BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25803_g2_i1 len=1720 path=[1:0-566 568:567-691 693:692-719
721:720-745 18360:746-778 780:779-805 18584:806-808 810:809-843
845:844-1019 1021:1020-1045 7341:1046-1159 18679:1160-1160
7455:1161-1268 18695:1269-1276 18703:1277-1294 7586:1295-1410
18737:1411-1431 18748:1432-1450 18767:1451-1454 18771:1455-1498
7784:1499-1520 7806:1521-1529 7815:1530-1564 15589:1565-1719]

Length=1720
                                                                      Score     E

gb|ADN32811.1|  sieve element occlusion b                               320   5e-95   
ref|XP_006341794.1|  PREDICTED: uncharacterized protein LOC102602329    318   3e-94   
ref|XP_009767734.1|  PREDICTED: uncharacterized protein LOC104218849    317   4e-94   
ref|XP_009622867.1|  PREDICTED: uncharacterized protein LOC104114193    315   3e-93   
gb|ADN32812.1|  sieve element occlusion c                               315   5e-93   
ref|XP_004239152.1|  PREDICTED: uncharacterized protein LOC101249174    313   1e-92   
ref|XP_004239153.1|  PREDICTED: uncharacterized protein LOC101249...    303   8e-89   
ref|XP_004237262.1|  PREDICTED: uncharacterized protein LOC101263509    296   2e-86   
ref|XP_010320950.1|  PREDICTED: uncharacterized protein LOC101249...    286   2e-83   
ref|XP_006438201.1|  hypothetical protein CICLE_v10030843mg             276   2e-79   
ref|XP_006483988.1|  PREDICTED: uncharacterized protein LOC102625551    276   2e-79   
gb|KDO82145.1|  hypothetical protein CISIN_1g005245mg                   276   2e-79   
ref|XP_010682345.1|  PREDICTED: uncharacterized protein LOC104897214    269   5e-77   
gb|KDP26703.1|  hypothetical protein JCGZ_17861                         269   7e-77   
ref|XP_006378256.1|  hypothetical protein POPTR_0010s06010g             267   3e-76   
emb|CDP13257.1|  unnamed protein product                                264   2e-74   
ref|XP_011012451.1|  PREDICTED: uncharacterized protein LOC105116695    260   9e-74   
ref|XP_002282172.1|  PREDICTED: uncharacterized protein LOC100261038    260   2e-73   Vitis vinifera
ref|XP_010248720.1|  PREDICTED: uncharacterized protein LOC104591548    256   3e-72   
emb|CAN83922.1|  hypothetical protein VITISV_026532                     253   6e-71   Vitis vinifera
ref|XP_010250966.1|  PREDICTED: uncharacterized protein LOC104593030    252   2e-70   
ref|XP_011034021.1|  PREDICTED: uncharacterized protein LOC105132310    248   2e-69   
ref|XP_006379953.1|  hypothetical protein POPTR_0008s18360g             248   3e-69   
ref|XP_002515051.1|  conserved hypothetical protein                     247   8e-69   Ricinus communis
ref|XP_009403632.1|  PREDICTED: uncharacterized protein LOC103987147    239   6e-66   
ref|XP_010660833.1|  PREDICTED: uncharacterized protein LOC100245845    234   4e-64   
ref|XP_002526964.1|  conserved hypothetical protein                     234   8e-64   Ricinus communis
ref|XP_002298571.2|  hypothetical protein POPTR_0001s35870g             233   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010904538.1|  PREDICTED: uncharacterized protein LOC105031936    232   2e-63   
ref|XP_011013023.1|  PREDICTED: uncharacterized protein LOC105117152    231   5e-63   
emb|CBI34821.3|  unnamed protein product                                236   7e-63   
gb|KDP46383.1|  hypothetical protein JCGZ_10223                         231   7e-63   
ref|XP_011016134.1|  PREDICTED: uncharacterized protein LOC105119666    230   1e-62   
ref|XP_002526966.1|  conserved hypothetical protein                     231   2e-62   Ricinus communis
ref|XP_006369948.1|  hypothetical protein POPTR_0001s35900g             229   3e-62   
ref|XP_002526965.1|  conserved hypothetical protein                     229   6e-62   Ricinus communis
ref|XP_003633800.1|  PREDICTED: uncharacterized protein LOC100244128    229   7e-62   
ref|XP_010912936.1|  PREDICTED: uncharacterized protein LOC105038753    228   9e-62   
ref|XP_011014801.1|  PREDICTED: uncharacterized protein LOC105118...    227   2e-61   
ref|XP_007044877.1|  Sieve element occlusion e, putative                226   2e-61   
ref|XP_006369945.1|  hypothetical protein POPTR_0001s35850g             226   3e-61   
ref|XP_011014800.1|  PREDICTED: uncharacterized protein LOC105118...    226   3e-61   
ref|XP_011014132.1|  PREDICTED: uncharacterized protein LOC105117991    226   4e-61   
ref|XP_006369946.1|  hypothetical protein POPTR_0001s35860g             226   4e-61   
ref|XP_011014351.1|  PREDICTED: uncharacterized protein LOC105118161    225   6e-61   
ref|XP_002298572.2|  hypothetical protein POPTR_0001s35880g             224   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_008793697.1|  PREDICTED: uncharacterized protein LOC103709939    224   2e-60   
ref|XP_011010496.1|  PREDICTED: uncharacterized protein LOC105115342    224   2e-60   
ref|XP_011013686.1|  PREDICTED: uncharacterized protein LOC105117652    223   3e-60   
ref|XP_003633822.1|  PREDICTED: uncharacterized protein LOC100249294    223   6e-60   
ref|XP_006848934.1|  hypothetical protein AMTR_s00166p00029650          222   7e-60   
ref|XP_009415984.1|  PREDICTED: uncharacterized protein LOC103996731    222   8e-60   
ref|XP_002324001.2|  hypothetical protein POPTR_0017s10720g             222   8e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010044527.1|  PREDICTED: uncharacterized protein LOC104433471    221   1e-59   
gb|KDP46373.1|  hypothetical protein JCGZ_10213                         221   3e-59   
ref|NP_001240968.1|  uncharacterized protein LOC100799626               220   3e-59   
ref|XP_010660832.1|  PREDICTED: uncharacterized protein LOC100268167    221   4e-59   
ref|XP_007159683.1|  hypothetical protein PHAVU_002G258300g             220   5e-59   
gb|KHN29013.1|  hypothetical protein glysoja_008348                     219   5e-59   
ref|XP_009386688.1|  PREDICTED: uncharacterized protein LOC103973766    219   7e-59   
ref|XP_011013170.1|  PREDICTED: uncharacterized protein LOC105117262    219   1e-58   
ref|XP_006470197.1|  PREDICTED: uncharacterized protein LOC102630205    219   2e-58   
ref|XP_008786702.1|  PREDICTED: uncharacterized protein LOC103704947    216   9e-58   
emb|CBI34824.3|  unnamed protein product                                214   3e-57   
ref|XP_010660831.1|  PREDICTED: uncharacterized protein LOC100264492    214   4e-57   
emb|CBI34826.3|  unnamed protein product                                214   4e-57   
emb|CBI34825.3|  unnamed protein product                                212   2e-56   
ref|XP_007031665.1|  Uncharacterized protein TCM_017020                 212   6e-56   
ref|XP_006378263.1|  hypothetical protein POPTR_0010s06060g             211   7e-56   
ref|XP_010029070.1|  PREDICTED: uncharacterized protein LOC104419194    209   3e-55   
emb|CDP15097.1|  unnamed protein product                                209   4e-55   
ref|XP_010029073.1|  PREDICTED: uncharacterized protein LOC104419196    209   5e-55   
ref|XP_002526959.1|  conserved hypothetical protein                     206   5e-54   Ricinus communis
ref|XP_010029068.1|  PREDICTED: uncharacterized protein LOC104419192    205   1e-53   
ref|XP_002271723.2|  PREDICTED: uncharacterized protein LOC100242213    202   1e-52   Vitis vinifera
gb|KDO44359.1|  hypothetical protein CISIN_1g008311mg                   199   3e-52   
ref|XP_010026936.1|  PREDICTED: uncharacterized protein LOC104417333    200   5e-52   
ref|XP_010029072.1|  PREDICTED: uncharacterized protein LOC104419195    200   5e-52   
gb|KEH20741.1|  sieve element occlusion protein                         199   7e-52   
emb|CBI34823.3|  unnamed protein product                                202   1e-51   
ref|XP_010695991.1|  PREDICTED: uncharacterized protein LOC104908569    199   1e-51   
ref|XP_006432374.1|  hypothetical protein CICLE_v10000431mg             199   1e-51   
ref|XP_010663068.1|  PREDICTED: uncharacterized protein LOC100243366    199   1e-51   
ref|XP_008449999.1|  PREDICTED: uncharacterized protein LOC103491716    198   2e-51   
ref|XP_006471327.1|  PREDICTED: uncharacterized protein LOC102619778    197   3e-51   
gb|KHG12713.1|  hypothetical protein F383_04328                         198   3e-51   
emb|CBI14908.3|  unnamed protein product                                197   3e-51   
ref|XP_004171463.1|  PREDICTED: uncharacterized protein LOC101229786    196   9e-51   
ref|XP_004145690.1|  PREDICTED: uncharacterized protein LOC101221710    196   1e-50   
ref|XP_003633839.2|  PREDICTED: uncharacterized protein LOC100254392    195   3e-50   
emb|CAN65891.1|  hypothetical protein VITISV_041167                     194   4e-50   Vitis vinifera
ref|XP_004236294.1|  PREDICTED: uncharacterized protein LOC101251765    192   2e-49   
ref|XP_010029069.1|  PREDICTED: uncharacterized protein LOC104419193    191   3e-49   
gb|KHG00716.1|  hypothetical protein F383_23634                         191   4e-49   
gb|KHG00715.1|  hypothetical protein F383_23634                         191   5e-49   
gb|KHG01411.1|  hypothetical protein F383_21965                         191   6e-49   
emb|CDP05462.1|  unnamed protein product                                190   9e-49   
ref|XP_006351433.1|  PREDICTED: uncharacterized protein LOC102598958    189   4e-48   
ref|NP_001239838.1|  uncharacterized protein LOC100801064               188   6e-48   
gb|KHN27576.1|  hypothetical protein glysoja_018688                     187   8e-48   
ref|XP_007031664.1|  Uncharacterized protein TCM_017019                 187   9e-48   
ref|XP_004504145.1|  PREDICTED: uncharacterized protein LOC101504...    187   1e-47   
ref|XP_010694661.1|  PREDICTED: uncharacterized protein LOC104907426    187   1e-47   
gb|ADN32810.1|  sieve element occlusion a                               187   1e-47   
ref|XP_011071161.1|  PREDICTED: uncharacterized protein LOC105156657    187   2e-47   
gb|EPS71838.1|  hypothetical protein M569_02915                         185   4e-47   
gb|EYU22546.1|  hypothetical protein MIMGU_mgv1a001374mg                186   6e-47   
ref|XP_009592492.1|  PREDICTED: uncharacterized protein LOC104089332    184   8e-47   
ref|XP_011046122.1|  PREDICTED: uncharacterized protein LOC105140824    184   9e-47   
ref|XP_007037798.1|  Sieve element occlusion e, putative                183   2e-46   
ref|XP_004504143.1|  PREDICTED: uncharacterized protein LOC101504...    183   3e-46   
emb|CAN62582.1|  hypothetical protein VITISV_034667                     183   3e-46   Vitis vinifera
ref|XP_003622294.1|  hypothetical protein MTR_7g032660                  182   6e-46   
ref|XP_008222003.1|  PREDICTED: uncharacterized protein LOC103321928    182   6e-46   
ref|XP_006378259.1|  hypothetical protein POPTR_0010s060303g            177   9e-46   
emb|CAN65452.1|  hypothetical protein VITISV_003896                     181   1e-45   Vitis vinifera
ref|XP_009769607.1|  PREDICTED: uncharacterized protein LOC104220433    177   2e-44   
ref|XP_004236293.1|  PREDICTED: uncharacterized protein LOC101251462    176   7e-44   
ref|XP_004138263.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    175   1e-43   
ref|XP_004161368.1|  PREDICTED: uncharacterized LOC101204444            175   1e-43   
ref|XP_006439978.1|  hypothetical protein CICLE_v10019109mg             175   1e-43   
gb|AFN06072.1|  sieve element occlusion protein 1                       175   1e-43   
ref|XP_002271950.2|  PREDICTED: uncharacterized protein LOC100261056    175   2e-43   Vitis vinifera
ref|XP_007140863.1|  hypothetical protein PHAVU_008G147900g             175   2e-43   
ref|XP_008464490.1|  PREDICTED: uncharacterized protein LOC103502...    174   2e-43   
ref|XP_004143056.1|  PREDICTED: uncharacterized protein LOC101208559    174   4e-43   
ref|XP_009769432.1|  PREDICTED: uncharacterized protein LOC104220...    173   4e-43   
ref|XP_006476923.1|  PREDICTED: uncharacterized protein LOC102608...    173   5e-43   
gb|KDO69426.1|  hypothetical protein CISIN_1g044391mg                   173   7e-43   
ref|XP_008464491.1|  PREDICTED: uncharacterized protein LOC103502...    172   1e-42   
ref|XP_006439977.1|  hypothetical protein CICLE_v10019128mg             172   1e-42   
ref|XP_006476926.1|  PREDICTED: uncharacterized protein LOC102609296    171   3e-42   
ref|XP_008239364.1|  PREDICTED: uncharacterized protein LOC103337969    170   6e-42   
emb|CBI16824.3|  unnamed protein product                                169   7e-42   
ref|XP_009769433.1|  PREDICTED: uncharacterized protein LOC104220...    169   8e-42   
ref|XP_002282165.1|  PREDICTED: uncharacterized protein LOC100266247    169   9e-42   Vitis vinifera
ref|XP_006378261.1|  hypothetical protein POPTR_0010s060502g            164   1e-41   
ref|XP_006476924.1|  PREDICTED: uncharacterized protein LOC102608...    169   1e-41   
emb|CBI34827.3|  unnamed protein product                                167   3e-41   
ref|XP_008444389.1|  PREDICTED: uncharacterized protein LOC103487729    167   6e-41   
ref|XP_009628800.1|  PREDICTED: uncharacterized protein LOC104119093    167   7e-41   
ref|XP_011087135.1|  PREDICTED: uncharacterized protein LOC105168700    167   8e-41   
ref|XP_008221943.1|  PREDICTED: uncharacterized protein LOC103321871    167   1e-40   
ref|XP_007211100.1|  hypothetical protein PRUPE_ppa023699mg             163   1e-39   
ref|XP_009359246.1|  PREDICTED: uncharacterized protein LOC103949...    164   1e-39   
ref|XP_004516128.1|  PREDICTED: uncharacterized protein LOC101508220    163   2e-39   
ref|XP_008340128.1|  PREDICTED: uncharacterized protein LOC103403085    164   2e-39   
emb|CAN83923.1|  hypothetical protein VITISV_026533                     162   2e-39   Vitis vinifera
ref|XP_004299166.1|  PREDICTED: uncharacterized protein LOC101294943    162   3e-39   
ref|XP_006408537.1|  hypothetical protein EUTSA_v10020146mg             162   4e-39   
ref|XP_010694662.1|  PREDICTED: uncharacterized protein LOC104907427    162   6e-39   
ref|XP_008389748.1|  PREDICTED: uncharacterized protein LOC103452052    161   1e-38   
ref|XP_009124044.1|  PREDICTED: uncharacterized protein LOC103848...    160   2e-38   
ref|XP_010496279.1|  PREDICTED: uncharacterized protein LOC104773380    159   4e-38   
gb|KFK37630.1|  hypothetical protein AALP_AA3G008200                    159   4e-38   
gb|KCW55913.1|  hypothetical protein EUGRSUZ_I01711                     157   4e-38   
ref|XP_009124045.1|  PREDICTED: uncharacterized protein LOC103848...    159   5e-38   
ref|XP_004501847.1|  PREDICTED: uncharacterized protein LOC101501922    158   5e-38   
emb|CDX77080.1|  BnaC04g38750D                                          159   5e-38   
ref|XP_010435652.1|  PREDICTED: uncharacterized protein LOC104719422    158   6e-38   
emb|CDY37506.1|  BnaA05g33710D                                          158   7e-38   
ref|NP_001241461.1|  uncharacterized protein LOC100789215               157   8e-38   
ref|XP_002884266.1|  hypothetical protein ARALYDRAFT_477347             158   9e-38   
ref|XP_010030737.1|  PREDICTED: uncharacterized protein LOC104420628    157   1e-37   
gb|KHG30263.1|  hypothetical protein F383_10527                         156   1e-37   
gb|KHG30262.1|  hypothetical protein F383_10527                         156   1e-37   
ref|XP_007137986.1|  hypothetical protein PHAVU_009G171300g             157   1e-37   
ref|XP_006299972.1|  hypothetical protein CARUB_v10016185mg             159   2e-37   
ref|XP_008374367.1|  PREDICTED: uncharacterized protein LOC103437653    156   2e-37   
ref|XP_002526960.1|  conserved hypothetical protein                     156   2e-37   Ricinus communis
ref|NP_186817.1|  uncharacterized protein                               156   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010248721.1|  PREDICTED: uncharacterized protein LOC104591550    155   4e-37   
gb|KDP46378.1|  hypothetical protein JCGZ_10218                         155   5e-37   
ref|XP_010550173.1|  PREDICTED: uncharacterized protein LOC104821101    155   7e-37   
ref|XP_007221911.1|  hypothetical protein PRUPE_ppa001579mg             155   1e-36   
ref|XP_004310159.1|  PREDICTED: uncharacterized protein LOC101309120    153   4e-36   
gb|KEH35012.1|  sieve element occlusion protein                         152   5e-36   
emb|CDY28669.1|  BnaCnng05550D                                          152   6e-36   
ref|XP_009124817.1|  PREDICTED: uncharacterized protein LOC103849857    152   9e-36   
ref|XP_009359245.1|  PREDICTED: uncharacterized protein LOC103949844    151   2e-35   
ref|NP_001241263.1|  uncharacterized protein LOC100811452               150   4e-35   
ref|XP_009359248.1|  PREDICTED: uncharacterized protein LOC103949...    150   6e-35   
gb|EYU17767.1|  hypothetical protein MIMGU_mgv1a002070mg                149   7e-35   
gb|KDO82146.1|  hypothetical protein CISIN_1g005245mg                   147   8e-35   
ref|XP_008350940.1|  PREDICTED: uncharacterized protein LOC103414321    147   3e-34   
ref|XP_006440672.1|  hypothetical protein CICLE_v10019121mg             146   7e-34   
ref|XP_008340127.1|  PREDICTED: uncharacterized protein LOC103403084    145   2e-33   
ref|XP_010102927.1|  hypothetical protein L484_018946                   144   3e-33   
gb|KHN05808.1|  hypothetical protein glysoja_038722                     140   6e-32   
gb|KHN13158.1|  hypothetical protein glysoja_040438                     139   1e-31   
ref|NP_001241224.1|  uncharacterized protein LOC100794293               139   2e-31   
ref|XP_010674858.1|  PREDICTED: uncharacterized protein LOC104890938    137   8e-31   
ref|XP_004309998.1|  PREDICTED: uncharacterized protein LOC101307854    136   1e-30   
gb|KDO54551.1|  hypothetical protein CISIN_1g015053mg                   132   4e-30   
gb|KHN01070.1|  hypothetical protein glysoja_000738                     132   3e-29   
ref|XP_006476925.1|  PREDICTED: uncharacterized protein LOC102608...    132   3e-29   
ref|XP_002526962.1|  conserved hypothetical protein                     133   3e-29   Ricinus communis
gb|KHG22560.1|  hypothetical protein F383_04018                         129   3e-28   
ref|XP_006477599.1|  PREDICTED: uncharacterized protein LOC102631158    129   4e-28   
ref|XP_006446667.1|  hypothetical protein CICLE_v10015478mg             121   1e-26   
gb|KDO40196.1|  hypothetical protein CISIN_1g046837mg                   124   1e-26   
gb|KCW55915.1|  hypothetical protein EUGRSUZ_I01713                     119   2e-26   
ref|XP_006440670.1|  hypothetical protein CICLE_v10023346mg             122   9e-26   
gb|KDO37241.1|  hypothetical protein CISIN_1g014387mg                   119   2e-25   
ref|XP_006376885.1|  hypothetical protein POPTR_0012s09220g             120   4e-25   
gb|KHG11411.1|  Ornithine aminotransferase                              119   8e-25   
gb|KDP47163.1|  hypothetical protein JCGZ_00054                         117   4e-24   
gb|KDO35949.1|  hypothetical protein CISIN_1g044845mg                   114   4e-24   
ref|XP_008224125.1|  PREDICTED: uncharacterized protein LOC103323883    117   5e-24   
ref|XP_008224124.1|  PREDICTED: uncharacterized protein LOC103323881    115   8e-24   
ref|XP_007221903.1|  hypothetical protein PRUPE_ppa015869mg             115   1e-23   
ref|XP_007225209.1|  hypothetical protein PRUPE_ppa002007mg             114   3e-23   
gb|KHG17606.1|  hypothetical protein F383_20800                         112   6e-23   
ref|XP_002526961.1|  conserved hypothetical protein                     113   7e-23   Ricinus communis
gb|AGV54562.1|  sieve element occlusion c                               112   8e-23   
ref|XP_010087773.1|  hypothetical protein L484_016343                   112   1e-22   
emb|CAN65453.1|  hypothetical protein VITISV_003897                     112   2e-22   Vitis vinifera
ref|XP_006440671.1|  hypothetical protein CICLE_v10019121mg             111   2e-22   
ref|XP_004310160.1|  PREDICTED: uncharacterized protein LOC101309418    111   2e-22   
ref|XP_006378262.1|  hypothetical protein POPTR_0010s060501g            107   4e-22   
ref|XP_007137985.1|  hypothetical protein PHAVU_009G171300g             110   4e-22   
ref|XP_010650779.1|  PREDICTED: uncharacterized protein LOC100255...    110   5e-22   
ref|XP_003590763.1|  Sieve element-occluding protein                    109   9e-22   
gb|KDO54552.1|  hypothetical protein CISIN_1g015053mg                   106   1e-21   
ref|XP_003590766.1|  Sieve element-occluding protein                    109   1e-21   
ref|XP_002282178.2|  PREDICTED: uncharacterized protein LOC100255...    108   2e-21   Vitis vinifera
ref|XP_006483987.1|  PREDICTED: uncharacterized protein LOC102625281    108   2e-21   
emb|CAN61289.1|  hypothetical protein VITISV_032473                     108   2e-21   Vitis vinifera
ref|XP_006438202.1|  hypothetical protein CICLE_v10030798mg             108   3e-21   
ref|XP_007044875.1|  Uncharacterized protein isoform 1                  107   4e-21   
gb|KEH42743.1|  sieve element occlusion protein                         106   8e-21   
ref|XP_004304991.1|  PREDICTED: uncharacterized protein LOC101294285    105   2e-20   
gb|KCW55914.1|  hypothetical protein EUGRSUZ_I01712                     103   3e-20   
emb|CBI16822.3|  unnamed protein product                                104   4e-20   
ref|XP_003590760.1|  Sieve element-occluding protein                    104   5e-20   
ref|XP_004288434.1|  PREDICTED: uncharacterized protein LOC101297774    103   1e-19   
emb|CAN82617.1|  hypothetical protein VITISV_012086                     103   1e-19   Vitis vinifera
ref|XP_008224078.1|  PREDICTED: uncharacterized protein LOC103323835    102   2e-19   
gb|KDO54550.1|  hypothetical protein CISIN_1g015053mg                 97.8    8e-19   
ref|XP_010904539.1|  PREDICTED: uncharacterized protein LOC105031937    100   9e-19   
gb|AES61036.2|  sieve element occlusion protein                         100   1e-18   
ref|XP_008224130.1|  PREDICTED: uncharacterized protein LOC103323887  99.8    1e-18   
ref|XP_008224484.1|  PREDICTED: uncharacterized protein LOC103324225  98.2    4e-18   
ref|XP_008224486.1|  PREDICTED: uncharacterized protein LOC103324227  98.2    5e-18   
ref|XP_010040608.1|  PREDICTED: uncharacterized protein LOC104429456  97.8    5e-18   
gb|KDO54553.1|  hypothetical protein CISIN_1g015053mg                 94.7    9e-18   
gb|KDP46376.1|  hypothetical protein JCGZ_10216                       97.4    1e-17   
ref|XP_007225527.1|  hypothetical protein PRUPE_ppa026573mg           96.7    2e-17   
ref|XP_010045508.1|  PREDICTED: uncharacterized protein LOC104434233  97.1    2e-17   
ref|XP_007044876.1|  Uncharacterized protein isoform 2                95.5    3e-17   
ref|XP_006848931.1|  hypothetical protein AMTR_s00166p00027970        90.1    5e-17   
ref|XP_008222002.1|  PREDICTED: uncharacterized protein LOC103321927  94.4    7e-17   
ref|XP_011014799.1|  PREDICTED: uncharacterized protein LOC105118520  89.4    8e-17   
ref|XP_011011157.1|  PREDICTED: uncharacterized protein LOC105115...  89.4    9e-17   
ref|XP_008224131.1|  PREDICTED: uncharacterized protein LOC103323888  93.6    1e-16   
ref|XP_006388021.1|  hypothetical protein POPTR_0395s002001g          87.8    1e-16   
ref|XP_004495321.1|  PREDICTED: uncharacterized protein LOC101490473  93.2    2e-16   
gb|KCW86614.1|  hypothetical protein EUGRSUZ_B03242                   92.4    3e-16   
gb|KDP46382.1|  hypothetical protein JCGZ_10222                       92.4    3e-16   
gb|ADN32804.1|  sieve element occlusion by forisomes 3                91.3    7e-16   
ref|XP_007029300.1|  Uncharacterized protein TCM_025178               90.9    9e-16   
gb|ACH92804.1|  sieve element-occluding protein 3                     90.9    9e-16   Medicago truncatula
emb|CBI25482.3|  unnamed protein product                              91.3    1e-15   
ref|XP_010087771.1|  hypothetical protein L484_016341                 90.5    1e-15   
ref|XP_002271883.2|  PREDICTED: putative disease resistance prote...  90.9    1e-15   Vitis vinifera
emb|CAN64088.1|  hypothetical protein VITISV_006939                   90.9    1e-15   Vitis vinifera
ref|XP_010650784.1|  PREDICTED: uncharacterized protein LOC100255...  90.1    1e-15   
ref|XP_010025851.1|  PREDICTED: uncharacterized protein LOC104416113  89.0    4e-15   
ref|XP_008239602.1|  PREDICTED: uncharacterized protein LOC103338194  88.6    4e-15   
ref|XP_010069164.1|  PREDICTED: uncharacterized protein LOC104456...  88.6    5e-15   
ref|XP_010069162.1|  PREDICTED: uncharacterized protein LOC104456...  88.2    6e-15   
ref|XP_010069163.1|  PREDICTED: uncharacterized protein LOC104456...  88.2    6e-15   
ref|XP_007144080.1|  hypothetical protein PHAVU_007G127000g           87.8    8e-15   
ref|XP_004239489.1|  PREDICTED: uncharacterized protein LOC101249458  87.4    1e-14   
gb|KDP45226.1|  hypothetical protein JCGZ_15091                       87.0    1e-14   
ref|XP_007146208.1|  hypothetical protein PHAVU_006G021400g           87.0    1e-14   
ref|XP_002515052.1|  conserved hypothetical protein                   86.3    2e-14   Ricinus communis
ref|NP_001242554.1|  uncharacterized LOC100807591                     86.3    2e-14   
ref|XP_006593456.1|  PREDICTED: uncharacterized LOC100807591 isof...  86.3    2e-14   
gb|KHN37707.1|  Putative nucleoredoxin 3                              85.9    3e-14   
gb|EYU22545.1|  hypothetical protein MIMGU_mgv1a026947mg              85.9    3e-14   
gb|KCW83210.1|  hypothetical protein EUGRSUZ_B001512                  84.0    5e-14   
ref|XP_007146209.1|  hypothetical protein PHAVU_006G0215000g          85.1    5e-14   
gb|KHN13159.1|  hypothetical protein glysoja_040439                   85.1    5e-14   
ref|NP_001241173.1|  uncharacterized protein LOC100793771             85.1    6e-14   
ref|XP_010040606.1|  PREDICTED: uncharacterized protein LOC104429454  82.4    1e-13   
ref|XP_008239606.1|  PREDICTED: uncharacterized protein LOC103338199  83.2    2e-13   
ref|XP_006387169.1|  hypothetical protein POPTR_1619s002002g          79.0    2e-13   
ref|NP_001239643.1|  uncharacterized protein LOC100778245             82.8    4e-13   
gb|KDP26702.1|  hypothetical protein JCGZ_17860                       79.7    4e-13   
ref|XP_010100344.1|  hypothetical protein L484_027653                 82.4    4e-13   
gb|KDP45224.1|  hypothetical protein JCGZ_15089                       82.0    6e-13   
ref|NP_001239846.1|  uncharacterized protein LOC100801833             81.6    6e-13   
ref|XP_011040448.1|  PREDICTED: uncharacterized protein LOC105136707  81.3    9e-13   
ref|XP_009124043.1|  PREDICTED: uncharacterized protein LOC103848960  81.3    1e-12   
emb|CDY37507.1|  BnaA05g33720D                                        81.3    1e-12   
ref|XP_007144075.1|  hypothetical protein PHAVU_007G126500g           80.9    1e-12   
emb|CDX77078.1|  BnaC04g38730D                                        80.9    2e-12   
ref|XP_002315652.2|  hypothetical protein POPTR_0010s06000g           79.7    3e-12   
gb|KDP45230.1|  hypothetical protein JCGZ_15095                       79.7    3e-12   
ref|NP_566145.1|  uncharacterized protein                             79.7    3e-12   
ref|XP_009346429.1|  PREDICTED: uncharacterized protein LOC103938158  79.3    4e-12   
gb|AAF01550.1|AC009325_20  unknown protein                            79.7    4e-12   
ref|XP_008224077.1|  PREDICTED: uncharacterized protein LOC103323834  79.3    4e-12   
ref|XP_008465190.1|  PREDICTED: uncharacterized protein LOC103502853  79.0    5e-12   
ref|XP_007225119.1|  hypothetical protein PRUPE_ppa002624mg           78.6    6e-12   
ref|XP_008224076.1|  PREDICTED: uncharacterized protein LOC103323832  78.6    7e-12   
ref|XP_007226973.1|  hypothetical protein PRUPE_ppa002391mg           77.8    1e-11   
ref|XP_004150407.1|  PREDICTED: uncharacterized protein LOC101217067  77.4    1e-11   
ref|NP_001280876.1|  uncharacterized LOC103453287                     77.4    2e-11   
ref|XP_007163693.1|  hypothetical protein PHAVU_001G256100g           77.0    2e-11   
ref|NP_001240225.1|  uncharacterized protein LOC100819823             76.6    3e-11   
ref|XP_009403631.1|  PREDICTED: uncharacterized protein LOC103987146  76.6    3e-11   
gb|KHN01071.1|  Putative nucleoredoxin 2                              75.1    7e-11   
ref|XP_004288435.1|  PREDICTED: uncharacterized protein LOC101298064  74.7    9e-11   
ref|XP_006848932.1|  hypothetical protein AMTR_s00166p00028130        71.2    1e-10   
ref|XP_009359348.1|  PREDICTED: uncharacterized protein LOC103949937  74.7    1e-10   
ref|XP_010550172.1|  PREDICTED: uncharacterized protein LOC104821100  73.9    2e-10   
emb|CDX74311.1|  BnaA03g27360D                                        73.9    2e-10   
ref|NP_001239787.1|  uncharacterized protein LOC100812318             73.6    2e-10   
ref|XP_011097584.1|  PREDICTED: uncharacterized protein LOC105176465  73.6    3e-10   
ref|XP_006408536.1|  hypothetical protein EUTSA_v10020071mg           72.8    5e-10   
gb|KDP46375.1|  hypothetical protein JCGZ_10215                       72.8    5e-10   
gb|KCW57424.1|  hypothetical protein EUGRSUZ_H00204                   72.4    6e-10   
ref|XP_010069165.1|  PREDICTED: uncharacterized protein LOC104456129  72.4    6e-10   
ref|XP_004310158.1|  PREDICTED: uncharacterized protein LOC101308835  70.1    6e-10   
ref|XP_010524284.1|  PREDICTED: uncharacterized protein LOC104802389  72.4    7e-10   
ref|XP_004498013.1|  PREDICTED: uncharacterized protein LOC101506963  72.0    7e-10   
gb|KHN07967.1|  hypothetical protein glysoja_039841                   71.6    8e-10   
emb|CDP13256.1|  unnamed protein product                              71.2    1e-09   
ref|XP_008340363.1|  PREDICTED: uncharacterized protein LOC103403330  70.9    2e-09   
ref|XP_004150405.1|  PREDICTED: uncharacterized protein LOC101216599  68.6    2e-09   
ref|XP_011097560.1|  PREDICTED: uncharacterized protein LOC105176450  70.9    2e-09   
ref|XP_007226977.1|  hypothetical protein PRUPE_ppa002363mg           70.5    2e-09   
ref|XP_010026373.1|  PREDICTED: uncharacterized protein LOC104416720  70.5    2e-09   
ref|XP_002884267.1|  hypothetical protein ARALYDRAFT_477348           70.1    3e-09   
ref|XP_004288436.1|  PREDICTED: uncharacterized protein LOC101298363  70.1    3e-09   
gb|KFK41194.1|  hypothetical protein AALP_AA2G097500                  68.6    7e-09   
ref|XP_010044529.1|  PREDICTED: uncharacterized protein LOC104433473  68.9    8e-09   
gb|KDO82147.1|  hypothetical protein CISIN_1g039432mg                 68.6    9e-09   
emb|CDX91934.1|  BnaC03g32360D                                        68.6    1e-08   
gb|ADN32815.1|  sieve element occlusion a                             68.6    1e-08   
gb|KGN61634.1|  hypothetical protein Csa_2G193380                     68.2    1e-08   
ref|NP_001239844.1|  uncharacterized protein LOC100797481             67.4    2e-08   
emb|CAH59411.1|  hypothetical protein                                 66.6    2e-08   
ref|XP_010485384.1|  PREDICTED: uncharacterized protein LOC104763723  67.4    2e-08   
ref|NP_001240090.1|  uncharacterized protein LOC100818773             67.0    3e-08   
ref|XP_007145937.1|  hypothetical protein PHAVU_007G280500g           67.0    3e-08   
ref|XP_010556201.1|  PREDICTED: uncharacterized protein LOC104825547  66.2    3e-08   
ref|XP_007146049.1|  hypothetical protein PHAVU_006G008500g           66.6    4e-08   
gb|KHN37957.1|  hypothetical protein glysoja_042603                   66.6    4e-08   
ref|XP_008465188.1|  PREDICTED: uncharacterized protein LOC103502851  66.6    4e-08   
ref|XP_009134596.1|  PREDICTED: uncharacterized protein LOC103858898  66.6    4e-08   
ref|XP_010527731.1|  PREDICTED: uncharacterized protein LOC104805029  66.6    4e-08   
ref|XP_010435651.1|  PREDICTED: uncharacterized protein LOC104719421  66.6    4e-08   
ref|XP_007226583.1|  hypothetical protein PRUPE_ppa023840mg           66.2    4e-08   
gb|KDP46380.1|  hypothetical protein JCGZ_10220                       66.2    5e-08   
ref|XP_004495334.1|  PREDICTED: uncharacterized protein LOC101493939  65.9    6e-08   
gb|KHN33833.1|  hypothetical protein glysoja_021714                   65.9    7e-08   
ref|XP_010496280.1|  PREDICTED: uncharacterized protein LOC104773381  65.9    7e-08   
ref|XP_010682346.1|  PREDICTED: uncharacterized protein LOC104897...  65.5    9e-08   
ref|XP_010682347.1|  PREDICTED: uncharacterized protein LOC104897...  65.5    1e-07   
ref|XP_004288433.1|  PREDICTED: uncharacterized protein LOC101296807  65.1    1e-07   
ref|XP_010682350.1|  PREDICTED: uncharacterized protein LOC104897...  64.7    1e-07   
ref|XP_004151045.1|  PREDICTED: uncharacterized protein LOC101222989  64.7    1e-07   
ref|XP_011100417.1|  PREDICTED: uncharacterized protein LOC105178604  64.7    1e-07   
ref|XP_007224445.1|  hypothetical protein PRUPE_ppa021991mg           64.7    1e-07   
gb|KFK37629.1|  hypothetical protein AALP_AA3G008100                  64.7    2e-07   
gb|KGN61638.1|  hypothetical protein Csa_2G196890                     64.3    2e-07   
ref|XP_004167801.1|  PREDICTED: uncharacterized protein LOC101227691  64.3    2e-07   
ref|XP_003590785.1|  Sieve element-occluding protein                  64.3    2e-07   
gb|KDP45223.1|  hypothetical protein JCGZ_15088                       64.3    2e-07   
ref|XP_009767735.1|  PREDICTED: uncharacterized protein LOC104218850  63.9    3e-07   
ref|XP_008465186.1|  PREDICTED: uncharacterized protein LOC103502848  63.5    3e-07   
gb|KDP45227.1|  hypothetical protein JCGZ_15092                       62.0    4e-07   
ref|XP_010087772.1|  hypothetical protein L484_016342                 62.8    6e-07   
gb|AFN06074.1|  sieve element occlusion protein 1                     62.8    6e-07   
gb|KCW45067.1|  hypothetical protein EUGRSUZ_L01341                   62.0    8e-07   
ref|XP_004308643.1|  PREDICTED: uncharacterized protein LOC101294898  62.4    9e-07   
gb|KDP46379.1|  hypothetical protein JCGZ_10219                       61.6    1e-06   
ref|XP_008224079.1|  PREDICTED: uncharacterized protein LOC103323836  61.6    1e-06   
emb|CDY56213.1|  BnaAnng14110D                                        61.6    1e-06   
ref|XP_009105329.1|  PREDICTED: uncharacterized protein LOC103831204  61.2    2e-06   
ref|XP_010026374.1|  PREDICTED: uncharacterized protein LOC104416722  61.2    2e-06   
gb|ADN34084.1|  hypothetical protein                                  60.8    2e-06   
gb|KGN61640.1|  hypothetical protein Csa_2G199900                     60.5    2e-06   
ref|XP_010069166.1|  PREDICTED: uncharacterized protein LOC104456130  60.5    3e-06   
ref|XP_008465183.1|  PREDICTED: uncharacterized protein LOC103502846  60.1    3e-06   
ref|XP_004173105.1|  PREDICTED: uncharacterized LOC101217067          58.5    4e-06   
ref|XP_007221631.1|  hypothetical protein PRUPE_ppb018052mg           60.1    4e-06   
ref|XP_010040159.1|  PREDICTED: uncharacterized protein LOC104428938  59.3    4e-06   
ref|XP_004150431.1|  PREDICTED: uncharacterized protein LOC101203597  59.3    5e-06   
ref|XP_004164423.1|  PREDICTED: uncharacterized LOC101203597          59.3    5e-06   
ref|XP_008465184.1|  PREDICTED: uncharacterized protein LOC103502847  59.3    6e-06   
gb|ADN32805.1|  sieve element occlusion by forisomes 4                59.3    7e-06   
ref|XP_002888624.1|  hypothetical protein ARALYDRAFT_315794           58.9    8e-06   
gb|KCW45441.1|  hypothetical protein EUGRSUZ_L00852                   58.9    8e-06   
ref|XP_010069159.1|  PREDICTED: uncharacterized protein LOC104456126  58.2    2e-05   
ref|XP_003590780.1|  Sieve element-occluding protein                  58.2    2e-05   
ref|XP_010069161.1|  PREDICTED: uncharacterized protein LOC104456127  58.2    2e-05   
emb|CDY01854.1|  BnaC06g28940D                                        57.8    2e-05   
ref|XP_007029394.1|  Uncharacterized protein TCM_025263               57.4    2e-05   
ref|XP_008362016.1|  PREDICTED: uncharacterized protein LOC103425707  57.4    3e-05   
ref|XP_010268430.1|  PREDICTED: uncharacterized protein LOC104605382  57.4    3e-05   
gb|KFK41192.1|  hypothetical protein AALP_AA2G097500                  55.8    3e-05   
ref|XP_006590351.1|  PREDICTED: uncharacterized protein LOC100819...  57.0    3e-05   
ref|XP_008362017.1|  PREDICTED: uncharacterized protein LOC103425708  57.0    4e-05   
gb|KHG21363.1|  hypothetical protein F383_27730                       57.0    4e-05   
ref|XP_008465192.1|  PREDICTED: uncharacterized protein LOC103502855  56.6    4e-05   
gb|ACH92805.1|  sieve element-occluding protein 2                     57.0    4e-05   
ref|XP_010087775.1|  hypothetical protein L484_016346                 56.6    4e-05   
ref|XP_007144074.1|  hypothetical protein PHAVU_007G126400g           56.6    4e-05   
ref|XP_004169605.1|  PREDICTED: uncharacterized LOC101203350          55.8    4e-05   
ref|XP_010511743.1|  PREDICTED: uncharacterized protein LOC104787...  56.6    4e-05   
gb|KDO69425.1|  hypothetical protein CISIN_1g019680mg                 55.8    5e-05   
gb|KHN44379.1|  hypothetical protein glysoja_014420                   56.6    5e-05   
ref|XP_004495330.1|  PREDICTED: uncharacterized protein LOC101492853  56.6    5e-05   
gb|AHY04439.1|  sieve element occlusion by forisomes 1                56.2    7e-05   
ref|NP_001239674.1|  uncharacterized protein LOC100801290             55.8    1e-04   
ref|XP_010250967.1|  PREDICTED: uncharacterized protein LOC104593...  55.1    1e-04   
ref|XP_010250968.1|  PREDICTED: uncharacterized protein LOC104593...  55.1    1e-04   
ref|XP_008793699.1|  PREDICTED: uncharacterized protein LOC103709...  55.1    1e-04   
ref|XP_006388020.1|  hypothetical protein POPTR_0395s002003g          52.0    1e-04   
gb|ACV83947.1|  calcium-regulated/ATP-independent forisome protein    55.1    1e-04   
ref|XP_004491932.1|  PREDICTED: uncharacterized protein LOC101497031  55.1    2e-04   
ref|XP_008793698.1|  PREDICTED: uncharacterized protein LOC103709...  54.7    2e-04   
ref|XP_004150430.1|  PREDICTED: uncharacterized protein LOC101203350  54.7    2e-04   
gb|KGN61639.1|  hypothetical protein Csa_2G196900                     54.7    2e-04   
ref|XP_006301417.1|  hypothetical protein CARUB_v10021833mg           54.7    2e-04   
gb|ACD45457.1|  forisome                                              54.3    2e-04   
gb|ABV32454.1|  sieve element occlusion by forisome 1                 54.3    3e-04   
ref|NP_176945.1|  uncharacterized protein                             53.9    3e-04   
ref|NP_001242716.1|  uncharacterized LOC100795343                     53.5    4e-04   
ref|XP_006588493.1|  PREDICTED: uncharacterized protein LOC100815...  53.5    4e-04   
ref|XP_010470711.1|  PREDICTED: uncharacterized protein LOC104750590  53.1    5e-04   
gb|KHN13154.1|  hypothetical protein glysoja_040434                   52.8    7e-04   
ref|XP_004495333.1|  PREDICTED: uncharacterized protein LOC101493...  52.4    0.001   
ref|XP_007145938.1|  hypothetical protein PHAVU_007G280600g           52.4    0.001   
ref|XP_004495331.1|  PREDICTED: uncharacterized protein LOC101493...  52.4    0.001   
ref|XP_007146048.1|  hypothetical protein PHAVU_006G008400g           52.4    0.001   



