+DM++AE IL 
Sbjct  178   DEDGFLGTDDASLVERIGVPVHIVKGEYSNIKVTTPEDMVVAEAILR  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4282802373808