>gb|ADN32811.1| sieve element occlusion b [Solanum phureja]
Length=823

 Score =   320 bits (820),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 229/572 (40%), Positives = 325/572 (57%), Gaps = 43/572 (8%)
 Frame = +1

Query  43    KMAQTTINNTGRPMSESTTRATDTTPLVPRTAP-NTPHNPVH-EIVPKATNLNPRSLTTY  216
              M+  +  N   PMS  TT      PL  +  P NT  NP++ +I P  T +NP +    
Sbjct  24    NMSSGSAANRMYPMSNPTT-GHHINPLNAQINPLNTQINPLNAQINPLNTQINPLN-AQI  81

Query  217   TPHPAY-PVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--FLASSED  387
              PH    PV    +PA+       T P    + P  + +  A R   +RGD     +S+D
Sbjct  82    NPHSVVKPVSHDMIPASVVPAAHHTTP----INPRTSNL--AARPPHRRGDHHMFLTSDD  135

Query  388   TAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKV  567
              AMM H+  TH  D   + VKPL+ +IEDI+ RA   I G V   + Q A L+A LEEK 
Sbjct  136   NAMMRHIEETHIPDGRDFDVKPLVDIIEDIVHRA-TPIAGRVHEAKVQ-AHLEA-LEEKA  192

Query  568   VHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAF  747
              HSGL E +   AYP +R S E+I   ++  DAHS T+S+L  L  Y WD K  ITFAAF
Sbjct  193   PHSGLTELLNYLAYPIHRISMELISKCANKEDAHSTTMSLLHSLTTYAWDTKVAITFAAF  252

Query  748   AQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVT  927
             AQQYGEFGLL   Y TDPLAKSVA I+++P+++        +  K   +  L DKML+VT
Sbjct  253   AQQYGEFGLLVHQYTTDPLAKSVAIIMELPEIM---TRQDVLKQKFDAIHDLIDKMLDVT  309

Query  928   HKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLV  1107
               II  +++ +          V + +EL   ++  TA     ++ A+Y+ ++AAV C+ +
Sbjct  310   KCIIEFRDVQTSHNQ-----HVIITQELEMLIN--TAH----ISTAAYWTMRAAVMCAAM  358

Query  1108  ILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEE  1287
             ILNL+A+G +  SST E  E+S+LTHKL+ IL  L+K +    Q+I + +     + L  
Sbjct  359   ILNLIAIGHEQISSTSEAWELSSLTHKLANILDHLRKVLDLCHQKIEEKRQHDAFEALLR  418

Query  1288  TLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEV  1467
              L   H DN     ++I   ++  P+  G     ++ GLD+LRRK+V LL+SDLDI  E 
Sbjct  419   LLRTPHIDNMKILSILIHSRDNQLPLFDGT--HKRRVGLDVLRRKHVLLLISDLDIAPEE  476

Query  1468  ITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFSVSHP  1644
             + +L HMY ESK  P+R ES +E+VW+P+VD+R SPWT AK+ +F  V++SMPW+SV+HP
Sbjct  477   LFILHHMYAESKTQPNRPESNYEVVWIPVVDKRLSPWTEAKQMKFEEVQASMPWYSVAHP  536

Query  1645  SKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
             S ID A       V+G+   ++KP L V+D Q
Sbjct  537   SMIDPAVIRCIKEVWGF---KKKPQLVVLDPQ  565



>ref|XP_006341794.1| PREDICTED: uncharacterized protein LOC102602329 [Solanum tuberosum]
Length=811

 Score =   318 bits (814),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 222/578 (38%), Positives = 327/578 (57%), Gaps = 48/578 (8%)
 Frame = +1

Query  40    PKMAQTTINN--TGRPMSESTTRATDTTP--LVPRTAPNTPH--NPVH-EIVPKATNLNP  198
             P   + ++NN  T  PM+  ++ + D     + P +   T H  NP++ +I P   ++NP
Sbjct  6     PLNEKESMNNPMTTNPMNNMSSGSADVVANRMHPMSNATTGHHINPLNAQINPLNAHINP  65

Query  199   RSLTTYTPHPAY-PVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--F  369
              ++ T  PH    PV    +PA+       T P    + P  + +  A R   +RGD   
Sbjct  66    LNVQT-NPHSVVKPVSHDMIPASVVPAAHHTGP----INPRTSNL--AARPPHRRGDHHM  118

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
               +S+D AMM H+  TH  D   + VKPL+H+IEDI+ RA   I G V   + Q A L+A
Sbjct  119   FLTSDDNAMMKHIVETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAKVQ-AHLEA  176

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
              LEEK  HSGL E +   AYP +R S E+I   ++  DAHS T+S+L  L  Y WD K V
Sbjct  177   -LEEKAPHSGLTEILNYLAYPIHRISMELISKCANKEDAHSTTMSLLHSLTTYAWDTKVV  235

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             ITFAAFAQQYGEFGLL   Y T+PLAKS+A I+++P+++        +  K   +  L D
Sbjct  236   ITFAAFAQQYGEFGLLVHQYTTNPLAKSIAIIMELPEIM---TRQDVLKQKFDAIHDLID  292

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
             KML+VT  II  +++ +      +   + +    A             ++ A+Y+ ++AA
Sbjct  293   KMLDVTKCIIEFRDVQTSHSQHVITQELEMLINTAH------------ISTAAYWTMRAA  340

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V C+ +ILNL+A+G +  SST E  E+S+LTHKL+ IL  L+K +    Q+I + +    
Sbjct  341   VMCAAMILNLIAIGHEQISSTSEAWELSSLTHKLANILDHLRKVLDLCHQKIEEKRQHDA  400

Query  1270  RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDL  1449
              + L   L   H DN     ++I   +D  P+  G     ++  LD+LRRK+V LL+SDL
Sbjct  401   FEALLRLLRTPHIDNMKILSILIHSRDDQLPLFDGT--HKRRVSLDVLRRKHVLLLISDL  458

Query  1450  DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPW  1626
             DI  E + +L HMY ESK  P+R ES +++VW+P+VD+R SPWT AK+ +F  V++SMPW
Sbjct  459   DIAPEELFVLHHMYDESKTQPNRPESNYDVVWIPVVDKRLSPWTEAKQMKFEEVQASMPW  518

Query  1627  FSVSHPSKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
             +SV+HPS ID A       V+G+   ++KP L V+D Q
Sbjct  519   YSVAHPSMIDPAVIRCIKEVWGF---KKKPQLVVLDPQ  553



>ref|XP_009767734.1| PREDICTED: uncharacterized protein LOC104218849 [Nicotiana sylvestris]
Length=793

 Score =   317 bits (811),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 215/537 (40%), Positives = 301/537 (56%), Gaps = 48/537 (9%)
 Frame = +1

Query  139   PNTPHNPV--HEIVPKATNLNPRSLTTYTPHPAY-PVQQAYMPATTTNVVSATAPPSQVV  309
             P T H+    H I P  T +NP        HP   PV    +PA   N        + + 
Sbjct  37    PTTGHHATSGHHINPLNTQINP-----VMNHPVVKPVSHDMVPAVAHN--------THIN  83

Query  310   APLQAKIIPAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMP  483
                  +I P      +RGD     +S+D AMM H+  TH  D   + VKPLLH IEDI+ 
Sbjct  84    PRTTNRIHP------RRGDHHLFLTSDDNAMMKHIEDTHSPDGRDFDVKPLLHTIEDIVH  137

Query  484   RAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRD  663
             RA A IPG++   Q Q A L+A LEEKV HSGL+E +   AYP +R S E+I   ++  D
Sbjct  138   RAPAAIPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEILNYLAYPIHRISMELICKCANKED  195

Query  664   AHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDL  843
              HS T+++L  L  Y WD K  ITFAAFAQQYGEF LL + YPT+PLAKSVA I ++P++
Sbjct  196   PHSTTIALLHSLTTYAWDTKVAITFAAFAQQYGEFWLLVQQYPTNPLAKSVAIIKELPEI  255

Query  844   LEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESL  1023
             +E    +  +  K   ++ L +KML+VT  II  ++I +      +   + +   L  + 
Sbjct  256   ME---RTDVLKPKFDAISDLINKMLDVTKCIIEFRDIRTSHHQYAITQELEM---LINTA  309

Query  1024  SPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYIL  1203
                TA    I         +AAV C+ +ILNL+A G +Y S+T E  EIS+L HKL+ IL
Sbjct  310   HISTAAYWTI---------RAAVMCAAIILNLIATGHEYMSTTSETWEISSLAHKLANIL  360

Query  1204  GDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGL  1383
               L+K + +  Q+I + +     + L   L   H DN     ++I  ++D  P+  G   
Sbjct  361   DLLRKVLNQCYQKIEEKRQHDAFEALLRLLRTPHIDNMKILSILIYSKDDQLPLFDGT--  418

Query  1384  EMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDR  1563
               ++  LD+LRRK+V LL+SDLDI  E + +L HMY ESK  PSR ES +E+VW+P+VD+
Sbjct  419   HKRRVSLDVLRRKHVLLLLSDLDIAAEELFILHHMYAESKAQPSRPESNYEVVWIPVVDK  478

Query  1564  R-SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             R + WT  K+ +F  V++SMPW+SV+HPS ID AV  Y+       +KP L V+D Q
Sbjct  479   RVTTWTEEKQMKFEQVQASMPWYSVAHPSMIDPAVIRYIKEIWGFNKKPQLVVLDPQ  535



>ref|XP_009622867.1| PREDICTED: uncharacterized protein LOC104114193 [Nicotiana tomentosiformis]
 gb|AFN06073.1| sieve element occlusion protein 2 [Nicotiana tabacum]
Length=786

 Score =   315 bits (806),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 205/491 (42%), Positives = 287/491 (58%), Gaps = 39/491 (8%)
 Frame = +1

Query  304   VVAPLQAKIIPA------------GRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHY  441
             VV P+   ++PA             R   +RGD     +S+D AMM H+  TH  D   +
Sbjct  58    VVKPVSHDMVPAVAHNTHINPRTPNRIHPRRGDHHLFLTSDDNAMMKHIEDTHSPDGRDF  117

Query  442   KVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYR  621
              VKPLLH IEDI+ RA A IPG++   Q Q A L+A LEEKV HSGL+E +   AYP +R
Sbjct  118   DVKPLLHTIEDIVHRAPA-IPGHLHGGQAQ-AHLEA-LEEKVPHSGLSEILNYLAYPIHR  174

Query  622   TSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDP  801
              S E+I   ++  D HS T+++L  L  Y WD K  ITFAAFAQQYGEF LL   YPT+P
Sbjct  175   ISMELICKCANKEDPHSTTMALLHSLTTYAWDTKVAITFAAFAQQYGEFWLLVHQYPTNP  234

Query  802   LAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKV  981
             LAKSVA I ++P+++E    +  +  K   ++ L +KML+VT  II  ++I +      +
Sbjct  235   LAKSVAIIKELPEIME---RTDVLKPKFDAISDLINKMLDVTKCIIEFRDIRTSHHQYAI  291

Query  982   KYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteee  1161
                + +   L  +    TA    I         +AAV C+ +ILNL+A G +Y S+T E 
Sbjct  292   TQELEM---LINTAHISTAAYWTI---------RAAVMCTAIILNLIATGHEYMSTTSET  339

Query  1162  leistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIIC  1341
              EIS+L HKL+ IL  L+K + +  Q+I + +     + L   L   H DN     ++I 
Sbjct  340   WEISSLAHKLANILDLLRKVLNQCYQKIEEKRQHDAFEALLRLLRTPHIDNMKILSILIY  399

Query  1342  GENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRA  1521
              ++D  P+  G     ++  LD+LRRK+V LL+SDLDI  E + +L HMY ESK  PSR 
Sbjct  400   SKDDQLPLFDGT--HKRRVSLDVLRRKHVLLLLSDLDIAPEELFILHHMYAESKAQPSRP  457

Query  1522  ESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*R  1686
             ES +E+VW+P+VD+R +PWT AK+ +F  V++SMPW+SV+HPS ID AV  Y+       
Sbjct  458   ESNYEVVWIPVVDKRLTPWTEAKQMKFEQVQASMPWYSVAHPSMIDPAVIRYIKEIWGFN  517

Query  1687  RKPLLAVVDTQ  1719
             +KP L V+D Q
Sbjct  518   KKPQLVVLDPQ  528



>gb|ADN32812.1| sieve element occlusion c [Solanum phureja]
Length=818

 Score =   315 bits (806),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 220/565 (39%), Positives = 318/565 (56%), Gaps = 49/565 (9%)
 Frame = +1

Query  61    INNTGRPMSESTTRATDTTPLVPRTAPNTPHNPVH-EIVPKATNLNPRSLTTYTPHPAY-  234
             + N   PMS +TT      PL      N   NP++ +I P   ++NP ++ T  PH    
Sbjct  33    VANRMHPMSNATT-GHHINPL------NAQINPLNAQINPLNAHINPLNVQT-NPHSVVK  84

Query  235   PVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--FLASSEDTAMMDHV  408
             PV    +PA+       T P    + P  + +  A R   +RGD     +S+D AMM H+
Sbjct  85    PVSHDMIPASVVPAAHHTTP----INPRTSNL--AARPPHRRGDHHMFLTSDDNAMMKHI  138

Query  409   RATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNE  588
               TH  D   + VKPL+H+IEDI+ RA   I G V   + Q A L+A LEEK  HSGL E
Sbjct  139   VETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGRVHEAKVQ-AHLEA-LEEKAPHSGLTE  195

Query  589   AIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEF  768
              +   AYP +R S E+I   ++  DAHS T+S+L  L  Y WD K  ITFAAFAQQYGEF
Sbjct  196   ILNYLAYPIHRISMELISKCANKEDAHSTTMSLLHSLTTYAWDTKVAITFAAFAQQYGEF  255

Query  769   GLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALK  948
             GLL   Y T+PLAKSVA I+++P+++        +  K   +  L DKML+VT  II  +
Sbjct  256   GLLVHQYTTNPLAKSVAIIMELPEIM---TRQDVLKQKFDAIHDLIDKMLDVTKCIIEFR  312

Query  949   EIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAV  1128
             ++ +      +   + +    A             ++ A+Y+ ++AAV C+ +ILNL+A+
Sbjct  313   DVQTSHNQQVITQELEMLINTAH------------ISTAAYWTMRAAVMCAAMILNLIAI  360

Query  1129  GRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHT  1308
             G +  SST E  E+S+LTHKL+ IL  L+K +    Q+I + +     + L   L   H 
Sbjct  361   GHEQISSTSEAWELSSLTHKLANILDHLRKVLDLCHQKIEEKRQHDAFEALLRLLRTPHI  420

Query  1309  DNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHM  1488
             DN     ++I   +D  P+  G     ++  LD+LRRK+V LL+SDLDI  E + +L HM
Sbjct  421   DNMKILSILIHSRDDQLPLFDGT--HKRRVSLDVLRRKHVLLLISDLDIAPEELFVLHHM  478

Query  1489  YLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA-  1662
             Y ESK  P+R ES +++VW+P+VD+R +PWT AK+ +F  V++SMPW+SV+HPS ID A 
Sbjct  479   YDESKTQPNRPESNYDVVWIPVVDKRLTPWTEAKQMKFEEVQASMPWYSVAHPSMIDPAV  538

Query  1663  ------VYGYLN*RRKPLLAVVDTQ  1719
                   V+G+   ++KP L V+D Q
Sbjct  539   IRCIKEVWGF---KKKPQLVVLDPQ  560



>ref|XP_004239152.1| PREDICTED: uncharacterized protein LOC101249174 [Solanum lycopersicum]
Length=795

 Score =   313 bits (801),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 217/572 (38%), Positives = 320/572 (56%), Gaps = 52/572 (9%)
 Frame = +1

Query  40    PKMAQTTINN--TGRPMSESTTRATDTTPLVPRTAPNTPHNPVHEIVPKATNLNPRSLTT  213
             P   + ++NN  T  PM+  ++  +    + P + P T H+    I P    +NP S+  
Sbjct  6     PLNEKVSMNNPMTTNPMNNMSS-GSAANMMHPISNPTTGHH----INPLNAQINPHSVVK  60

Query  214   YTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--FLASSED  387
                H         +PA+       TAP    + P  + +  A R   +RGD     +S+D
Sbjct  61    PVSH------HDMIPASVVPAAHHTAP----INPRTSNL--AARLPHRRGDHHMFLTSDD  108

Query  388   TAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKV  567
              AMM H+  TH  D   + VKPL+H+IEDI+ RA   I G+V   + Q A L+A LEEK 
Sbjct  109   NAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHEAKVQ-AHLEA-LEEKA  165

Query  568   VHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAF  747
              HSGL + +   AYP +R S E+I   ++  DAHS T+S+L  L  Y WD K VITFAAF
Sbjct  166   PHSGLTDILNYLAYPIHRISMELISKCANKEDAHSTTMSLLHSLTTYAWDTKVVITFAAF  225

Query  748   AQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVT  927
             AQQYG+FGLLA  Y T+PLAKSVA I+++P+++        +  K   +  L DKML+VT
Sbjct  226   AQQYGQFGLLAHQYTTNPLAKSVAIIMELPEIMS---RQDVLKHKFDAIHDLIDKMLDVT  282

Query  928   HKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLV  1107
               II  +++ +      +   + +    A             ++ A+Y+ ++AAV C+ +
Sbjct  283   KCIIEFRDVQTSHSQHVITQELEMLINTAH------------ISTAAYWTMRAAVMCAAM  330

Query  1108  ILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEE  1287
             ILNL+A+G +  SST E  E+S+LTHKL+ IL  L+K +    Q+I + +     + L  
Sbjct  331   ILNLIAIGHEQISSTSESWELSSLTHKLANILDHLKKVLNLCHQKIEEKRQHDAFEALLR  390

Query  1288  TLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEV  1467
              L   H DN     ++I   +D  P+  G     ++  LD+LRRK+V LL+SDLDI  E 
Sbjct  391   LLRTPHIDNMKILSILIHSRDDQLPLFDGT--HKRRVSLDVLRRKHVLLLISDLDIAPEE  448

Query  1468  ITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFSVSHP  1644
             + +L HMY ESK  P+R ES +E+VW+P+VD+R +PWT AK+ +F   ++SMPW+SV+HP
Sbjct  449   LFILHHMYAESKMQPNRPESNYEVVWIPVVDKRLTPWTEAKQMKFEEGQASMPWYSVAHP  508

Query  1645  SKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
             S ID A       V+G+   ++KP L V+D Q
Sbjct  509   SMIDPAVIRCIKEVWGF---KKKPQLVVLDPQ  537



>ref|XP_004239153.1| PREDICTED: uncharacterized protein LOC101249457 isoform X1 [Solanum 
lycopersicum]
Length=789

 Score =   303 bits (775),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 208/541 (38%), Positives = 303/541 (56%), Gaps = 50/541 (9%)
 Frame = +1

Query  127   PRTAPNTPHNPVHEIVPKATNLNPRSLTTYTPHPAYPVQQAYMPATTTNVVSATAPPSQV  306
             P + P T H+    I P    +NP S+         PV +  +PA+       TAP    
Sbjct  31    PMSNPTTGHH----INPLNVQINPHSVVN-------PVSRDMIPASVVPAAHHTAP----  75

Query  307   VAPLQAKIIPAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIM  480
             + P  + +  A R   +RGD     +S+D AMM H+  TH  D   + VKPL+H+IEDI+
Sbjct  76    INPRTSNL--AARLPHRRGDHHMFLTSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIV  133

Query  481   PRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNR  660
              RA   I G+V   + Q A L+A LEEK  H+ L E +   AYP  R   E+I   ++  
Sbjct  134   HRA-TPIAGHVHEAKVQ-AHLEA-LEEKAPHNELIEILNYLAYPIQRIKMELISKCANKE  190

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             DAHS T+S+L  L  Y WD K  ITFAAFAQ YGEFGLL   Y T+PLAKSVA I+++P+
Sbjct  191   DAHSTTMSLLHSLTTYAWDTKVAITFAAFAQLYGEFGLLTHQYTTNPLAKSVAIIMELPE  250

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
             ++        +  K   +  L DKML+VT  II  +++ S +    +   + +    A  
Sbjct  251   IM---TRQDILKQKFDAIHDLIDKMLDVTKCIIEFRDVQSSQNQHVITQELEMLINTAH-  306

Query  1021  LSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYI  1200
                        ++ A+Y+ ++AAV C+ +ILNL+A+G +  SST E  EIS+L HKL+ I
Sbjct  307   -----------ISTAAYWTMRAAVMCAAMILNLIAIGHEQISSTSEAWEISSLAHKLANI  355

Query  1201  LGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAG  1380
             L  L+K +    Q+I + +   K + +   L     DN     ++I   +D  P+  G  
Sbjct  356   LDHLKKVLNLCHQKIEEKRQYDKFEAILRLLRTPQLDNMKILSMLIHSRDDQLPLFDGT-  414

Query  1381  LEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVD  1560
                ++  LD+LRRK+V LL+SDLDI  E + +L HMY ESK  P+R ES +E+VW+P+VD
Sbjct  415   -HKRRVSLDVLRRKHVLLLISDLDIAPEELFVLHHMYEESKAQPNRPESNYEVVWIPVVD  473

Query  1561  RR-SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA-------VYGYLN*RRKPLLAVVDT  1716
             +R +PWT AK+ +F  V++SMPW++V+HPS ID A       V+G+   ++KP L V+D 
Sbjct  474   KRLTPWTDAKQVKFEEVQASMPWYTVAHPSMIDPAVLRCIKEVWGF---KKKPQLVVLDP  530

Query  1717  Q  1719
             Q
Sbjct  531   Q  531



>ref|XP_004237262.1| PREDICTED: uncharacterized protein LOC101263509 [Solanum lycopersicum]
Length=788

 Score =   296 bits (757),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 206/536 (38%), Positives = 296/536 (55%), Gaps = 42/536 (8%)
 Frame = +1

Query  136   APNTPHNPVHEIVPKATNLNPRSLTTYTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAP  315
             A N  H   + I P    +NP S+         P     +PAT       T P +   + 
Sbjct  29    AANRMHPMSNHINPLNVQINPHSVVK-------PASHDTIPATAVPAAHHTTPINPQTSN  81

Query  316   LQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA  495
             L A++ P  RG  +   FLAS +D  MM H+  TH  D   + VKPL+H+IEDI+ RA  
Sbjct  82    LAARL-PHRRGDHRM--FLAS-DDNTMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-T  136

Query  496   TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSI  675
              I G+V   + Q A L A L+EK  HSGL E +   AYP  R   E+I   +   DAHS 
Sbjct  137   PIAGHVHEAKVQ-AHLQA-LDEKAPHSGLTEILYYLAYPIQRIKVELISKCAKKEDAHST  194

Query  676   TLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEss  855
             T+S+L  L  Y WD K  ITFAAFAQ YGEFGLL   Y T+PLAKSVA I+++P+++   
Sbjct  195   TMSLLHSLTTYAWDTKVAITFAAFAQLYGEFGLLVHQYTTNPLAKSVAIIMELPEIM---  251

Query  856   essravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVT  1035
                  +  K   +  L DKML+VT  II  +++ S      +   + +    A       
Sbjct  252   THQDVLKQKFDAIHDLIDKMLDVTKCIIEFRDVQSSHSQHVITQELEMLINTAH------  305

Query  1036  AEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
                   ++ A+Y+ ++AAV C+ +ILNL+A+G +  SST E  EIS L HKL+ IL  L+
Sbjct  306   ------ISTAAYWTMRAAVMCAAMILNLIAIGHEQISSTSEAWEISNLAHKLANILDHLR  359

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKK  1395
             K +    Q+I + +     + +   L     DN     ++I   +D  P+  G     ++
Sbjct  360   KVLNLCHQKIEEKRQYDAFEAILRLLRTPQLDNMKILSMLIHSRDDQLPLFDGT--HKRR  417

Query  1396  HGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SP  1572
               LD+LRRK+V LL+SDLDI +E + +L HMY ESK  P+R ES +++VW+P+VD+R +P
Sbjct  418   VSLDVLRRKHVLLLISDLDIASEELFVLHHMYDESKTQPNRPESNYDVVWMPVVDKRLTP  477

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
             WT AK+ +F  V++SMPW+SV+HPS +D A       V+G+   ++KP L V+D Q
Sbjct  478   WTEAKQMKFEEVQASMPWYSVAHPSMMDPAVLRCIKEVWGF---KKKPQLVVLDPQ  530



>ref|XP_010320950.1| PREDICTED: uncharacterized protein LOC101249457 isoform X2 [Solanum 
lycopersicum]
Length=694

 Score =   286 bits (732),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 186/456 (41%), Positives = 270/456 (59%), Gaps = 31/456 (7%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             +S+D AMM H+  TH  D   + VKPL+H+IEDI+ RA   I G+V   + Q A L+A L
Sbjct  4     TSDDNAMMKHIEETHIPDGRDFDVKPLVHIIEDIVHRA-TPIAGHVHEAKVQ-AHLEA-L  60

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             EEK  H+ L E +   AYP  R   E+I   ++  DAHS T+S+L  L  Y WD K  IT
Sbjct  61    EEKAPHNELIEILNYLAYPIQRIKMELISKCANKEDAHSTTMSLLHSLTTYAWDTKVAIT  120

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
             FAAFAQ YGEFGLL   Y T+PLAKSVA I+++P+++        +  K   +  L DKM
Sbjct  121   FAAFAQLYGEFGLLTHQYTTNPLAKSVAIIMELPEIM---TRQDILKQKFDAIHDLIDKM  177

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             L+VT  II  +++ S +    +   + +    A             ++ A+Y+ ++AAV 
Sbjct  178   LDVTKCIIEFRDVQSSQNQHVITQELEMLINTAH------------ISTAAYWTMRAAVM  225

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C+ +ILNL+A+G +  SST E  EIS+L HKL+ IL  L+K +    Q+I + +   K +
Sbjct  226   CAAMILNLIAIGHEQISSTSEAWEISSLAHKLANILDHLKKVLNLCHQKIEEKRQYDKFE  285

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
              +   L     DN     ++I   +D  P+  G     ++  LD+LRRK+V LL+SDLDI
Sbjct  286   AILRLLRTPQLDNMKILSMLIHSRDDQLPLFDGT--HKRRVSLDVLRRKHVLLLISDLDI  343

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFS  1632
               E + +L HMY ESK  P+R ES +E+VW+P+VD+R +PWT AK+ +F  V++SMPW++
Sbjct  344   APEELFVLHHMYEESKAQPNRPESNYEVVWIPVVDKRLTPWTDAKQVKFEEVQASMPWYT  403

Query  1633  VSHPSKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
             V+HPS ID A       V+G+   ++KP L V+D Q
Sbjct  404   VAHPSMIDPAVLRCIKEVWGF---KKKPQLVVLDPQ  436



>ref|XP_006438201.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
 gb|ESR51441.1| hypothetical protein CICLE_v10030843mg [Citrus clementina]
Length=706

 Score =   276 bits (705),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 180/473 (38%), Positives = 275/473 (58%), Gaps = 39/473 (8%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             ++ PAGR   +R  F A+S+D AM+  V+ATH  D   + VKPLL++IEDI  RA  + P
Sbjct  9     RMQPAGR---ERHMF-ATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFP  64

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             G++Q  Q Q   LD +L++K   SG  + ++  +    R S EI    S   DAH+ TL 
Sbjct  65    GFIQETQAQ---LD-VLDDKAFQSGFFDMLDLLSSTINRISCEISCKCSGGGDAHATTLG  120

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  ++ +Y WD+K V+  AAFA  YGEF ++A+L+P +PLAKSVA + Q+P++LE +++ 
Sbjct  121   IFNIVTSYSWDSKVVLALAAFALNYGEFWVVAQLFPVNPLAKSVALLKQLPEILERADTM  180

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +    +   ++ L   ML++T  I+ +KE+ S+                   ++P T E 
Sbjct  181   KP---RFETLSNLITAMLDLTKCIVEVKELPSD------------------YITPDTPEM  219

Query  1045  ENI---MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
               +   +  A Y+++++ V C+  IL L+ +G +Y  ST E  E+S+L HK++ I   L 
Sbjct  220   AAVTAHIPTAVYWIIRSIVACAGQILGLIGMGHEYIISTTETWELSSLAHKINSIYNHLL  279

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMK  1392
             + ++   Q I + +     + L   +   H DN K    L+I  ++D  P++       +
Sbjct  280   QQLKLCHQLIEEKRQIESYQALVRLMETIHIDNMKVLNRLLIHTKDDQLPLVECPT--KR  337

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             K  +D+LRRK V LLVSDLD+ NE + +L  MY ES+Q  SR ESQ+E+VWLPIVDR +P
Sbjct  338   KVSIDVLRRKSVLLLVSDLDVSNEELFLLEQMYRESRQLSSRTESQYEVVWLPIVDRSTP  397

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGY----LN*RRKPLLAVVDTQ  1719
             WT AKE +F  ++  MPWFSV HPS ID AV  Y     + R+KP+L V+D Q
Sbjct  398   WTEAKEHKFEALQYMMPWFSVHHPSAIDPAVIRYAKEKWDFRKKPILVVLDPQ  450



>ref|XP_006483988.1| PREDICTED: uncharacterized protein LOC102625551 [Citrus sinensis]
Length=706

 Score =   276 bits (705),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 180/473 (38%), Positives = 275/473 (58%), Gaps = 39/473 (8%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             ++ PAGR   +R  F A+S+D AM+  V+ATH  D   + VKPLL++IEDI  RA  + P
Sbjct  9     RMQPAGR---ERHMF-ATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFP  64

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             G++Q  Q Q   LD +L++K   SG  + ++  +    R S EI    S   DAH+ TL 
Sbjct  65    GFIQETQAQ---LD-VLDDKAFQSGFFDMLDLLSSTINRISCEISCKCSGGGDAHATTLG  120

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  ++ +Y WD+K V+  AAFA  YGEF ++A+L+P +PLAKSVA + Q+P++LE +++ 
Sbjct  121   IFNIVTSYSWDSKVVLALAAFALNYGEFWVVAQLFPVNPLAKSVALLKQLPEILERADTM  180

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +    +   ++ L   ML++T  I+ +KE+ S+                   ++P T E 
Sbjct  181   KP---RFETLSNLITAMLDLTKCIVEVKELPSD------------------YITPDTPEM  219

Query  1045  ENI---MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
               +   +  A Y+++++ V C+  IL L+ +G +Y  ST E  E+S+L HK++ I   L 
Sbjct  220   AAVTAHIPTAVYWIIRSIVACAGQILGLIGMGHEYIISTTETWELSSLAHKINSIYNHLL  279

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMK  1392
             + ++   Q I + +     + L   +   H DN K    L+I  ++D  P++       +
Sbjct  280   QQLKLCHQLIEEKRQIESYQALVRLMETIHIDNMKVLNRLLIHTKDDQLPLVECPT--KR  337

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             K  +D+LRRK V LLVSDLD+ NE + +L  MY ES+Q  SR ESQ+E+VWLPIVDR +P
Sbjct  338   KVSIDVLRRKSVLLLVSDLDVSNEELFLLEQMYRESRQLSSRTESQYEVVWLPIVDRSTP  397

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGY----LN*RRKPLLAVVDTQ  1719
             WT AKE +F  ++  MPWFSV HPS ID AV  Y     + R+KP+L V+D Q
Sbjct  398   WTEAKEHKFEALQYMMPWFSVHHPSAIDPAVIRYAKEKWDFRKKPILVVLDPQ  450



>gb|KDO82145.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=706

 Score =   276 bits (705),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 180/473 (38%), Positives = 274/473 (58%), Gaps = 39/473 (8%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             ++ P GR   +R  F A+S+D AM+  V+ATH  D   + VKPLL++IEDI  RA  + P
Sbjct  9     RMQPVGR---ERHMF-ATSDDNAMLRQVQATHAPDGREFNVKPLLYIIEDIFQRAAPSFP  64

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             G++Q  Q Q   LD +L++K   SG  + ++  +    R S EI    S   DAH+ TL 
Sbjct  65    GFIQETQAQ---LD-VLDDKAFQSGFFDMLDLLSSTINRISCEISCKCSGGGDAHATTLG  120

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  ++ +Y WDAK V+  AAFA  YGEF ++A+L+P +PLAKSVA + Q+P++LE +++ 
Sbjct  121   IFNIVTSYSWDAKVVLALAAFALNYGEFWVVAQLFPVNPLAKSVALLKQLPEILERADTM  180

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +    +   ++ L   ML++T  I+ +KE+ S+                   ++P T E 
Sbjct  181   KP---RFETLSNLITAMLDLTKCIVEVKELPSD------------------YITPDTPEM  219

Query  1045  ENI---MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
               +   +  A Y+++++ V C+  IL L+ +G +Y  ST E  E+S+L HK++ I   L 
Sbjct  220   AAVTAHIPTAVYWIIRSIVACAGQILGLIGMGHEYIISTTETWELSSLAHKINSIYNHLL  279

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMK  1392
             + ++   Q I + +     + L   +   H DN K    L+I  ++D  P++       +
Sbjct  280   QQLKLCHQLIEEKRQIESYQALVRLMETIHIDNMKVLNRLLIHTKDDQLPLVECPT--KR  337

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             K  +D+LRRK V LLVSDLD+ NE + +L  MY ES+Q  SR ESQ+E+VWLPIVDR +P
Sbjct  338   KVSIDVLRRKSVLLLVSDLDVSNEELFLLEQMYRESRQLSSRTESQYEVVWLPIVDRSTP  397

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGY----LN*RRKPLLAVVDTQ  1719
             WT AKE +F  ++  MPWFSV HPS ID AV  Y     + R+KP+L V+D Q
Sbjct  398   WTEAKEHKFEALQYMMPWFSVHHPSAIDPAVIRYAKEKWDFRKKPILVVLDPQ  450



>ref|XP_010682345.1| PREDICTED: uncharacterized protein LOC104897214 [Beta vulgaris 
subsp. vulgaris]
Length=706

 Score =   269 bits (688),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 177/471 (38%), Positives = 272/471 (58%), Gaps = 35/471 (7%)
 Frame = +1

Query  331   IPAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +PA R  R RGD    +SS+DT M++ +RATH  D     V+PL H+IEDI  RA  TIP
Sbjct  6     VPA-RKQRFRGDRHLFSSSDDTTMLNQLRATHAPDGRDIDVRPLFHIIEDIFHRAAPTIP  64

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             G   S Q     LDA L++K + +G  + IE  AY   + S EI    +S+ DAH+ T+S
Sbjct  65    G---SNQGAEPHLDA-LDDKTLQAGYGDLIELLAYTINKISNEITCKCTSSEDAHATTMS  120

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  ++++Y WDAK V+  AAFA  YG+F L+A+LY  + LAKSVA + Q+P++++ S+S 
Sbjct  121   IFNMVSSYSWDAKVVLALAAFAVYYGDFWLIAQLYTVNSLAKSVAILKQLPEIMDHSDSH  180

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +    + + +A L   M+ VT  ++  KE+  +     +     +YK + ++L P  A  
Sbjct  181   KP---RFKAIANLIKAMVNVTKCMVDFKELPPQ----YISADTDIYKSV-DALIPTAAYW  232

Query  1045  --ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQK  1218
                +IM            TC+  I  L+++  +Y SST E  E+S+L HK+S I   L+K
Sbjct  233   IVRSIM------------TCASQIAGLISMSYEYASSTTEPWELSSLAHKVSNIYEHLRK  280

Query  1219  AVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKH  1398
              +    Q I + KH    ++L  T      DN    +++I  + D  P+  G+    K+ 
Sbjct  281   QLDLCYQHIDEKKHMEAYQMLVRTFETPQLDNMKILKILIYAKEDQLPLFDGSA--KKRV  338

Query  1399  GLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWT  1578
              +D++RR+ V LL+SDLDI +E +T+L  MY ES+Q  SR ESQ+E+VWLP++DR +PWT
Sbjct  339   SIDVMRRRNVLLLISDLDISHEELTILDQMYQESRQQASRMESQYEVVWLPVIDRSTPWT  398

Query  1579  GAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               K+ QF  ++S M W +V HPS ++ AV  Y+    +  +KP+L V+D Q
Sbjct  399   EQKQKQFEALQSMMLWHTVHHPSLLEPAVIRYIKEVWHFNKKPMLVVLDPQ  449



>gb|KDP26703.1| hypothetical protein JCGZ_17861 [Jatropha curcas]
Length=709

 Score =   269 bits (687),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 175/462 (38%), Positives = 255/462 (55%), Gaps = 28/462 (6%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT-IPGYVQSVQT  528
             R      +SS+D  MM  ++ATH  D   + VKPLLH++EDI  RA  T +   V     
Sbjct  10    RAERHMFSSSDDNTMMKQIQATHAPDGREFAVKPLLHVVEDIFQRAKPTGLATLVHHQGA  69

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A+LDA LEEK + +G  E +E  +Y   + S EI    S   DAH+ TLS+  LL++Y
Sbjct  70    HQAQLDA-LEEKALQNGFYEMLEVLSYTINKISCEISCKCSGGGDAHATTLSIFNLLSSY  128

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF L+A+LY T+PLAK++A + Q+PD+LE +++ +    K  
Sbjct  129   SWDAKVVLALAAFAVNYGEFWLVAQLYLTNPLAKAIALLKQLPDILERADALKP---KFE  185

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMaka  1065
              +  L    L+V   I+  KE       L  +Y      E+  + + + TA    I    
Sbjct  186   ALNNLIGATLDVAKCIVEFKE-------LPEQYITPDAPEMLTATAHIPTAVYWTI----  234

Query  1066  syyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEI  1245
                  ++ V C+  I+ L+ +G +Y +ST E  E+S+L HK+  I   L + +      I
Sbjct  235   -----RSLVACASQIIGLIGMGHEYIASTTEAWELSSLAHKVRSIHEHLMRQLTLCYHHI  289

Query  1246  GKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKY  1425
              + +H    + L       H DN    + +I  ++D  P+  GA    K+  LD+LRRK 
Sbjct  290   DEKRHIEAYQTLVRLFDTIHIDNIKILKALIYAKDDQLPLYDGAA--KKRASLDVLRRKN  347

Query  1426  VFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTL  1605
             V L +SDL++P E + ML  MY E++Q PSR ESQ+E+VWLP+VDR SPW   K+ QF  
Sbjct  348   VLLYISDLELPREELEMLEQMYTEARQHPSRTESQYEVVWLPVVDRSSPWDDVKQKQFET  407

Query  1606  VKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             +++ MPW+SV HPS +D AV  Y+       +KPLL V+D Q
Sbjct  408   LQTMMPWYSVYHPSLLDPAVIRYIKEVWRFNKKPLLVVLDPQ  449



>ref|XP_006378256.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
 gb|ERP56053.1| hypothetical protein POPTR_0010s06010g [Populus trichocarpa]
Length=706

 Score =   267 bits (682),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 172/467 (37%), Positives = 264/467 (57%), Gaps = 35/467 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             +R+     +SS+DTAMM  ++ATH  D   + VKPLLH++EDI  RA   + G    VQ 
Sbjct  8     MRRERSMFSSSDDTAMMKQIQATHAPDGREFPVKPLLHIVEDIFLRATPAL-GMTSIVQQ  66

Query  529   Q---PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLL  699
             Q    A+LD  LEEK + +G +E IE  +Y   + S E+    S   DAH+ TL++  L+
Sbjct  67    QGAHQAQLDE-LEEKALQNGFHETIEMLSYNINKISCEMSCKCSGGGDAHATTLAIFNLV  125

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
             +NY WD K V+  A FA  YGEF L+A+LY T+PLAK+VA + Q+PD++E +++ +    
Sbjct  126   SNYSWDEKVVLALAGFAVNYGEFWLVAQLYLTNPLAKAVALLKQLPDIIERADNLKP---  182

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI--  1053
             K   +  L   M++V   I+  KE+ S+                   ++P T E      
Sbjct  183   KFEALTSLIKAMMDVAKCIVEFKELPSQ------------------YITPDTPEMLTATA  224

Query  1054  -MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQK  1230
              +  A Y+ +++ V C+  I+ L+ +G +Y +ST E  E+S+L HK++ I   L K +  
Sbjct  225   HIPTAVYWTIRSIVACASQIMGLIGMGHEYIASTTEAWELSSLAHKVNNIHSHLMKQLTL  284

Query  1231  STQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDI  1410
               Q I + +H    + L       H DN    + +I  ++D  P+  G+    K+  LD+
Sbjct  285   CLQHIDEKRHIEAFQTLVSLFEAFHIDNMKILKALIYAKDDQLPLFDGS--TKKRASLDV  342

Query  1411  LRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKE  1590
             LRR+ V LL+SDL+I +E ++ML+ MY E+++ P R ESQ+E+VWLP+VDR SPW+  K 
Sbjct  343   LRRRSVLLLISDLEISHEELSMLQQMYSEAREQPGRPESQYEVVWLPVVDRSSPWSETKH  402

Query  1591  DQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               F   +  MPW+SV HPS +D AV  Y+    +  ++PLL V+D Q
Sbjct  403   KLFEDFQRMMPWYSVYHPSLLDVAVIRYIKEVWHFNKRPLLVVLDPQ  449



>emb|CDP13257.1| unnamed protein product [Coffea canephora]
Length=812

 Score =   264 bits (675),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 204/574 (36%), Positives = 311/574 (54%), Gaps = 60/574 (10%)
 Frame = +1

Query  61    INNTGRPMSES--TTRATDTTPLVPRTAPNTPHNPVHEIVPKATNLNPRSLTTYTPHPAY  234
             I    RPM+E+  TTR    T      AP+T   P       +T   P  L    PH  +
Sbjct  20    IQPVSRPMTENVPTTRGHPMTQATHEIAPSTRGQP-------STTARP-YLGESRPH--F  69

Query  235   PVQQAYMPATTTNVVSATA-----------PPSQVVAPLQAKIIPAGRG---IRKRGDFL  372
                QA++     ++  A A           PP+ V   L+ +  PAGR    +R+R  F 
Sbjct  70    GEGQAHLGEGQAHLGEAQAHLAEVPAVRGQPPTNVPGILKNQP-PAGRSGHLMRERHLF-  127

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ-PARLDA  549
             +SS+D AMM  + A H  D   + VK L+ ++EDIM RA  T  G  +  Q+Q PA    
Sbjct  128   SSSDDNAMMKQILAAHAPDGREFDVKTLVFIVEDIMRRA--TFLG--EGAQSQAPA---D  180

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
               E++ +H G  + +E  AYP  +T+ E+I   SS  DAHSIT+++ + L++Y W+AK  
Sbjct  181   TWEDRAIHGGYTDMLELLAYPINKTNSELICKCSSGGDAHSITMALFQTLSSYTWEAKVA  240

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             I FAAFA  YGEF L+A+LY T+PLAKSVA + ++P+++E +E+ +    K   V  L +
Sbjct  241   IAFAAFAVSYGEFWLVAQLYTTNPLAKSVAVLKELPEIMEHAEALKQ---KFEAVNNLIN  297

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              ML VTH I+  KE+ ++           +  E  E +S         +  A Y+ V++ 
Sbjct  298   AMLNVTHCIVKFKELPTQ----------YINPESPEMISAAAH-----IPTAVYWTVRSI  342

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V CS ++LNL+A+G ++ +S  E  E+++L HKL+ I   L++ +    + I + +    
Sbjct  343   VACSFILLNLIALGHEFVASAAEAWELNSLAHKLASIKEHLERQMDIINRRIEERRENDA  402

Query  1270  RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDL  1449
                L      TH DN      +I  + D  P+  G     ++  LD+LRRK+V LL+SDL
Sbjct  403   YLALVRLFETTHVDNMKILRALIYAKEDQLPLFDGT--HKRRASLDVLRRKHVLLLISDL  460

Query  1450  DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWF  1629
             D+ +E +++L  MY ES+Q P+R ESQ+E+VWLP++DR  PW  A + QF  V++SMPW+
Sbjct  461   DMSHEELSVLHQMYTESRQQPTRPESQYEVVWLPVIDRLLPWHDATDKQFQFVQNSMPWY  520

Query  1630  SVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             SV+HP  +D AV  ++       +KP L V+D Q
Sbjct  521   SVAHPMMLDPAVIRFIKENWGFNKKPQLVVLDPQ  554



>ref|XP_011012451.1| PREDICTED: uncharacterized protein LOC105116695 [Populus euphratica]
Length=715

 Score =   260 bits (665),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 171/475 (36%), Positives = 263/475 (55%), Gaps = 44/475 (9%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R+     +SS+DTAMM  ++ATH  D   + VKPLLH++EDI  RA   + G    VQ Q
Sbjct  9     RRERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPAL-GMTSIVQQQ  67

Query  532   ---PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLA  702
                 A+LD  LEEK + +G +E IE  +Y   + S E+    S   DAH+ TL++  L++
Sbjct  68    GAHQAQLDE-LEEKALQNGFHETIEMLSYNINKISCEMSCKCSGGGDAHATTLAIFNLVS  126

Query  703   NYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssK  882
             NY WD K V+  A FA  YGEF L+A+LY T+PLAK+VA + Q+PD++E +++ +    K
Sbjct  127   NYSWDEKVVLALAGFAVNYGEFWLVAQLYLTNPLAKAVALLKQLPDIIERADNLKP---K  183

Query  883   LREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI---  1053
                +  L   M++V   I+  KE+ S+                   ++P T E       
Sbjct  184   FEALTSLIRAMMDVAKCIVEFKELPSQ------------------YITPDTPEMLTATAH  225

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteee---------leistltHKLSYILG  1206
             +  A Y+ +++ V C+  I+ L+ +G +Y +ST E            +S+L HK++ I  
Sbjct  226   IPTAVYWTIRSIVACASQIMGLIGMGHEYIASTTEAWDLSSLPTRFMLSSLAHKVNNIHS  285

Query  1207  DLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLE  1386
              L K +    Q I + +H    + L       H DN    + +I  ++D  P+  G+   
Sbjct  286   HLMKQLTLCFQHIDEKRHIEAFQTLVSLFEAFHIDNMKILKALIYAKDDQLPLFDGST--  343

Query  1387  MKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR  1566
              K+  LD+LRR+ V LL+SDL+I +E ++ML+ MY E+++ P R ESQ+E+VWLP+VDR 
Sbjct  344   KKRASLDVLRRRSVLLLISDLEISHEELSMLQQMYSEAREQPGRPESQYEVVWLPVVDRS  403

Query  1567  SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +PWT  K+  F   +  MPW+SV HPS +D AV  Y+    +  ++PLL V+D Q
Sbjct  404   TPWTETKQKLFEDFQRMMPWYSVYHPSLLDVAVIRYIKEVWHFSKRPLLVVLDPQ  458



>ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera]
 emb|CBI16823.3| unnamed protein product [Vitis vinifera]
Length=714

 Score =   260 bits (664),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 171/468 (37%), Positives = 261/468 (56%), Gaps = 34/468 (7%)
 Frame = +1

Query  349   IRKR-GDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA------TIPG  507
             +R+R GD + +S+D  +M  + A H  D   + VKPLL ++E+I+ R  +       +PG
Sbjct  13    VRQRSGDRMFASDDNGIMKQIHAIHVPDGRDFDVKPLLRIVENILLRTTSSTTLTPALPG  72

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                 + +  A+LDA LE+K +  G +  I+  A+   + S EI    +S  DAH+  ++V
Sbjct  73    I--PLGSNQAQLDA-LEDKTLQDGSSNMIDLLAHTINKISCEISCKCTSGGDAHATAVAV  129

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               +L++Y WDAK V+  AAFA  YGEF L+A LYPT+PLAKSVA + Q+PD+LE +++ +
Sbjct  130   FNILSSYSWDAKVVLALAAFATTYGEFWLVAHLYPTNPLAKSVAILKQLPDILEHTDALK  189

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
                 K   ++ L   M++V   I+  KE+  +  +      V+    +A   + V     
Sbjct  190   P---KFEALSSLIKVMVDVAKCIVQFKELPPQYITPDTPAMVT---AIAHIPTAVYWTIR  243

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
             +I+             C+  I +L+ +  +Y +ST +  E+S L HK+S + G LQ  + 
Sbjct  244   SIV------------ACASQIASLIGMSHEYIASTMDAWELSGLAHKVSNMYGHLQSQLY  291

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                Q I   KH     +L       H DN     ++I  ++D  P+  G  L  +K  LD
Sbjct  292   LCQQHINDKKHIEAYMMLVRLFETPHIDNMKIIRVLIYAKDDQPPLFDG--LSKRKVSLD  349

Query  1408  ILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAK  1587
             ILRRK V L +S+L++P+E + +L  MY ES+QDP+R ESQ+E+VW+P+VDR +PWT  K
Sbjct  350   ILRRKNVLLFISELEVPHEELFILDQMYQESRQDPTRPESQYEVVWMPMVDRSTPWTEEK  409

Query  1588  EDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               QF  +KS MPW+SV HPS ID AV  Y+       +KPLL V+D Q
Sbjct  410   NRQFETLKSMMPWYSVDHPSSIDLAVIKYIKEMWGFNKKPLLVVLDPQ  457



>ref|XP_010248720.1| PREDICTED: uncharacterized protein LOC104591548 [Nelumbo nucifera]
Length=700

 Score =   256 bits (654),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 179/466 (38%), Positives = 262/466 (56%), Gaps = 38/466 (8%)
 Frame = +1

Query  358   RGD---FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV--  522
             RGD     ++S+D+AMM  + ATH  D     VKPL+ LI DI   +  T P  V  V  
Sbjct  2     RGDRNIMFSTSDDSAMMKQILATHAHDGREIDVKPLIQLIGDIFQTSPPTAPTAVDGVIV  61

Query  523   ---QTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLK  693
                +T P  +DA+++ K  H G    +EA AY  ++ S EI    S   DAH+ T SV  
Sbjct  62    PAAETHP--IDALVD-KTQHLGFVGVMEAVAYTIHKISTEISYKCSGGADAHATTQSVFN  118

Query  694   LLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessrav  873
             ++++Y W+AK V+  AAFA  YGEF L++R Y TD LAKS+A + Q+PD+LE SE  +  
Sbjct  119   MVSSYTWEAKMVLALAAFAVTYGEFSLVSRFYLTDQLAKSIALLKQLPDILEHSELLKPR  178

Query  874   ssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI  1053
                LR   KL   +L++T  +I       E + L  +Y          S +P  +   N+
Sbjct  179   FDALR---KLFMSLLDLTKCVI-------EFRGLPTQY--------ISSDTPPMSVAVNL  220

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
             +  A+Y+ V++ V CS  I++L+  G +Y  ST E  E+S+L HK+S IL  L+K +   
Sbjct  221   IPTAAYWTVRSVVACSTQIISLIGFGYEYVPSTAEAWELSSLAHKISNILDLLKKQLHLC  280

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              Q I + +H    + L       H DN    + +I  ++D   +  G      + GLD+L
Sbjct  281   YQHIDEKRHLEAFQTLIRLFETPHIDNTKILKALIYAKDDLQLLFDGT-----RVGLDVL  335

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             RRK V LL+SDLDI  + +++L  +Y+ES+Q P+R ESQFE+VW+P+VDR  PW   K+ 
Sbjct  336   RRKNVLLLISDLDISRDELSILEQVYMESRQQPTRPESQFEVVWIPVVDRSLPWDQYKQT  395

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              F  +++SMPW+SV HPS ID AV  Y+    N  +KP+L V+D Q
Sbjct  396   DFERLQTSMPWYSVHHPSLIDPAVIRYIKEIWNFGKKPILVVLDPQ  441



>emb|CAN83922.1| hypothetical protein VITISV_026532 [Vitis vinifera]
Length=714

 Score =   253 bits (645),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 171/468 (37%), Positives = 261/468 (56%), Gaps = 34/468 (7%)
 Frame = +1

Query  349   IRKR-GDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA------TIPG  507
             +R+R GD + +S+D  +M  + A H  D   + VKPLL ++E+I+ R  +       +PG
Sbjct  13    VRQRSGDRMFASDDNGIMKQIHAIHVPDGRDFDVKPLLRIVENILLRTTSSTTLTPALPG  72

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                 + +  A+LDA LE+K +  G +  I+  A+   + S EI    +S  DAH+  ++V
Sbjct  73    I--PLGSNQAQLDA-LEDKTLQDGSSNMIDLLAHTINKISCEISCKCTSGGDAHATAVAV  129

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               +L++Y WDAK V+  AAFA  YGEF L+A LYPT+PLAKSVA + Q+PD+LE +++ +
Sbjct  130   FNILSSYSWDAKVVLALAAFATTYGEFWLVAHLYPTNPLAKSVAILKQLPDILEHTDALK  189

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
                 K   ++ L   M++V   I+  KE+  +  +      V+    +A   + V     
Sbjct  190   P---KFEALSSLIKVMVDVAKCIVQFKELPPQYITPDTPAMVT---AIAHIPTAVYWTIR  243

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
             +I+             C+  I +L+ +  +Y +ST +  E+S L HK+S + G LQ  + 
Sbjct  244   SIV------------ACASQIASLIGMSHEYIASTMDAWELSGLAHKVSNMYGHLQXQLY  291

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                Q I   KH     +L       H DN     ++I  ++D  P+  G  L  +K  LD
Sbjct  292   LCQQHINDKKHIEAYMMLVRLFETPHIDNMKIIRVLIYAKDDQPPLFDG--LSKRKVSLD  349

Query  1408  ILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAK  1587
             ILRRK V L +S+L++P+E + +L  MY ES+QDP+R ESQ+E+VW+P+VDR +PWT  K
Sbjct  350   ILRRKNVLLFISELEVPHEELFILDQMYQESRQDPTRPESQYEVVWMPMVDRSTPWTEEK  409

Query  1588  EDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               QF  +KS MPW+SV HPS ID AV  Y+       +KPLL V+D Q
Sbjct  410   NRQFETLKSMMPWYSVDHPSSIDLAVIKYIKEMWGFNKKPLLVVLDPQ  457



>ref|XP_010250966.1| PREDICTED: uncharacterized protein LOC104593030 [Nelumbo nucifera]
Length=747

 Score =   252 bits (644),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 182/500 (36%), Positives = 273/500 (55%), Gaps = 44/500 (9%)
 Frame = +1

Query  262   TTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHY  441
             +TT  + A AP    +  L A++    RG R   +  ++S+D AMM  +  TH  D    
Sbjct  2     STTTPLHAAAPK---ITSLSAQL---PRGER---NLFSTSDDNAMMKQILGTHAHDGREV  52

Query  442   KVKPLLHLIEDIMPRAHAT-------IPGYVQSVQTQPAR--LDAILEEKVVHSGLNEAI  594
              VKPLL ++EDI  R+  T       + G VQ V        +DA+++ K  H G    +
Sbjct  53    DVKPLLQIVEDIFHRSPPTATTTTNVVDGIVQHVVAADTHTHIDALVD-KTHHLGFAGML  111

Query  595   EAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGL  774
             EA AY  ++ S E+    S   DAH+  L++   LA+Y WDAK V++ AAFA  YGEF L
Sbjct  112   EALAYTIHKISCELSYKCSGGTDAHATALAIFSTLASYSWDAKVVLSLAAFAVNYGEFWL  171

Query  775   LARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEI  954
             +A+LYPT+PLAKS+A + Q+PD+LE SE  +     LR    L + ML++T  +I  KE+
Sbjct  172   VAQLYPTNPLAKSIALLKQLPDILEHSELLKPRFEGLR---NLINAMLDLTKCLIEFKEL  228

Query  955   GSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGR  1134
              ++  S                 +P  A   +++  A+Y+ V+  V  +  I  L+ +G 
Sbjct  229   PTQYISTD---------------TPPMAVAMSLIPTAAYWTVRGVVASATQINGLIGLGH  273

Query  1135  DYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDN  1314
             +Y  ST E  E+S+L HK++ I    +K +    Q I + +H    + L       H DN
Sbjct  274   EYIPSTAEAWELSSLAHKINNIKEHFRKQLHFCYQHIDEKRHIEAFQTLVRLFETPHIDN  333

Query  1315  KYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYL  1494
                   +I  ++D  PI  G     KK GL+ILRRK V LL+SDLDI  + +++L  +YL
Sbjct  334   MKILRALIYSKDDMQPIFDGT--TKKKVGLEILRRKNVLLLISDLDISRDELSILETVYL  391

Query  1495  ESKQDPSRAESQFEIVWLPIVDRRSPWT-GAKEDQFTLVKSSMPWFSVSHPSKIDEAVYG  1671
             ES+  PSR ESQFE+VWLP++D+  PW   +++  F  ++S MPW+SV+HPS ID+AV  
Sbjct  392   ESRHQPSRPESQFEMVWLPVLDKSVPWNESSRQTDFERLQSIMPWYSVNHPSLIDQAVIR  451

Query  1672  YL----N*RRKPLLAVVDTQ  1719
             Y+    +  +KP+L  +D Q
Sbjct  452   YIKEVWHFSKKPILVALDPQ  471



>ref|XP_011034021.1| PREDICTED: uncharacterized protein LOC105132310 [Populus euphratica]
Length=706

 Score =   248 bits (634),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 165/465 (35%), Positives = 255/465 (55%), Gaps = 33/465 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R+     A+S++  MM  ++ATH  D   + VK LLH++EDI  R   + PG    VQ Q
Sbjct  9     RRERTVFAASDENVMMKQIQATHAPDGREFSVKLLLHIVEDIFHRT-TSAPGITDFVQHQ  67

Query  532   PARLDAI--LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLAN  705
              +    +  LEEKV+ +G NE I+  +Y   + S E+    S   D H+ TL++  L++N
Sbjct  68    GSHQAQLYELEEKVLQNGFNEMIDMLSYTISKISCEMSCKCSGGGDGHATTLAIFNLVSN  127

Query  706   YWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKL  885
             Y WDAK V+  AAFA  YGEF L+++LY T+PLAK+VA + + P++ E +E+ +     L
Sbjct  128   YSWDAKVVLALAAFALNYGEFWLVSQLYLTNPLAKAVALLKRFPEITERAEALKPTFEAL  187

Query  886   REVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI---M  1056
                  L   M +V   ++  KE+ S+                   ++P T E       +
Sbjct  188   ---TNLIRAMTDVAKCVVEFKELPSQ------------------YITPDTPEMLTATAHI  226

Query  1057  akasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKST  1236
               A Y+ +++ V C+  I+ L ++G +Y +ST    E+S+L +K+SYI   L K +    
Sbjct  227   PTAVYWTIRSIVACTSQIVGLTSMGHEYLASTTAAWELSSLAYKVSYIHSHLLKQLTLCF  286

Query  1237  QEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILR  1416
             Q I + +H      L   L   H DN    + +I  ++D  P+  G+    K+  LD+LR
Sbjct  287   QHIDEKRHHEAYLTLVRLLESVHIDNMKILKALIYAKDDQLPLFDGS--TKKRASLDLLR  344

Query  1417  RKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQ  1596
              K V LL+SDL++  E + ML  M+ E+++ P RAESQ+EIVWLP++DR +PW   K+ Q
Sbjct  345   MKSVLLLISDLELSQEELLMLLQMFSEARKQPGRAESQYEIVWLPVMDRSTPWNETKKKQ  404

Query  1597  FTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +   +SSMPW+SV HPS +D AV  Y+    +  +K LL V+D Q
Sbjct  405   YEDFQSSMPWYSVYHPSLLDVAVIRYIKEVWHFNKKALLVVLDPQ  449



>ref|XP_006379953.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
 gb|ERP57750.1| hypothetical protein POPTR_0008s18360g [Populus trichocarpa]
Length=706

 Score =   248 bits (633),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 168/465 (36%), Positives = 256/465 (55%), Gaps = 33/465 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R+     A+S++  MM  ++ATH  D   + VK LL ++EDI  RA    PG    VQ Q
Sbjct  9     RRERTVFAASDENVMMKQIQATHAPDGREFSVKLLLQIVEDIFHRA-TPAPGITDFVQHQ  67

Query  532   PARLDAI--LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLAN  705
              +    +  LEEKV+ +G NE I+  ++   + S E+    S   DAH+ TL++  L++N
Sbjct  68    GSHQAQLYELEEKVLQNGFNEMIDMLSHTISKISCEMSCKCSGGGDAHATTLAIFNLVSN  127

Query  706   YWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKL  885
             Y WDAK V+  AAFA  YGEF L+++LY T+PLAK+VA + Q+P+++E +E+ +    K 
Sbjct  128   YSWDAKVVVALAAFALNYGEFWLVSQLYLTNPLAKAVALLKQLPEIIERAEALKP---KF  184

Query  886   REVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI---M  1056
               +  L   M +V   I+  KE+ S+                   ++P T E       +
Sbjct  185   EALTNLIRAMTDVAKCIVEFKELPSQ------------------YITPDTPEMLTATAHI  226

Query  1057  akasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKST  1236
               A Y+ +++ V C+  I+ L  +G +Y +ST E  E+S L +K+S I   L K +    
Sbjct  227   PTAVYWTIRSIVACTSQIVGLTGMGHEYIASTTEAWELSGLAYKVSNIHSHLVKQLTLCF  286

Query  1237  QEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILR  1416
             Q I + +H      L   L   H DN    + +I  ++D  P+  G+    K+  LD+LR
Sbjct  287   QHIDEKRHHEAYLTLVRLLESVHIDNMKILKALIYAKDDQLPLFDGS--TKKRASLDLLR  344

Query  1417  RKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQ  1596
             RK V LL+SDL+   E + ML+ MY E+++ P RAESQ+EIVWLP++DR +PW   K+ Q
Sbjct  345   RKSVLLLISDLEPSQEELLMLQQMYSEAREQPGRAESQYEIVWLPVMDRSTPWNETKKKQ  404

Query  1597  FTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +   +SSMPW+SV  PS +D AV  Y+    +  +K LL V+D Q
Sbjct  405   YEDFQSSMPWYSVYQPSLLDVAVIRYIKEVWHFNKKALLVVLDPQ  449



>ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47605.1| conserved hypothetical protein [Ricinus communis]
Length=701

 Score =   247 bits (630),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 163/469 (35%), Positives = 255/469 (54%), Gaps = 36/469 (8%)
 Frame = +1

Query  328   IIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             ++P     R      ++S+D AMM  ++ATH  D   + V+PLL+++ED+  RA   +P 
Sbjct  3     VVPHRSNPRGERHMFSTSDDNAMMKQIQATHAPDGREFDVRPLLNVVEDVFQRA---VPP  59

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                +   QP       +EK + +G  E ++  +Y   + S EI    S   DAH+ TL++
Sbjct  60    SGLATIVQP-------QEKTLQNGFYEMLDLLSYTINKISCEIACKCSGGGDAHATTLAI  112

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               L+++Y WDAK V+  AAFA  YGEF L+A LY T+PLAK+VA + Q+PD+LE +++ +
Sbjct  113   FNLVSSYSWDAKLVLALAAFAVNYGEFWLVAHLYLTNPLAKAVALLKQLPDILERADALK  172

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQ  1044
                 K   V+ L    L+V   I+  KE       L  +Y      E+  + + + TA  
Sbjct  173   P---KFEAVSSLIRAALDVAKCIVEFKE-------LPPQYITPDAPEMLIATAHIPTAVY  222

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
               I         ++ V C+  I+ L+ +G +Y +ST E  E+S+L HK+  I   L + +
Sbjct  223   WTI---------RSIVACATQIIGLIGMGHEYMASTTEAWELSSLAHKVRSIHEHLMRQL  273

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                   I + +H    + L       H DN      +I  ++D  P+  G     K+  L
Sbjct  274   TLCYHHIDEKRHVEAYQTLIRLFDTIHIDNIKILRALIYAKDDQLPLYDGHN--KKRASL  331

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             D+LRRK V L +SDLD+P+E ++ML  MY E++Q+P+R ES +E+VWLP+V+R + W  A
Sbjct  332   DVLRRKNVLLYISDLDLPHEELSMLEQMYSEARQNPARTESHYEVVWLPVVERSTAWNDA  391

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             K+ QF  ++S MPW++V HPS +D AV  Y+       +KPLL V+D Q
Sbjct  392   KQKQFENLQSVMPWYTVYHPSLLDPAVIRYIKEFWKFNKKPLLVVLDPQ  440



>ref|XP_009403632.1| PREDICTED: uncharacterized protein LOC103987147 [Musa acuminata 
subsp. malaccensis]
Length=699

 Score =   239 bits (609),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 169/462 (37%), Positives = 254/462 (55%), Gaps = 36/462 (8%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             I+      +SS+D+ +M  + ATH  D      +PLL ++ED++ RA  T+      + T
Sbjct  12    IKADRHLFSSSDDSVVMKQILATHSPDGRDINTRPLLRIVEDVLQRATPTV------IVT  65

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A+L+ + ++K  H  +   +EA AY  +R S EI    S   DAH  TL +L  LANY
Sbjct  66    PQAQLEPV-DDKAHHVEVGGMLEALAYTIHRISCEITCKCSGGGDAHGTTLVLLNSLANY  124

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK VI  AAFA  YGEF L A+L+  +PLAKSVA + Q+PD+LE +++ +    +  
Sbjct  125   TWDAKVVIALAAFAVSYGEFWLTAQLHTINPLAKSVALLKQLPDILEHTDALKP---RFD  181

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMaka  1065
              +  L   ML+VT  II  KE+ SE       Y       +A +L+ V TA    I    
Sbjct  182   TINNLIKAMLDVTKCIIQFKELPSE-------YISPDTPAMAMALAHVPTAVYWTI----  230

Query  1066  syyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEI  1245
                  ++ V C+  I++L+ +G +Y SST E  E+S+L HK+  I G L K +    + I
Sbjct  231   -----RSVVACASQIVSLIGLGHEYISSTSEVWELSSLAHKVGSIHGHLTKQLDLCNRHI  285

Query  1246  GKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKY  1425
             G+ KH    + L       H DN     ++I  ++D  P+I G+    ++  +D+LRRK 
Sbjct  286   GEKKHIEAYQTLVRLFETVHIDNLKILRVLISSKDD-LPLIDGS--TKRRVSVDVLRRKI  342

Query  1426  VFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTL  1605
             V L +SDLDI +E + +L  +Y E+     + +  +E+VWLP+ DR  PWT AKE+ F  
Sbjct  343   VMLFISDLDIIHEELFVLIQIYNEAHH--GKLDRSYEVVWLPVTDRHVPWTAAKEETFNR  400

Query  1606  VKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             + S+MPW+S+ HPS +D AV  Y+    +  +KPLL V+D Q
Sbjct  401   LASNMPWYSLHHPSLLDPAVIKYIRDLWHFDKKPLLVVLDPQ  442



>ref|XP_010660833.1| PREDICTED: uncharacterized protein LOC100245845 [Vitis vinifera]
Length=712

 Score =   234 bits (597),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 164/461 (36%), Positives = 255/461 (55%), Gaps = 31/461 (7%)
 Frame = +1

Query  358   RGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             +GD   +  S+D AMM  + ATH  D     V+PL  L+EDI+ R   + PG    V T 
Sbjct  11    KGDRSMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDILNR---STPGVDAIVTTT  67

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
               R++  LE++  H+G    IEA ++   R S EI    S+  DAH+ TLS+  +LA+Y 
Sbjct  68    ETRVEP-LEDRTQHAGFIAMIEALSFTIDRISCEIACKCSAGGDAHATTLSIFNMLASYS  126

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P LLE S   +     L  
Sbjct  127   WDAKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILKQVPILLEHSALLKPRFDALNN  186

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             + +    M++VT  II  KE+     +  V    +L   +A   + V     +I+     
Sbjct  187   LIR---AMMDVTRCIIEFKELPPMYITQDVP---ALSIAMAHIPTAVYWTIRSIV-----  235

Query  1072  yvvkaavTCSLVILNLLAVGRDY-YssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
                     C+  I +L ++G +Y  S+T E  E+STL HK++ IL  L+K +    Q I 
Sbjct  236   -------ACATQIASLTSMGHEYAISTTNETWELSTLAHKINSILDHLKKQLFICYQYIE  288

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + ++    ++L+      H DN    + +I  ++D  P++ G+    ++  +D+LRRK V
Sbjct  289   EKRNVETYQMLQNLFQSIHIDNMKILKALIYAKDDMQPLVDGST--KRRVHIDVLRRKNV  346

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLDI  + +++L  +Y ES+   +R ESQ+E+VW+PIVD    W    + QF  +
Sbjct  347   LLLISDLDISQDELSILEQIYNESRVHATRMESQYEVVWVPIVDHSLEWADPVQKQFENL  406

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +++MPWFSV  P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  407   QATMPWFSVHSPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  447



>ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35451.1| conserved hypothetical protein [Ricinus communis]
Length=805

 Score =   234 bits (598),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 186/579 (32%), Positives = 300/579 (52%), Gaps = 52/579 (9%)
 Frame = +1

Query  46    MAQTTINNTGRPMSESTTRATDTTPLVPRTAPNTPHNPVHEIV-PKATNLN--PRSLTTY  216
             MA  T+ N  + M+++        P V +  PN     +H+++ P  +N+   P ++   
Sbjct  1     MANQTLANMQQLMNKNQ-------PNVQQPLPNQAQVNLHQLMNPTPSNMQQTPATMQQL  53

Query  217   T-PHPAYPVQQ------AYM-------PATTTNVVSATAPPSQVVAPLQAKIIPAGRGIR  354
             T P PA  +QQ      A+M       PA T  ++  T  P  +   L+     A + I+
Sbjct  54    TNPAPA-NMQQLINPTPAHMHHHINSNPANTQQLIKQT--PFTMQQLLKQTPASAHQLIK  110

Query  355   KRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQP  534
                   +SS+D AM   ++ATH  D   + VKPLL+++EDI  RA   I           
Sbjct  111   ADRLLFSSSDDNAMTKQIQATHSPDGREFDVKPLLNIVEDIFDRAAPAIESLALPAAAHH  170

Query  535   ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
             AR +A L++   HS +   +E+ ++   R + EI    SS  +AH+IT+S+L  L++Y W
Sbjct  171   ARNEA-LDDNTYHSSVMAMLESLSFVIDRVASEITYKCSSGGEAHAITMSILNTLSSYTW  229

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             DAK VI  AAFA  YGEF L+A+ Y ++ LAKS+A +  +PD+LE S   +    +   V
Sbjct  230   DAKLVIALAAFAMTYGEFWLVAQNYTSNQLAKSMAILKHMPDILEHSSMLKP---RFDSV  286

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
               L   ML +   I+  +E+  +  ++ V            +LS   A     +  + Y+
Sbjct  287   KNLITVMLAIAKCIVEFQELPPQYITMDVP-----------ALSAAMAH----LPISVYW  331

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
              +++ V C+  ++ L+ +G ++ +ST E  E+S+L HKLS +   LQ  +    + I + 
Sbjct  332   TIRSIVACASQVIGLIGLGHEHVASTTEAWELSSLAHKLSNMQSHLQNQLGLCYKHIDER  391

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFL  1434
             KH    + L       H DN    + +I  ++D  P++ G     ++  +D+LRRK V L
Sbjct  392   KHMEIYQNLIRLFEMAHIDNMRVLKALIYSKDDIQPLLEGT--TKRRVNIDVLRRKNVLL  449

Query  1435  LVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
             L+SDLDI  + I++L  +Y ES+  PSR ESQ+EIVWLPI+D+  P+      +F  ++S
Sbjct  450   LISDLDITQDEISILEQIYNESRLHPSRQESQYEIVWLPILDQAVPFNDNMLKKFEALQS  509

Query  1615  SMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              M W+S+ HPS ID AV  ++    N  +KP+L V+D Q
Sbjct  510   VMTWYSIHHPSLIDRAVIKFVKEKWNFGKKPILVVLDPQ  548



>ref|XP_002298571.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
 gb|EEE83376.2| hypothetical protein POPTR_0001s35870g [Populus trichocarpa]
Length=723

 Score =   233 bits (594),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 157/458 (34%), Positives = 246/458 (54%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKALGGTDAHATTVSLFNMLTSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNDLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+STL HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTMAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+  + +++L  +Y ES+Q   R +SQ+E+VW+PIVDR   W+   + +F  ++SS
Sbjct  360   ISGLDMSTDELSILEQIYNESRQHGPRLDSQYEVVWVPIVDRSVQWSDPMKGKFESMQSS  419

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  420   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  457



>ref|XP_010904538.1| PREDICTED: uncharacterized protein LOC105031936 [Elaeis guineensis]
Length=707

 Score =   232 bits (592),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 165/461 (36%), Positives = 246/461 (53%), Gaps = 34/461 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             I+      +SS+D  +M     TH  D     V+ LL LIEDIM RA+ T       V  
Sbjct  20    IKGERHLFSSSDDNIVMKQTLETHSPDGREVDVRSLLRLIEDIMQRANPT-------VLV  72

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
              P     +LE++  H+ +   +EA AYP +R + EI    +S  DAH+ T+++L  L++Y
Sbjct  73    TPQTHMEVLEDRAHHAAVIGMLEALAYPIHRIAAEITYKCTSGGDAHATTIALLHSLSSY  132

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK  +  AAFA  YGEF L A+L+  +PLAKSV+ + Q+PD++E S   +    +  
Sbjct  133   AWDAKVTLALAAFAVLYGEFWLTAQLHTVNPLAKSVSLLKQLPDIIEHSHLLKP---RFD  189

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   ML+VT  I+ LKE+ SE  SL+               SP  +     +  A 
Sbjct  190   AINNLIKAMLDVTKCIVELKELPSEYISLE---------------SPDMSMAIAHIPTAV  234

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V CS  I+ L+ +G +Y S+T E  E+S+LTHK++ I G L K + +  Q I 
Sbjct  235   YWTIRSVVACSSQIIMLIGLGHEYISATTEAWELSSLTHKVNNIHGHLTKQLDRCHQHID  294

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + +H    + L       H DN      ++    D  P+  G     K+ G+DILRR+ V
Sbjct  295   ERRHVEAYQTLVRLFEVIHIDNSKILRALM-SSKDEHPLFDGTS--KKRFGVDILRRRIV  351

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              L +SDLDIP E + +L  +Y +S Q   + E  +EIVWLP+ +R  PW    E+ F  +
Sbjct  352   MLFISDLDIPQEELLILVQLYHDSHQ--GKLERPYEIVWLPVTERHGPWNRDHEENFNRL  409

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              S MPW+ + HPS +D AV  Y+    +  +KPLLAV+D Q
Sbjct  410   ASMMPWYLLHHPSLLDRAVIQYIREVWHFEKKPLLAVLDPQ  450



>ref|XP_011013023.1| PREDICTED: uncharacterized protein LOC105117152 [Populus euphratica]
Length=724

 Score =   231 bits (589),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 155/458 (34%), Positives = 247/458 (54%), Gaps = 28/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + + Q  PA
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTNSQA-PA  83

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
              ++   E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  84    EME---EDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  140

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T +AFA  YG+F LLA++Y ++ LAKS+A + Q+P ++E +   +     +  + 
Sbjct  141   AKLVLTLSAFALNYGDFWLLAQIYSSNDLAKSMAILRQLPRIMEQTGPLKLRFDAINNLI  200

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   S V     +++       
Sbjct  201   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPSAVYWTMRSVV-------  247

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G D+  ST    E+STL HKLS IL  L+K +    Q I + +
Sbjct  248   -----ACAAQITSLTTMGHDFSISTTAAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKR  302

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  303   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  360

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W+   + +F  ++SS
Sbjct  361   ISGLDMSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWSDPMKGKFESMQSS  420

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  421   MPWFTVYHPSLIEKAVMRFIKEAWHFRNKPILVVLDPQ  458



>emb|CBI34821.3| unnamed protein product [Vitis vinifera]
Length=1487

 Score =   236 bits (601),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 260/475 (55%), Gaps = 31/475 (7%)
 Frame = +1

Query  316   LQAKIIPAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRA  489
             L +K+ P       +GD   +  S+D AMM  + ATH  D     V+PL  L+EDI+ R 
Sbjct  842   LASKMAPISLQQMIKGDRSMITMSDDNAMMKQIHATHAHDGRQIDVRPLYQLVEDILNR-  900

Query  490   HATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAH  669
               + PG    V T   R++  LE++  H+G    IEA ++   R S EI    S+  DAH
Sbjct  901   --STPGVDAIVTTTETRVEP-LEDRTQHAGFIAMIEALSFTIDRISCEIACKCSAGGDAH  957

Query  670   SITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLE  849
             + TLS+  +LA+Y WDAK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P LLE
Sbjct  958   ATTLSIFNMLASYSWDAKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILKQVPILLE  1017

Query  850   ssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSP  1029
              S   +     L  + +    M++VT  II  KE+     +  V    +L   +A   + 
Sbjct  1018  HSALLKPRFDALNNLIR---AMMDVTRCIIEFKELPPMYITQDVP---ALSIAMAHIPTA  1071

Query  1030  VTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDY-YssteeeleistltHKLSYILG  1206
             V     +I+             C+  I +L ++G +Y  S+T E  E+STL HK++ IL 
Sbjct  1072  VYWTIRSIV------------ACATQIASLTSMGHEYAISTTNETWELSTLAHKINSILD  1119

Query  1207  DLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLE  1386
              L+K +    Q I + ++    ++L+      H DN    + +I  ++D  P++ G+   
Sbjct  1120  HLKKQLFICYQYIEEKRNVETYQMLQNLFQSIHIDNMKILKALIYAKDDMQPLVDGS--T  1177

Query  1387  MKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR  1566
              ++  +D+LRRK V LL+SDLDI  + +++L  +Y ES+   +R ESQ+E+VW+PIVD  
Sbjct  1178  KRRVHIDVLRRKNVLLLISDLDISQDELSILEQIYNESRVHATRMESQYEVVWVPIVDHS  1237

Query  1567  SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               W    + QF  ++++MPWFSV  P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  1238  LEWADPVQKQFENLQATMPWFSVHSPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  1292


 Score =   220 bits (561),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 162/503 (32%), Positives = 261/503 (52%), Gaps = 42/503 (8%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVVAPLQA-KI--IPAGRGIRKRGDFLASSEDTAMMDH  405
             P+QQ   PA          P  QV+ P +  KI  +P  + I+     +  S+D  M+  
Sbjct  56    PMQQVINPA----------PLQQVLKPSETTKINPVPLQQLIKHDRSMITMSDDNIMVKQ  105

Query  406   VRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLN  585
             + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    ++   +   
Sbjct  106   IHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----DRTNQASFI  161

Query  586   EAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGE  765
               +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK V+T +AFA  YGE
Sbjct  162   ALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFNLLTSYSWEAKLVLTLSAFAVNYGE  221

Query  766   FGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIAL  945
             F LLA++Y ++ LAKS+A + Q+P +LE S   +     L  + +    M+  T  II  
Sbjct  222   FWLLAQIYSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMVASTRCIIEF  278

Query  946   KEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLA  1125
             KE+ S   S  V               P  A     +  A Y+ +++ V C+  I    +
Sbjct  279   KELPSMYISQDV---------------PALATAMTHIPTAVYWTIRSVVACATQITTFTS  323

Query  1126  VGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART  1302
             +G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    ++L       
Sbjct  324   MGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQMLLNLFDSI  383

Query  1303  HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLR  1482
             H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I ++ +++L 
Sbjct  384   HIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSISHDELSILE  441

Query  1483  HMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA  1662
              +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV  P+ ID+A
Sbjct  442   QIYNESRVHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSVYTPTLIDKA  501

Query  1663  VYGYL----N*RRKPLLAVVDTQ  1719
             V  ++    + R KP+L V+D Q
Sbjct  502   VIRFIKEVWHFRNKPILVVLDPQ  524



>gb|KDP46383.1| hypothetical protein JCGZ_10223 [Jatropha curcas]
Length=709

 Score =   231 bits (588),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 157/464 (34%), Positives = 250/464 (54%), Gaps = 29/464 (6%)
 Frame = +1

Query  340   GRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQS  519
             G+G R      +SS+D AM   ++ TH  D   ++VKPLLH++EDI  RA  TI     +
Sbjct  14    GKGERL---LFSSSDDNAMTKQIQGTHSPDGREFEVKPLLHIVEDIFNRAAPTIDALAIA  70

Query  520   VQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLL  699
                Q  R +A L+++   +     +E+ A+   R + EI    +   DAH+ T+S+L +L
Sbjct  71    A-PQQTRSEA-LDDRTYQTSFIATLESLAFVIDRVATEIAYKCTGGADAHATTMSLLNML  128

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
             +NY W+AK VI  AAFA  YGEF L+A+ Y ++ LAKSVA + Q+PD+LE S   +    
Sbjct  129   SNYSWEAKLVIALAAFAMNYGEFWLVAQCYTSNQLAKSVAILKQLPDMLEHSSMLKPRFD  188

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa  1059
              ++ + K+   M+++   I+  KE+     SL +    +    +     P+T        
Sbjct  189   AIKNLIKV---MVDIAKCIVEFKELPPHYISLDIPAMSTAMAHI-----PITV-------  233

Query  1060  kasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQ  1239
                Y+ +++ V C+  I  L+ +G ++  ST E  E+S+L HKLS +   L   +    +
Sbjct  234   ---YWTMRSIVACASQITGLIGLGHEHVVSTTEAWELSSLAHKLSNMHSHLATQLAICYK  290

Query  1240  EIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRR  1419
              I + KH    + L       H DN      +I  ++D  P++ G     ++  +D+LRR
Sbjct  291   HIDEKKHLETYQNLLHLFEMAHIDNMKVLRALIYTKDDLQPLVEGT--TKRRVNIDVLRR  348

Query  1420  KYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQF  1599
             K V LL+SDL+I  E I +L  +Y ES+  P+R ESQ+EIVWLPI+D   PW    + +F
Sbjct  349   KNVLLLISDLEILQEEIAILEQIYNESRLHPTRQESQYEIVWLPIIDPAVPWNDNMQSRF  408

Query  1600  TLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               +++ M W+S+ HPS ID AV  ++    +  +KP+L V+D Q
Sbjct  409   ETLQAGMTWYSIHHPSLIDRAVIKFVKQAWHFEKKPILVVLDPQ  452



>ref|XP_011016134.1| PREDICTED: uncharacterized protein LOC105119666 [Populus euphratica]
Length=724

 Score =   230 bits (586),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 154/458 (34%), Positives = 247/458 (54%), Gaps = 28/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + + Q  PA
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQA-PA  83

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
              ++   E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  84    EME---EDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  140

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T +AFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E +   +     +  + 
Sbjct  141   AKLVLTLSAFALNYGEFWLLAQIYSSNDLAKSMAILRQLPRIMEQTGPLKLRFDAINNLI  200

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  201   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  247

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G D+  ST    E+STL HKLS +L  L+K +    Q I + +
Sbjct  248   -----ACAAQITSLTTMGHDFSISTTAAWELSTLAHKLSNLLDHLRKQLDTCYQYIDEKR  302

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  303   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  360

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W+   + +F  ++SS
Sbjct  361   ISGLDMSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWSDPMKGKFESMQSS  420

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  421   MPWFTVYHPSLIEKAVMRFIKEAWHFRNKPILVVLDPQ  458



>ref|XP_002526966.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35453.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score =   231 bits (588),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 173/515 (34%), Positives = 271/515 (53%), Gaps = 33/515 (6%)
 Frame = +1

Query  193   NPRSLTTYTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--  366
             NP +LTT    P+  +QQ   PA TT     +A   Q++     K  PA      +GD  
Sbjct  48    NP-ALTTMHQLPSAKMQQLTNPAPTTMHQLPSAKIQQLI-----KQTPASAHQLIKGDRL  101

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
               +SS++ AM   ++ATH  D   + VKPLL+++E+I  RA  TI           AR D
Sbjct  102   LFSSSDENAMTKQIQATHSPDGREFDVKPLLNIVENIFDRAAPTIESLALPAAAHQARPD  161

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
             A L++K  HS     +E+ ++   R + EI    SS  +AH+IT+S+L  L++Y WDAK 
Sbjct  162   A-LDDKTYHSSFMAMLESLSFVIDRVASEITYKCSSGGEAHAITMSILNTLSSYTWDAKL  220

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAFA  YG F L+A+ Y  + LAKS+A +  +PD+LE S   +    +   +  L 
Sbjct  221   VLALAAFAMTYGNFWLVAQNYTLNQLAKSMAILKHMPDILEHSSMLKP---RFDSIKHLI  277

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               ML +   I+  +E+  +  ++ V            +LS   A     +  + Y+ +++
Sbjct  278   MVMLAIAKCIVEFQELPPQYITIDVP-----------ALSAAIAH----LPISVYWTIRS  322

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+  I  L+ +G ++ +ST E  E+S+L HKLS +   LQ  +    + I + KH  
Sbjct  323   IVACASQITGLIGLGHEHIASTTEAWELSSLAHKLSNMQSHLQNQLGLCYKHIDERKHME  382

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN    + +I  ++D  P++ G     ++  +D+LRRK V LL+SD
Sbjct  383   TYQNLLRLFEMAHIDNMRVLKALIYSKDDIQPLLEGT--TKRRVNIDVLRRKNVLLLISD  440

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDI  + I++L  +Y ES+  PS+ ES++EIVWLPI D   P+      +F  ++S M W
Sbjct  441   LDITQDEISILEQIYNESRLHPSKQESRYEIVWLPIRDPAVPFNDNMLKKFQALQSGMTW  500

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +S+ HPS ID AV  ++    N  +KP+L V+D Q
Sbjct  501   YSIYHPSLIDRAVIKFIKEEWNFGKKPILVVLDPQ  535



>ref|XP_006369948.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
 gb|ERP66517.1| hypothetical protein POPTR_0001s35900g [Populus trichocarpa]
Length=722

 Score =   229 bits (583),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 154/458 (34%), Positives = 247/458 (54%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + + Q    
Sbjct  24    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQAH--  81

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A +E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  82    ---AEMEDKTSHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  138

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T +AFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  139   AKLVLTLSAFALNYGEFWLLAQIYSSNDLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  198

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  199   KV---MMDVARCMVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  245

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST +  E+STL HKLS IL  L+K +    Q I + +
Sbjct  246   -----ACAAQITSLTTMGHEFSISTTDAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKR  300

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  301   NVESFQMLKNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  358

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+P + +++L  +Y ES+    R ++Q+E+VW+PIVDR   W+   + +F  ++SS
Sbjct  359   ISGLDMPTDELSILEQIYNESRHHGPRLDNQYEVVWVPIVDRSVQWSDPMKGKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35452.1| conserved hypothetical protein [Ricinus communis]
Length=809

 Score =   229 bits (585),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 183/586 (31%), Positives = 296/586 (51%), Gaps = 59/586 (10%)
 Frame = +1

Query  1     KHTKLNLSSLLNPPKMAQTTINNTGRPMSESTTRATDTTP-----LVPRTAPNTPHNPVH  165
               T+ NL  L+NP       +NN   P   +  +  + TP     L+  T     H+P++
Sbjct  13    NQTQANLQQLMNPTPANTQQLNN---PTPSTLQQLANLTPANMQQLINSTPARMQHHPIN  69

Query  166   EIVPKATNLNPRSLTTYTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKI--IPA  339
                P  TN++         HP        + +T TN+     P  Q    +Q ++   PA
Sbjct  70    ---PTPTNMH---------HP--------INSTPTNM---QQPTKQTPTTMQQQLKQSPA  106

Query  340   GRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYV  513
                   +GD    +SS++ AM   ++ATH  D   + VKPLL+++EDI  RA  TI    
Sbjct  107   SAHQLIKGDRLLFSSSDENAMTKQIQATHSPDGREFDVKPLLNIVEDIFERAAPTIESLA  166

Query  514   QSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLK  693
                    AR + +L++K+ HS     +E+ ++   + + EI    S   DAH+ T+S+L 
Sbjct  167   LPAAGHQARPE-VLDDKIYHSSSMAMLESLSFIIEQIASEISYKCSGGGDAHATTMSILN  225

Query  694   LLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessrav  873
             +L++Y WDAK VI  AAF+  YGEF L+A+   ++ LAKSVA + Q+PD+LE    S  +
Sbjct  226   MLSSYTWDAKLVIALAAFSMTYGEFWLVAQNCTSNQLAKSVAILKQLPDILE---HSSML  282

Query  874   ssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI  1053
               +   V  L   ML +   I+  +++     ++ V            +LS   A     
Sbjct  283   KPRFDSVKSLIKVMLAIAKCIVEFQDLPPRYITMDVP-----------ALSTAMAH----  327

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
             +  + Y+ +++ V C+  I+ L+ +  ++ +ST E  E+S+L HKLS +   LQ  +   
Sbjct  328   LPISVYWTIRSIVACASQIIGLIGLAHEHIASTTEAWELSSLAHKLSNMQSHLQNQLGLC  387

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              + I + KH    + L       H DN    + +I  ++D  P++ G   + +   +D+L
Sbjct  388   YKHIDERKHMETYQNLIHLFDMAHIDNMRVLKALIYSKDDIQPLLEGTT-KRRVVNIDVL  446

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             RRK V LL+SDLDI  + I++L  +Y ES+  PS+ ESQ+EIVWLPI+D   P+      
Sbjct  447   RRKNVLLLISDLDITQDEISILEQIYNESRLYPSKQESQYEIVWLPILDPAVPFNDIMLK  506

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +F  ++S M W+S+ HPS ID AV  ++    N  +KP+L V+D Q
Sbjct  507   KFEALQSVMTWYSIHHPSLIDRAVITFVKEKWNFGKKPILVVLDPQ  552



>ref|XP_003633800.1| PREDICTED: uncharacterized protein LOC100244128 [Vitis vinifera]
Length=825

 Score =   229 bits (584),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 180/576 (31%), Positives = 287/576 (50%), Gaps = 55/576 (10%)
 Frame = +1

Query  79    PMSESTTRATDTTPLVPRTAPNTPHNPVHEIVPKATNLNPRSLTTY-TPHPAY-------  234
             P+ +   + ++  P+ P   P TP +P     P    LNP  L     P P +       
Sbjct  11    PLQQMPNKLSNPNPMQPAINP-TPMHPAINPTPMQQLLNPTPLQQLLNPTPLHQLMKPSA  69

Query  235   --------PVQQAYMPATTTNVVSATAPPSQVVAP------LQAKI--IPAGRGIRKRGD  366
                     P QQA  P+T    V+ +    Q V P      L  KI  +P  + IR    
Sbjct  70    MQQLINPSPGQQAVNPSTGQQAVNPSTG-QQAVNPTPMHHELTTKINPVPLHQLIRHDRS  128

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
              +  S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D
Sbjct  129   MITMSDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD  188

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                 ++   +     +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK 
Sbjct  189   ----DRTNQASFIALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFDLLTSYSWEAKL  244

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+T +AFA  YGEF LLA++Y ++ LAKS+A + Q+P +LE S   +    +   +  L 
Sbjct  245   VLTLSAFAVNYGEFWLLAQIYSSNQLAKSMAILKQVPIILEHSGQLKP---RFDALNNLI  301

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               M+ +T  II  KE+ S   S  V               P  A     +  A Y+ +++
Sbjct  302   RAMVAITRCIIEFKELPSMYISQDV---------------PALATAMTHIPTAVYWTIRS  346

Query  1087  avTCSLVILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHT  1263
              V C+  I  L ++G +Y++S   E  E+ST+ HK++ IL  L+K +    Q I    + 
Sbjct  347   VVACATQITTLTSMGHEYWTSATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKWNA  406

Query  1264  IKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
                ++L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S
Sbjct  407   ETFQMLLNLFESIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLIS  464

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
              L I ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MP
Sbjct  465   GLSISHDELSILEQIYNESRVHGTRMESQYEVVWIPVVDRSVMWTDAMQDRFETLQATMP  524

Query  1624  WFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             W+SV  P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  525   WYSVYTPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  560



>ref|XP_010912936.1| PREDICTED: uncharacterized protein LOC105038753 [Elaeis guineensis]
Length=707

 Score =   228 bits (580),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 163/461 (35%), Positives = 249/461 (54%), Gaps = 34/461 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             I+      ASS+D  +M  V ATH  D      +PL  LI+DI+ R+  T+      V T
Sbjct  20    IKGERHLFASSDDNIVMKQVLATHSPDGREVDARPLFQLIQDILQRSTPTV------VVT  73

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 ++A+ E++  H  +   +EA AY  +R S E+I   +S  DAH+ TLS+  +L++Y
Sbjct  74    PQTHMEAV-EDRAHHPAVAGMLEALAYTIHRISSEMIYKCTSGSDAHATTLSLFNMLSSY  132

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF L A+L+   PLAKSV+ + Q+PD++E ++  +    +  
Sbjct  133   TWDAKVVLVLAAFAVDYGEFWLTAQLHTVHPLAKSVSLLKQVPDIIEHTDVLKP---RFD  189

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   ML+VT+ II  KE+ SE  S                 SP  A     +  A+
Sbjct  190   TINNLIKAMLDVTNCIIEFKELPSEYISPD---------------SPDMAMAMAHIPTAA  234

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ V++AV C+  I  L+ +G +Y SST E  E+S+L HK++ I G L K +    + I 
Sbjct  235   YWAVRSAVACATQITMLIGLGHEYMSSTTEAWELSSLAHKVNNIHGHLTKQLDLCQKHID  294

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + KH    + L       H DN    + ++   +D  P+I G     K+ G+D+LRRK V
Sbjct  295   EKKHIEAYQTLVRLFQAVHIDNMKILKALLYSRDD-LPLIDGTS--KKRVGVDVLRRKIV  351

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              L +SDLD+ +E + +L  +Y ++ Q   R E  FEIVWLP++DR  PW   KE+ +  +
Sbjct  352   MLFISDLDVAHEELLVLVQIYSDTHQ--GRLERHFEIVWLPVLDRHLPWNTTKEETYNRL  409

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              S MPW+ +  P ++D AV  Y+    +  +KP+L V+D Q
Sbjct  410   ASMMPWYLLHDPLQVDAAVIKYIRDVWHIEKKPMLVVLDPQ  450



>ref|XP_011014801.1| PREDICTED: uncharacterized protein LOC105118522 isoform X2 [Populus 
euphratica]
Length=722

 Score =   227 bits (578),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 247/458 (54%), Gaps = 30/458 (7%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKSLDGTDAHATTVSLFSMLPSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A     V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEV---AALSTAMAHIPIAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+S+L HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSSLAHKLSNILDHLRKQLDTCYQHIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+ N+ +++L  +Y ES+   +R +SQ+E+VW+PIVD RS  +   +++F  ++SS
Sbjct  360   ISGLDMSNDELSILEQIYNESRHHEARLDSQYEVVWIPIVD-RSVQSDPMKEKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_007044877.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY00709.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score =   226 bits (577),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 155/455 (34%), Positives = 247/455 (54%), Gaps = 28/455 (6%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
             F ++S   A+   + A HD   +H  +KP+L ++EDI  RA     G VQ    Q   +D
Sbjct  16    FSSASGGKAIGKQIEAIHDPAGIHTSMKPVLDIVEDIFRRAAPPGRGTVQEAHMQ---VD  72

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
             A  +E+ +HS  +E I+  +    R S EI    S   DAH+ TL+V  ++ +Y WDAK 
Sbjct  73    AS-DERALHSSADELIDYLSAIINRISCEIAYRLSIGEDAHATTLAVAHVVRSYSWDAKV  131

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAFA  YGEF L+ +LY T+PLAK VA + Q+P++L     +  + +K   +A L 
Sbjct  132   VLALAAFAMSYGEFLLIVQLYTTNPLAKGVALLKQLPEVL---ARADLLKTKFDTLANLI  188

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
             + M  V   +I  KE+ S+  S +                P  +   + +  A Y+ +++
Sbjct  189   NAMHCVAKCVIEFKELPSQYISPE---------------DPELSSANSDIPSAVYWTIRS  233

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+  I+ L+ +G ++ SST +  E+S+L H +  I  DL + +++  Q I + K   
Sbjct  234   TVVCASQIIGLIGMGHEFVSSTTDAWELSSLAHNIDSICSDLMEKLKRCRQRINERKDIE  293

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN    + +I  ++D  P+  G     +K  +D+LRR+ V L +SD
Sbjct  294   AYQTLLRLFDAVHIDNMKILKALIYAKDDQLPLWDGT--TKQKVSIDLLRRRTVLLFISD  351

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             L+IP++ I +L  MY ES+  P+R ESQ+E++W+P+VDR  P+   K +QF  +K+ MPW
Sbjct  352   LEIPHDDILILEQMYNESQAHPTRVESQYEVIWIPVVDRSVPFDDTKREQFESLKAMMPW  411

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +SVSHPS I  AV   +    +  +KPL+ V+D Q
Sbjct  412   YSVSHPSMIQPAVIRCIKEVWDFSKKPLVVVLDPQ  446



>ref|XP_006369945.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
 gb|ERP66514.1| hypothetical protein POPTR_0001s35850g [Populus trichocarpa]
Length=722

 Score =   226 bits (577),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 248/458 (54%), Gaps = 30/458 (7%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKSLDGTDAHATTVSLFNMLPSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+S+L HKLS IL  L+  +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSSLAHKLSNILDHLKTQLATCYQHIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFRMLKNLFEMVHIDNMKILKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+ N+ +++L  +Y ES+   +R ESQ+E+VW+PIVD RS  + A +++F  ++SS
Sbjct  360   ISGLDMSNDELSILEQIYNESRPHEARLESQYEVVWVPIVD-RSVQSDAMKEKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPW++V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWYTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_011014800.1| PREDICTED: uncharacterized protein LOC105118522 isoform X1 [Populus 
euphratica]
Length=722

 Score =   226 bits (577),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 247/458 (54%), Gaps = 30/458 (7%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATLQIDSSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKSLDGTDAHATTVSLFSMLPSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A     V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEV---AALSTAMAHIPIAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+S+L HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSSLAHKLSNILDHLRKQLDTCYQHIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+ N+ +++L  +Y ES+   +R +SQ+E+VW+PIVD RS  +   +++F  ++SS
Sbjct  360   ISGLDMSNDELSILEQIYNESRHHEARLDSQYEVVWIPIVD-RSVQSDPMKEKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_011014132.1| PREDICTED: uncharacterized protein LOC105117991 [Populus euphratica]
Length=723

 Score =   226 bits (576),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 154/458 (34%), Positives = 246/458 (54%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLL L+EDI+ RA   I   + + Q Q  
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDSSLTTSQAQ--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A +E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AEMEDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++  ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQISSSNQLAKSMAILKQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTIRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST +  E+STL HKLSYIL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTDAWELSTLAHKLSYILDHLRKQLDTCYQYIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S L++  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W    +++F  ++SS
Sbjct  360   ISGLEMSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWNDPMKEKFESMQSS  419

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HP  I++AV  ++    + R KP+L V+D Q
Sbjct  420   MPWFTVYHPLLIEKAVIRFIKEVWHFRNKPILVVLDPQ  457



>ref|XP_006369946.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
 gb|ERP66515.1| hypothetical protein POPTR_0001s35860g [Populus trichocarpa]
Length=722

 Score =   226 bits (576),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 248/458 (54%), Gaps = 30/458 (7%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKSLDGTDAHATTVSLFNMLPSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARFVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+S+L HKLS IL  L+  +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSSLAHKLSNILDHLKTQLATCYQHIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFRMLKNLFEMVHIDNMKILKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+ N+ +++L  +Y ES+   +R ESQ+E+VW+PIVD RS  + A +++F  ++SS
Sbjct  360   ISGLDMSNDELSILEQIYNESRPHEARLESQYEVVWVPIVD-RSVQSDAMKEKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPW++V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWYTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_011014351.1| PREDICTED: uncharacterized protein LOC105118161 [Populus euphratica]
Length=722

 Score =   225 bits (574),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 246/458 (54%), Gaps = 30/458 (7%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AELEDKTHQINFVSMLDALSYTIDRISCEIAYKSLDGTDAHATTVSLFNMLTSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A     V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPIAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+S+L HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSSLAHKLSNILDHLRKQLDTCYQHIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+ N+ +++L  +Y ES+    R +SQ+E+VW+PIVD RS  +   +++F  ++SS
Sbjct  360   ISGLDMSNDELSILEQIYNESRHHEGRLDSQYEVVWIPIVD-RSVQSDPMKEKFESMQSS  418

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  419   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  456



>ref|XP_002298572.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
 gb|EEE83377.2| hypothetical protein POPTR_0001s35880g [Populus trichocarpa]
Length=723

 Score =   224 bits (572),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 155/458 (34%), Positives = 248/458 (54%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM+ +  TH  D     VKPLL L+EDI+ RA   I     S+ T  A
Sbjct  25    RGSMLTMSDDNVMMNQIVGTHAPDGREVDVKPLLLLVEDILKRATLQIDS---SLTTSKA  81

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A +E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  82    H--AEMEDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T +AFA  YGEF LLA++  ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLSAFALNYGEFWLLAQISSSNQLAKSMAILRQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTMRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L   G ++ +ST +  E+STL HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTKGHEFSTSTTDAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+  + +++L  +Y ES+   +R +SQ+E+VW+PIVDR   W+   + +F  ++SS
Sbjct  360   ISGLDMSTDELSILEQIYNESRHHGARLDSQYEVVWVPIVDRSVQWSDPMKQKFESMQSS  419

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  420   MPWFTVYHPSLIEKAVMRFIKEVWHFRNKPILVVLDPQ  457



>ref|XP_008793697.1| PREDICTED: uncharacterized protein LOC103709939 [Phoenix dactylifera]
Length=712

 Score =   224 bits (570),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 159/461 (34%), Positives = 245/461 (53%), Gaps = 34/461 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             I+      +SS+D  +M     TH  D     V+ LL+LIEDIM RA    P  +++  T
Sbjct  25    IKGERHLFSSSDDNIVMKQTLETHSPDGREVDVRSLLYLIEDIMQRA---TPAILETPHT  81

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                    ++E++  H+ +   +EA AYP +R + EI    +S  DAH+ T+++L  L+NY
Sbjct  82    HME----VMEDRAHHAAVVGMLEALAYPIHRIAAEITYKCTSGGDAHATTIALLHTLSNY  137

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK ++  AAFA  YGEF L A+L+  +PLAKSV+ + Q+PD+ E +   +    +  
Sbjct  138   AWDAKVILVLAAFAVTYGEFWLTAQLHTINPLAKSVSLLKQLPDIFEHTHLLKP---RFD  194

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   M++VT  I+  KE+ SE  S +               SP  +     +  A 
Sbjct  195   AINNLIKAMVDVTKCIVEFKELPSEYISPE---------------SPDMSMAMTHIPTAV  239

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V CS  I+ L+ +G +Y SST E  E+S+L HK+S I   L K +      I 
Sbjct  240   YWTIRSIVACSSQIIMLVGLGHEYISSTTEAWELSSLAHKVSNIHRHLTKQLALCHHHID  299

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + KH    + L       H DN      ++  ++D  P+    G   K+ G+D+LRRK V
Sbjct  300   EKKHIETYQTLARLFEVAHLDNLKILRALMQSKDD-LPL--SDGTRKKRVGVDMLRRKIV  356

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              L +SDLDIP E + +L  +Y ++ Q   + E  +EIVWLP++DR  PW   +E+ F  +
Sbjct  357   MLFISDLDIPQEELLVLVQIYNDTHQ--GKLERPYEIVWLPVIDRHVPWNSGREETFNRL  414

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              S MPW+ + HPS +D AV  Y+    +  +KPLL V+D Q
Sbjct  415   ASMMPWYLMHHPSLLDRAVIKYIRDVWHFEKKPLLVVLDPQ  455



>ref|XP_011010496.1| PREDICTED: uncharacterized protein LOC105115342 [Populus euphratica]
Length=713

 Score =   224 bits (570),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 154/461 (33%), Positives = 249/461 (54%), Gaps = 31/461 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             IR     +  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA         S+ T
Sbjct  22    IRSDRSMITMSDDNVMMKQIVETHAPDGREVDVKPLLHLVEDILKRATLQTD---TSLTT  78

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A  ++  E+K  H+     +++ ++   R S EI   Y    D H+ T+ +  +LA+Y
Sbjct  79    SQAHAES--EDKTNHANFAVMLDSLSHTIDRISCEI--AYKGGADGHATTVELFNMLASY  134

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P++LE S   +     L 
Sbjct  135   SWDAKLVLTMAAFALNYGEFWLLAQIYSSNQLAKSMAILKQLPNILEHSGPLKPRFDALN  194

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K+   M++VT  ++  K++     S +V    +L   +A   + V     +++    
Sbjct  195   YLIKV---MMDVTRCVVEFKDLPPTYISHEVS---ALSAAMAHVPTAVYWTVRSVL----  244

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
                      C+  I +L  +G ++  ST +  E+STL HKLS IL  L+K +    Q I 
Sbjct  245   --------ACADQITSLTTMGYEFSISTTKAWELSTLAHKLSNILEHLRKQLATCYQYID  296

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + +H    ++L       H DN    + +I  ++D  P+I G+    ++  LD+LRRK V
Sbjct  297   EKRHVEAYQMLLNLFEMIHVDNMKVLKALIYAKDDIQPLIDGSN--KRRVHLDVLRRKNV  354

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+S LDI N+ +++L  +Y ES+   +R +SQ+++VW+PI D    WT   +++F  +
Sbjct  355   LLLISGLDISNDELSILEQIYNESRHHGTRLDSQYDLVWIPITDHSIQWTDPLKEKFESL  414

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++SMPW++V HPS ID+A   ++    + R KP+L V+D Q
Sbjct  415   QNSMPWYTVYHPSLIDKAAIRFIKEVWHFRNKPILVVLDPQ  455



>ref|XP_011013686.1| PREDICTED: uncharacterized protein LOC105117652 [Populus euphratica]
Length=723

 Score =   223 bits (569),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 245/458 (53%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA   I   + + Q    
Sbjct  25    RGTMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLHLVEDILKRATQQIDTSLTTSQAH--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A LE+K         ++A +Y   R S EI        DAH+ T+S+  +L++Y WD
Sbjct  83    ---AELEDKTHQVNFVSMLDALSYTIDRISCEIAYKALGGTDAHATTVSLFNMLSSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T +AFA  YGEF LLA++  ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLSAFALNYGEFWLLAQISSSNQLAKSMAILRQLPRIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTVRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST    E+STL HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTVAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LD+  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W+   +++F  ++ S
Sbjct  360   ISGLDMSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWSDPMKEKFESMQYS  419

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HPS I++AV  ++    + R KP+L V+D Q
Sbjct  420   MPWFTVYHPSLIEKAVIRFIKEVWHFRNKPILVVLDPQ  457



>ref|XP_003633822.1| PREDICTED: uncharacterized protein LOC100249294 [Vitis vinifera]
Length=752

 Score =   223 bits (568),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 161/503 (32%), Positives = 265/503 (53%), Gaps = 33/503 (7%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVVAPLQA-KI--IPAGRGIRKRGDFLASSEDTAMMDH  405
             P+QQ   P+     ++  AP  QV+ P +  KI  +P  + I+     +  S+D  M+  
Sbjct  10    PMQQVNNPSPMQQAINP-APLQQVLKPAETTKINPVPLQKLIKHDRSMITMSDDNMMVKQ  68

Query  406   VRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLN  585
             + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    ++   +   
Sbjct  69    IHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----DRTNQASFI  124

Query  586   EAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGE  765
               +EA ++   R S EI        DAH++TLS+  LL +Y W+AK V+T +AFA  YGE
Sbjct  125   ALLEALSFTIDRISCEIAYKSLGGGDAHAMTLSIFNLLTSYSWEAKLVLTLSAFAVNYGE  184

Query  766   FGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIAL  945
             F LLA++  ++ LAKS+A + Q+P +LE S   +     L  + +    M+ +T  II  
Sbjct  185   FWLLAQISSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMVAITRCIIEF  241

Query  946   KEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLA  1125
             KE+ S   S  V               P  A     +  A Y+ +++ V C+  I    +
Sbjct  242   KELPSMYISQDV---------------PALATAMKHIPTAVYWTIRSVVACATQITTFTS  286

Query  1126  VGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART  1302
             +G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    ++L       
Sbjct  287   MGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQMLLNLFESI  346

Query  1303  HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLR  1482
             H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I ++ +++L 
Sbjct  347   HIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSISHDELSILD  404

Query  1483  HMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA  1662
              +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV  P+ ID+A
Sbjct  405   QIYNESRVHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSVYTPTLIDKA  464

Query  1663  VYGYL----N*RRKPLLAVVDTQ  1719
             V  ++    + R KP+L V+D Q
Sbjct  465   VIRFIKEVWHFRNKPILVVLDPQ  487



>ref|XP_006848934.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
 gb|ERN10515.1| hypothetical protein AMTR_s00166p00029650 [Amborella trichopoda]
Length=695

 Score =   222 bits (565),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 162/459 (35%), Positives = 248/459 (54%), Gaps = 35/459 (8%)
 Frame = +1

Query  355   KRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQP  534
             +R  F+AS +D A+M  + ATH  D     VKPL+ ++EDI+   H TI   V      P
Sbjct  11    ERHLFIAS-DDAAVMKQILATHSPDGREIDVKPLVQIVEDILK--HTTITTVVH-----P  62

Query  535   ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
                  +LE+K     +   +EA AY  +R S EI    S   DAH+ TL++   L+NY W
Sbjct  63    QTTVELLEDKAHTERMIGMLEALAYTIHRISCEITCKCSGAGDAHATTLTLFNSLSNYSW  122

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             DAK V+  AAFA  YGEF L A+    + LAKS++ + Q+PDL E +E+ +     L  +
Sbjct  123   DAKVVLVVAAFATSYGEFWLTAQQSTVNHLAKSLSLLKQLPDLFEHTEALKPRFEALNAL  182

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
              K    ML+VT  II  KE       L V+Y          + +P        +  A+Y+
Sbjct  183   VK---AMLDVTKCIIEFKE-------LPVEY--------INADTPAMTTAMKHIPTAAYW  224

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
              +++AV C+  ++ L+ +G DY  ST E  E+S+L HK++ I G L+K ++   Q I + 
Sbjct  225   TIRSAVACATQVIGLIGMGHDYAISTSETWELSSLAHKVNNIHGHLRKQLEYCNQHIDER  284

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFL  1434
             ++      L+      H DN+     + C   D TP+  GA    +K  +D+LRRK V L
Sbjct  285   RNVEAYHSLQRLFEMIHIDNQKILRALFCS-RDETPLRDGAS--QRKVSVDVLRRKLVIL  341

Query  1435  LVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
              VSDL+I +E + +L  +Y ++    S+ +  +E+VW+P+VDR +PW  AKE  F  + +
Sbjct  342   FVSDLEIAHEELLVLMQIYNDTHH--SKTDRTYEVVWVPMVDRTAPWNEAKETAFNHLAN  399

Query  1615  SMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              MPWFS+ HPS ++ AV+ Y+    +  +KP+L V+D Q
Sbjct  400   QMPWFSLHHPSSLEPAVWRYIKEVWHFEKKPILVVLDHQ  438



>ref|XP_009415984.1| PREDICTED: uncharacterized protein LOC103996731 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score =   222 bits (565),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 163/461 (35%), Positives = 253/461 (55%), Gaps = 38/461 (8%)
 Frame = +1

Query  358   RGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             +GD    A S+D+ ++  + ATH  D       PLL L+EDI+ RA  T+      + T 
Sbjct  16    KGDRHLYAKSDDSVVVKQILATHSPDGRDIDTMPLLKLVEDILQRATPTV------IVTP  69

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
              A L+ ++E+K  H  +   +EA AY  ++ S E+    S   D H+ TLS+   L+NY 
Sbjct  70    QAHLE-LVEDKAHHLEVVGMLEALAYTIHKISCELTCKCSGGGDGHATTLSLFNSLSNYS  128

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK VI  AAFA  YGEF L A+L+  +PLAKSVA + Q+PD+LE +E+ +     L  
Sbjct  129   WDAKVVIALAAFAVSYGEFWLTAQLHTVNPLAKSVALLKQLPDILEHTEALKPRFDALNN  188

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakas  1068
             + K    M++VT  I+  KE+ SE       Y      ++A +L+ + TA    I     
Sbjct  189   LIK---AMVDVTKCIVQFKELPSE-------YISPDAPDMAMALAHIPTAVYWTI-----  233

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
                 ++ V C+  I++L+ +G ++ SST E  E+S+L HKLS I   L K ++   + IG
Sbjct  234   ----RSVVACASQIISLIGLGHEHVSSTSEAWELSSLAHKLSNIHDHLTKQLELCYRHIG  289

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + K+    + L       H DN    + ++  ++D  P++ G     ++  +D+LRRK V
Sbjct  290   EKKNIEAYQTLVHLFQTVHIDNMKILKALMYSKDD-LPLVDGT--TKRRVSVDVLRRKIV  346

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              L +SDLDI  E + +L  +Y ++ Q   + E  +EIVWLPI+DR  PW GAKE+ F  +
Sbjct  347   MLFISDLDISQEELFVLIQIYSDTHQ--GKIERHYEIVWLPIIDRHVPWGGAKEETFNRL  404

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              S MPW+S+ HPS ++  V  Y+    +  ++P+L V+D Q
Sbjct  405   ASMMPWYSLHHPSLLEPPVIKYIRDVWHFDKRPMLVVLDPQ  445



>ref|XP_002324001.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
 gb|EEF04134.2| hypothetical protein POPTR_0017s10720g [Populus trichocarpa]
Length=716

 Score =   222 bits (566),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 153/461 (33%), Positives = 247/461 (54%), Gaps = 31/461 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             IR     +  S+D  MM  +  TH  D     VKPLLHL+EDI+ RA         S+ T
Sbjct  22    IRSDRSMITMSDDNVMMKRIVETHAPDGREVDVKPLLHLVEDILKRATLQTD---TSLTT  78

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A  ++  E+K  H+     +++ +Y   R S EI   Y    D H+ T+ +  +LA+Y
Sbjct  79    SQAHAES--EDKTNHASFAVMLDSLSYTIDRISCEI--AYKGGADGHATTVELFNMLASY  134

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+T AAFA  YGEF LLA++Y ++ LAKS+A + Q+P++LE S   +     L 
Sbjct  135   SWDAKLVLTLAAFALNYGEFWLLAQIYSSNQLAKSMAILKQLPNILEHSGPLKPRFDALN  194

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K+   M++VT  ++  K++     S +V    +L   +A   + V     +++    
Sbjct  195   NLIKV---MMDVTRCVVEFKDLPPTYISHEVS---ALSAAMAHVPTAVYWTVRSVL----  244

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
                      C+  I +L  +G ++  ST +  E+STL HKLS IL  L++ +    Q I 
Sbjct  245   --------ACAAQITSLTTMGYEFSISTTKAWELSTLAHKLSNILEHLRRQLATCYQYID  296

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + ++    ++L       H DN    + +I  ++D  P+I G+    ++  LD+LRRK V
Sbjct  297   EKRNVEAYQMLLNLFEMIHIDNMKVLKALIYAKDDIQPLIDGSN--KRRVHLDVLRRKNV  354

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+S LDI N+ + +L  +Y ES    +R +SQ+++VW+PI D    WT   +++F  +
Sbjct  355   LLLISGLDISNDELAILEQIYNESSHHGTRLDSQYDLVWIPITDHSVQWTDPLKEKFESL  414

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++SMPW++V HPS ID+A   ++    + R KP+L V+D Q
Sbjct  415   QNSMPWYTVYHPSLIDKAAIRFIREVWHFRNKPILVVLDPQ  455



>ref|XP_010044527.1| PREDICTED: uncharacterized protein LOC104433471 [Eucalyptus grandis]
 gb|KCW86613.1| hypothetical protein EUGRSUZ_B03241 [Eucalyptus grandis]
Length=699

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 247/454 (54%), Gaps = 31/454 (7%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
              +SS+D+AM+  +++TH  D     V  LLH+IE I  RA              P  LD 
Sbjct  17    FSSSDDSAMLKQIQSTHSPDGREVDVTYLLHIIEVIFERAKPFSTHETHQAAQPP--LD-  73

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
             ILE++     L E +E  A+   + S E+        DAH+ T+++  +L NY WDAK V
Sbjct  74    ILEDR----DLREMLELLAHTINKISCEMACKCMGGGDAHATTVNIFNILTNYSWDAKVV  129

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +  AAF+  YGEF +LA+LYPT+ LAK+VA + Q+P+ LE  ++ +    K   +  L  
Sbjct  130   LALAAFSVNYGEFWMLAQLYPTNYLAKAVAILKQLPETLERVDALKP---KFDALTSLVT  186

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              M+++T  II  +++ S+  S             A  L   TA     +  A+Y+++++ 
Sbjct  187   AMVDLTKCIIEFRQLPSQYISPD-----------ATELLTATAH----IPTAAYWIIRSI  231

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V C+  I NL+ +  +Y +ST E  E+S+L HK++ I   L+K +    Q I + K+   
Sbjct  232   VACASQITNLIGMSHEYIASTAEAWELSSLAHKINSIYTHLKKQLDLCYQLINEKKYLEA  291

Query  1270  RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDL  1449
              + +    A  H DN    + +I   +D  P++ G+    K+  LD+LRRK V L +SD+
Sbjct  292   FEKIVHLFATPHVDNMKVLQALIYARDDQLPLLDGST--KKRASLDVLRRKNVLLFISDI  349

Query  1450  DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWF  1629
             D+P + + +L  MY E+KQ P+R ES +EIVW+P++DR +PW   K+ +F  ++  M W+
Sbjct  350   DLPLDELLVLEQMYQEAKQAPTRMESHYEIVWIPVMDRSTPWDEEKQKKFETLQGMMTWY  409

Query  1630  SVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             SV HPS ID AV  Y+       +K +L V+D Q
Sbjct  410   SVFHPSLIDAAVIKYIKEVWKFNKKAMLVVLDPQ  443



>gb|KDP46373.1| hypothetical protein JCGZ_10213 [Jatropha curcas]
Length=718

 Score =   221 bits (562),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 154/472 (33%), Positives = 258/472 (55%), Gaps = 37/472 (8%)
 Frame = +1

Query  334   PAGRG------IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA  495
             P+G G      I+     LA S++ +M+  ++ATH  D   + V+PLL++++DI+ RA  
Sbjct  9     PSGSGGLSQQLIKGDRSMLALSDENSMLKQIQATHAPDGREFDVRPLLNIVDDILSRATL  68

Query  496   TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSI  675
                  +   QT      A +++K   +     +EA ++   R + EI     S  DAH+ 
Sbjct  69    HGDSALMVNQTH-----AEVDDKNRQANFIAMLEALSFVIDRIASEISYKALSGADAHAT  123

Query  676   TLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEss  855
             TLS+  +L++Y WDAK V+T AAFA  YGEF LLA++Y ++PLAKS+A + Q+P +LE +
Sbjct  124   TLSLFNMLSSYSWDAKVVLTMAAFALNYGEFWLLAQIYSSNPLAKSMAILKQLPVILEHT  183

Query  856   essravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVT  1035
                +    +   +  L   M++VT  I+  KE+ S   S +V    +L   +A   + V 
Sbjct  184   GPLKP---RFDALNNLISVMMDVTKCIVEFKELPSSYISSEVP---ALSTAIAHIPTAVY  237

Query  1036  AEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
                 +++             C+  I NL  +G ++  +T E  E+STL HKL  IL  L+
Sbjct  238   WTMRSVV------------ACATQITNLTTMGHEF--ATTEAWELSTLAHKLQNILEHLR  283

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKK  1395
             K +    Q I + ++    + L       H DN    + +I  ++D  P++ G+    ++
Sbjct  284   KQLSICYQHIEEKRNVEAYQALLNLFDTIHIDNMKILKALIYAKDDIQPLVDGST--KRR  341

Query  1396  HGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPW  1575
               +D+LRRK V LL+S LDI ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR  P+
Sbjct  342   VNVDVLRRKNVLLLISGLDISHDELSILEQIYNESRIHATRLESQYEVVWVPVVDRTVPY  401

Query  1576  TGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             T A   QF  +++ MPW++V HP+ I++ V  ++    + RR+P+L V+D Q
Sbjct  402   TDAMHKQFESLQTVMPWYTVYHPTLIEKVVIRFIKEVWHFRRRPILVVLDPQ  453



>ref|NP_001240968.1| uncharacterized protein LOC100799626 [Glycine max]
 gb|ADN32787.1| sieve element occlusion e [Glycine max]
Length=703

 Score =   220 bits (561),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 153/469 (33%), Positives = 249/469 (53%), Gaps = 30/469 (6%)
 Frame = +1

Query  328   IIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             ++P     R      ++S+DT M  ++RATH     H  V+PLLH+++DI  RA + IPG
Sbjct  3     MVPRKMQSRPSRHIFSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPG  62

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
              VQ  Q Q   +DA +++    S L   I+   +   + S EI    SS  D H+ T+ +
Sbjct  63    IVQGKQVQ---MDA-MKDSAYQSDLANVIDISYHTINKISCEICCKCSSGGDVHATTMGI  118

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
             L +L++Y WDAK VI  AAFA  +GEF L+A+LY T+ LAKSVA +  I + LE      
Sbjct  119   LGMLSSYSWDAKVVIALAAFAANFGEFWLVAQLYATNRLAKSVAKLKHIHETLE---QVD  175

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
              +  K + V  L   ML+VT+ I+   E+ S               +  +  +P      
Sbjct  176   DLGPKFQTVNNLLKAMLDVTNNIVQFHELPS---------------QYIDPEAPEMLTAS  220

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
             N++  A Y+ +++ V+C+  IL +  +G+ Y +ST E  E+S+L HKL  I   L+K + 
Sbjct  221   NLIPGAVYWTIRSIVSCASHILGITGLGQGYMTSTTETWELSSLAHKLDNINSHLRKQLT  280

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                Q +   +       L       H DN    + + C ++DP P+  G+    ++  ++
Sbjct  281   VCRQHLDDNRQREAFATLRLLFETPHQDNSKVLKAMFCSKDDPLPLFDGSS--KQRVSIE  338

Query  1408  ILRRKYVFLLVSDL-DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             +LRRK V L ++D+ ++P++ + +   MY ES+QD +R ESQ+E+VW+P+VD+  PW   
Sbjct  339   VLRRKIVLLYITDVHNVPDQELVIFEQMYQESRQDSTRLESQYELVWIPVVDKAIPWNDV  398

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             K  +F  ++S M  +S+  PS ++ A   Y+      + KP+L V+D Q
Sbjct  399   KP-KFEKLQSMMSCYSLYDPSLLEPATIRYIKEVWLFKTKPILVVLDPQ  446



>ref|XP_010660832.1| PREDICTED: uncharacterized protein LOC100268167 [Vitis vinifera]
Length=743

 Score =   221 bits (562),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 162/503 (32%), Positives = 261/503 (52%), Gaps = 42/503 (8%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVVAPLQA-KI--IPAGRGIRKRGDFLASSEDTAMMDH  405
             P+QQ   PA          P  QV+ P +  KI  +P  + I+     +  S+D  M+  
Sbjct  10    PMQQVINPA----------PLQQVLKPSETTKINPVPLQQLIKHDRSMITMSDDNIMVKQ  59

Query  406   VRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLN  585
             + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    ++   +   
Sbjct  60    IHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----DRTNQASFI  115

Query  586   EAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGE  765
               +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK V+T +AFA  YGE
Sbjct  116   ALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFNLLTSYSWEAKLVLTLSAFAVNYGE  175

Query  766   FGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIAL  945
             F LLA++Y ++ LAKS+A + Q+P +LE S   +     L  + +    M+  T  II  
Sbjct  176   FWLLAQIYSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMVASTRCIIEF  232

Query  946   KEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLA  1125
             KE+ S   S  V               P  A     +  A Y+ +++ V C+  I    +
Sbjct  233   KELPSMYISQDV---------------PALATAMTHIPTAVYWTIRSVVACATQITTFTS  277

Query  1126  VGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART  1302
             +G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    ++L       
Sbjct  278   MGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQMLLNLFDSI  337

Query  1303  HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLR  1482
             H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I ++ +++L 
Sbjct  338   HIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSISHDELSILE  395

Query  1483  HMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA  1662
              +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV  P+ ID+A
Sbjct  396   QIYNESRVHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSVYTPTLIDKA  455

Query  1663  VYGYL----N*RRKPLLAVVDTQ  1719
             V  ++    + R KP+L V+D Q
Sbjct  456   VIRFIKEVWHFRNKPILVVLDPQ  478



>ref|XP_007159683.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
 gb|ESW31677.1| hypothetical protein PHAVU_002G258300g [Phaseolus vulgaris]
Length=702

 Score =   220 bits (560),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 152/467 (33%), Positives = 254/467 (54%), Gaps = 31/467 (7%)
 Frame = +1

Query  328   IIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             ++P     R   +  ++S+DT M  +VRATH  D  H +V+PLL++++DI+ R  + IP 
Sbjct  3     MVPRKMQSRATRNIFSASDDTTMTKNVRATHAPDDRHVEVRPLLNVVQDILHRVASLIPD  62

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
              VQ    +P +  A+ E+    S L E ++   Y   + S EI    SS  D H+ T+ +
Sbjct  63    IVQG---KPVQTGAV-EDSNHQSDLAEVLDISYYTINQISCEICCKCSSG-DGHATTMGI  117

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
             L +L+ Y WDAK VI  AAFA  +GEF L+A+LY T+ LAKSVA +  I + LE      
Sbjct  118   LSMLSGYSWDAKVVIALAAFAANFGEFWLVAQLYATNRLAKSVAKLKHIHETLE---QVD  174

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
              +  K   +  L   ML+VT+ I+   E+ S       +Y   ++ E  E L+       
Sbjct  175   DLGLKFETINNLFKAMLDVTNYIVQFHELPS-------RY---IHPEAPEMLTASI----  220

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
              +   A Y+ +++ + C+  +L++  +   Y ++  E  E+S+L HKL  + G L+K + 
Sbjct  221   -LFPGAVYWTIRSILFCASHLLDITGLAHGYMTTITESWELSSLAHKLDNLNGHLRKQIT  279

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                  +   K     + L+     +H DN  + + + C  NDP P+  G+    ++  ++
Sbjct  280   LCHLHLDDNKQREAFETLQLLFETSHQDNLKALKAMFCSNNDPLPLFDGSS--KQRVSIE  337

Query  1408  ILRRKYVFLLVSDL-DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             +LRRK V L +SDL ++ ++ + +   MY+ES+QD +R ESQ+E+VW+P+VD+  PWT  
Sbjct  338   VLRRKIVLLYISDLQNVSDQELVIFEQMYIESRQDSTRLESQYELVWIPVVDKGIPWTEL  397

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVD  1713
             K  +F +V+S+M W+SV  P+ ++ A   Y+      + KP+L V+D
Sbjct  398   KP-KFDMVQSTMSWYSVYDPTALEPATIRYIKEVWLFKAKPILVVLD  443



>gb|KHN29013.1| hypothetical protein glysoja_008348 [Glycine soja]
Length=696

 Score =   219 bits (559),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 245/455 (54%), Gaps = 30/455 (7%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
              ++S+DT M  ++RATH     H  V+PLLH+++DI  RA + IPG VQ  Q Q   +DA
Sbjct  10    FSASDDTTMTKNIRATHAPVDGHIGVRPLLHVVQDIFHRAASLIPGIVQGKQVQ---MDA  66

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
              +++    S L   I+   +   + S EI    SS  D H+ T+ +L +L++Y WDAK V
Sbjct  67    -MKDSAYQSDLANVIDISYHTINKISCEICCKCSSGGDVHATTMGILGMLSSYSWDAKVV  125

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             I  AAFA  +GEF L+A+LY T+ LAKSVA +  I + LE       +  K + V  L  
Sbjct  126   IALAAFAANFGEFWLVAQLYATNRLAKSVAKLKHIHETLE---QVDDLGPKFQTVNNLLK  182

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              ML+VT+ I+   E+ S               +  +  +P      N++  A Y+ +++ 
Sbjct  183   AMLDVTNNIVQFHELPS---------------QYIDPEAPEMLTASNLIPGAVYWTIRSI  227

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V+C+  IL +  +G+ Y +ST E  E+S+L HKL  I   L+K +    Q +   +    
Sbjct  228   VSCASHILGITGLGQGYMTSTTETWELSSLAHKLDNINSHLRKQLTVCRQHLDDNRQREA  287

Query  1270  RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDL  1449
                L       H DN    + + C ++DP P+  G+    ++  +++LRRK V L ++D+
Sbjct  288   FATLRLLFETPHQDNSKVLKAMFCSKDDPLPLFDGSS--KQRVSIEVLRRKIVLLYITDV  345

Query  1450  -DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
              ++P++ + +   MY ES+QD +R ESQ+E+VW+P+VD+  PW   K  +F  ++S M  
Sbjct  346   HNVPDQELVIFEQMYQESRQDSTRLESQYELVWIPVVDKAIPWNDVKP-KFEKLQSMMSC  404

Query  1627  FSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             +S+  PS ++ A   Y+      + KP+L V+D Q
Sbjct  405   YSLYDPSLLEPATIRYIKEVWLFKTKPILVVLDPQ  439



>ref|XP_009386688.1| PREDICTED: uncharacterized protein LOC103973766 [Musa acuminata 
subsp. malaccensis]
Length=702

 Score =   219 bits (558),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 252/463 (54%), Gaps = 42/463 (9%)
 Frame = +1

Query  358   RGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             +GD    ++S+D+ ++  +  TH  D      +PLL L+EDI+ RA  T+    Q+    
Sbjct  16    KGDRHLFSASDDSVVLKQILGTHSPDGRDVDARPLLRLVEDILQRATPTVIVTPQA----  71

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
             PA L   +E+KV H  +   +EA AY  +R S EI    S + DAH+ T+++   LANY 
Sbjct  72    PAEL---VEDKVHHVEVVAMLEALAYTVHRISCEISCKCSGSGDAHATTMALFNSLANYT  128

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK VI  AAFA  YGEF L A+L+  +PLAKSVA + Q+PD+LE +++ +    +   
Sbjct  129   WDAKVVIALAAFAVSYGEFWLTAQLHKVNPLAKSVALLKQLPDILEHTDALKP---RFDA  185

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa---k  1062
             ++ L   ML+VT  II  KE+ SE                   +SP   + +  +A    
Sbjct  186   LSNLIKAMLDVTKCIIQFKELPSE------------------YISPDNPDMDMALAHIPT  227

Query  1063  asyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQE  1242
             A Y+ +++ V C+  I+ L+  G ++ +ST E  E+S+L HK+  I   L K ++   + 
Sbjct  228   AVYWTIRSVVACASQIVALIGPGHEHITSTTEVWELSSLAHKVRSIHEHLTKQLELCNRH  287

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
             IG+ KH    + L       H DN      +I  ++D  P+  G     ++  +D+LRRK
Sbjct  288   IGEKKHLEAYQTLVRLFETVHIDNNKILRALIYSKDD-LPLFDGDT--KRRVSVDVLRRK  344

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              V L +SDLDI +E + +L  +Y ++ Q   + +  +EIVWLP++DR +PWT AKE+ + 
Sbjct  345   IVMLFISDLDISDEELLVLIQIYNDTHQ--GKLDRPYEIVWLPVIDRHAPWTNAKEETYN  402

Query  1603  LVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
                S+MPW+S+ HPS ++ A   Y+       ++ L+ V+D Q
Sbjct  403   RFASTMPWYSLHHPSLLEPAAVKYIRNEWHFDKRALMVVLDPQ  445



>ref|XP_011013170.1| PREDICTED: uncharacterized protein LOC105117262 [Populus euphratica]
Length=722

 Score =   219 bits (557),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 152/458 (33%), Positives = 245/458 (53%), Gaps = 29/458 (6%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L  S+D  MM  +  TH  D     VKPLL L EDI+ RA   I   + + Q Q  
Sbjct  25    RGSMLTMSDDNVMMKQIVGTHAPDGREVDVKPLLLLAEDILKRATLQIDSSLTTSQAQ--  82

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
                A +++K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WD
Sbjct  83    ---AEMKDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWD  139

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YGEF LLA++  ++ LAKS+A + Q+P ++E S   +     +  + 
Sbjct  140   AKLVLTLAAFALNYGEFWLLAQISSSNQLAKSMAILKQLPSIMEHSGPLKPRFDAINNLI  199

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
             K+   M++V   ++  K++     S +V    +L   +A   + V     +++       
Sbjct  200   KV---MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWAIRSVV-------  246

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
                   C+  I +L  +G ++  ST +  E+STL HKLS IL  L+K +    Q I + +
Sbjct  247   -----ACAAQITSLTTMGHEFSISTTDAWELSTLAHKLSNILDHLRKQLDICYQYIDEKR  301

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             +    ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL
Sbjct  302   NVESFQMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLL  359

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S L++  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W+   +++F  ++SS
Sbjct  360   ISGLEMSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWSDPMKEKFESMQSS  419

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             MPWF+V HP  I++AV  ++    + R KP+L V+D Q
Sbjct  420   MPWFTVYHPLLIEKAVIRFIKEVWHFRNKPILVVLDPQ  457



>ref|XP_006470197.1| PREDICTED: uncharacterized protein LOC102630205 [Citrus sinensis]
Length=845

 Score =   219 bits (559),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 160/489 (33%), Positives = 255/489 (52%), Gaps = 34/489 (7%)
 Frame = +1

Query  271   NVVSATAPPSQVVAPLQAK----IIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVH  438
              V   T  PS  + P  ++    + P  +G + R     +S+D  ++  V+ TH  D   
Sbjct  123   GVTKPTPTPSLQLLPAASRQHGLMTPMMKGDKFR---FTTSDDNTLLKQVQGTHLPDGRV  179

Query  439   YKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAY  618
              +VKPL+H++E I   A  +I G +  ++T+ A L+A LE+K   +     +E  AY   
Sbjct  180   IEVKPLIHIVEGIFKLADPSI-GAISDLETR-ASLEA-LEDKTYQTDSLGMLEVLAYIID  236

Query  619   RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTD  798
             R S EI    S   DAH   LS+L ++++Y WDAK  +  +AFA  YGEF L+A+ Y T+
Sbjct  237   RISCEITCKCSGGGDAHVTALSILNMVSSYSWDAKLALALSAFAVTYGEFWLVAQSYTTN  296

Query  799   PLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLK  978
              LAK+VA + Q+P++LE +   +    +   +  L   M++V+  I+   E+ S+  + +
Sbjct  297   QLAKAVAILKQLPEILEHTHVLKP---QFDAIKNLVRAMVDVSKCIVQFNELPSQYITAE  353

Query  979   VKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee  1158
                  +LY   A     V     +I+             C+  +  L   GR++  ST E
Sbjct  354   ---NDALYSASAHIPVAVYWTIRSIL------------ACASQLTGLTLFGREHMVSTTE  398

Query  1159  eleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELII  1338
               E+S+L HKLS +   L   +    + I + K+      L+     +H DN      +I
Sbjct  399   AWELSSLAHKLSNMHSHLLSLLHNCHKYIDEKKYLEALHNLKTLFEMSHIDNMRILRALI  458

Query  1339  CGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSR  1518
               ++D  P++ GA     +  L++LRRK V LL+SDLDI  E + +L  +Y E++Q  +R
Sbjct  459   YPKDDLLPLVDGA--TKTRVNLEVLRRKMVLLLISDLDISQEEVIILEQLYSEARQHQTR  516

Query  1519  AESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----  1686
              ESQ+E+VWLPIVD   PWT  K+ QF  ++S+MPW++V HPS ID AV  ++       
Sbjct  517   HESQYEVVWLPIVDPNMPWTDNKQKQFQSLQSAMPWYTVYHPSLIDRAVIQFIKEEWQFG  576

Query  1687  RKPLLAVVD  1713
             +KP+L V+D
Sbjct  577   KKPILVVLD  585



>ref|XP_008786702.1| PREDICTED: uncharacterized protein LOC103704947 [Phoenix dactylifera]
Length=699

 Score =   216 bits (550),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 155/464 (33%), Positives = 243/464 (52%), Gaps = 43/464 (9%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             I+      +SS+D  +M  + ATH  D      +PL HL++DI+ RA  T+      + T
Sbjct  15    IKGERHLFSSSDDNIVMKQILATHSPDGRDVDARPLFHLVQDILQRATPTL------IVT  68

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
             Q   +    E+   H  +   +EA AY  +R S E+I   +S  DAH+ TL++  +L++Y
Sbjct  69    QMEDV----EDTAHHPAVVGMLEALAYTIHRISSEMIYKCTSGSDAHATTLALFNMLSSY  124

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF L A+L+  +PLAKSV+ + Q+PD++E ++  +    +  
Sbjct  125   TWDAKVVLVLAAFAVNYGEFWLTAQLHTVNPLAKSVSLLKQVPDIIEHTDVLKP---RFD  181

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa---  1059
              +  L   M++VT  II  +E+ SE                   +SP + +    MA   
Sbjct  182   TINNLIKAMVDVTRCIIEFRELPSE------------------YISPESPDMSVAMAHIP  223

Query  1060  kasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQ  1239
              A+Y+ +++ V C+  I  L+ +G +Y SST +  E+S+L HK+  I   L K +    Q
Sbjct  224   TAAYWAIRSVVACAAQITMLIGLGHEYVSSTTDTWELSSLAHKVGNIHEHLTKQLALCHQ  283

Query  1240  EIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRR  1419
              I + KH    + L       H DN       +  ++D  P+I G     K+ G+D+LRR
Sbjct  284   HINEKKHVEAYQTLVRLFQTVHIDNMKILRAFLYSKDD-LPLIDGTS--KKRVGVDVLRR  340

Query  1420  KYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQF  1599
             K V   +SDLD+P E + +L  +Y ++ Q   + E  ++IVWLP+VDR  PW   KE+ F
Sbjct  341   KIVMFFISDLDVPREELLVLVQIYNDTHQ--GKLERPYDIVWLPVVDRHHPWNKTKEETF  398

Query  1600  TLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               + S MPW+ +  PS +D AV  Y+       +KP+L V+D Q
Sbjct  399   NRLASMMPWYLLHDPSLLDPAVIKYVRDVWRFEKKPVLVVLDPQ  442



>emb|CBI34824.3| unnamed protein product [Vitis vinifera]
Length=664

 Score =   214 bits (545),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 242/452 (54%), Gaps = 29/452 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    
Sbjct  2     SDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----  57

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             ++   +     +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK V+T 
Sbjct  58    DRTNQASFFALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFNLLTSYSWEAKLVLTL  117

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             +AFA  YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + +    M+
Sbjct  118   SAFAVNYGEFWLLAQISSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMV  174

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
              +T  II  KE+ S   S  V               P  A     +  A Y+ +++ V C
Sbjct  175   AITRCIIEFKELPSMYISQDV---------------PALATAMTHIPTAVYWTIRSVVAC  219

Query  1099  SLVILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             +  I  L ++G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    +
Sbjct  220   ATQITTLTSMGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQ  279

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I
Sbjct  280   MLLNLFESIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSI  337

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV
Sbjct  338   SHDELSILDQIYNESRDHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSV  397

Query  1636  SHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  398   YTPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  429



>ref|XP_010660831.1| PREDICTED: uncharacterized protein LOC100264492 [Vitis vinifera]
Length=697

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 242/452 (54%), Gaps = 29/452 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    
Sbjct  5     SDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----  60

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             ++   +     +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK V+T 
Sbjct  61    DRTNQASFFALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFNLLTSYSWEAKLVLTL  120

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             +AFA  YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + +    M+
Sbjct  121   SAFAVNYGEFWLLAQISSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMV  177

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
              +T  II  KE+ S   S  V               P  A     +  A Y+ +++ V C
Sbjct  178   AITRCIIEFKELPSMYISQDV---------------PALATAMTHIPTAVYWTIRSVVAC  222

Query  1099  SLVILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             +  I  L ++G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    +
Sbjct  223   ATQITTLTSMGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQ  282

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I
Sbjct  283   MLLNLFESIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSI  340

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV
Sbjct  341   SHDELSILDQIYNESRDHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSV  400

Query  1636  SHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  401   YTPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  432



>emb|CBI34826.3| unnamed protein product [Vitis vinifera]
Length=659

 Score =   214 bits (544),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 242/452 (54%), Gaps = 29/452 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    
Sbjct  2     SDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----  57

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             ++   +     +EA ++   R S EI        DAH+ TLS+  LL +Y W+AK V+T 
Sbjct  58    DRTNQASFIALLEALSFTIDRISCEIAYKSLGGGDAHATTLSIFDLLTSYSWEAKLVLTL  117

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             +AFA  YGEF LLA++Y ++ LAKS+A + Q+P +LE S   +     L  + +    M+
Sbjct  118   SAFAVNYGEFWLLAQIYSSNQLAKSMAILKQVPIILEHSGQLKPRFDALNNLIR---AMV  174

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
              +T  II  KE+ S   S  V               P  A     +  A Y+ +++ V C
Sbjct  175   AITRCIIEFKELPSMYISQDV---------------PALATAMTHIPTAVYWTIRSVVAC  219

Query  1099  SLVILNLLAVGRDYYssteeele-istltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             +  I  L ++G +Y++S   E   +ST+ HK++ IL  L+K +    Q I    +    +
Sbjct  220   ATQITTLTSMGHEYWTSATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKWNAETFQ  279

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I
Sbjct  280   MLLNLFESIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSI  337

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV
Sbjct  338   SHDELSILEQIYNESRVHGTRMESQYEVVWIPVVDRSVMWTDAMQDRFETLQATMPWYSV  397

Query  1636  SHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  398   YTPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  429



>emb|CBI34825.3| unnamed protein product [Vitis vinifera]
Length=694

 Score =   212 bits (540),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/452 (33%), Positives = 242/452 (54%), Gaps = 29/452 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D  M+  + ATH  D   + VKPL  L+EDI+ RA   +   + + QT+    D    
Sbjct  2     SDDNMMVKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISAAQTRIETSD----  57

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             ++   +     +EA ++   R S EI        DAH++TLS+  LL +Y W+AK V+T 
Sbjct  58    DRTNQASFIALLEALSFTIDRISCEIAYKSLGGGDAHAMTLSIFNLLTSYSWEAKLVLTL  117

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             +AFA  YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + +    M+
Sbjct  118   SAFAVNYGEFWLLAQISSSNQLAKSMAILKQVPTILEHSGQLKPRFDALNNLIR---AMV  174

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
              +T  II  KE+ S   S  V               P  A     +  A Y+ +++ V C
Sbjct  175   AITRCIIEFKELPSMYISQDV---------------PALATAMKHIPTAVYWTIRSVVAC  219

Query  1099  SLVILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             +  I    ++G +Y+ S   E  E+ST+ HK++ IL  L+K +    Q I   ++    +
Sbjct  220   ATQITTFTSMGHEYWISATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKRNAETFQ  279

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I
Sbjct  280   MLLNLFESIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSI  337

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV
Sbjct  338   SHDELSILDQIYNESRVHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYSV  397

Query  1636  SHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               P+ ID+AV  ++    + R KP+L V+D Q
Sbjct  398   YTPTLIDKAVIRFIKEVWHFRNKPILVVLDPQ  429



>ref|XP_007031665.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
 gb|EOY02591.1| Uncharacterized protein TCM_017020 [Theobroma cacao]
Length=814

 Score =   212 bits (540),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 174/573 (30%), Positives = 274/573 (48%), Gaps = 58/573 (10%)
 Frame = +1

Query  25    SLLNPPKMAQTTINNTGRPMSESTTRATDTTPLVPRTAPNTPHNPVHEIVPKATNLNPRS  204
             +LL+ P  A   +NN G       T A  T PL+                      NP  
Sbjct  27    ALLHNPGAAHAFLNNPGAATQALLTTAGATQPLLS---------------------NPGV  65

Query  205   LTTYTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSE  384
                 T HP         P T    +S    PS   A +++           RG  L+ S+
Sbjct  66    GQQITSHPGAIQPHISTPGTNQPFISK---PSAAQALMKSPSASHALIRSDRGSMLSMSD  122

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  MM  +  TH  D     V+PLL+L+EDI+ RA   +   V+    Q       LEEK
Sbjct  123   DNVMMKQIMTTHAPDGREVDVRPLLYLVEDILNRATQHVDFLVKGTLAQIE-----LEEK  177

Query  565   VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAA  744
                +     +EA  Y   R + E+        DAH+ T ++  LL++Y WDAK V++ +A
Sbjct  178   AQQANYIAMLEALTYIIDRIACELSYKAMGGSDAHATTTAIFNLLSSYAWDAKLVLSLSA  237

Query  745   FAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEV  924
             FA  YGEF LLA++Y T+ LAKS+A + Q+P +LE +   +     L  + +    M++V
Sbjct  238   FALNYGEFWLLAQIYSTNQLAKSMAILKQLPSILEHTAPLKPRFDALNNLIR---TMMDV  294

Query  925   THKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSL  1104
             T  ++  KE+ S   S +V               P  A     +  A Y+ +++ V C+ 
Sbjct  295   TRCVVEFKELPSMYISQEV---------------PALATAMTHIPTAVYWTIRSMVACAT  339

Query  1105  VILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
              I +L ++G ++  ST E  E+S+L HKL  I   L++ +    + I + K     ++L 
Sbjct  340   QISSLTSMGHEFAISTSESWELSSLAHKLKNIYEHLKQQLSLCYKYIDERKDVETYQMLL  399

Query  1285  ETL--ARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKH-GLDILRRKYVFLLVSDLDI  1455
                  +  H DN    + +I   +D  P++ G+    K+H  LD+LRRK V LL+S LD 
Sbjct  400   NLFDPSVMHIDNMRILKALIYARDDKLPLLDGS---TKRHVSLDVLRRKNVLLLISSLDF  456

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKEDQFTLVKSSMPWFS  1632
              ++ + +L  +Y ES+   +R ESQ+E+VW+P+VD    P TG  + +F  ++S+MPW+S
Sbjct  457   SSDELAILEQIYNESRVHATRLESQYEVVWIPVVDHSVVPLTGEIQTKFENLRSTMPWYS  516

Query  1633  VSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             V  P  I++ V  ++    + R KP+L V+D Q
Sbjct  517   VQDPKFIEKPVIRFIKEVWHFRNKPILVVLDAQ  549



>ref|XP_006378263.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
 gb|ERP56060.1| hypothetical protein POPTR_0010s06060g [Populus trichocarpa]
Length=685

 Score =   211 bits (536),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 165/475 (35%), Positives = 244/475 (51%), Gaps = 74/475 (16%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R+R  F +SS+DTAMM  ++ATH  D   + VKPLLH++EDI  RA A   G    VQ Q
Sbjct  9     RERSMF-SSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRA-APALGMTNIVQQQ  66

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
                                            S +  GG     DAH+ TL++  L++NY 
Sbjct  67    ------------------------------MSCKCSGG----GDAHATTLAIFNLVSNYT  92

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WD K V+  A FA  YGEF L+A+LY T+PLAK+VA + Q+PD++E +++ +    K  E
Sbjct  93    WDEKLVLALAGFAVNYGEFWLVAQLYLTNPLAKAVALLKQLPDIIERADNMKP---KFEE  149

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakas  1068
             +  L   M++V   I   KE+ S+       Y      E+  + + V TA    I     
Sbjct  150   LTSLIKVMMDVAQCIFEFKELPSQ-------YITPDTPEMLTATAHVPTAVYWTI-----  197

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
                 ++ V C+  I+ L   G +Y +ST E  E+S+L HK++ I   L K +    Q I 
Sbjct  198   ----RSIVACASQIMGLSGKGHEYIASTTEAWELSSLAHKVNNIHSHLMKQLTLCLQHID  253

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKK-----------  1395
             + +H    + L       H DN    + +I  E+D  P+  G+  +  +           
Sbjct  254   EKRHIEAFQTLVSLFEAFHIDNMKILKALIYAEDDQLPLFDGSTKKRVRLLFCSFSPFYS  313

Query  1396  ---HGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR  1566
                  LD+LRR+ V LL+SDL I +E ++ML+ MY E++++P R ESQ+E+VWLP+VDR 
Sbjct  314   DYAASLDVLRRRSVLLLISDLLISHEELSMLQQMYSEAREEPGRPESQYEVVWLPVVDRS  373

Query  1567  SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             SPW+  KE  F   +  MPW+SV HPS +D AV  Y+    +  ++P L V+D Q
Sbjct  374   SPWSETKEKLFEDFQRIMPWYSVHHPSLLDVAVIRYIKEVWHFNKRPFLVVLDPQ  428



>ref|XP_010029070.1| PREDICTED: uncharacterized protein LOC104419194 [Eucalyptus grandis]
 gb|KCW55911.1| hypothetical protein EUGRSUZ_I01709 [Eucalyptus grandis]
Length=720

 Score =   209 bits (532),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 160/470 (34%), Positives = 257/470 (55%), Gaps = 32/470 (7%)
 Frame = +1

Query  334   PAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             P+ + + K GD   +  S++  +   ++ TH  D     VKPLLHL++DI+ R+   +  
Sbjct  12    PSMQRLIKGGDRSMITMSDEDVLTKQIKETHAPDGREVDVKPLLHLVKDILNRSTLNVDA  71

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                + +  PA  +  +E++   +   + ++A +Y   R S E+     +  +AHS TL++
Sbjct  72    V--AAEGSPAHTEN-MEDQTYRASDTDLLDALSYIIERVSSELHAKALTGGEAHSTTLAI  128

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               +LA + WDAK V+T AAFA  YGEF LLA++  T+ LAK +AT+ Q+P ++E    S 
Sbjct  129   CNMLAPFSWDAKLVLTLAAFAFNYGEFWLLAQVSSTNQLAKLMATLKQLPMIME---YSS  185

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQ  1044
              + S+   +  L   ML+VT  ++ LKE+ S        Y  S +  L+ +++ V TA  
Sbjct  186   VLKSRFDALNSLIQAMLKVTKCVVDLKELPS-------AYISSEFPALSAAMNHVPTAVY  238

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
               I         ++AV C   I +L + G +Y +ST E  E+STL HKL+ I   LQK +
Sbjct  239   WTI---------RSAVACYGQITSLTSYGLEYITSTTEAWELSTLAHKLTNIYEHLQKQI  289

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                 Q I + +     K L       H DN    + +I  ++D  P++ G+    ++  L
Sbjct  290   GICYQHIEEKRRLDAYKSLLNLFETIHIDNMKILKALIYPKDDVLPLVEGS--TRQRVNL  347

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSPWTG  1581
             ++LRRK V LL+S +DI  E +++L  ++ ESK    R E  Q+E+VW+P+VDR   WTG
Sbjct  348   EVLRRKNVLLLISGVDISQEELSILEQIHSESKLHAIRHEIHQYELVWIPMVDRSVEWTG  407

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              K+ QF  ++SSMPW++V HPS ID+ V  ++    + R KP+L V+D Q
Sbjct  408   PKQKQFEALQSSMPWYTVYHPSLIDDLVIRFVKEKWHFRNKPILVVLDPQ  457



>emb|CDP15097.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   209 bits (531),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 156/460 (34%), Positives = 251/460 (55%), Gaps = 31/460 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R RG F AS +D AMM  ++ATH  D    +VKP+L +IE ++      I G V     +
Sbjct  16    RDRGMFTAS-DDAAMMKQIQATHAPDGRELEVKPILQIIEALLHHVSPGIDGIVNGTHHE  74

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
              A     LEE+    G+   ++  AY   + S E+    S   D H+ T+++L +L++Y 
Sbjct  75    GADE---LEERTALVGMEGILDGLAYIVQKISCELECKCSGGGDMHATTMAILNMLSSYT  131

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++  AFA  YGEF L+A+L+ T+PLAKS+A + Q+PD++E S   ++   +   
Sbjct  132   WDAKGVLSLTAFAVNYGEFWLIAKLFATNPLAKSIAVLKQLPDIMEHSNVLKS---RFDA  188

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             ++ L   ML+VT  I+  KE       L  +Y       +A +++ V A          Y
Sbjct  189   ISNLIKAMLDVTKCIVEFKE-------LPAQYISDDTPAMAVAVAHVPAS--------VY  233

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             + +++ V C+ +I +LL +G +   ST E  E+++L HKLS I G L+  +    Q I +
Sbjct  234   WTIRSMVACASLITSLLGMGYELIGSTTETWELTSLAHKLSSIHGHLKTQLANCFQHIAE  293

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              +H    ++L       H +N    + +I  ++D  P+    G    +  +D+LRRK V 
Sbjct  294   KRHLEYFQMLVHLFEVPHLENLRILKALIYNKDDLLPL--EIGTSKTRANVDVLRRKTVL  351

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+SDLD+  E + +L H+Y E++   SR E Q+EIVWLPIV+R   W    E +F  ++
Sbjct  352   LLISDLDLSQEELPVLTHIYTEAR---SRPEFQYEIVWLPIVERSVTWNEGYEQKFKQLQ  408

Query  1612  SSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             S+MPW+++ HPS ++ AV  Y+    +  +K +L V+D Q
Sbjct  409   SAMPWYTLHHPSLLEPAVARYIKEVWHFEKKMMLVVLDPQ  448



>ref|XP_010029073.1| PREDICTED: uncharacterized protein LOC104419196 [Eucalyptus grandis]
 gb|KCW55917.1| hypothetical protein EUGRSUZ_I01715 [Eucalyptus grandis]
Length=721

 Score =   209 bits (531),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 164/470 (35%), Positives = 254/470 (54%), Gaps = 34/470 (7%)
 Frame = +1

Query  334   PAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             PA + + K GD   +  S+DTAMM  V  TH  D     VKPLL L+EDI+ RA  T   
Sbjct  13    PAMQRLIKGGDRSMITMSDDTAMMKQVTDTHAPDGREVDVKPLLLLVEDILNRATLT---  69

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                S  T  +     +E+K   +  N  ++  +Y   R S E+     +  +AHS TL++
Sbjct  70    --ASTPTMGSLYAEHMEDKGYQASFNAVLDVLSYTIERISCELSAKALTGGEAHSTTLAI  127

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               +LA + WDAK V+T AAFA  YGEF LLA++Y T+ LAKS+A + Q+P ++E    S 
Sbjct  128   CSMLAPFSWDAKLVLTLAAFAFNYGEFWLLAQIYTTNQLAKSMAILKQLPMIME---HSG  184

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQ  1044
             A+ S+   +  L   ML+VT  ++ LK++ S        Y  S    L+ +++ V TA  
Sbjct  185   ALKSRFDALNGLIQAMLKVTRCVVDLKDLPS-------AYISSEAPALSAAMAHVPTAVY  237

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
               I         ++AV C+  I +L + G +Y SST E  E+ST+ HKL  I   LQK +
Sbjct  238   WTI---------RSAVACASQITSLTSYGIEYISSTTEAWELSTMDHKLKNIYEHLQKQI  288

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                 Q I + +     + L       H DN    + +I  ++D  P++ G     K+  L
Sbjct  289   DICKQYIDEKRDIEAYQTLLNLFETIHIDNMKVLKALIYPKDDILPLVEGTS--KKRVNL  346

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSPWTG  1581
             ++LRR+ V LL+S LDI  + +++L  ++ ESK   SR +  Q+E+VW+P+V+R    TG
Sbjct  347   EVLRRRNVLLLISGLDISQDELSILEQIHSESKAHASRHDIHQYELVWIPLVERAGELTG  406

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               + +F  ++S+MPW++V HP+ I +AV  ++    + R KP+L V+D Q
Sbjct  407   PMQTKFETLQSTMPWYTVYHPNLIHKAVIRFIKEKWHFRNKPILVVLDPQ  456



>ref|XP_002526959.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35446.1| conserved hypothetical protein [Ricinus communis]
Length=718

 Score =   206 bits (523),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 150/467 (32%), Positives = 258/467 (55%), Gaps = 33/467 (7%)
 Frame = +1

Query  337   AGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQ  516
             A + IR      A S++ +MM  ++ATH  D   + V+PLL+++ DI+ RA+  IP    
Sbjct  15    AQQLIRSDRSMFALSDENSMMKQIQATHAPDGREFDVRPLLNIVADILSRAN--IPH--A  70

Query  517   SVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKL  696
                   ++  A +E+K   +     +EA A+   R + EI     S  D H+ T+S+L +
Sbjct  71    DTALTASQTHAEMEDKNRQANFIAMLEALAHVIDRIACEISYKALSGSDPHATTMSLLNM  130

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             L++Y WDAK V+T +AFA  YGEF LLA++Y ++PLAKS+AT+ Q+P +LE +   +   
Sbjct  131   LSSYNWDAKLVLTMSAFALNYGEFWLLAQIYSSNPLAKSMATLKQLPYILEHTVPLKP--  188

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENI  1053
              +   + KL   M++VT+ ++ L+E       L   Y  +    L  +++ V TA    I
Sbjct  189   -RFDALNKLIGVMMDVTNCVVELRE-------LPTAYISAETGALTTAIAHVPTAAYWTI  240

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
                      ++ + C+  I +L  +G ++  +T E  E+STL HKL  I   L+K +   
Sbjct  241   ---------RSILACASQITSLTTLGHEF--ATTEVWELSTLAHKLQNIDDHLRKQLSLC  289

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              Q I + ++    ++L       H DN    + +I  ++D  P++ G+    ++  +D+L
Sbjct  290   HQHIDERRNVESYQMLLNLFDMIHIDNMKILKALIYPKDDIQPLVDGST--KRRVNIDVL  347

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAES-QFEIVWLPIVDRRSPWTGAKE  1590
             RRK V LL+S L+I ++ +++L  +Y ES+   +R +S Q+E+VW+P+VDR   WT   +
Sbjct  348   RRKNVLLLISGLNISHDQLSILEQIYNESRIHATRMDSHQYEVVWIPVVDRTVQWTDPMQ  407

Query  1591  DQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              QF  ++++MPW++V  P+ ID+ V  ++    + R KP+L V+D Q
Sbjct  408   KQFEALQATMPWYTVYSPTLIDKVVIRFIKEVWHFRNKPILVVLDPQ  454



>ref|XP_010029068.1| PREDICTED: uncharacterized protein LOC104419192 [Eucalyptus grandis]
Length=722

 Score =   205 bits (521),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 162/470 (34%), Positives = 249/470 (53%), Gaps = 33/470 (7%)
 Frame = +1

Query  334   PAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             PA + + K GD   +  S+D AMM  V  TH  D     VKPLL L+EDI+ RA  T   
Sbjct  13    PAMQRLIKGGDRSMIMMSDDIAMMKQVTDTHAPDGREVDVKPLLLLVEDILNRATLT---  69

Query  508   YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                +  T  +     +E+K   +  N  ++  +Y   R S E+     +  +AH+ TLS+
Sbjct  70    -ASTGPTMGSPYAENMEDKGYQASFNAVLDVLSYTIERISCELSAKALTGGEAHATTLSI  128

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
               +LA + WDAK V+T AAFA  YGEF LLA++Y T+ LAKS+A + Q+P ++E    S 
Sbjct  129   CNMLAPFSWDAKLVLTLAAFAFNYGEFWLLAQIYTTNQLAKSMAILKQLPMIME---HSG  185

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQ  1044
             A+ S+   +  L   ML+VT  ++ LK++ S        Y  S    L+ +++ V TA  
Sbjct  186   ALKSRFDALNGLIQAMLKVTRCVVDLKDLPS-------AYISSEAPALSAAMAHVPTAVY  238

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
               I         ++AV C+  I +L + G +Y SST E  E+ST+ HKL  I   LQK +
Sbjct  239   WTI---------RSAVACASQITSLTSYGIEYISSTTEAWELSTMDHKLKNIYEHLQKQI  289

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                 Q I + +     + L       H DN    + +I  ++D  P++ G     K+  L
Sbjct  290   DICKQYIEEKRDIEAYQTLLNLFETIHIDNMKVLKALIYPKDDILPLVEGTS--KKRVNL  347

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESK-QDPSRAESQFEIVWLPIVDRRSPWTG  1581
             ++LRR+ V LL+S LDI  + +++L  ++ ESK     R  +Q+E+VW+PIVDR   WT 
Sbjct  348   EVLRRRNVLLLISGLDISQDELSILEQIHGESKLHTTQRQINQYEVVWIPIVDRSVKWTD  407

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               + QF  ++S MPW++V HP+ I +    ++    + R KP+L V+D Q
Sbjct  408   PVQKQFEALQSRMPWYTVYHPNLIHKVAIRFIREQWHFRNKPILVVLDPQ  457



>ref|XP_002271723.2| PREDICTED: uncharacterized protein LOC100242213 [Vitis vinifera]
Length=715

 Score =   202 bits (513),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 162/480 (34%), Positives = 252/480 (53%), Gaps = 38/480 (8%)
 Frame = +1

Query  298   SQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDI  477
             S++ AP   ++I   RG  K  D      + AMM  + ATH  D     VKPL  L+EDI
Sbjct  3     SRIAAPSLTQLIRGERGRIKLSD------ENAMMKQIYATHTPDGREVDVKPLFQLVEDI  56

Query  478   MPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSN  657
             + RA   +     + QT+    D    +K   +     +EA ++   R + EI    SS 
Sbjct  57    LSRASPAVDPLFLTAQTRVETWD----DKTQQASFIAMLEALSFTIDRVACEITYKSSSG  112

Query  658   RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIP  837
              DAH+ TLS+   L+ + W+AK VIT AAFA  YGEF LLA++Y ++ LAKSVA + Q+P
Sbjct  113   EDAHATTLSIFNQLSYFPWEAKLVITLAAFALSYGEFWLLAQIYSSNQLAKSVAILKQVP  172

Query  838   DLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAE  1017
              +LE S S +     L  + +    M +VT  II  K + S            +Y  ++ 
Sbjct  173   VILEHSASLKPRFDALNNLIR---AMTDVTKCIIEFKGLPS------------VY--ISH  215

Query  1018  SLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDY--YssteeeleistltHKL  1191
               +P+     +I   A Y+ ++A + C+  I +L ++G ++   SST E  E+STL HK+
Sbjct  216   DAAPLVTAMAHI-PTAVYWTIRAVIACASQISSLSSLGHEHALMSSTNETWELSTLAHKI  274

Query  1192  SYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIH  1371
               IL  L   +    Q I +  +    ++L   L     DN    + +I  + D  P++ 
Sbjct  275   KNILDLLNNQLALCYQYIEEKMNLETYQMLLNLLEGVQIDNMKLLKALIYAKEDLQPLLD  334

Query  1372  GAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
             G+    ++  LD+LRRK V LL+S LD P + +++L  +Y ES+   +R E  +EIVW+P
Sbjct  335   GST--KRRVNLDVLRRKNVLLLISSLDFPRDELSILEQIYNESRVHATRME--YEIVWIP  390

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             IVDR + WT   + QF  ++++MPW+SV  PS I++ V  ++    + R KP+L V+D Q
Sbjct  391   IVDRFAEWTDPLQSQFETLQTTMPWYSVYSPSLIEKPVIRFIREVWHFRNKPILVVLDPQ  450



>gb|KDO44359.1| hypothetical protein CISIN_1g008311mg [Citrus sinensis]
Length=570

 Score =   199 bits (505),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 150/461 (33%), Positives = 244/461 (53%), Gaps = 28/461 (6%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             IR+    ++ S+D  MM  ++ATH  D     VKPL +L+EDI+ RA      +   +  
Sbjct  14    IRRDRSMVSISDDNMMMRQIQATHAPDGREVDVKPLFNLVEDILNRA-----TFQTDIDE  68

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A+    +E+    +G    I+A ++   R S EI        DAH+ TLS+  +L+NY
Sbjct  69    TDAQAHLEIEDNAQQAGFLAMIDAISFTIDRISCEIACKALGGSDAHATTLSLFSMLSNY  128

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E +        +  
Sbjct  129   SWDAKLVLALAAFALYYGEFWLLAQIYSSNQLAKSMAILKQLPSIMEHTSGPLKS--RFD  186

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   M+ VT  I+  K++ S        Y      E + +++ +          A 
Sbjct  187   TLNNLIKAMMGVTRCIVEFKDMPS-------NYITQDAPEFSSAMAHIP--------IAV  231

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V C+  I  L  +G ++  ST E  E+STL HKL  I   L+K +    + I 
Sbjct  232   YWTIRSVVACATQITTLTGMGHEFVISTSEAWELSTLAHKLKNIHESLKKLMATCYRHIE  291

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + K     ++L +     H DN    + +I  ++D  P++ G+    ++  +++LRRK V
Sbjct  292   EKKSHEAYQMLVKLFDSIHIDNMKVLKALIYAKDDLQPLVDGST--KRRVNIEVLRRKNV  349

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLDI  E +++L  +Y ES+   +R ES +E+VW+PIVD    W    + +F  +
Sbjct  350   LLLISDLDISQEELSILEQIYNESRLHLTRQESHYEVVWIPIVDHFIHWDDPTQKKFETL  409

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +SSMPW++V HP+ ID AV  Y+    + + KP+L V+D Q
Sbjct  410   QSSMPWYTVYHPTLIDRAVIRYVKDVWHFKNKPILVVLDPQ  450



>ref|XP_010026936.1| PREDICTED: uncharacterized protein LOC104417333 [Eucalyptus grandis]
 gb|KCW83234.1| hypothetical protein EUGRSUZ_B00175 [Eucalyptus grandis]
Length=713

 Score =   200 bits (508),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 150/441 (34%), Positives = 233/441 (53%), Gaps = 31/441 (7%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
               A+S+D+AMM  ++ATH  D     VKP+L LIE +    HAT PG   ++  +    +
Sbjct  21    MFAASDDSAMMKQIQATHTPDGREVDVKPILGLIESLF--RHAT-PGIDGALSGKHGAEE  77

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
             A  EEK   +  +  +E   Y   + S E+    S   DAH  T+++  +++ Y WDAK 
Sbjct  78    ASSEEKAYLASFDSVLEGLPYIIQKISCELSCKCSGGGDAHGTTMAIFNMISAYSWDAKV  137

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAF   YGEF L+ +LY  +PLAKSVA + Q+PD++     S A+ ++   +  L 
Sbjct  138   VLALAAFGVNYGEFSLMIQLYSRNPLAKSVALLKQLPDMM---VHSNALKTQFDALHNLI  194

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasyyvvk  1083
               M++VT  II   E       L  +Y  S    L+ +L+ + TA    I         +
Sbjct  195   VAMVDVTKCIIQFSE-------LPPQYISSETPPLSTALTHIPTAVYWTI---------R  238

Query  1084  aavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHT  1263
             + V+C+  I +L+ +G +Y  ST E  E+S+L +K+  I   L+K +    Q I +  H 
Sbjct  239   SIVSCASQIASLIGLGNEYMPSTTEAWELSSLAYKIGSIYDHLKKQLAICYQHIDEKMHF  298

Query  1264  IKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
                + L     R+H DN    + +IC ++D  P++  +  +  +  L++LR+K V LL+S
Sbjct  299   EAFQTLIRLFDRSHMDNMTILKHLICLKDDIHPLVDVS--KKSRVSLEVLRKKTVLLLIS  356

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVD---RRSPWTGAKEDQFTLVKS  1614
             DLDI  E I  L  +Y E    P+   SQFEIVWLPIVD   R + W    + +F  ++S
Sbjct  357   DLDIATEDIDYLHLIYKEPSAKPA---SQFEIVWLPIVDIDPRSAAWDMNHQQKFEALQS  413

Query  1615  SMPWFSVSHPSKIDEAVYGYL  1677
              MPW++V HPS ++ AV  Y+
Sbjct  414   IMPWYTVHHPSILEPAVIRYI  434



>ref|XP_010029072.1| PREDICTED: uncharacterized protein LOC104419195 [Eucalyptus grandis]
 gb|KCW55916.1| hypothetical protein EUGRSUZ_I01714 [Eucalyptus grandis]
Length=722

 Score =   200 bits (508),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 158/473 (33%), Positives = 254/473 (54%), Gaps = 31/473 (7%)
 Frame = +1

Query  325   KIIP-AGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA  495
             K++P + + + K GD   +A S+D+ MM  V  TH  D     VKPLL L+EDI+ RA  
Sbjct  10    KVMPLSMQRLIKGGDRSMIALSDDSVMMKQVVETHAPDGREVDVKPLLLLVEDILNRATL  69

Query  496   TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSI  675
              +     +  T+ A     +E+K+  +  N  ++  +    R S E+     S  +AH+ 
Sbjct  70    NVDTLADTGSTKHAE---NMEDKIYQANFNATLDVLSPIIERISCELSAKALSGSEAHAT  126

Query  676   TLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEss  855
             TL++L +LA + WDAK V+T AAFA  YGEF LLA++  ++ LAKS+A + Q+  ++E S
Sbjct  127   TLTLLNMLAPFSWDAKLVLTLAAFAFNYGEFWLLAQIQSSNQLAKSMAVLKQMTLIMEHS  186

Query  856   essravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVT  1035
              + ++   KL     L   MLEVT  ++ LKE+ S        Y  S    L+ +++ VT
Sbjct  187   AALKSRFDKLN---SLIQAMLEVTRCVVKLKELPS-------AYISSDVPALSTAMAHVT  236

Query  1036  AEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQ  1215
                      A Y+ +++AV C+  I NL   G ++ +S  E  ++STL HKL  I   LQ
Sbjct  237   T--------AVYWTIRSAVACASQITNLTTFGYEFITSPTEAWDLSTLHHKLKNIYEHLQ  288

Query  1216  KAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKK  1395
             K +    Q I + ++    + L       H DN    + +I  ++D  P++ G     K+
Sbjct  289   KQIDICNQYIEEKRYLEAYQNLLNLFETIHIDNMKILKALIYPKDDILPLVEGTT--KKR  346

Query  1396  HGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSP  1572
               L++LRRK V LL+S L+I  + + +L  ++ ESK   +R E  Q+E+VW+P+VDR   
Sbjct  347   VNLEVLRRKNVLLLISGLEILQDELAILEQIHSESKTHATRHEIHQYELVWIPMVDRSVE  406

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             WT   + +F  ++S+MPW++V  P+ I +A    +    + R KP+L V+D Q
Sbjct  407   WTDPMQKKFETLQSTMPWYTVYDPNLIQKAAIRLIKEKWHFRNKPILVVLDPQ  459



>gb|KEH20741.1| sieve element occlusion protein [Medicago truncatula]
Length=704

 Score =   199 bits (507),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 151/475 (32%), Positives = 248/475 (52%), Gaps = 39/475 (8%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +++P     R      ++S+DT M   +RATH     H  V+PLL++++DI   A + IP
Sbjct  2     EMVPRKNQSRAMRHMFSASDDTIMTKQIRATHAPIEEHVDVRPLLNVVQDIFRHAASLIP  61

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEI-----IGGYSSNRDAH  669
               VQ  Q Q      ++++    S L++ +E   +   + S EI     +GG     DAH
Sbjct  62    DIVQGKQVQMG----VIKDDANESDLSDVLEISYHAINKISCEISCKCMMGG----GDAH  113

Query  670   SITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLE  849
             +  + +L +L++Y WDAK VI  AAFA   GEF L+A+LY T+ LAKSVA +  I + L 
Sbjct  114   ATAIGILGMLSSYSWDAKLVIALAAFAANLGEFWLVAQLYATNRLAKSVALLKHIHETLN  173

Query  850   ssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSP  1029
                    +  K   V  L   ML+VT  I+   E               L  +  +  +P
Sbjct  174   ---QVDDLGPKFEAVHHLLKAMLDVTDCIVEFHE---------------LPDQYIDHEAP  215

Query  1030  VTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGD  1209
              T     ++  A Y+++++ V C+  I  ++ +G+ Y +ST E  E+S+LT KL  + G 
Sbjct  216   ETLTASTLIPSAVYWIIRSIVACASHIFGIIGLGQGYMTSTTETWELSSLTQKLDSMNGH  275

Query  1210  LQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEM  1389
             LQ  +    Q +   K     + L+     +H DN    + +I  ++DP P+  G+    
Sbjct  276   LQNQLAICRQHLDDNKQKEAFQTLQHLFETSHQDNIKVLKALIRCKDDPLPLSDGS--TK  333

Query  1390  KKHGLDILRRKYVFLLVSDL-DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR  1566
             ++  +++LR+K V L ++DL  I ++ + +   MY ES+QD +R ESQ+E+VW+PIV++ 
Sbjct  334   QRVSIEVLRKKIVLLYITDLHHISDQEVVIFEQMYQESRQDSTRLESQYELVWIPIVEKG  393

Query  1567  SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             +PWT  K+ +F  ++S MPW+SV  PS ++ A   Y+        KP+L V+D Q
Sbjct  394   APWTETKQ-KFERLQSMMPWYSVYDPSLLEPASIRYIKEVWLFNTKPMLVVLDPQ  447



>emb|CBI34823.3| unnamed protein product [Vitis vinifera]
Length=1392

 Score =   202 bits (515),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 162/480 (34%), Positives = 252/480 (53%), Gaps = 38/480 (8%)
 Frame = +1

Query  298   SQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDI  477
             S++ AP   ++I   RG  K  D      + AMM  + ATH  D     VKPL  L+EDI
Sbjct  754   SRIAAPSLTQLIRGERGRIKLSD------ENAMMKQIYATHTPDGREVDVKPLFQLVEDI  807

Query  478   MPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSN  657
             + RA   +     + QT+    D    +K   +     +EA ++   R + EI    SS 
Sbjct  808   LSRASPAVDPLFLTAQTRVETWD----DKTQQASFIAMLEALSFTIDRVACEITYKSSSG  863

Query  658   RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIP  837
              DAH+ TLS+   L+ + W+AK VIT AAFA  YGEF LLA++Y ++ LAKSVA + Q+P
Sbjct  864   EDAHATTLSIFNQLSYFPWEAKLVITLAAFALSYGEFWLLAQIYSSNQLAKSVAILKQVP  923

Query  838   DLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAE  1017
              +LE S S +     L  + +    M +VT  II  K + S            +Y  ++ 
Sbjct  924   VILEHSASLKPRFDALNNLIR---AMTDVTKCIIEFKGLPS------------VY--ISH  966

Query  1018  SLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDY--YssteeeleistltHKL  1191
               +P+     +I   A Y+ ++A + C+  I +L ++G ++   SST E  E+STL HK+
Sbjct  967   DAAPLVTAMAHI-PTAVYWTIRAVIACASQISSLSSLGHEHALMSSTNETWELSTLAHKI  1025

Query  1192  SYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIH  1371
               IL  L   +    Q I +  +    ++L   L     DN    + +I  + D  P++ 
Sbjct  1026  KNILDLLNNQLALCYQYIEEKMNLETYQMLLNLLEGVQIDNMKLLKALIYAKEDLQPLLD  1085

Query  1372  GAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
             G+    ++  LD+LRRK V LL+S LD P + +++L  +Y ES+   +R E  +EIVW+P
Sbjct  1086  GST--KRRVNLDVLRRKNVLLLISSLDFPRDELSILEQIYNESRVHATRME--YEIVWIP  1141

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             IVDR + WT   + QF  ++++MPW+SV  PS I++ V  ++    + R KP+L V+D Q
Sbjct  1142  IVDRFAEWTDPLQSQFETLQTTMPWYSVYSPSLIEKPVIRFIREVWHFRNKPILVVLDPQ  1201


 Score =   194 bits (494),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 160/509 (31%), Positives = 258/509 (51%), Gaps = 42/509 (8%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVV--APLQAKI------IPAGRGIRKRGDFLASSEDT  390
             P QQ   P++      A     QV+   P+Q ++      +P  +  R     +  S+D 
Sbjct  21    PTQQLMKPSSMQQ---ANPGSRQVINPTPMQHEVTTKINPVPLHQLTRHDRSMITMSDDN  77

Query  391   AMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVV  570
              MM  + ATH  D   + VKPL  L+EDI+ RA   +   +   QT+    D    ++  
Sbjct  78    IMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISDAQTRIETSD----DRTH  133

Query  571   HSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFA  750
              +     +EA ++   R + +I        DAH+ TLS+  LL +Y W+AK V+T +AFA
Sbjct  134   QASFIALLEALSFTIDRIACQIAYKSLGGGDAHATTLSIFDLLTSYSWEAKLVLTLSAFA  193

Query  751   QQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTH  930
               YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + K    M+ +T 
Sbjct  194   VTYGEFWLLAQISSSNQLAKSMAILKQVPIVLEYSGLLKPRFDALNNLIK---AMVAITR  250

Query  931   KIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasyyvvkaavTCSLV  1107
              II  KE+     S  V         LA +L+ + TA    I         ++ V C+  
Sbjct  251   CIIEFKELPPMYISQDVS-------ALATALTHIPTAVYWTI---------RSVVACATQ  294

Query  1108  ILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
             I  L ++G +Y+ S   E  E+STL HK++ IL  L+K +    Q I   +     + L 
Sbjct  295   ITTLTSMGHEYWISATNEAWELSTLAHKINSILDLLKKQLTLCHQYIDDKRSAEAFQTLL  354

Query  1285  ETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNE  1464
                   H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I  +
Sbjct  355   NLFESLHIDNMKILRALISPKDDVLPLLEGST--KRRVNIDVLRRKNVLLLLSGLSISQD  412

Query  1465  VITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHP  1644
              +++L  +Y ES+   +R E Q+E+VW+P+VDR   WT A +++F  ++++MPW+SV  P
Sbjct  413   ELSVLEQIYNESRVHGNRMEYQYEVVWIPVVDRSVVWTDAMQNRFETLQATMPWYSVYTP  472

Query  1645  SKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++ID AV  ++    + R KP+L V+D Q
Sbjct  473   TQIDRAVIRFIKEVWHFRNKPILVVLDPQ  501



>ref|XP_010695991.1| PREDICTED: uncharacterized protein LOC104908569 [Beta vulgaris 
subsp. vulgaris]
Length=698

 Score =   199 bits (505),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 150/445 (34%), Positives = 242/445 (54%), Gaps = 39/445 (9%)
 Frame = +1

Query  358   RGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG-YVQSVQ-  525
             RGD    A+S+D+ M+  ++ TH  D     V+P+L +IED++ RA  +I G ++ S++ 
Sbjct  13    RGDRRMFAASDDSTMLKQIQGTHAPDGRDVDVRPILDIIEDVLKRAAPSIEGAHIDSMED  72

Query  526   -TQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLA  702
              T  A +DA           NE +EA A+   + S EI    S   DAH+ T+S+L LL+
Sbjct  73    KTSGAVIDA-----------NEMLEALAFIIQKVSCEITCKCSGGGDAHATTMSLLHLLS  121

Query  703   NYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssK  882
             NY WDAK  I  AA A  YGEFGL+ +L+PT PLAKSVA + Q+PDL+E S + ++   +
Sbjct  122   NYSWDAKVAIALAALAIAYGEFGLVVQLFPTHPLAKSVAILKQLPDLMEHSNALKS---R  178

Query  883   LREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMak  1062
                +  L   ML+VT +I+  K++               ++ ++    P++    +I   
Sbjct  179   FEALNSLIGAMLDVTKRIMEFKQLP--------------HQYISPEQPPLSVAMTHI-PT  223

Query  1063  asyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQE  1242
             A+Y+ +++ V C+  I +L+ +  +Y +ST E  E+S+L HK   I   L + +    Q 
Sbjct  224   AAYWTIRSVVACATQIASLIGMSYEYVTSTTEAWELSSLAHKERNIHDHLMQQLLLCYQH  283

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
             I + KH      L         DN    + +I  ++D  P+  G+     +  ++ LRRK
Sbjct  284   IDEKKHVEAYHNLVRAFELPQLDNTRILKHLIYMKDDIQPLHEGS--TKSRVPVEALRRK  341

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              V LL+SDLD+  E + +L H+Y ES+  P   E Q+EIVW+PI+D   PWT A++ +F 
Sbjct  342   SVLLLISDLDVSQEELMILDHIYRESRMRP---ELQYEIVWVPIIDNSVPWTDAEQHKFE  398

Query  1603  LVKSSMPWFSVSHPSKIDEAVYGYL  1677
              ++S M W+++ HP  ++ A   Y+
Sbjct  399   QLQSLMSWYTLHHPKVMEPAAIRYI  423



>ref|XP_006432374.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
 gb|ESR45614.1| hypothetical protein CICLE_v10000431mg [Citrus clementina]
Length=716

 Score =   199 bits (505),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 150/461 (33%), Positives = 244/461 (53%), Gaps = 28/461 (6%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             IR+    ++ S+D  MM  ++ATH  D     VKPL +L+EDI+ RA      +   +  
Sbjct  14    IRRDRSMVSISDDNMMMRQIQATHAPDGREVDVKPLFNLVEDILNRA-----TFQTDIDE  68

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A+    +E+    +G    I+A ++   R S EI        DAH+ TLS+  +L+NY
Sbjct  69    TDAQAHLEIEDNAQQAGFLAMIDAISFTIDRISCEIACKALGGSDAHATTLSLFSMLSNY  128

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E +        +  
Sbjct  129   SWDAKLVLALAAFALYYGEFWLLAQIYSSNQLAKSMAILKQLPSIMEHTSGPLKS--RFD  186

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   M+ VT  I+  K++ S        Y      E + +++ +          A 
Sbjct  187   TLNNLIKAMMGVTRCIVEFKDMPS-------NYITQDAPEFSSAMAHIP--------IAV  231

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V C+  I  L  +G ++  ST E  E+STL HKL  I   L+K +    + I 
Sbjct  232   YWTIRSVVACATQITTLTGMGHEFVISTSEAWELSTLAHKLKNIHESLKKLMATCYRHIE  291

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + K     ++L +     H DN    + +I  ++D  P++ G+    ++  +++LRRK V
Sbjct  292   EKKSNEAYQMLVKLFDSIHIDNMKVLKALIYAKDDLQPLVDGS--TKRRVNIEVLRRKNV  349

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLDI  E +++L  +Y ES+   +R ES +E+VW+PIVD    W    + +F  +
Sbjct  350   LLLISDLDISQEELSILEQIYNESRLHLTRQESHYEVVWIPIVDHFIHWDDPTQKKFETL  409

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +SSMPW++V HP+ ID AV  Y+    + + KP+L V+D Q
Sbjct  410   QSSMPWYTVYHPTLIDRAVIRYVKDVWHFKNKPILVVLDPQ  450



>ref|XP_010663068.1| PREDICTED: uncharacterized protein LOC100243366 [Vitis vinifera]
Length=706

 Score =   199 bits (505),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 159/460 (35%), Positives = 251/460 (55%), Gaps = 34/460 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R    FL  S+DT MM  ++ATH  D    +VKP++ +IEDI+  A   I G   ++   
Sbjct  20    RDHPKFLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGN  76

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
             P  L+A LE++    GL+  +E  AY   + S E+    S   DAH+ T++V  +L++Y 
Sbjct  77    PPHLEA-LEDRSSQDGLHGILEELAYTIQKLSCELSCKCSGGGDAHATTMAVFNMLSHYS  135

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YGEF L+ +LY T+PLAKSVA + Q+PD++E      ++ S+   
Sbjct  136   WDAKVVLSLAAFAANYGEFWLVIQLYATNPLAKSVALLKQLPDIIE---HGNSLKSRFDA  192

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V KL   ML+VT  II  KE+             SLY  ++  + P+++   +I   A+Y
Sbjct  193   VTKLIKVMLDVTKSIIEFKELP------------SLY--ISPDMPPMSSTMAHI-PTAAY  237

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             + ++  V C+  I++L+    +Y S T E  E+STL HK+S I   L + +    Q I +
Sbjct  238   WTIRGIVACASQIISLIGTSNEYTSWTTESWELSTLAHKVSSIHEHLIQQLIICHQHIEE  297

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              K       L       H DN+   + +I  + D  P++ G      K  ++ILRRK V 
Sbjct  298   KKQFESYNNLVRIFEMPHLDNQKVLKTLIYAKEDIQPLLQGN----TKVNIEILRRKTVL  353

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+SDLD+ +E I +L   Y E      +++ ++E+VWL +VDR  P T   +++F  ++
Sbjct  354   LLISDLDLLHEEIVILHKFYREQ----IKSDVEYEVVWLSVVDRSKPLTEENQNKFHELQ  409

Query  1612  SSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               MPW+++ HPS ++ AV  Y+    +  +K +L V+D Q
Sbjct  410   KEMPWYTLLHPSLLEPAVVRYIKEVWHFTKKAILVVLDLQ  449



>ref|XP_008449999.1| PREDICTED: uncharacterized protein LOC103491716 [Cucumis melo]
Length=714

 Score =   198 bits (504),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 153/463 (33%), Positives = 245/463 (53%), Gaps = 31/463 (7%)
 Frame = +1

Query  349   IRKRGDFLAS-SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQ  525
             + K   FL++ S+D  MM  + ATHD D      + LL L+E+I+ RA  T+        
Sbjct  15    LAKGNKFLSAISDDNVMMKQILATHDPDDRDVDTRSLLRLVENILKRA--TLAADATGSY  72

Query  526   TQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLAN  705
              Q   L+++ E     +GL   +EA +Y   R S EI        D H+ TL++  +LA+
Sbjct  73    EQ---LESMEETGTNQAGLTTMLEALSYTIDRISSEISYKALEGIDPHATTLAIFNMLAS  129

Query  706   YWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKL  885
             Y W AK V+T AAFA  YGEF LLA++Y  + LAK++A + Q+P + E S + +     L
Sbjct  130   YEWGAKLVLTLAAFALNYGEFWLLAQIYSQNQLAKAMAILKQLPGIFEHSVALKPKFDAL  189

Query  886   REVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMaka  1065
             ++   L   +L VT  +I LKE+ S   S +V    ++   +A   + V     +I+   
Sbjct  190   KD---LVAAILNVTWCVIDLKELPSAYISQEVP---AMSTAVAHIPTAVYWTIRSIV---  240

Query  1066  syyvvkaavTCSLVILNLLAVGRDY-YssteeeleistltHKLSYILGDLQKAVQKSTQE  1242
                      +C+  I +L ++G +   S++ +  E+STL HKL  I   L+K +    Q 
Sbjct  241   ---------SCATQITSLTSMGYELALSTSTDSWELSTLAHKLKNICDHLKKKLVLCHQY  291

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
             I + K T   ++L      TH DN    + +I  ++D  P++ G+    ++  LD+L+RK
Sbjct  292   IEEKKDTESFQMLVNLFGMTHLDNMKVLKALIYPKDDLQPLVDGS--TGQRVNLDVLKRK  349

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              V LL+SDL+I ++ +++L  +Y ES+    R ESQFE+VW+PIVD    W  + + +F 
Sbjct  350   NVLLLISDLNISHDELSILDQLYNESRAQGMRVESQFEVVWIPIVDHSIKWNDSMQKRFE  409

Query  1603  LVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
              + S MPW  V HP+ I +AV  ++      R +P+L V+D Q
Sbjct  410   YLLSIMPWHIVHHPTLISKAVTRFIGEVWQFRNRPILVVLDPQ  452



>ref|XP_006471327.1| PREDICTED: uncharacterized protein LOC102619778 [Citrus sinensis]
Length=716

 Score =   197 bits (502),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 150/461 (33%), Positives = 244/461 (53%), Gaps = 28/461 (6%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             IR+    ++ S+D  MM  ++ATH  D     VKPL +L+EDI+ RA      +   +  
Sbjct  14    IRRDRSMVSISDDNMMMRQIQATHAPDGREVDVKPLFNLVEDILNRA-----TFQTDIDE  68

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
               A+    +E+    +G    I+A ++   R S EI        DAH+ TLS+  +L+NY
Sbjct  69    TDAQAHLEIEDNAQQAGFLAMIDAISFTIDRISCEIACKALGGSDAHATTLSLFSMLSNY  128

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+  AAFA  YGEF LLA++Y ++ LAKS+A + Q+P ++E +        +  
Sbjct  129   SWDAKLVLALAAFALYYGEFWLLAQIYSSNQLAKSMAILKQLPSIMEHTSGPLKS--RFD  186

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              +  L   M+ VT  I+  K++ S        Y      E + +++ +          A 
Sbjct  187   TLNNLIKAMMGVTRCIVEFKDMPS-------NYITQDAPEFSSAMAHIP--------IAV  231

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V C+  I  L  +G ++  ST E  E+STL HKL  I   L+K +    + I 
Sbjct  232   YWTIRSVVACATQITTLTGMGHEFVISTSEAWELSTLAHKLKNIHESLKKLMATCYRHIE  291

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + K     ++L +     H DN    + +I  ++D  P++ G+    ++  +++LRRK V
Sbjct  292   EKKSHEAYQMLVKLFDSIHIDNMKVLKALIYAKDDLQPLVDGS--TKRRVNVEVLRRKNV  349

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLDI  E +++L  +Y ES+   +R ES +E+VW+PIVD    W    + +F  +
Sbjct  350   LLLISDLDISQEELSILEQIYNESRLHLTRQESHYEVVWIPIVDHFIHWDDPTQKKFETL  409

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +SSMPW++V HP+ ID AV  Y+    + + KP+L V+D Q
Sbjct  410   QSSMPWYTVYHPTLIDRAVIRYVKDVWHFKNKPILVVLDPQ  450



>gb|KHG12713.1| hypothetical protein F383_04328 [Gossypium arboreum]
Length=762

 Score =   198 bits (503),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 155/466 (33%), Positives = 245/466 (53%), Gaps = 42/466 (9%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RG  L+ S+D  MM+ + ATH  D   + V+PLL+L+EDI+ RA   +   V+       
Sbjct  147   RGSMLSMSDDNVMMNQILATHAPDGREFDVRPLLYLVEDILNRATQHVDFLVKGT-----  201

Query  538   RLDAI-LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
              LD + LEE+   +     +EA  Y   R + E+        DAH+ T ++  LL++Y W
Sbjct  202   -LDQVELEERAQAANHIAMLEALTYTIDRIACELSYKALGGSDAHATTTAIFNLLSSYTW  260

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             DAK VI+ +AFA  YGEF LLA++Y T+ LAKS+A + Q+P LLE +   +     L  +
Sbjct  261   DAKLVISLSAFALNYGEFWLLAQIYSTNQLAKSMAVLRQLPSLLEHAAPLKPRFDALNSL  320

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasy  1071
              +    M++VT  ++  KE       L +KY       LA +++ + TA    I      
Sbjct  321   IR---TMMDVTRCVVQFKE-------LPLKYISPDAPALATAMTHIPTAVYWTI------  364

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
                ++ V C+  I +L   G ++  ST E  E+STL HKL  I   L++ +    + I +
Sbjct  365   ---RSMVACATQISSLTNAGHEFGVSTTESWELSTLAHKLRNIYEHLKQQLSYCYKHIDE  421

Query  1252  IKHTIKRKILEETLA-----RTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILR  1416
                 +  +I +  LA       H DN  + + +I  ++D  P++ GA    ++  LD+LR
Sbjct  422   ---RMDVEIYQMLLAIFDPNVLHIDNMKALKALIYDKDDKQPLLDGA--TKRQVSLDVLR  476

Query  1417  RKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR-SPWTGAKED  1593
             RK V LL+S L+  N+ + +L  +Y ES+   +R ESQ+E+VW+PIVD    P     + 
Sbjct  477   RKNVLLLISSLEFANDELAILEQIYNESRIHATRLESQYEVVWIPIVDHSIIPLPEEMQT  536

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +F  ++S MPW+SV  P  I + V  ++    + R KP+L V+D Q
Sbjct  537   KFENLQSPMPWYSVQDPLFIKKPVIRFIKEVWHFRTKPILVVLDPQ  582



>emb|CBI14908.3| unnamed protein product [Vitis vinifera]
Length=708

 Score =   197 bits (502),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 158/460 (34%), Positives = 251/460 (55%), Gaps = 32/460 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R    FL  S+DT MM  ++ATH  D    +VKP++ +IEDI+  A   I G   ++   
Sbjct  20    RDHPKFLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGN  76

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
             P  L+A LE++    GL+  +E  AY   + S E+    S   DAH+ T++V  +L++Y 
Sbjct  77    PPHLEA-LEDRSSQDGLHGILEELAYTIQKLSCELSCKCSGGGDAHATTMAVFNMLSHYS  135

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YGEF L+ +LY T+PLAKSVA + Q+PD++E      ++ S+   
Sbjct  136   WDAKVVLSLAAFAANYGEFWLVIQLYATNPLAKSVALLKQLPDIIE---HGNSLKSRFDA  192

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V KL   ML+VT  II  KE+             SLY  ++  + P+++   +I   A+Y
Sbjct  193   VTKLIKVMLDVTKSIIEFKELP------------SLY--ISPDMPPMSSTMAHI-PTAAY  237

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             + ++  V C+  I++L+    +Y S T E  E+STL HK+S I   L + +    Q I +
Sbjct  238   WTIRGIVACASQIISLIGTSNEYTSWTTESWELSTLAHKVSSIHEHLIQQLIICHQHIEE  297

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              K       L       H DN+   + +I  + D  P++ G      +  ++ILRRK V 
Sbjct  298   KKQFESYNNLVRIFEMPHLDNQKVLKTLIYAKEDIQPLLQGN--TKARVNIEILRRKTVL  355

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+SDLD+ +E I +L   Y E      +++ ++E+VWL +VDR  P T   +++F  ++
Sbjct  356   LLISDLDLLHEEIVILHKFYREQ----IKSDVEYEVVWLSVVDRSKPLTEENQNKFHELQ  411

Query  1612  SSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               MPW+++ HPS ++ AV  Y+    +  +K +L V+D Q
Sbjct  412   KEMPWYTLLHPSLLEPAVVRYIKEVWHFTKKAILVVLDLQ  451



>ref|XP_004171463.1| PREDICTED: uncharacterized protein LOC101229786 [Cucumis sativus]
Length=714

 Score =   196 bits (499),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 243/465 (52%), Gaps = 35/465 (8%)
 Frame = +1

Query  349   IRKRGDFLAS-SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRA--HATIPGYVQS  519
             + K   FL++ S+D  MM  + ATHD D      + LL L+E+I+ RA   A   G  + 
Sbjct  15    LAKGNKFLSAISDDNVMMKQILATHDPDDRDVDTRSLLRLVENILKRATLAADATGSYEQ  74

Query  520   VQTQPARLDAILEEKVVH-SGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKL  696
             +++        LEE   H +GL   +EA +Y   R S EI        D H+ TL++  +
Sbjct  75    LES--------LEETGTHQAGLTTMLEALSYTIDRISSEISYKALEGIDPHATTLAIFNM  126

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             LA+Y WDAK V+T AAFA  YGEF LLA++Y  + LAK++A + Q+P + E S + +   
Sbjct  127   LASYRWDAKLVLTLAAFALNYGEFWLLAQIYSQNQLAKAMAILKQLPGIFEHSIALKPKF  186

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIM  1056
               L+E   L   +L+VT  II LKE+ S   S +V    ++   +A   + V     +I+
Sbjct  187   DALKE---LVAAILDVTWCIIDLKELPSAYISQEVP---AMSTAVAHIPTAVYWTIRSIV  240

Query  1057  akasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKST  1236
             + A+      ++   L     L+   D +       E+STL HKL  I   L+K +    
Sbjct  241   SSATQITSLTSMGYELA----LSTSTDAW-------ELSTLAHKLKNICDHLKKKLVLCH  289

Query  1237  QEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILR  1416
             Q I + K     ++L       H DN    + +I  ++D  P++ G+    ++  LD+L+
Sbjct  290   QHIEEKKDIESFQMLVNLFEMNHLDNMKVLKALIYPKDDLQPLVDGS--TGQRVNLDVLK  347

Query  1417  RKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQ  1596
             RK V LL+SDL+I ++ +++L  +Y ES+    R ESQFE+VW+PIVD    W  + + +
Sbjct  348   RKNVLLLISDLNISHDELSILDQLYNESRAQGMRVESQFEVVWIPIVDHSIKWNDSMQKR  407

Query  1597  FTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             F  + S MPW  V HP+ I +AV  ++      R +P+L V+D Q
Sbjct  408   FEYLLSIMPWHIVHHPTLISKAVTRFIGEVWQFRNRPILVVLDPQ  452



>ref|XP_004145690.1| PREDICTED: uncharacterized protein LOC101221710 [Cucumis sativus]
 gb|KGN58227.1| hypothetical protein Csa_3G597260 [Cucumis sativus]
Length=714

 Score =   196 bits (498),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 243/465 (52%), Gaps = 35/465 (8%)
 Frame = +1

Query  349   IRKRGDFLAS-SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRA--HATIPGYVQS  519
             + K   FL++ S+D  MM  + ATHD D      + LL L+E+I+ RA   A   G  + 
Sbjct  15    LAKGNKFLSAISDDNVMMKQILATHDPDDRDVDTRSLLRLVENILKRATLAADATGSYEQ  74

Query  520   VQTQPARLDAILEEKVVH-SGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKL  696
             +++        LEE   H +GL   +EA +Y   R S EI        D H+ TL++  +
Sbjct  75    LES--------LEETGTHQAGLTTMLEALSYTIDRISSEISYKALEGIDPHATTLAIFNM  126

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             LA+Y WDAK V+T AAFA  YGEF LLA++Y  + LAK++A + Q+P + E S + +   
Sbjct  127   LASYRWDAKLVLTLAAFALNYGEFWLLAQIYSQNQLAKAMAILKQLPGIFEHSIALKPKF  186

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIM  1056
               L+E   L   +L+VT  II LKE+ S   S +V    ++   +A   + V     +I+
Sbjct  187   DALKE---LVAAILDVTWCIIDLKELPSAYISQEVP---AMSTAVAHIPTAVYWTIRSIV  240

Query  1057  akasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKST  1236
             + A+      ++   L     L+   D +       E+STL HKL  I   L+K +    
Sbjct  241   SSATQITSLTSMGYELA----LSTSTDAW-------ELSTLAHKLKNICDHLKKKLVLCH  289

Query  1237  QEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILR  1416
             Q I + K     ++L       H DN    + +I  ++D  P++ G+    ++  LD+L+
Sbjct  290   QHIEEKKDIESFQMLINLFEMNHLDNMKVLKALIYPKDDLQPLVDGS--TGQRVNLDVLK  347

Query  1417  RKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQ  1596
             RK V LL+SDL+I ++ +++L  +Y ES+    R ESQFE+VW+PIVD    W  + + +
Sbjct  348   RKNVLLLISDLNISHDELSILDQLYNESRAQGMRVESQFEVVWIPIVDHSIKWNDSMQKR  407

Query  1597  FTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             F  + S MPW  V HP+ I +AV  ++      R +P+L V+D Q
Sbjct  408   FEYLLSIMPWHIVHHPTLISKAVTRFIGEVWQFRNRPILVVLDPQ  452



>ref|XP_003633839.2| PREDICTED: uncharacterized protein LOC100254392 [Vitis vinifera]
Length=766

 Score =   195 bits (496),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 160/509 (31%), Positives = 258/509 (51%), Gaps = 42/509 (8%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVV--APLQAKI------IPAGRGIRKRGDFLASSEDT  390
             P QQ   P++      A     QV+   P+Q ++      +P  +  R     +  S+D 
Sbjct  21    PTQQLMKPSSMQQ---ANPGSRQVINPTPMQHEVTTKINPVPLHQLTRHDRSMITMSDDN  77

Query  391   AMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVV  570
              MM  + ATH  D   + VKPL  L+EDI+ RA   +   +   QT+    D    ++  
Sbjct  78    IMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISDAQTRIETSD----DRTH  133

Query  571   HSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFA  750
              +     +EA ++   R + +I        DAH+ TLS+  LL +Y W+AK V+T +AFA
Sbjct  134   QASFIALLEALSFTIDRIACQIAYKSLGGGDAHATTLSIFDLLTSYSWEAKLVLTLSAFA  193

Query  751   QQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTH  930
               YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + K    M+ +T 
Sbjct  194   VTYGEFWLLAQISSSNQLAKSMAILKQVPIVLEYSGLLKPRFDALNNLIK---AMVAITR  250

Query  931   KIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasyyvvkaavTCSLV  1107
              II  KE+     S  V         LA +L+ + TA    I         ++ V C+  
Sbjct  251   CIIEFKELPPMYISQDVS-------ALATALTHIPTAVYWTI---------RSVVACATQ  294

Query  1108  ILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
             I  L ++G +Y+ S   E  E+STL HK++ IL  L+K +    Q I   +     + L 
Sbjct  295   ITTLTSMGHEYWISATNEAWELSTLAHKINSILDLLKKQLTLCHQYIDDKRSAEAFQTLL  354

Query  1285  ETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNE  1464
                   H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I  +
Sbjct  355   NLFESLHIDNMKILRALISPKDDVLPLLEGS--TKRRVNIDVLRRKNVLLLLSGLSISQD  412

Query  1465  VITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHP  1644
              +++L  +Y ES+   +R E Q+E+VW+P+VDR   WT A +++F  ++++MPW+SV  P
Sbjct  413   ELSVLEQIYNESRVHGNRMEYQYEVVWIPVVDRSVVWTDAMQNRFETLQATMPWYSVYTP  472

Query  1645  SKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++ID AV  ++    + R KP+L V+D Q
Sbjct  473   TQIDRAVIRFIKEVWHFRNKPILVVLDPQ  501



>emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera]
Length=693

 Score =   194 bits (493),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 157/460 (34%), Positives = 249/460 (54%), Gaps = 36/460 (8%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R    FL  S+DT MM  ++ATH  D    +VKP++ +IEDI+  A   I G   ++   
Sbjct  20    RDHXKFLRMSDDTTMMKQIQATHTPDGREVEVKPIVQVIEDILNHATPAIDG---TLYGN  76

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
             P  L+A LE++    GL   +E  AY   + S +  GG     DAH+ T++V  +L++Y 
Sbjct  77    PXHLEA-LEDRSSQDGLXGILEELAYTIQKLSCKCSGG----GDAHATTMAVFNMLSHYS  131

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK  ++ AAFA  YGEF L+ +LY T+PLAKSVA + Q+PD++E      ++ S+   
Sbjct  132   WDAKVXLSLAAFAANYGEFWLVIQLYATNPLAKSVALLKQLPDIIE---HGNSLKSRFDA  188

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V KL   ML+VT  II  KE+             SLY  ++  + P+++   +I   A+Y
Sbjct  189   VTKLIXVMLDVTKSIIEFKELP------------SLY--ISPDMPPMSSXMAHI-PTAAY  233

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             + ++  V C+  I++L+    +Y S T E  E+STL HK+S I   L + +    Q I +
Sbjct  234   WTIRGIVACASQIISLIGTSNEYTSWTTESWELSTLAHKVSSIHEHLIQQLIJCHQHIEE  293

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              K       L       H DN+   + +I  + D  P++ G      +  ++ILRRK V 
Sbjct  294   KKQFESYNNLVRIFEMPHLDNQKVLKTLIYAKEDIQPLLQGN--TKARVNIEILRRKTVL  351

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+SDLD+ +E I +L   Y E      +++ ++E+VWLP+VDR  P     +++F  ++
Sbjct  352   LLISDLDLLHEEIVILHKFYREQ----IKSDVEYEVVWLPVVDRSKPLNEENQNKFHELQ  407

Query  1612  SSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               MPW+++ HPS ++ AV  Y+    +  +K +L V+D Q
Sbjct  408   KEMPWYTLLHPSLLEPAVVRYIKEVWHFTKKAILVVLDLQ  447



>ref|XP_004236294.1| PREDICTED: uncharacterized protein LOC101251765 [Solanum lycopersicum]
Length=723

 Score =   192 bits (488),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 153/487 (31%), Positives = 250/487 (51%), Gaps = 38/487 (8%)
 Frame = +1

Query  286   TAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHL  465
             +A  ++ V P Q  ++   R I       + S+D AM   +  THD D     V  +LH+
Sbjct  8     SAATTRGVKPTQHAMVKRERPI------FSLSDDHAMFKKILDTHDPDGREVDVDVILHI  61

Query  466   IEDIMPRAH-ATIPGYVQSVQTQ--PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEI  636
             +ED+   ++ A + G +    T    A + A+  E+      +  +E  AY  ++ S E+
Sbjct  62    VEDVFQHSYPAAMDGVLNGTGTDHLEANVGALKLEEKTSLAFDGILEGLAYIIHKVSCEL  121

Query  637   IGGYSSN-RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKS  813
                 SS   D HS T+SVL++L+NY WDAK VI  AAFA  YGEF L+A+L+ T PLAKS
Sbjct  122   TCNCSSGGHDTHSTTMSVLEMLSNYHWDAKLVICLAAFAVTYGEFWLVAQLFGTHPLAKS  181

Query  814   VATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRV  993
             VA + Q+PD++E   S ++    + E+ K    +L+VT  I+  K++             
Sbjct  182   VAILKQLPDIMEHHGSLKSRFDAINELIK---AILDVTKSIMEFKKLP------------  226

Query  994   SLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-elei  1170
               ++ + E   P++    ++   A Y+ +K+ V C+  +  L  +  D   +T     E+
Sbjct  227   --FQYITEDQPPLSVAITHV-PTAVYWTIKSIVACAFQLTTLSGMSYDMIVATTADTWEM  283

Query  1171  stltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGEN  1350
             S+ THKL  I   L   + +  Q I +  H    ++L      T  DN      +I  ++
Sbjct  284   SSSTHKLKNISKHLGAELNRCYQHIQEKMHIEYFQMLVHLFEATQFDNMKIMRAMIYIKD  343

Query  1351  DPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ  1530
             D  P+    G    +  +++LRRK V LL+SDL+  +E I +L  +YLES+   SR E Q
Sbjct  344   DLLPL--EVGTTQTRAIVEVLRRKTVLLLLSDLEASHEEILVLSQIYLESR---SRPEIQ  398

Query  1531  FEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPL  1698
             +EIVWLPIVDR   W   +E +F  +++ MPW+++ HPS ++ A+  ++  +    +K +
Sbjct  399   YEIVWLPIVDRSKEWNEEQEQKFKELQALMPWYTLHHPSLLEPAIAKFVKEKWHFSKKMM  458

Query  1699  LAVVDTQ  1719
             L  +D Q
Sbjct  459   LVTLDPQ  465



>ref|XP_010029069.1| PREDICTED: uncharacterized protein LOC104419193 [Eucalyptus grandis]
Length=705

 Score =   191 bits (486),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 155/472 (33%), Positives = 248/472 (53%), Gaps = 51/472 (11%)
 Frame = +1

Query  334   PAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
             PA + + K GD   +  S D  MM  V  TH  D +   VK +L ++EDI+   HAT+  
Sbjct  10    PAMQRLIKGGDRSMITMSGDYVMMKQVEETHRPDGIEVNVKRVLQIVEDILK--HATLNA  67

Query  508   YVQSVQTQPAR---LDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSIT  678
                ++   P     ++ ILEE  +   LN  ++A                 +  D H+ T
Sbjct  68    DTSAIAGSPVHGEIVNDILEENRIIDQLN--LKAL----------------TGVDDHANT  109

Query  679   LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             L+V  +LA++ WDAK V+T AA A  YGEF LLA+   ++ LAK++A + Q+  +++   
Sbjct  110   LAVFNMLAHFSWDAKLVLTMAALAFHYGEFWLLAQARYSNQLAKAMAMLKQMTSIMDHLG  169

Query  859   ssravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTA  1038
               +     L  +  L   MLEVT  ++ LKE+ S   S +V         L+++++ VT 
Sbjct  170   ELK----SLDALNSLIQAMLEVTRCVVKLKELASAYISREVP-------ALSDAMAHVTT  218

Query  1039  EQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQK  1218
                     A Y+ +++AV C+  I NL   G +Y +ST E  E+STL HKL  I   LQK
Sbjct  219   --------AVYWTIRSAVACASQITNLTTFGYEYIASTTEAWELSTLNHKLKNIYEHLQK  270

Query  1219  AVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKH  1398
              +    Q I + ++    + L       H DN    + +I  ++D  P++ G     K+ 
Sbjct  271   QIDICNQYIEEKQYLEAYQTLLNLFETIHNDNMKILKALIYPKDDILPLVEGNS--KKRV  328

Query  1399  GLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSPW  1575
              +++LRR+ V LL+S LDI  + +++L  M+ ESK   ++ E  Q+E+VW+P+VD    W
Sbjct  329   NIEVLRRRNVLLLISWLDISQDELSILEDMHSESKLHATQHEIHQYEVVWIPMVDCSVKW  388

Query  1576  TGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             T   + QF  ++S+MPW++V HPS IDEAV  ++    + R+KP+L ++D Q
Sbjct  389   TDPMQKQFEALQSTMPWYTVYHPSLIDEAVIRFIKEKWHYRKKPILVLLDPQ  440



>gb|KHG00716.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=706

 Score =   191 bits (486),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 256/481 (53%), Gaps = 37/481 (8%)
 Frame = +1

Query  289   APPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLI  468
             AP S  ++ L +K   + + +R      A+S+D AMM  +++TH  D     VKP+L +I
Sbjct  3     APISFSLSSLASK---SQQLVRNERRMFAASDDGAMMKQIQSTHAPDGRVVDVKPILQVI  59

Query  469   EDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGY  648
             E+++   H  IP    +++     +DA L++    S ++ A++A AY  ++   E+    
Sbjct  60    ENVL---HHIIPNIDHAMKGGTGHIDA-LDDLTTSSAVDGALDALAYIVHKICCEVSCKC  115

Query  649   SSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIV  828
             S   DAH+ T+ +L +L++Y WDAK V+T AAFA  +GEF L+ +L  ++ LAKSVA + 
Sbjct  116   SGGGDAHATTMGILNMLSSYSWDAKVVLTLAAFAVNFGEFWLIVQLCTSNSLAKSVALLK  175

Query  829   QIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKE  1008
             Q+PDLLE S + +     L    KL + M++VT  I+   E+ SE  S+ V         
Sbjct  176   QLPDLLEHSPTLKPHFDALN---KLINAMIDVTKCIVEFTELPSEFISIDV---------  223

Query  1009  LAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHK  1188
                   P++    +I   A+Y+++ + V C+  I  L+ +  ++ +ST E  E+S+L HK
Sbjct  224   -----PPLSTAMAHI-PTATYWIIWSVVACAAQITGLVGMRHEFITSTSEAWELSSLAHK  277

Query  1189  LSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPII  1368
             +S I   LQ  +    + I + K     +  + T+     DN     L I  + +   ++
Sbjct  278   VSSIHEHLQSLLHLCYERIDEKKLLEAFEDFKRTIETPQMDN-LKILLKIFRKEETCYLL  336

Query  1369  HGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWL  1548
             +    E+    +D+LRRK+V LL+SDLDI +E I +L  +Y   K +   +E  +EI+WL
Sbjct  337   NPDKTEVL---IDVLRRKHVLLLISDLDISHEEIRVLEALY---KGERVSSELNYEILWL  390

Query  1549  PIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDT  1716
             PIVD RS W    E +F  +KS M W++V HP  I+ AV  Y+       +KP+   +D 
Sbjct  391   PIVD-RSTWNDGYEQKFLNLKSIMSWYTVKHPFAIEPAVIKYIMEVWGFVKKPIAVTLDP  449

Query  1717  Q  1719
             Q
Sbjct  450   Q  450



>gb|KHG00715.1| hypothetical protein F383_23634 [Gossypium arboreum]
Length=715

 Score =   191 bits (485),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 256/481 (53%), Gaps = 37/481 (8%)
 Frame = +1

Query  289   APPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLI  468
             AP S  ++ L +K   + + +R      A+S+D AMM  +++TH  D     VKP+L +I
Sbjct  3     APISFSLSSLASK---SQQLVRNERRMFAASDDGAMMKQIQSTHAPDGRVVDVKPILQVI  59

Query  469   EDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGY  648
             E+++   H  IP    +++     +DA L++    S ++ A++A AY  ++   E+    
Sbjct  60    ENVL---HHIIPNIDHAMKGGTGHIDA-LDDLTTSSAVDGALDALAYIVHKICCEVSCKC  115

Query  649   SSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIV  828
             S   DAH+ T+ +L +L++Y WDAK V+T AAFA  +GEF L+ +L  ++ LAKSVA + 
Sbjct  116   SGGGDAHATTMGILNMLSSYSWDAKVVLTLAAFAVNFGEFWLIVQLCTSNSLAKSVALLK  175

Query  829   QIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKE  1008
             Q+PDLLE S + +     L    KL + M++VT  I+   E+ SE  S+ V         
Sbjct  176   QLPDLLEHSPTLKPHFDALN---KLINAMIDVTKCIVEFTELPSEFISIDV---------  223

Query  1009  LAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHK  1188
                   P++    +I   A+Y+++ + V C+  I  L+ +  ++ +ST E  E+S+L HK
Sbjct  224   -----PPLSTAMAHI-PTATYWIIWSVVACAAQITGLVGMRHEFITSTSEAWELSSLAHK  277

Query  1189  LSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPII  1368
             +S I   LQ  +    + I + K     +  + T+     DN     L I  + +   ++
Sbjct  278   VSSIHEHLQSLLHLCYERIDEKKLLEAFEDFKRTIETPQMDN-LKILLKIFRKEETCYLL  336

Query  1369  HGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWL  1548
             +    E+    +D+LRRK+V LL+SDLDI +E I +L  +Y   K +   +E  +EI+WL
Sbjct  337   NPDKTEVL---IDVLRRKHVLLLISDLDISHEEIRVLEALY---KGERVSSELNYEILWL  390

Query  1549  PIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDT  1716
             PIVD RS W    E +F  +KS M W++V HP  I+ AV  Y+       +KP+   +D 
Sbjct  391   PIVD-RSTWNDGYEQKFLNLKSIMSWYTVKHPFAIEPAVIKYIMEVWGFVKKPIAVTLDP  449

Query  1717  Q  1719
             Q
Sbjct  450   Q  450



>gb|KHG01411.1| hypothetical protein F383_21965 [Gossypium arboreum]
Length=741

 Score =   191 bits (485),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 148/493 (30%), Positives = 250/493 (51%), Gaps = 37/493 (8%)
 Frame = +1

Query  262   TTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHY  441
             +TT + +AT   SQ +    +      RG R  G  L  S+D  MM+ + ATH  D    
Sbjct  51    STTQLRTATPGASQALMKSPSATHALIRGDRTAG-MLTMSDDHVMMNQILATHAPDGRDV  109

Query  442   KVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYR  621
              V+PLL+L+EDI+ RA   +   ++  Q Q       +EEK   +     +EA  +   R
Sbjct  110   DVRPLLYLVEDILNRATEHVNFIIKGTQAQIE-----MEEKAQQANYIAMLEALTFTIDR  164

Query  622   TSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDP  801
              + E+        D H+ T ++   L++Y WDAK V++ +AFA  YGEF LLA++Y T+ 
Sbjct  165   IACELSYKALRGSDPHTTTTAIFSFLSSYAWDAKLVLSLSAFALNYGEFWLLAQIYSTNQ  224

Query  802   LAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKV  981
             LAKS+A + Q+P LLE    +  +  +   +  L   M++VT  ++  K++ S   S   
Sbjct  225   LAKSMAILKQLPSLLE---HTAPLKPRFNALNTLIRTMMDVTRCVVEFKDLPSMYISPD-  280

Query  982   KYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteee  1161
                           +P  A    ++  A Y+ +++ V C+  I +L ++G +Y     E 
Sbjct  281   --------------APALASAMTLIPTAVYWTIRSMVACATQISSLTSMGHEYGVLATES  326

Query  1162  leistltHKLSYILGDLQKAVQKSTQEIGKIKHT----IKRKILEETLARTHTDNKYSAE  1329
              E+STL HKL  I   L+K +    Q I + K      +  K+ +  +A  H DN    +
Sbjct  327   WELSTLAHKLQNIHEHLRKQLNLCYQHIEEKKDVDTFHMLLKLFDPNVA--HIDNMKHLK  384

Query  1330  LIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQD  1509
              +I   +D  P++ GA    +K GL++LRR+ V LL+S L+   + + +L  +Y +++  
Sbjct  385   ALIYAGDDKLPLLDGA--TRRKVGLEVLRRRNVLLLISSLEFSGDELAILEQIYSDTRMH  442

Query  1510  PSRAESQFEIVWLPIVDRRS-PWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL---  1677
              +  +S +E+VW+P+V+    P +     +F  ++SSMPW+SV  P  I++ V  ++   
Sbjct  443   EAGMQSHYEVVWIPVVEHSGVPLSEETRTRFEALRSSMPWYSVEDPLLIEKPVLRFIKEI  502

Query  1678  -N*RRKPLLAVVD  1713
              + R KP+L V+D
Sbjct  503   WHFRTKPILVVLD  515



>emb|CDP05462.1| unnamed protein product [Coffea canephora]
Length=673

 Score =   190 bits (483),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 146/430 (34%), Positives = 226/430 (53%), Gaps = 36/430 (8%)
 Frame = +1

Query  397   MDHVRA---THDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKV  567
             MD V+    TH  D   + VKPL+ ++EDIM RA     G       Q        E+  
Sbjct  3     MDRVKEVLDTHVPDGRDFDVKPLVPIVEDIMKRATFLGGG------AQDQDYADTWEDTA  56

Query  568   VHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAF  747
             + SG  +  E   Y   +T  EII   SS  D H + +++ + L+ Y W+ K  I  AAF
Sbjct  57    IRSGYTDMPE-LTYAINKTINEIICNCSSGGDEHFVAIALCRSLSRYAWEDKVAIALAAF  115

Query  748   AQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVT  927
             A  YG+F L+A+L  T+PLAKS+A I ++P+++E +E+ +    K   V+ L+  ML VT
Sbjct  116   AVSYGKFWLVAQLRTTNPLAKSLAVIRELPEIIEHTEALKR---KFEAVSNLSKAMLNVT  172

Query  928   HKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLV  1107
               II LKE+  E+     ++              +TA     +  A Y+ V++   CS  
Sbjct  173   SCIINLKELPIEDIGQSNEWVF------------LTAH----VPTAVYWTVRSIAACSF-  215

Query  1108  ILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEE  1287
             ILNL A+G +Y  S  E  +++ + HKL+ I  DL++ +    Q+I   +       L E
Sbjct  216   ILNLTALGPEYVDSAAEAWDLNGVAHKLAKIKEDLKEQMNSIKQKIEDKRQDDAYNALVE  275

Query  1288  TLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEV  1467
                  +TDN      +I  + D  P+  G     K+  +DILR+K+V LL+S+L IP E 
Sbjct  276   LFKTPNTDNTKILSAVINVKEDQLPLYDGTN--KKRASIDILRKKHVLLLISELHIPQEE  333

Query  1468  ITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPS  1647
              ++L   Y ES+Q P++ + Q+E+VWLP+VD  S    A ++QF LV++SMPW+SV HP 
Sbjct  334   PSILHQFYTESRQQPTKLDKQYEVVWLPVVDTFS---NATDEQFELVQNSMPWYSV-HPI  389

Query  1648  KIDEAVYGYL  1677
              ++ A   ++
Sbjct  390   MLEPAFIRFI  399



>ref|XP_006351433.1| PREDICTED: uncharacterized protein LOC102598958 [Solanum tuberosum]
Length=723

 Score =   189 bits (479),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 159/501 (32%), Positives = 253/501 (50%), Gaps = 48/501 (10%)
 Frame = +1

Query  244   QAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHD  423
              A +PA TT       P  Q +A             R+R  F + S+D AM   +  TH+
Sbjct  4     HALVPAATTR---GMKPTQQAMAK------------RERPVF-SLSDDHAMSKKILDTHN  47

Query  424   VDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQTQ--PARLDAILEEKVVHSGLNEAI  594
              D     V  +LH+ E++   A+ A + G +           ++A+  E+      +  +
Sbjct  48    PDGREVDVNVILHIAEEVFQHAYPAGMDGVLHGAGAHHLEGNIEALKLEENASLAFDGIL  107

Query  595   EAFAYPAYRTSFEIIGGYSSN-RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFG  771
             E  AY  ++ S E+    SS   D HS T+S+L +L+ Y WDAK VI+ AAFA  YGEF 
Sbjct  108   EGLAYIIHKVSCELTCKCSSGGHDTHSTTMSILGMLSGYQWDAKLVISLAAFAVTYGEFW  167

Query  772   LLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKE  951
             L+A+++ T PLAKSVA + Q+PD++E   S R+    + E+ K    +LEVT  II  K+
Sbjct  168   LVAQMFATHPLAKSVAILKQLPDIMEHHGSLRSRFDAINELIK---AILEVTKIIIEFKK  224

Query  952   IGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVG  1131
             + S+               ++E   P++    +I   A Y+ +K+ V C+  +  LL + 
Sbjct  225   LPSQY--------------ISEDQPPLSVAITHI-PTAVYWTIKSIVACASQLTTLLGMS  269

Query  1132  RDYYsstee-eleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHT  1308
              D   +T     E+S+ THKL  I   L+  + +  Q I    H    ++L      T  
Sbjct  270   YDMIVATTADTWEMSSSTHKLRNISEHLRAELNRCYQHIQDKMHVEYFQMLVHLFEATQF  329

Query  1309  DNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHM  1488
             DN      +I  ++D  P+    G    +  +++LRRK V LL+SDL+  +E I +L  +
Sbjct  330   DNMKIMRAMIYIKDDLLPL--EVGTTHTRASVEVLRRKTVLLLLSDLEASHEEILVLSQI  387

Query  1489  YLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVY  1668
             YLES+   SR E Q+EIVWLPIVDR   W  A+E +F  +++ MPW+++ HPS ++ A+ 
Sbjct  388   YLESR---SRPEFQYEIVWLPIVDRSKGWNDAQEQKFKELQALMPWYTLHHPSLLEPAIV  444

Query  1669  GYLN*R----RKPLLAVVDTQ  1719
              ++  +    +K +L  +D Q
Sbjct  445   KFVKEKWHFSKKMMLVTLDPQ  465



>ref|NP_001239838.1| uncharacterized protein LOC100801064 [Glycine max]
 gb|ADN32797.1| sieve element occlusion m [Glycine max]
Length=727

 Score =   188 bits (477),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 142/469 (30%), Positives = 242/469 (52%), Gaps = 33/469 (7%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             K+I  GR +       A S+D+ ++  + A H  + + Y V+PLLH++ED++  +  +  
Sbjct  12    KLIKGGRAMPAA----AISDDSVLVKKIVAEHSPEGIEYDVRPLLHIVEDVLIYSTLSSD  67

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
                 +  T   R D + E++    G    +EA +    R S EI     +  DAHS T++
Sbjct  68    SATTAALT---RADHV-EDRSHRPGHTNMLEALSAKIDRISCEISYKTLNGVDAHSTTIA  123

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  +L  Y WD K V+  AAFA  YGEF LLA+++ T+ LAKS+A +  +P ++E   S 
Sbjct  124   IFDMLTIYKWDVKIVLALAAFALTYGEFWLLAQIHDTNQLAKSMAILKLLPSIMEHGSSL  183

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +     L +   L + +LEVT  +I   ++ ++  +  +    + Y              
Sbjct  184   KPRFDTLND---LVNNILEVTKCVIEFHDLPAQYITQDISAYTTAY--------------  226

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              N +  ASY+  ++ V C+  I +L  +G + ++ST+     + +  KL  I+  L++ +
Sbjct  227   -NYIPVASYWATRSIVACAAQITSLTTLGYEIFTSTDAWELSTLI-FKLKNIVDHLRQLL  284

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                 + IGK       ++L E  ++ HTDN    + +I  ++D  P+  G  +  K+  L
Sbjct  285   NSCHEHIGKKMDAEAYQMLRELFSKPHTDNMKVLKALIYAQDDILPLYDG--VTKKRVSL  342

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             + LRRK V LL S ++I  + + +L  +Y ESK    R ES++E+VW+PIVD  S W   
Sbjct  343   EPLRRKNVLLLFSGMEISTDELLILEQIYNESKAHAPRMESRYELVWIPIVDPNSEWIEP  402

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             K+ QF +++ SM W+SV HPS I + V  ++      + KP+L V+D Q
Sbjct  403   KQKQFEILQESMSWYSVYHPSLIGKPVIWFIQREWKYKNKPILVVLDPQ  451



>gb|KHN27576.1| hypothetical protein glysoja_018688 [Glycine soja]
Length=727

 Score =   187 bits (476),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 142/469 (30%), Positives = 242/469 (52%), Gaps = 33/469 (7%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             K+I  GR +       A S+D+ ++  + A H  + + Y V+PLLH++ED++  +  +  
Sbjct  12    KLIKGGRAMPAA----AISDDSVLVKKIVAEHSPEGIEYDVRPLLHIVEDVLIYSTLSSD  67

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
                 +  T   R D + E++    G    +EA +    R S EI     +  DAHS T++
Sbjct  68    SATTAALT---RADHV-EDRSHRPGHTNMLEALSAKIDRISCEISYKTLNGVDAHSTTIA  123

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +  +L  Y WD K V+  AAFA  YGEF LLA+++ T+ LAKS+A +  +P ++E   S 
Sbjct  124   IFDMLTIYKWDVKIVLALAAFALTYGEFWLLAQIHDTNQLAKSMAILKLLPSIMEHGSSL  183

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             +     L +   L + +LEVT  +I   ++ ++  +  +    + Y              
Sbjct  184   KPRFDTLND---LVNNILEVTKCVIEFHDLPAQYITQDISAYTTAY--------------  226

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              N +  ASY+  ++ V C+  I +L  +G + ++ST+     + +  KL  I+  L++ +
Sbjct  227   -NYIPVASYWATRSIVACAAQITSLTILGYEIFTSTDAWELSTLI-FKLKNIVDHLRQLL  284

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
                 + IGK       ++L E  ++ HTDN    + +I  ++D  P+  G  +  K+  L
Sbjct  285   NSCHEHIGKKMDAEAYQMLRELFSKPHTDNMKVLKALIYAQDDILPLYDG--VTKKRVSL  342

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             + LRRK V LL S ++I  + + +L  +Y ESK    R ES++E+VW+PIVD  S W   
Sbjct  343   EPLRRKNVLLLFSGMEISTDELLILEQIYNESKAHAPRMESRYELVWIPIVDPNSEWIEP  402

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             K+ QF +++ SM W+SV HPS I + V  ++      + KP+L V+D Q
Sbjct  403   KQKQFEILQESMSWYSVYHPSLIGKPVIWFIQREWKYKNKPILVVLDPQ  451



>ref|XP_007031664.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
 gb|EOY02590.1| Uncharacterized protein TCM_017019 [Theobroma cacao]
Length=705

 Score =   187 bits (475),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 245/461 (53%), Gaps = 46/461 (10%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATI---PGYVQSVQTQPAR  540
              ++SED  M+  ++A+H  D     V+PLL ++EDI  RA  +    P + + V+ Q  +
Sbjct  23    FSASEDGVMLKQIQASHAPDGRVINVRPLLRIVEDIFNRAAPSAIVAPAHTEEVEDQTYQ  82

Query  541   LDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDA  720
              D I           + IEA ++   R S EI    +   +AH+ T+S+L +++NY WDA
Sbjct  83    ADVI-----------DMIEALSFLIDRISSEIAFKCTETGEAHATTMSILNIVSNYPWDA  131

Query  721   KAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAK  900
             K VI  +AFA  YGEF LLA+ Y ++ LAK++A + Q+P++L+ S   +    +      
Sbjct  132   KLVIALSAFAVNYGEFWLLAQSYTSNQLAKNLAILRQVPEILQHSSMLKY---RFETTKN  188

Query  901   LADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvv  1080
             L   M+++   I+  KE+ S              K ++  ++ ++   ++I     + + 
Sbjct  189   LIRAMVDIAKCIVDFKELPS--------------KYISADVTAMSTAMDHIPIAIYWTIR  234

Query  1081  kaavTCSLVILNLLAVGRDYYssteeeleistltHKL----SYILGDLQKAVQKSTQEIG  1248
                 + S  I  L   G +Y  ST E  E+S+L HKL    S+++G L  A  K   E  
Sbjct  235   SMLASAS-QITGLSGFGNEYLLSTMESWELSSLVHKLDSMHSHLVG-LLAACHKHIDERK  292

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
              ++       L ET      DN    + +I  ++DP P+IHGA    ++  +D+LR++ V
Sbjct  293   FLEAYQNLLYLYET---AQIDNIKILKALINPKDDPLPLIHGA--TNRRVNIDVLRKRNV  347

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLDI  + I +L  +Y ES+  PSR ESQ+E VWLP++D   P +  K+D+F  +
Sbjct  348   LLLISDLDILQDKIAILEQIYNESRSQPSRLESQYEFVWLPVLDPSVPLSEIKKDKFENL  407

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             K+ M W+++ HPS ID AV+ ++    +  +KP+L V+D Q
Sbjct  408   KALMTWYTLQHPSLIDRAVFKFIKEVWHFEKKPILVVLDPQ  448



>ref|XP_004504145.1| PREDICTED: uncharacterized protein LOC101504285 isoform X3 [Cicer 
arietinum]
Length=704

 Score =   187 bits (475),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 152/469 (32%), Positives = 246/469 (52%), Gaps = 42/469 (9%)
 Frame = +1

Query  343   RGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV  522
             R IR      ++S+DT M   + ATH     H  V+PLL++++DI  RA + IP  +Q  
Sbjct  11    RAIRH---IFSASDDTVMTKQISATHAPIEEHVDVRPLLNVVQDIFHRATSLIPDILQGK  67

Query  523   QTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEI-----IGGYSSNRDAHSITLSV  687
             QTQ +      +E    S L++ +E   +   + + EI     +GG     DAH+ T+ +
Sbjct  68    QTQMSAS----KENANQSDLSDILEISYHTINKIACEISCKCMMGG----GDAHATTIGI  119

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
             L +L+++ WDAK  I  AAFA   GEF L+A+L  T+ LAKSVA +  I + LE      
Sbjct  120   LGMLSSFSWDAKVGIALAAFASNLGEFWLVAQLNATNRLAKSVALLKHIHETLE---QVD  176

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
              +  K   V  L + M  V + I+   E+ S+           +  E  E L+  T    
Sbjct  177   DLGPKFETVNNLLNAMFVVANCIVEFHELPSQ----------YIDHEAPEMLTAST----  222

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
              ++  A Y+ +++ V C+  IL ++ +G+ Y +ST E  E+S+LTHKL  +   LQK + 
Sbjct  223   -LIPSAVYWTIRSIVACASHILGIIGLGQGYMTSTIETWELSSLTHKLDNMNDHLQKQLT  281

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                Q +   K     + LE     +H DN    + +I  ++DP P+  G+    ++  +D
Sbjct  282   ICHQHLDDNKQREAFQTLEILFETSHQDNINVLKALIRCKDDPLPLFDGS--TKQRVSID  339

Query  1408  ILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             +LR K V L ++DL  I  + + +   MY +S+QD +R ESQ+E+VW+PIV++ + WT +
Sbjct  340   VLRSKIVLLYITDLQHISEQELVIFGQMYQDSRQDSTRLESQYELVWIPIVEKGTLWTES  399

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             K+ +F  ++S MPW+SV  PS ++ A   Y+        K +L V+D Q
Sbjct  400   KQ-RFERLQSMMPWYSVYDPSVLEAATIRYIKEVWLFNTKHMLVVLDPQ  447



>ref|XP_010694661.1| PREDICTED: uncharacterized protein LOC104907426 [Beta vulgaris 
subsp. vulgaris]
Length=759

 Score =   187 bits (475),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 225/460 (49%), Gaps = 40/460 (9%)
 Frame = +1

Query  355   KRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQP  534
             +RG    +S+D A+   +   H  DA +  V+PL HL+E+I+ R    + G        P
Sbjct  52    ERGGIFLTSDDNALAKQIEQLHKPDARYVNVRPLFHLVEEIIHRGSPNVEG--------P  103

Query  535   ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
             +      E ++  +GL E  E       R S E+     S  DAH++TLSVL +L ++ W
Sbjct  104   SLGQREAEGRLTLNGLEEVPE-LPLIVERISSEMTCKLLSGNDAHNVTLSVLNMLPHFSW  162

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             +AK V+TFAAFA  YG+F LL ++Y T+PLAKS+A + ++P ++E    + A  ++    
Sbjct  163   EAKVVLTFAAFALTYGDFWLLVQIYSTNPLAKSMALMKRLPAMVE---HTGAFKNRFEAT  219

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
               L   MLE T  II   E       L   Y      E+ +++         I+  A   
Sbjct  220   NNLIRAMLEATRCIIEFGE-------LPTMYVTDEDPEVKDAMCHFPIAVYWIIRSAVAA  272

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
               +     S  + N+ A    +        E+S   HKL  I   L+  +    + I + 
Sbjct  273   ATQITTMSSRGVENMSATAESW--------ELSNWAHKLKTISDHLRTTLSNLYELIAEK  324

Query  1255  KHTIKRKILEETLART-HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
             K      ++++ +  T H DN    + +I   ND  P ++   ++ + H LD+LRRK V 
Sbjct  325   KQLDAYNMIKKIIYHTMHIDNMKVLKTLIYA-NDDVPPLYDGPVKRRVH-LDVLRRKNVL  382

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+S LDI +E + +L   Y ESK         +EIVW+P+ D    WT + E Q   +K
Sbjct  383   LLISGLDITHEELYILEQSYTESKI------QAYEIVWIPVKDPSVQWTDSMEVQLETLK  436

Query  1612  SSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +SMPW+SV HPS ID AV  +L    + R KP+L V+D Q
Sbjct  437   ASMPWYSVHHPSIIDHAVLKFLRDDWHFRGKPMLVVMDPQ  476



>gb|ADN32810.1| sieve element occlusion a [Solanum phureja]
Length=723

 Score =   187 bits (474),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 157/501 (31%), Positives = 253/501 (50%), Gaps = 48/501 (10%)
 Frame = +1

Query  244   QAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHD  423
              A +PA TT       P  Q +A             R+R  F + S+D AM   +  TH+
Sbjct  4     HALVPAATTR---GMKPTQQAMAK------------RERPVF-SLSDDHAMSKKILDTHN  47

Query  424   VDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQTQ--PARLDAILEEKVVHSGLNEAI  594
              D     V  +LH+ E++   A+ A + G +           ++A+  E+      +  +
Sbjct  48    PDGREVDVNVILHIAEEVFQHAYPAGMDGVLHGAGAHHLEGNIEALKLEEKASLAFDGIL  107

Query  595   EAFAYPAYRTSFEIIGGYSSN-RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFG  771
             E  AY  ++ S E+    SS   D HS T+S+L +L+ Y WDAK VI+ +AFA  YGEF 
Sbjct  108   EGLAYIIHKVSCELTCKCSSGGHDTHSTTMSILGMLSGYQWDAKLVISLSAFAVTYGEFW  167

Query  772   LLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKE  951
             L+A+++ T PLAKSVA + Q+PD++E   S R+    + E+ K    +LEVT  II  K+
Sbjct  168   LVAQMFATHPLAKSVAILKQLPDIMEHHGSLRSRFDAINELIK---AILEVTKIIIEFKK  224

Query  952   IGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVG  1131
             + S+               ++E   P++    +I   A Y+ +K+ V C+  +  LL + 
Sbjct  225   LPSQY--------------ISEDQPPLSVAITHI-PTAVYWTIKSIVACASQLTTLLGMS  269

Query  1132  RDYYsstee-eleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHT  1308
              D   ++     E+S+ THKL  I   L+  + +  Q I    H    ++L      T  
Sbjct  270   YDMIVASTADTWEMSSSTHKLRNISEHLRAELNRCYQHIQDKMHIEYFQMLVHLFEATQF  329

Query  1309  DNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHM  1488
             DN      +I  ++D  P+    G    +  +++LRRK V LL+SDL+  +E I +L  +
Sbjct  330   DNMKIMRAMIYIKDDLLPL--EVGTTHTRASVEVLRRKTVLLLLSDLEASHEEILVLSQI  387

Query  1489  YLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVY  1668
             YLES+   SR E Q+EIVWLPIVDR   W  A+E +F  +++ MPW+++ HPS ++ A+ 
Sbjct  388   YLESR---SRPEFQYEIVWLPIVDRSKGWNDAQEQKFKELQALMPWYTLHHPSLLEPAIV  444

Query  1669  GYLN*R----RKPLLAVVDTQ  1719
              ++  +    +K +L  +D Q
Sbjct  445   KFVKEKWHFSKKMMLVTLDPQ  465



>ref|XP_011071161.1| PREDICTED: uncharacterized protein LOC105156657 [Sesamum indicum]
Length=768

 Score =   187 bits (474),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 158/487 (32%), Positives = 249/487 (51%), Gaps = 45/487 (9%)
 Frame = +1

Query  313   PLQAKIIPAGR-GIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIM--P  483
             P  A++   GR G   R     SS+D A+   +  TH  D     V+P+L ++EDIM   
Sbjct  48    PSSAQVAARGRLGKADRAPNFFSSDD-ALTKQIVGTHAPDMEDLDVRPVLSIVEDIMRLA  106

Query  484   RAHATIPGYVQSVQTQPARLDAIL-------EEKVVHSGLNEA--IEAFAYPAYRTSFEI  636
             R  +    +V   Q+   +LD  +       ++K+ H+  ++A  +   AYP  +TS EI
Sbjct  107   RPSSADTTHVAQTQSHVDKLDDKVSHIPYHHDDKIYHTAEHDAEIVRVLAYPINKTSCEI  166

Query  637   IGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSV  816
             I   +   ++H+IT+ +LK L++Y WDAK VIT AAF+  YGEF L+   +  + LAK++
Sbjct  167   ICKCAGGGESHAITMDLLKSLSSYSWDAKVVITLAAFSINYGEFWLVEHQHTKNALAKNI  226

Query  817   ATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVS  996
             AT+  +PD++     +  +  K   V  L  ++L+VTH II  KE+              
Sbjct  227   ATLKDLPDII---AHAGELRKKFEAVLSLLTQVLKVTHCIIEFKELP------------P  271

Query  997   LYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleist  1176
             LY  ++     +TA   +I   A Y++++  +TCS  +LNL+  GR+Y +ST E  EI  
Sbjct  272   LY--ISRESPEITAATAHI-PTAVYWIIRGLLTCSSTLLNLVGSGREYVTSTAESWEIQN  328

Query  1177  ltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDP  1356
             L HKLS IL  LQ  ++     I + K        ++ +   H DN      +I    D 
Sbjct  329   LAHKLSVILEHLQDQLKHCKDLIDRKKAEDAYIAFKKLMESAHIDNMKVLRAMIRSREDQ  388

Query  1357  TPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFE  1536
              P+ HG+    ++  L+ LR KYV LL+SDL++P+E + +L  +Y    Q   R E  +E
Sbjct  389   RPLYHGSRRTNER--LEELRLKYVLLLISDLELPHEELNVLHLIY---NQHSMRHE--YE  441

Query  1537  IVWLPIVDRRSPWTGAKEDQ--FTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPL  1698
             ++W PIV+  +  T +  D   + L  + MPW+SV HPS I+     Y+    N    P+
Sbjct  442   VLWFPIVNSTTS-TASLTDPIFYDLRNNHMPWYSVDHPSLIEPVAIRYIREVWNFVHMPM  500

Query  1699  LAVVDTQ  1719
             L V+D Q
Sbjct  501   LVVLDPQ  507



>gb|EPS71838.1| hypothetical protein M569_02915, partial [Genlisea aurea]
Length=688

 Score =   185 bits (470),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 237/454 (52%), Gaps = 40/454 (9%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D A+   + +T+ +DA    V+P+L +IEDI+  A      +  ++Q     L +I +
Sbjct  8     SDDNALTKQIESTNAIDAEELDVRPVLSIIEDILRLAKPAT--FDTTIQVSLHILTSIRD  65

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
                     +E ++  AYP  R S EII   ++  ++HS+T+ +L+ L++Y WDAK VITF
Sbjct  66    P----DQDSEIVKLLAYPINRISSEIICKCAAGGESHSVTMELLQSLSHYAWDAKVVITF  121

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             AAFA  YGEF L+ +L+  + LA+++A +  +PD+L     +  +  K  +V  L   ++
Sbjct  122   AAFAINYGEFWLIEQLHTKNALARNIAALKDLPDIL---AHAGELRKKFEDVLDLLTAVI  178

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
             +VTH I+  KE+ S+  S +               +P   E    +  A Y+V+++ + C
Sbjct  179   KVTHCIVEFKELPSKYISRQ---------------APEITEATGHIPTAVYWVIRSLLVC  223

Query  1099  SLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKI  1278
             +  +LNL+  G +  SS  E  EI  L HKLS IL  L K ++   + I + K   K   
Sbjct  224   AATLLNLVGTGHECISSPAESWEIRNLAHKLSVILEHLHKQLRVCKELIDQKKTNDKFNE  283

Query  1279  LEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHG--LDILRRKYVFLLVSDLD  1452
                     H DN      I+    D  P+       +KK    L++LR KYV LL++DL 
Sbjct  284   FVSLTDSVHIDNMKVLRAIVHAREDQGPLYD----PVKKTNVPLEMLRLKYVLLLITDLK  339

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQF-TLVKSSMPWF  1629
             IP+E I +L  +Y    Q   R E  +E++WLP+VD  +P T ++E  F +L  ++MPW+
Sbjct  340   IPHEEINILHLIY---NQRTMRDE--YEVLWLPVVDPTTPITQSQEAAFYSLRNNTMPWY  394

Query  1630  SVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             SV HPS +D     Y+  R     KP+L V++ Q
Sbjct  395   SVDHPSLVDPVAIRYIKNRWMFESKPILVVLNPQ  428



>gb|EYU22546.1| hypothetical protein MIMGU_mgv1a001374mg [Erythranthe guttata]
Length=831

 Score =   186 bits (471),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 170/541 (31%), Positives = 264/541 (49%), Gaps = 83/541 (15%)
 Frame = +1

Query  250   YMPATTTNVVSATAPPSQVVAPLQAKII----PAGRGIRKRGDFLASSEDTAMMDHVRAT  417
             +M ATT N         QV  PL A ++    P  +G   R +F  SS+D A+   ++ T
Sbjct  56    HMGATTAN----HHLGQQVAVPLSAPVLGRRQPGRQGDHDRSNFF-SSDDNALTKQIQGT  110

Query  418   HDVDAVHYKVKPLLHLIEDIM----PRAHAT--IPGYVQSVQTQPA-RLD----------  546
             H  D     VKPLL ++EDIM    P +H T  IPG      +Q   +LD          
Sbjct  111   HAPDVQELDVKPLLAIVEDIMRLATPASHDTNLIPGGQIVASSQHVEKLDDKAFHNTTAS  170

Query  547   ------------------AILEEKVVHSGLN---EAIEAFAYPAYRTSFEIIGGYSSNRD  663
                                + E KV  S  +   + +   AYP  + S EI+   S+  +
Sbjct  171   GHDNNKVYDNSKIYDNSKVVYESKVYGSTYDHDADIVRVLAYPINKISCEIVCKSSAGGE  230

Query  664   AHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDL  843
             +H++T+ +L  L+NY W AK VITFAAFA  YGEF L+  L   DPLAK++AT+  +PD+
Sbjct  231   SHTVTMHLLNTLSNYSWAAKVVITFAAFAINYGEFWLVEHLQAKDPLAKNIATLKDLPDV  290

Query  844   LEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESL  1023
             +     + A+  K  +V  L +++L+VTH+II  KE+            V +  +  E +
Sbjct  291   M---AHAGALQQKFDQVLNLLNQVLKVTHRIIEFKELPD----------VYISHDSPEYM  337

Query  1024  SPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYIL  1203
             +  TA     +  A Y+++++ + C+  +LNL+  G +Y +ST E  EIS+L HKLS IL
Sbjct  338   A-ATAH----IPLAVYWIIRSLLVCASTLLNLIGSGHEYITSTAESWEISSLAHKLSIIL  392

Query  1204  GDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGL  1383
               LQ   +     + K K   + K     +   H DN      +     D  P+ +G   
Sbjct  393   EHLQTQFKNCRDFVEKKKEEDEYKRFVIIMTSAHVDNMKVLRAMFRSREDQRPLYNGRTK  452

Query  1384  EMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDR  1563
               ++  LD+LR KYV LL+SDL++P E + +L  ++   +Q   R E  +E++WLP++  
Sbjct  453   TNER--LDVLRSKYVLLLISDLELPLEELHILNSIH---RQQSDRHE--YEVLWLPVIHD  505

Query  1564  RS-------PWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*RRK----PLLAVV  1710
              S         T  +E  F  +++ MPW+SV HPS ++     Y+    K    P+L V+
Sbjct  506   PSTTTAAAAAMTPMQEKAFQDLRNVMPWYSVEHPSLVERVAIRYIREYWKFVHMPMLVVL  565

Query  1711  D  1713
             D
Sbjct  566   D  566



>ref|XP_009592492.1| PREDICTED: uncharacterized protein LOC104089332 [Nicotiana tomentosiformis]
Length=712

 Score =   184 bits (468),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 249/488 (51%), Gaps = 43/488 (9%)
 Frame = +1

Query  271   NVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVK  450
             ++VS+TA P  V               R+     + S+D AM   +  TH  +     V 
Sbjct  5     SLVSSTAKPEPVT--------------RRERPVFSMSDDHAMSKKILDTHSPNGREVDVA  50

Query  451   PLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSF  630
              +L +IE+I   A   I G +Q    +       LEEK   +  +  +E  AY  ++ S 
Sbjct  51    IILQVIEEIFQHAFLAIDGVLQDGHRESMETSK-LEEKTSFTFDSFHLEGLAYIMHKVSC  109

Query  631   EIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAK  810
             ++   +S   +AH+ T+ +L +L++Y WDAK V+T A+F+  YGEF L+A+ + T PLAK
Sbjct  110   QLTCKFSGGGEAHATTMEILGMLSSYHWDAKLVLTLASFSIIYGEFWLVAQKFATQPLAK  169

Query  811   SVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYR  990
              VA + Q+PD++E + + ++   +   +  L   +L++T  II  K + S+         
Sbjct  170   MVALLKQLPDIIEHAAALKS---RFDAINNLLKAILDITKCIIEFKRLPSQY--------  218

Query  991   VSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-ele  1167
                   ++E   P++         A Y+ +K+ V C+  + +LL +  ++ S+T     E
Sbjct  219   ------ISEDQPPMSVAIA-YFPTAVYWTIKSIVACASQLTSLLGMSYEFISATTTDTWE  271

Query  1168  istltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGE  1347
             +S+ THKL+ I   L+  +++  + I + KHT   ++L      T  DN    + +I  +
Sbjct  272   MSSSTHKLNNISDHLRAELERCYEHIQEKKHTEYYQMLVHLFETTQFDNMKINKALIYIK  331

Query  1348  NDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAES  1527
             +D  P+    G    +  +D+LRRK V LL+SDLDI  E + +L  +Y ES+    R+E 
Sbjct  332   DDLLPL--EVGTMHTRASIDVLRRKTVLLLISDLDITPEEVLILATIYNESR---GRSEL  386

Query  1528  QFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKP  1695
             Q+EIVWLPI DR   W    E +F  +++ MPWF++ HPS ++ AV  Y+  R    +K 
Sbjct  387   QYEIVWLPISDRSREWNEGYEHKFKELQARMPWFTLHHPSLLEPAVIKYVKERWHFSKKM  446

Query  1696  LLAVVDTQ  1719
             +L  +D Q
Sbjct  447   MLVALDPQ  454



>ref|XP_011046122.1| PREDICTED: uncharacterized protein LOC105140824 [Populus euphratica]
Length=639

 Score =   184 bits (466),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 214/393 (54%), Gaps = 24/393 (6%)
 Frame = +1

Query  553   LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVI  732
             +E+K  H      ++A +Y   R S EI        DAH+ T+S+  +L +Y WDAK V+
Sbjct  1     MEDKTYHVNFVSMLDALSYTIDRISSEIAYKALGGTDAHATTVSLFNMLTSYSWDAKLVL  60

Query  733   TFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADK  912
             T AAF+  YGEF LLA++  ++ LAKS+A + Q+P ++E S   +     +  + K+   
Sbjct  61    TLAAFSLNYGEFWLLAQISSSNQLAKSMAILKQLPSIMEHSGPLKPRFDAINNLIKV---  117

Query  913   MLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaav  1092
             M++V   ++  K++     S +V    +L   +A   + V     +++            
Sbjct  118   MMDVARCVVEFKDLPPAYISNEVP---ALSTAMAHIPTAVYWTIRSVV------------  162

Query  1093  TCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKR  1272
              C+  I +L  +G ++  ST +  E+STL HKLS IL  L+K +    Q I + ++    
Sbjct  163   ACAAQITSLTTMGHEFSISTTDAWELSTLAHKLSNILDHLRKQLDTCYQYIDEKRNVESF  222

Query  1273  KILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD  1452
             ++L+      H DN    + +I  ++D  P+I G+    K+  LD+LRRK V LL+S L+
Sbjct  223   QMLKNLFETIHIDNMKVLKALIYAKDDIQPLIDGSS--KKRVHLDVLRRKNVLLLISGLE  280

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
             +  + +++L  +Y ES+    R +SQ+E+VW+PIVDR   W+   ++ F  ++SSMPWF+
Sbjct  281   MSTDELSILEQIYNESRHHGPRLDSQYEVVWVPIVDRSVQWSDPMKEIFESMQSSMPWFT  340

Query  1633  VSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             V HP  I++AV  ++    + R KP+L V+D Q
Sbjct  341   VYHPLLIEKAVIRFIKEVWHLRNKPILVVLDPQ  373



>ref|XP_007037798.1| Sieve element occlusion e, putative [Theobroma cacao]
 gb|EOY22299.1| Sieve element occlusion e, putative [Theobroma cacao]
Length=705

 Score =   183 bits (465),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 146/462 (32%), Positives = 246/462 (53%), Gaps = 32/462 (7%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             +R+     + S+D +MM  +++TH  D     VKP+L +IE+++      I   + +   
Sbjct  15    LRRDRRIFSVSDDNSMMKQIQSTHAPDDRVVDVKPILQIIENVLRHVTPNIDRALNA--A  72

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 +D   +++   + ++  +EA A+  ++ S EI    S   DAHS T+++L +L++Y
Sbjct  73    DQGHIDG-FDDRASLAAIDGMLEALAFIVHKISCEISCKCSGGGDAHSTTMALLNMLSSY  131

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V+T AAF+   GEF L+ +L  T+ LAKSVA + Q+PD+LE S + +     L 
Sbjct  132   SWDAKVVLTLAAFSVNIGEFWLIVQLCTTNSLAKSVALLKQLPDILEHSHNLKPQFDALN  191

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K    M++VT  I+   E+ S+       Y +S        + P++    +I   A+
Sbjct  192   NLIK---AMMDVTKCIVEFTELPSQ-------YILS-------DVPPMSIAMAHI-PTAA  233

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+ +++ V C+  I +L+ +  ++ ++T E  E+S+L HK+S I   LQK +++  Q I 
Sbjct  234   YWTMRSVVACASQIASLVGLKHEHITATSEAWELSSLAHKVSSIHDHLQKLLRQCYQHID  293

Query  1249  KIKHTIKRKILEETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKY  1425
             + K     + L  +      DN K   +L   G+ DP   + G   +  K  +D+LRRK+
Sbjct  294   EKKQAEAYEGLAHSFGTPQLDNLKILIKLFSLGKEDPQNALLGP--DKTKVHMDVLRRKH  351

Query  1426  VFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTL  1605
             V LL+SDLDI  + I +   +Y   K +   +E  +EIVWLPIVD  S W    + +F  
Sbjct  352   VLLLISDLDISPDEIQVFEVLY---KYERVSSELNYEIVWLPIVDM-STWNDGHQQKFLN  407

Query  1606  VKSSMPWFSVSHPSKIDEAVYGY----LN*RRKPLLAVVDTQ  1719
             ++S MPW++V HPS I+ AV  Y        +KP++  +D Q
Sbjct  408   LQSIMPWYTVHHPSIIEPAVIKYTKEVWRFVKKPIVVTLDPQ  449



>ref|XP_004504143.1| PREDICTED: uncharacterized protein LOC101504285 isoform X1 [Cicer 
arietinum]
 ref|XP_004504144.1| PREDICTED: uncharacterized protein LOC101504285 isoform X2 [Cicer 
arietinum]
Length=706

 Score =   183 bits (464),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 151/469 (32%), Positives = 247/469 (53%), Gaps = 40/469 (9%)
 Frame = +1

Query  343   RGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV  522
             R IR      ++S+DT M   + ATH     H  V+PLL++++DI  RA + IP  +Q V
Sbjct  11    RAIRH---IFSASDDTVMTKQISATHAPIEEHVDVRPLLNVVQDIFHRATSLIPDILQ-V  66

Query  523   QTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEI-----IGGYSSNRDAHSITLSV  687
               +  ++ A  +E    S L++ +E   +   + + EI     +GG     DAH+ T+ +
Sbjct  67    DGKQTQMSAS-KENANQSDLSDILEISYHTINKIACEISCKCMMGG----GDAHATTIGI  121

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
             L +L+++ WDAK  I  AAFA   GEF L+A+L  T+ LAKSVA +  I + LE      
Sbjct  122   LGMLSSFSWDAKVGIALAAFASNLGEFWLVAQLNATNRLAKSVALLKHIHETLE---QVD  178

Query  868   avssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
              +  K   V  L + M  V + I+   E+ S+           +  E  E L+  T    
Sbjct  179   DLGPKFETVNNLLNAMFVVANCIVEFHELPSQ----------YIDHEAPEMLTAST----  224

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
              ++  A Y+ +++ V C+  IL ++ +G+ Y +ST E  E+S+LTHKL  +   LQK + 
Sbjct  225   -LIPSAVYWTIRSIVACASHILGIIGLGQGYMTSTIETWELSSLTHKLDNMNDHLQKQLT  283

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                Q +   K     + LE     +H DN    + +I  ++DP P+  G+    ++  +D
Sbjct  284   ICHQHLDDNKQREAFQTLEILFETSHQDNINVLKALIRCKDDPLPLFDGS--TKQRVSID  341

Query  1408  ILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             +LR K V L ++DL  I  + + +   MY +S+QD +R ESQ+E+VW+PIV++ + WT +
Sbjct  342   VLRSKIVLLYITDLQHISEQELVIFGQMYQDSRQDSTRLESQYELVWIPIVEKGTLWTES  401

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             K+ +F  ++S MPW+SV  PS ++ A   Y+        K +L V+D Q
Sbjct  402   KQ-RFERLQSMMPWYSVYDPSVLEAATIRYIKEVWLFNTKHMLVVLDPQ  449



>emb|CAN62582.1| hypothetical protein VITISV_034667 [Vitis vinifera]
Length=802

 Score =   183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 266/545 (49%), Gaps = 78/545 (14%)
 Frame = +1

Query  235   PVQQAYMPATTTNVVSATAPPSQVV--APLQAKI------IPAGRGIRKRGDFLASSEDT  390
             P QQ   P+    +  A     QV+   P+Q ++      +P  +  R     +  S+D 
Sbjct  21    PTQQLMKPSA---MQQANPGSLQVINPTPMQHEVTTKINPVPLHQLTRHDRSMITMSDDN  77

Query  391   AMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVV  570
              MM  + ATH  D   + VKPL  L+EDI+ RA   +   +   QT+    D    ++  
Sbjct  78    IMMKQIHATHAPDGREFDVKPLFQLVEDILNRATPGVDPLISDAQTRIETSD----DRTH  133

Query  571   HSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFA  750
              +     +EA ++   R + +I        DAH+ TLS+  LL +Y W+AK V+T +AFA
Sbjct  134   QASFIALLEALSFTIDRIACQIAYKSLGGGDAHATTLSIFDLLTSYSWEAKLVLTLSAFA  193

Query  751   QQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTH  930
               YGEF LLA++  ++ LAKS+A + Q+P +LE S   +     L  + K    M+ +T 
Sbjct  194   VTYGEFWLLAQISSSNQLAKSMAILKQVPIVLEYSGLLKPRFDALNNLIK---AMVAITR  250

Query  931   KIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasyyvvkaavTCSLV  1107
              II  KE+     S  V         LA +L+ + TA    I         ++ V C+  
Sbjct  251   CIIEFKELPPMYISQDV-------SALATALTHIPTAVYWTI---------RSVVACATQ  294

Query  1108  ILNLLAVGRDYY-ssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI------  1266
             I  L ++G +Y+ S+T E  E+STL HK++ IL  L+K +    Q IG+  +        
Sbjct  295   ITTLTSMGHEYWISATNEAWELSTLAHKINSILDLLKKQLTLCHQYIGQTTNPFQIYGSK  354

Query  1267  ----------------KRKILEETLART--------------HTDNKYSAELIICGENDP  1356
                             KR + +    R+              H DN      +I  ++D 
Sbjct  355   CCTANVNTNXMDFKSDKRLLFDADDKRSAEAFQTLLNLFESIHIDNMKILRALISPKDDV  414

Query  1357  TPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFE  1536
              P++ G+    ++  +D+LRRK V LL+S L I  + +++L  +Y ES+   +R E Q+E
Sbjct  415   LPLLEGS--TKRRVNIDVLRRKNVLLLLSGLSISQDELSVLEQIYNESRVHGNRMEYQYE  472

Query  1537  IVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLA  1704
             +VW+P+VDR   WT A +++F  ++++MPW+SV  P++ID AV  ++    + R KP+L 
Sbjct  473   VVWIPVVDRSVVWTDAMQNRFETLQATMPWYSVYTPTQIDRAVIRFIKEVWHFRNKPILV  532

Query  1705  VVDTQ  1719
             V+D Q
Sbjct  533   VLDPQ  537



>ref|XP_003622294.1| hypothetical protein MTR_7g032660 [Medicago truncatula]
 gb|ABD32254.1| hypothetical protein MtrDRAFT_AC149040g7v2 [Medicago truncatula]
 gb|ADN32809.1| sieve element occlusion e [Medicago truncatula]
 gb|AES78512.1| sieve element occlusion protein [Medicago truncatula]
Length=729

 Score =   182 bits (462),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 236/451 (52%), Gaps = 28/451 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+DT ++  + A H+ + + Y VKPLLH++EDI+ R+  T+         + + +D  LE
Sbjct  26    SDDTILVKKIVADHNPEGLDYDVKPLLHIVEDILRRS--TLGSSEHDSMGELSHVDQ-LE  82

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             ++         +EA +    R S EI     S  DAHS T+++ ++L  Y WD K V+  
Sbjct  83    DRTHLPSYTSMLEALSVKIDRISCEISYKILSGVDAHSTTVAIFEMLTIYKWDVKLVLAL  142

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             AAFA  YGEF LLA ++ T+ LAKS+A + Q+P ++E S S +     L +   L + +L
Sbjct  143   AAFALNYGEFWLLAHIHDTNQLAKSMAILKQLPGIMEHSSSLKPRFDTLND---LVNVIL  199

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
             EVT  +I   ++  +     ++  VS Y  ++  + PV A          Y+ +++ V C
Sbjct  200   EVTKCVIEFNDLPIQ----YIRQDVSAYNTVSNHI-PVAA----------YWSIRSIVAC  244

Query  1099  SLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKI  1278
             +  I +L  +G + ++S +     +    KL  I+  L+K +      + +   T    +
Sbjct  245   AAQITSLTTLGYEIFTSNDAWELSTLA-FKLRSIVDHLRKQLDICKIHVEEAMDTEAYGM  303

Query  1279  LEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIP  1458
             L E     HTDN    + +I   +D  P+  G     K+  L+ LRRK V LL S L+  
Sbjct  304   LRELFLTPHTDNMKIIKALIYSHDDILPLYDGVS--KKRASLEALRRKNVLLLFSGLEFS  361

Query  1459  NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVS  1638
              + + +L  +Y ESK    R ++++E+VW+PIVD+ S WT  K+ QF  ++ SMPWFSV 
Sbjct  362   TDELLILEQIYNESKAHAPRQDNRYELVWIPIVDQTSEWTDQKQMQFENLRESMPWFSVY  421

Query  1639  HPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             HPS I +AV  ++      + KP+L V+D Q
Sbjct  422   HPSLISKAVVWFIQSEWKYKNKPILVVLDPQ  452



>ref|XP_008222003.1| PREDICTED: uncharacterized protein LOC103321928 [Prunus mume]
Length=670

 Score =   182 bits (461),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 157/487 (32%), Positives = 241/487 (49%), Gaps = 59/487 (12%)
 Frame = +1

Query  334   PAGRGIRKRGDFLASSEDTAMMDHVRAT---HD--VDAVHYKVKPLLHLIEDIM-----P  483
             PA R  R++  F ++S+D A+++ +  T   HD   +     VK +L  IE I+     P
Sbjct  22    PAPRDGRRQ--FSSTSDDNALVNQILLTDKSHDRPYEVSSLAVKNILQTIEAILSRVMKP  79

Query  484   RAHATI--PGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAY---RTSFEIIGGY  648
               H  I  PG +    T     DA+  EK +H+ L+   E+F  P +     S EI+   
Sbjct  80    DTHGAIVLPGTLVPAATHA---DALEHEKTLHASLSTLSESFDVPNHVFNAISCEILCKS  136

Query  649   SSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIV  828
              +  DA+  T+ +L ++ NY WD K V+   AFA + GEF L+A+LY ++PLAK+V  + 
Sbjct  137   LAGEDANKTTMDILNIVQNYDWDEKVVLALGAFAVKDGEFWLVAQLYTSNPLAKAVGQLK  196

Query  829   QIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKE  1008
             Q+ ++LE + +      K      L   +L+VT  II L+E+ ++               
Sbjct  197   QLQEILERAGTILKP--KFDGYNNLVKAVLKVTRSIIQLQELQNDPH-------------  241

Query  1009  LAESLSPVTAEQENIMakasyyvvkaavTCSLVIL--NLLAVGRDYYssteeeleistlt  1182
                    +T E ++  + A           S+V+    LL +         E  E+S+L 
Sbjct  242   -------LTPEIKSAASTAHIPTAVYWTIRSIVVAASQLLGITGSDPEYVTEAWELSSLA  294

Query  1183  HKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTP  1362
             HKL  I   LQ+ + K  Q I KIK       +   L   H DN  S  L +    D  P
Sbjct  295   HKLENIFNHLQENLNKLNQIIQKIKDEDAFNAIARILESPHIDN--SKPLRVLFYKDDQP  352

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDI--PNEVITMLRHMYLESKQDPSRAESQFE  1536
              ++  GL  K+  +D+L+RK V L +SDLD+   NE + ++++MY+E +Q+  R ESQFE
Sbjct  353   ALYD-GLNKKRVDIDVLKRKVVILFISDLDVVQGNEYM-IVQNMYIEKRQNLGRPESQFE  410

Query  1537  IVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*RR------KPL  1698
             IVW+PI D    WT AK  QF  ++++M W+SV HPS +   V  Y+  +R      KPL
Sbjct  411   IVWVPITDE---WTAAKYQQFENLRNNMEWYSVFHPSVVSPIVVRYIRDQRKWNFVKKPL  467

Query  1699  LAVVDTQ  1719
             L V+D Q
Sbjct  468   LVVMDPQ  474



>ref|XP_006378259.1| hypothetical protein POPTR_0010s060303g, partial [Populus trichocarpa]
 gb|ERP56056.1| hypothetical protein POPTR_0010s060303g, partial [Populus trichocarpa]
Length=408

 Score =   177 bits (448),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 188/336 (56%), Gaps = 26/336 (8%)
 Frame = +1

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  A FA  YGEF L+A+LY T+PLAK+VA + Q+PD++E +++      K  E+  L 
Sbjct  2     VLALAGFAVNYGEFWLVAQLYLTNPLAKAVALLKQLPDIIERADNLNP---KFEELTTLI  58

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV-TAEQENIMakasyyvvk  1083
               +++V   I   KE+ S       +Y      E+  + + + TA    I         +
Sbjct  59    KAVMDVARCIFEFKELPS-------RYITPDTPEMLTATAHIPTAVYWTI---------R  102

Query  1084  aavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHT  1263
             + V C+  I+ L+ +G +Y +ST E  E+S+L HK++ I   L K +    Q I + +H 
Sbjct  103   SVVACASQIMGLIGMGHEYIASTTEAWELSSLAHKVNNIHSHLMKQLTLCFQHIDEKRHI  162

Query  1264  IKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
                + L       H DN    + +I  ++D  P+  G+    K+  LD+LRR+ V LL+S
Sbjct  163   EAFQTLVSLFEAFHIDNMKILKALIYAKDDQLPLFDGST--KKRASLDVLRRRSVLLLIS  220

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
             DL+I +E ++ML+ MY E+++ P R ESQ+E+VWLP+VDR SPW+  K+  F   +  MP
Sbjct  221   DLEISHEELSMLQQMYSEAREQPGRPESQYEVVWLPVVDRSSPWSETKQKLFEDFQRIMP  280

Query  1624  WFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             W+SV HPS +D AV  Y+    +  ++PLL V+D Q
Sbjct  281   WYSVHHPSLLDVAVIRYIKEVWHFNKRPLLVVLDPQ  316



>emb|CAN65452.1| hypothetical protein VITISV_003896 [Vitis vinifera]
Length=721

 Score =   181 bits (460),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 205/379 (54%), Gaps = 27/379 (7%)
 Frame = +1

Query  604   AYPAYRTSFEIIGGYSS--NRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLL  777
             A   YR +  I   Y S    DAH+ TLS+  LL +Y W+AK V+T +AFA  YGEF LL
Sbjct  98    AASVYRAASGIQIAYKSLGGXDAHATTLSIFDLLTSYSWEAKLVLTLSAFAVNYGEFWLL  157

Query  778   ARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIG  957
             A++Y ++ LAKS+A + Q+P +LE S   +     L  + +    M+ +T  II  KE+ 
Sbjct  158   AQIYSSNQLAKSMAILKQVPIILEHSGQLKPRFDALNNLIR---AMVAITRCIIEFKELP  214

Query  958   SEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRD  1137
             S   S  V               P  A     +  A Y+ +++ V C+  I  L ++G +
Sbjct  215   SMYISQDV---------------PALATAMTHIPTAVYWTIRSVVACATQITTLTSMGHE  259

Query  1138  YYssteeelei-stltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDN  1314
             Y+ S   E    ST+ HK++ IL  L+K +    Q I    +    ++L       H DN
Sbjct  260   YWXSATNEAWELSTMAHKINSILDLLKKQLTLCYQYIDDKWNAETFQMLLNLFESIHIDN  319

Query  1315  KYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYL  1494
                   +I  ++D  P++ G+    ++  +D+LRRK V LL+S L I ++ +++L  +Y 
Sbjct  320   MKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLSISHDELSILEQIYN  377

Query  1495  ESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGY  1674
             ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+SV  P+ ID+AV  +
Sbjct  378   ESRVHGTRMESQYEVVWIPVVDRSVXWTDAMQDRFETLQATMPWYSVYTPTLIDKAVIRF  437

Query  1675  L----N*RRKPLLAVVDTQ  1719
             +    + R KP+L V+D Q
Sbjct  438   IKEVWHFRNKPILVVLDPQ  456



>ref|XP_009769607.1| PREDICTED: uncharacterized protein LOC104220433 [Nicotiana sylvestris]
Length=719

 Score =   177 bits (450),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 149/470 (32%), Positives = 246/470 (52%), Gaps = 31/470 (7%)
 Frame = +1

Query  334   PAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGY  510
             PA    R+     + S+D AM   +  TH+ D     VK +LH++E+I   A+ A I G 
Sbjct  15    PAQPMARRERPVFSMSDDHAMSKKILDTHNPDGREVDVKIILHVVEEIFQHAYPARIDGM  74

Query  511   VQSV--QTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             +     Q   A ++A+  E+      +  +E  AY  ++ S E+    S   D HS T++
Sbjct  75    LHGTTDQHHEANIEALKLEEKASLAFDGILEGLAYIIHKVSCELTCKCSGGGDTHSTTMA  134

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +L +L+ Y WDAK V++ AAFA  YGEF L+A+++ T PLAKSVA + Q+PD +E   S 
Sbjct  135   ILAMLSGYQWDAKLVLSLAAFAITYGEFWLVAQMFATHPLAKSVALLKQLPDTMEHHASL  194

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             ++    + E+ K    +LEVT +II  K + S+               ++E   P++   
Sbjct  195   KSRFDAINELIK---AILEVTKRIIEFKRLPSQ--------------YISEDQPPLSIAI  237

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDLQKA  1221
              +I   A Y+ +K+ V C+  + +LL +  +  ++T     E+S+ THKL  I   L+  
Sbjct  238   SHI-PTAVYWTIKSIVACASQLTSLLGMNYEMIAATTSDTWEMSSSTHKLRNISDHLKAE  296

Query  1222  VQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHG  1401
             +++    I +  H    ++L      T  DN      +I  ++D  P+    G    +  
Sbjct  297   LERCYHHIQEKMHVEYYQMLVHLFETTQFDNMKINRGMIYIKDDLLPL--EVGTTRTRAS  354

Query  1402  LDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTG  1581
             +++LRRK V LL+SDLD   E + +L H+Y ES+   +R E Q+EIVWLPIVDR   W  
Sbjct  355   IEVLRRKTVLLLLSDLDASPEELLVLSHIYTESR---ARPELQYEIVWLPIVDRSRGWNE  411

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
              +E +F  +++ MPW+++ HPS ++ A+  ++  R    +K +L  +D Q
Sbjct  412   EQEMKFKELQAIMPWYTLHHPSLLEPAIVKFVKERWHFSKKMMLVTLDPQ  461



>ref|XP_004236293.1| PREDICTED: uncharacterized protein LOC101251462 [Solanum lycopersicum]
Length=724

 Score =   176 bits (446),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 150/456 (33%), Positives = 240/456 (53%), Gaps = 32/456 (7%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQTQ--PARLDA  549
             S+D AM   +  TH+ D     V  +LH++ED+   ++ A + G +           ++A
Sbjct  34    SDDHAMSKKILDTHNPDGREVDVNVILHIVEDVFQHSYPAAMDGVLNGAGAHHLEGNIEA  93

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSN-RDAHSITLSVLKLLANYWWDAKA  726
             +  E+      +  +E  AY  ++ S E+    SS   DAHS T+SVL +L+ Y WDAK 
Sbjct  94    LKLEEKASLAFDGILEGLAYIIHKVSCELTCKCSSGGHDAHSTTMSVLGMLSGYQWDAKL  153

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             VI+ AAFA  YGEF L+A+++ T PLAKSVA + Q+PD++E S S R+    + E+ K  
Sbjct  154   VISLAAFAVTYGEFWLVAQMFATHPLAKSVAILKQLPDIMEHSASLRSRFDAINELIK--  211

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +LEVT  I+  K++ S+               + E   P++    +I   A Y+ +K+
Sbjct  212   -AILEVTKIIMEFKKLPSQY--------------ITEDQPPLSVAISHI-PTAVYWTIKS  255

Query  1087  avTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDLQKAVQKSTQEIGKIKHT  1263
              V C+  +  LL +  D   +T     E+S+ THKL  I   L+  + +    I +  H 
Sbjct  256   IVACASQLTTLLGMSYDMIVATTADTWEMSSSTHKLKNISEHLRVELNRCYAHIQEKMHV  315

Query  1264  IKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
                ++L      T  DN      +I  ++D  P+    G    +  +++LRRK V LL+S
Sbjct  316   EYFQMLVHLFEATQFDNMKIMRAMIYIKDDLLPL--EVGTTHTRASVEVLRRKTVLLLLS  373

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
             DLD  +E I +L  +YLES+   SR E Q+EIVWLPIVDR   W  A+E +F  +++ MP
Sbjct  374   DLDASHEEILVLSQIYLESR---SRPEFQYEIVWLPIVDRSKGWNDAQEQKFKELQALMP  430

Query  1624  WFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             W+++ HPS ++ A+  ++  +    +K +L  +D Q
Sbjct  431   WYTLHHPSLLEPAIVKFVKEKWHFTKKMMLVTLDPQ  466



>ref|XP_004138263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101204444 
[Cucumis sativus]
Length=694

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 242/455 (53%), Gaps = 38/455 (8%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
              L  S+D AM   + ATH  D+    VKP+L ++E+++   HAT P  +       A+ +
Sbjct  11    MLPVSDDNAMTKQILATHSPDSHKVDVKPILLIVEEVI--RHAT-PDII-------AKGN  60

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
               L++++  + ++  +E  A+   +   E+     S  DAH+ T+++L LL+NY WDAK 
Sbjct  61    GQLDDQLGLAEMDGMLEPLAHVVQKVGAEL-ACKCSGGDAHATTMAILNLLSNYSWDAKV  119

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             VIT AAF+  YG++ LLA+LY T+ LAK++A + Q+PD++E S S +     L   +KL 
Sbjct  120   VITLAAFSVTYGQYWLLAQLYTTNMLAKALALLKQLPDVIEHSNSLKPHFDAL---SKLI  176

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +L VT  I+   E+ S+  S               S +P  +        A+Y+ +K+
Sbjct  177   AAILNVTKCIVKFTELPSQYIS---------------SDTPAMSVALASFPTAAYWTIKS  221

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+ +I +L+++  +   ST E  E+S+L HK+  I G LQ  ++   Q I + +H  
Sbjct  222   LVACTSLIESLVSLSHELIMSTTEVWELSSLAHKVKDIHGHLQMQLKLCIQYIDEKRHEE  281

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN       I    D  PI  G   +M  H L+IL+RK+V LL+SD
Sbjct  282   AYQNLVRISETLHLDNMKFIRAFISTREDIHPIYDGTT-KMTVH-LEILKRKHVLLLISD  339

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDIP+E + +L +++ E+ Q P   E ++EIVW+PI+D         + +F  +K  MPW
Sbjct  340   LDIPHEEVMILDNLFKEAHQRP---EIRYEIVWIPIIDPAIEQHSKSKHKFEELKQLMPW  396

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             FSV  PS I+ +   ++    N R+K +L  +D Q
Sbjct  397   FSVYDPSIIELSTIRFIKEKWNFRKKTILVALDPQ  431



>ref|XP_004161368.1| PREDICTED: uncharacterized LOC101204444 [Cucumis sativus]
 gb|KGN63518.1| hypothetical protein Csa_1G002870 [Cucumis sativus]
Length=698

 Score =   175 bits (444),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 150/455 (33%), Positives = 242/455 (53%), Gaps = 38/455 (8%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
              L  S+D AM   + ATH  D+    VKP+L ++E+++   HAT P  +       A+ +
Sbjct  21    MLPVSDDNAMTKQILATHSPDSHKVDVKPILLIVEEVI--RHAT-PDII-------AKGN  70

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
               L++++  + ++  +E  A+   +   E+     S  DAH+ T+++L LL+NY WDAK 
Sbjct  71    GQLDDQLGLAEMDGMLEPLAHVVQKVGAEL-ACKCSGGDAHATTMAILNLLSNYSWDAKV  129

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             VIT AAF+  YG++ LLA+LY T+ LAK++A + Q+PD++E S S +     L   +KL 
Sbjct  130   VITLAAFSVTYGQYWLLAQLYTTNMLAKALALLKQLPDVIEHSNSLKPHFDAL---SKLI  186

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +L VT  I+   E+ S+  S               S +P  +        A+Y+ +K+
Sbjct  187   AAILNVTKCIVKFTELPSQYIS---------------SDTPAMSVALASFPTAAYWTIKS  231

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+ +I +L+++  +   ST E  E+S+L HK+  I G LQ  ++   Q I + +H  
Sbjct  232   LVACTSLIESLVSLSHELIMSTTEVWELSSLAHKVKDIHGHLQMQLKLCIQYIDEKRHEE  291

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN       I    D  PI  G   +M  H L+IL+RK+V LL+SD
Sbjct  292   AYQNLVRISETLHLDNMKFIRAFISTREDIHPIYDGTT-KMTVH-LEILKRKHVLLLISD  349

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDIP+E + +L +++ E+ Q P   E ++EIVW+PI+D         + +F  +K  MPW
Sbjct  350   LDIPHEEVMILDNLFKEAHQRP---EIRYEIVWIPIIDPAIEQHSKSKHKFEELKQLMPW  406

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             FSV  PS I+ +   ++    N R+K +L  +D Q
Sbjct  407   FSVYDPSIIELSTIRFIKEKWNFRKKTILVALDPQ  441



>ref|XP_006439978.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
 gb|ESR53218.1| hypothetical protein CICLE_v10019109mg [Citrus clementina]
Length=698

 Score =   175 bits (443),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 149/462 (32%), Positives = 239/462 (52%), Gaps = 34/462 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQT  528
             R +    ++S+D+AMM  V+ATH  D     V P+L +IEDI  RA  + I G +   + 
Sbjct  7     RSQRRMFSASDDSAMMKQVQATHAPDGREVDVTPILSIIEDIFRRATPSDIDGVLNGARE  66

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 +DA L++ +     +  +EA +Y  ++ S EI    S   DAH+ T+++   L+ Y
Sbjct  67    H---MDA-LDDNISLDAFSGMLEALSYTIHKISCEISCKCSEGGDAHATTMALFNTLSGY  122

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V++ AAFA  YGEF L A+L   + LAKSVA + Q+ ++LE   + +     L 
Sbjct  123   KWDAKMVLSLAAFAVNYGEFWLGAQLCTNNSLAKSVAVLKQVSNVLEHYNALKPQFDALN  182

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K+   ML++T  I+  K++ S+  S             A+++S   A     +  A+
Sbjct  183   NLIKV---MLDLTKCIVEFKQLPSQYISTD-----------AQAVSIAMAH----IPAAA  224

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+  ++ V C    L+L  +   Y +ST E  E+S+L HK+S IL   +K +    Q+I 
Sbjct  225   YWTFRSIVACYSQTLSLTGLRDAYTASTTEAWELSSLAHKVSSILEHFKKLIAICYQQID  284

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + +       L   L   H DN      +I  ++D  P++ G      +  +D+LR+K+V
Sbjct  285   ENRQIEAYHNLVRLLETIHMDNMKVLRALIYAKDDIQPLVDG--FTKNRVNIDVLRKKHV  342

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAES-QFEIVWLPIVDRRSPWTGAKEDQFTL  1605
              LL+S LD+  E I +L  MY    +DP  +E   + IVWLPIVDR   W    + +F  
Sbjct  343   LLLISSLDLSAEEILVLDQMY----RDPKASEEYHYAIVWLPIVDRSIAWDDGYQQKFEQ  398

Query  1606  VKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +++ MPW++V HP+ I+ AV  Y+       +K +L  VD Q
Sbjct  399   LQAMMPWYTVQHPTIIEPAVVKYIKEVWKFSKKAILVPVDPQ  440



>gb|AFN06072.1| sieve element occlusion protein 1 [Nicotiana tabacum]
Length=719

 Score =   175 bits (443),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 148/470 (31%), Positives = 246/470 (52%), Gaps = 31/470 (7%)
 Frame = +1

Query  334   PAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGY  510
             PA    R+     + S+D AM   +  TH+ D     VK +LH++E+I   A+ A I G 
Sbjct  15    PAQPMARRERPVFSMSDDHAMSKKILDTHNPDGREVDVKIILHVVEEIFQHAYPARIDGM  74

Query  511   VQSV--QTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
             +     Q   A ++A+  E+      +  +E  AY  ++ S E+    S   D +S T++
Sbjct  75    LHGTTDQHHEANIEALKLEEKASLAFDGILEGLAYIIHKVSCELTCKCSGGGDTYSTTMA  134

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             +L +L+ Y WDAK V++ AAFA  YGEF L+A+++ T PLAKSVA + Q+PD +E   S 
Sbjct  135   ILAMLSGYQWDAKLVLSLAAFAITYGEFWLVAQMFATHPLAKSVALLKQLPDTMEHHASL  194

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
             ++    + E+ K    +LEVT +II  K + S+               ++E   P++   
Sbjct  195   KSRFDAINELIK---AILEVTKRIIEFKRLPSQ--------------YISEDQPPLSIAI  237

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDLQKA  1221
              +I   A Y+ +K+ V C+  + +LL +  +  ++T     E+S+ THKL  I   L+  
Sbjct  238   SHI-PTAVYWTIKSIVACASQLTSLLGMNYEMIAATTSDTWEMSSSTHKLRNISDHLKAE  296

Query  1222  VQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHG  1401
             +++    I +  H    ++L      T  DN      +I  ++D  P+    G    +  
Sbjct  297   LERCYHHIQEKMHVEYYQMLVHLFETTQFDNMKINRGMIYIKDDLLPL--EVGTTRTRAS  354

Query  1402  LDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTG  1581
             +++LRRK V LL+SDLD   E + +L H+Y ES+   +R E Q+EIVWLPIVDR   W  
Sbjct  355   IEVLRRKTVLLLLSDLDASPEELLVLSHIYTESR---ARPELQYEIVWLPIVDRSRGWNE  411

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
              +E +F  +++ MPW+++ HPS ++ A+  ++  R    +K +L  +D Q
Sbjct  412   EQEMKFKELQAIMPWYTLHHPSLLEPAIVKFVKERWHFSKKMMLVTLDPQ  461



>ref|XP_002271950.2| PREDICTED: uncharacterized protein LOC100261056 [Vitis vinifera]
Length=713

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/459 (30%), Positives = 237/459 (52%), Gaps = 32/459 (7%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
              ++SED  M+  + ATH+ D   + VKPLLHL+E I   A         S+  +   ++A
Sbjct  21    FSASEDNMMLKQIEATHEPDGREFDVKPLLHLVEQIFTCATPKSDVTFDSLDLKTNDVEA  80

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
              LE+K   +G    +EA AY   R S EI    S   +AH   +SVL +++++ WDAK V
Sbjct  81    -LEDKTHQAGFISTLEALAYTIDRISCEIRCKCSGGEEAHQRAISVLNMVSSHPWDAKLV  139

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +T +AFA  YGEF L+ + Y ++ LAKS+A + Q+P++L  S   +   + ++++ K   
Sbjct  140   LTLSAFAVNYGEFWLVFQSYNSNDLAKSMAILKQVPEILGRSSMLKPQFNSIKDLIK---  196

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              ML+V + I+  +E+ S+       Y  +     + +L+ +          A Y+ ++  
Sbjct  197   AMLDVANCIVKFRELPSQ-------YITTDESAFSTALANIP--------IAVYWTIRCV  241

Query  1090  vTCSLVILNLLAV-GRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
             V C+  I  L  + G ++  ST E  EIS L HK+  I   L+  +    + I   +   
Sbjct  242   VACASQIARLKGLQGDEHPLSTSEAWEISALVHKVRNIHNHLRDKLDACHKHIDDKRRME  301

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               ++L E    +H+DN    + +I   ++  P+ HGA    ++  +D+ +  +V LL+S+
Sbjct  302   AYQMLLELFKTSHSDNMKVLKALIYARDNQNPLFHGAT--HRRVDIDVFKDTHVLLLISN  359

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDI ++ + +L  +Y ES +   R   Q+EIVWLPI+D+  PW  + +  F   ++ MPW
Sbjct  360   LDISHDELEVLEDIYRESLK--KRPGIQYEIVWLPIIDQSDPWMESSQKLFENHRARMPW  417

Query  1627  FS----VSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             ++    +  PS  D AV  ++       RKP+L V+  Q
Sbjct  418   YARHDPLRSPSPEDGAVITFIKKEWHYGRKPILVVLGPQ  456



>ref|XP_007140863.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
 gb|ESW12857.1| hypothetical protein PHAVU_008G147900g [Phaseolus vulgaris]
Length=727

 Score =   175 bits (443),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 134/453 (30%), Positives = 233/453 (51%), Gaps = 29/453 (6%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAI  552
             A S+D+ ++  V   H+ + + Y V+PLL ++ED++  +  T  G         AR+D +
Sbjct  24    AISDDSVLVKKVLTEHNPEGIEYDVRPLLRIVEDVLICSTLTSEG---PTTGALARVDNV  80

Query  553   LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVI  732
              E+K  H G    +EA +    R S EI        D HS T+++  +L  + WD K V+
Sbjct  81    -EDKSYHPGQTNMLEALSAKIDRISCEIPYKTLCGVDVHSTTVAIFDMLTIFKWDVKIVL  139

Query  733   TFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADK  912
               AAFA  YGEF LLA+++  + LAKS+A + Q+P ++  + S +     L ++  +   
Sbjct  140   ALAAFALTYGEFWLLAQIHDKNQLAKSMAILKQLPSIMARASSLKPRFDTLNDLVSI---  196

Query  913   MLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaav  1092
             ++EVT ++I   ++ S+  +  +    + Y               N +  ASY+ V++ V
Sbjct  197   IVEVTKRVIEFHDLRSQYITQDISAYTTAY---------------NYIPVASYWTVRSIV  241

Query  1093  TCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKR  1272
              C+  I +L  +  + ++ST+     + +  KL  I   L++ +    + IGK       
Sbjct  242   ACAAQITSLTTLSYEIFASTDAWELSTLI-FKLRNINDHLRQLLNSCHEHIGKKMDAEAY  300

Query  1273  KILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD  1452
             ++L +  ++ HTDN    + +I  ++D  P+  G  +  K+  L+ LRRK V LL S ++
Sbjct  301   QMLRDLFSKPHTDNMKVLKALIYAQDDILPLYDG--VTKKRVSLEPLRRKNVLLLFSGME  358

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
             I  + + +L  +Y ESK   SR ES++E+VW+PIVD    W   K+ QF  ++ +M W+S
Sbjct  359   ISTDELMILEQIYNESKTHTSRMESRYELVWIPIVDPNYEWIEPKKKQFESLQENMSWYS  418

Query  1633  VSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             V  PS I + V  ++      + KP+L V+D Q
Sbjct  419   VYDPSLIGKPVIWFIQSEWKYKNKPILVVLDPQ  451



>ref|XP_008464490.1| PREDICTED: uncharacterized protein LOC103502357 isoform X1 [Cucumis 
melo]
Length=700

 Score =   174 bits (442),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 148/455 (33%), Positives = 238/455 (52%), Gaps = 35/455 (8%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
              L +S+D AM   + ATH  D+    VKP+L ++E+++  A   I G V     Q     
Sbjct  20    MLYASDDNAMTKQILATHSPDSHKVDVKPILLIVEEVIRHATPDIIGKVIDGNGQ-----  74

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
               L++++  + ++  +E  A+   +   E+   +    DAH+ T+++L LL+NY WDAK 
Sbjct  75    --LDDQLSLAEMDGMLEPLAHVVQKVGAELACKFLGG-DAHATTMAILNLLSNYSWDAKV  131

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             VIT AAFA  YG++ LLA+LY T+ LAK++A + Q+PD++E S S +     L   +KL 
Sbjct  132   VITLAAFAVTYGQYWLLAQLYTTNMLAKALALLKQLPDVIEHSNSLKPHFDAL---SKLI  188

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +L VT  I+   E+ S   S               S +P  +        A+Y+ +K+
Sbjct  189   AAILNVTKCIVKFTELPSHYIS---------------SDTPAMSVALANFPTAAYWTIKS  233

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+ +I +L+++  +   ST E  E+S+L HK+  I   LQ  ++   Q I + +H  
Sbjct  234   LVACTSLIESLVSLSHELIMSTTEVWELSSLAHKVKNIHEHLQMQLELCIQYIDEKRHEE  293

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN      +I    D  P+  G   +   H L+IL+RK+V LL+SD
Sbjct  294   AYQNLVRISETLHLDNMKFIRALISSREDIHPLYDGTT-KTTVH-LEILKRKHVLLLISD  351

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDIP+E + +L +++ ES Q P   E ++EIVW+PI+D         + +F  +K  MPW
Sbjct  352   LDIPHEEVMILDNLFKESHQRP---EIRYEIVWIPIIDPAVEQHSKSKHKFEELKQLMPW  408

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             FSV  PS I+ +   ++    N R+K +L  +D Q
Sbjct  409   FSVYDPSIIELSTIRFIKEKWNFRKKTILVALDPQ  443



>ref|XP_004143056.1| PREDICTED: uncharacterized protein LOC101208559 [Cucumis sativus]
 gb|KGN62332.1| hypothetical protein Csa_2G349660 [Cucumis sativus]
Length=703

 Score =   174 bits (440),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 153/480 (32%), Positives = 246/480 (51%), Gaps = 45/480 (9%)
 Frame = +1

Query  304   VVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMP  483
             V AP +  +I   R +   GD      + A+   V ATH  + + + V PLL L+E I  
Sbjct  3     VAAPRKLSLIKPDRQLFAGGD------ENALTKQVLATHSEEPLEFPVTPLLSLVEQIFL  56

Query  484   RAHA-TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNR  660
             RA   T+ G      T  A+L+AI ++    + L + ++  ++   R S EI    S   
Sbjct  57    RAKLNTLQG------TTRAQLEAIEDKSPSPTDLLDLLDFVSFTINRVSNEIQYKCSGAG  110

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             D H++T+ V  LL+++ WDAK V+  AAFA  YGEF LL +   TD LAK ++ + ++P+
Sbjct  111   DPHTVTMEVFNLLSSWPWDAKVVLALAAFAINYGEFWLLVQQSSTDLLAKDISLLKKLPE  170

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
             + E       V  K   + KL   +++V   I+  K +                      
Sbjct  171   IFE---RVDIVKQKFEALDKLIKSLVDVAKCIVDFKMLP------------------PHY  209

Query  1021  LSPVTAEQEN---IMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKL  1191
             ++P T E ++   ++  A Y+ +++ V C+     L+ VG +Y +S  E  E+S+L HK+
Sbjct  210   ITPDTPEMKSATTLIPTAIYWTIRSIVACAAQNAGLIGVGHEYLASASETWELSSLAHKI  269

Query  1192  SYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIH  1371
               I   L++ +      I +  H      L       H DN      +I  ++D  P++ 
Sbjct  270   DNIRKHLEQLLLACHHYINEKMHHEAYMNLVRLFEIPHIDNNKILRALIYSKDDKPPLLD  329

Query  1372  GAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
               GL  +K  L++LR+K V LL+SDLD+    ++ML  +Y ES+Q+ +R+ES +E+VW+P
Sbjct  330   --GLSKEKATLEVLRKKNVLLLISDLDLSIVELSMLDQIYRESRQNKTRSESDYEVVWMP  387

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             IV+  SPWT  K+ +F  +   MPW+SV+HPS I+ AV  Y+    N  +KPLL V+D Q
Sbjct  388   IVE--SPWTEDKQVKFEALLGLMPWYSVAHPSLIESAVIKYVRQVWNFIKKPLLVVLDPQ  445



>ref|XP_009769432.1| PREDICTED: uncharacterized protein LOC104220293 isoform X1 [Nicotiana 
sylvestris]
Length=706

 Score =   173 bits (439),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 146/473 (31%), Positives = 243/473 (51%), Gaps = 35/473 (7%)
 Frame = +1

Query  316   LQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA  495
             L A+  P  R  R+R  F + S+D AM   +  TH  +     V  +L +IE I    H 
Sbjct  6     LTARPQPVSR--RERPVF-SMSDDHAMSKKILNTHSPNGREVDVDIILQVIEGIFQHIH-  61

Query  496   TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSI  675
                G +Q    + +   + LEE    +  +  +E  AY  ++ S ++   +S   DAH+ 
Sbjct  62    ---GALQDSTDRESMETSKLEENASFAFDDFHLEGLAYIMHKVSCQLTCKFSGGGDAHAT  118

Query  676   TLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEss  855
             T+ +L +L++Y WD K V+T A+F+  YGEF L+A+ + T PLAK VA + Q+PD++E +
Sbjct  119   TMEILGMLSSYQWDTKLVLTLASFSIIYGEFWLVAQKFATHPLAKMVALLKQLPDIIEHA  178

Query  856   essravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVT  1035
              + ++   +   +  L   +L++T  II  K + S+  S           E   S+S   
Sbjct  179   AALKS---RFDAINNLLKAILDITKCIIEFKRLPSQYIS-----------EDQPSMSVAF  224

Query  1036  AEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDL  1212
             A        A Y+ +K+ V C+  + +LL +  +  S+T     E+S+ THKL+ I   L
Sbjct  225   A----YFPTAVYWTIKSIVACASQLTSLLGMSNELISATTTDTWEMSSSTHKLNNISDHL  280

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMK  1392
             +  +++  + I + KHT   ++L      T  DN    + +I  ++D  P+    G    
Sbjct  281   RAELERCYEHIQEKKHTEYYQMLVHLFETTQLDNMKINKALIYIKDDLLPL--EVGTMHT  338

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             +  +D+LRRK V LL+SDLDI  E + +L  +Y ES+    R+E Q+EIVWLPI DR   
Sbjct  339   RANIDVLRRKTVLLLISDLDITPEEVLILATVYNESR---GRSELQYEIVWLPISDRSRE  395

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             W    E +F  +++ MPW+++ HPS ++ A   ++  R    +K +L  +D Q
Sbjct  396   WNEGYEHKFKELQALMPWYTLHHPSLLEPAAIKFVKERWHFSKKMMLVALDPQ  448



>ref|XP_006476923.1| PREDICTED: uncharacterized protein LOC102608617 isoform X1 [Citrus 
sinensis]
Length=698

 Score =   173 bits (439),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 148/462 (32%), Positives = 239/462 (52%), Gaps = 34/462 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQT  528
             R +    ++S+D+AMM  V+ATH  D     V P+L +IEDI  RA  + I G +   + 
Sbjct  7     RSQRRMFSASDDSAMMKQVQATHAPDGREVDVTPILSIIEDIFRRATPSDIDGVLNGARE  66

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 +DA L++ +     +  +EA +Y  ++ S EI    S   DAH+ T+++   L+ Y
Sbjct  67    H---MDA-LDDNISLDAFSGMLEALSYTIHKISCEISCKCSEGGDAHATTMALFNTLSGY  122

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V++ AAFA  YGEF L A+L   + LAKSVA + Q+ ++LE   + +     L 
Sbjct  123   SWDAKMVLSLAAFAVNYGEFWLGAQLCTNNSLAKSVAVLKQVSNVLEHYNALKPQFDALN  182

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K+   ML++T  I+  K++ S+  S             A+++S   A     +  A+
Sbjct  183   SLIKV---MLDLTKCIVEFKQLPSQYISTD-----------AQAVSIAMAH----IPAAA  224

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+  ++ V C    L+L  +   Y +ST E  E+S+L HK+S +L   +K +    Q+I 
Sbjct  225   YWTFRSIVACYSQTLSLTGLRDAYTASTTEAWELSSLAHKVSSMLEHFKKLIAICYQQID  284

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             + +       L   L   H DN      +I  ++D  P++ G      +  +D+LR+K+V
Sbjct  285   ENRQIEAYHNLVRLLETIHLDNMKVLRALIYAKDDIQPLVDG--FTKNRVNIDVLRKKHV  342

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAES-QFEIVWLPIVDRRSPWTGAKEDQFTL  1605
              LL+S LD+  E I +L  MY    +DP  +E   + IVWLPIVDR   W    + +F  
Sbjct  343   LLLISSLDLSAEEILVLDQMY----RDPKASEEYHYAIVWLPIVDRSIAWDDGYQQKFEQ  398

Query  1606  VKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +++ MPW++V HP+ I+ AV  Y+       +K +L  VD Q
Sbjct  399   LQAMMPWYTVQHPTIIEPAVVKYIKEVWKFSKKAILVPVDPQ  440



>gb|KDO69426.1| hypothetical protein CISIN_1g044391mg [Citrus sinensis]
Length=691

 Score =   173 bits (438),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 140/441 (32%), Positives = 235/441 (53%), Gaps = 32/441 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R +G  L++++D+AMM  V+A+H  D     V+P+L +IEDI  RA    P  +  V T+
Sbjct  7     RSKGRMLSATDDSAMMKQVQASHAPDGREVDVRPILSIIEDIFRRA---TPSTIDGVGTR  63

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
                +DA L+     + L+  ++A +    + S EI    S   +AH+ T+ +  +L+ Y 
Sbjct  64    E-HVDA-LDNNASPAALSGMLDALSCDIRKISCEISCKCSGGEEAHATTMDLFNILSVYS  121

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YG+F L A+L   + LAKS+A + Q+P++LE   + +     L +
Sbjct  122   WDAKMVLSLAAFALNYGQFWLSAQLCNKNSLAKSMAVLKQLPNVLEHYNALKPQLDALIK  181

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V      ML++T  I+  K++ S+  S             A+++S   A+       A+Y
Sbjct  182   V------MLDLTKCIVEFKQLPSQYISTD-----------AQAMSTAMADT----PAAAY  220

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             +  ++ V C   IL+L  +  +Y +S  +  E+++L H++S IL   +K +    Q+I +
Sbjct  221   WTFRSIVACHSQILSLAGLRDEYTASNTDAWELASLAHRVSRILEHFKKLIAICYQQIDE  280

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              +       L   L   H DN      +I  ++D  P++ G+     +  +++LRRK+V 
Sbjct  281   NRQIEAYHNLVRLLETIHMDNMKVLRALIYAKDDIQPVVDGSS--RTRVNIEVLRRKHVL  338

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+S LD+ +E I +L H+Y E K   +R E  + IVWLPIVDR   W      +F  ++
Sbjct  339   LLISSLDLSDEEILVL-HLYREHK---AREEFDYAIVWLPIVDRSIAWDEGYRQKFEQLQ  394

Query  1612  SSMPWFSVSHPSKIDEAVYGY  1674
             + MPW++V HP+ I+ AV  Y
Sbjct  395   AMMPWYTVQHPTIIEPAVVKY  415



>ref|XP_008464491.1| PREDICTED: uncharacterized protein LOC103502357 isoform X2 [Cucumis 
melo]
Length=697

 Score =   172 bits (436),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 146/455 (32%), Positives = 238/455 (52%), Gaps = 38/455 (8%)
 Frame = +1

Query  367   FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
              L +S+D AM   + ATH  D+    VKP+L ++E+++  A   I G          + +
Sbjct  20    MLYASDDNAMTKQILATHSPDSHKVDVKPILLIVEEVIRHATPDIIG----------KGN  69

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
               L++++  + ++  +E  A+   +   E+   +    DAH+ T+++L LL+NY WDAK 
Sbjct  70    GQLDDQLSLAEMDGMLEPLAHVVQKVGAELACKFLGG-DAHATTMAILNLLSNYSWDAKV  128

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             VIT AAFA  YG++ LLA+LY T+ LAK++A + Q+PD++E S S +     L   +KL 
Sbjct  129   VITLAAFAVTYGQYWLLAQLYTTNMLAKALALLKQLPDVIEHSNSLKPHFDAL---SKLI  185

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +L VT  I+   E+ S   S               S +P  +        A+Y+ +K+
Sbjct  186   AAILNVTKCIVKFTELPSHYIS---------------SDTPAMSVALANFPTAAYWTIKS  230

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+ +I +L+++  +   ST E  E+S+L HK+  I   LQ  ++   Q I + +H  
Sbjct  231   LVACTSLIESLVSLSHELIMSTTEVWELSSLAHKVKNIHEHLQMQLELCIQYIDEKRHEE  290

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L       H DN      +I    D  P+  G   +   H L+IL+RK+V LL+SD
Sbjct  291   AYQNLVRISETLHLDNMKFIRALISSREDIHPLYDGTT-KTTVH-LEILKRKHVLLLISD  348

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDIP+E + +L +++ ES Q P   E ++EIVW+PI+D         + +F  +K  MPW
Sbjct  349   LDIPHEEVMILDNLFKESHQRP---EIRYEIVWIPIIDPAVEQHSKSKHKFEELKQLMPW  405

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             FSV  PS I+ +   ++    N R+K +L  +D Q
Sbjct  406   FSVYDPSIIELSTIRFIKEKWNFRKKTILVALDPQ  440



>ref|XP_006439977.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
 gb|ESR53217.1| hypothetical protein CICLE_v10019128mg [Citrus clementina]
Length=691

 Score =   172 bits (435),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 140/441 (32%), Positives = 234/441 (53%), Gaps = 32/441 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R  G  L++++D+AMM  V+A+H  D     V+P+L +IEDI  RA    P  +  V T+
Sbjct  7     RSEGRMLSATDDSAMMKQVQASHAPDGREVDVRPILSIIEDIFRRA---TPSTIDGVGTR  63

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
                +DA L+     + L+  ++A +    + S EI    S   +AH+ T+ +  +L+ Y 
Sbjct  64    E-HVDA-LDNNASPAALSGMLDALSCDIRKISCEISCKCSGGEEAHATTMDLFNILSVYS  121

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YG+F L A+L   + LAKS+A + Q+P++LE   + +     L +
Sbjct  122   WDAKMVLSLAAFALNYGQFWLSAQLCNKNSLAKSMAVLKQLPNVLEHYNALKPQLDALIK  181

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V      ML++T  I+  K++ S+  S             A+++S   A+       A+Y
Sbjct  182   V------MLDLTKCIVEFKQLPSQYISTD-----------AQAMSTAMADT----PAAAY  220

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             +  ++ V C   IL+L  +  +Y +S  +  E+++L H++S IL   +K +    Q+I +
Sbjct  221   WTFRSIVACHSQILSLAGLRDEYTASNTDAWELASLAHRVSRILEHFKKLIAICYQQIDE  280

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              +       L   L   H DN      +I  ++D  P++ G+     +  +++LRRK+V 
Sbjct  281   NRQIEAYHNLVRLLETIHMDNMKVLRALIYAKDDIQPVVDGSS--RTRVNIEVLRRKHVL  338

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+S LD+ +E I +L H+Y E K   +R E  + IVWLPIVDR   W      +F  ++
Sbjct  339   LLISSLDLSDEEILVL-HLYREHK---AREEFDYAIVWLPIVDRSIAWDEGYRQKFEQLQ  394

Query  1612  SSMPWFSVSHPSKIDEAVYGY  1674
             + MPW++V HP+ I+ AV  Y
Sbjct  395   AMMPWYTVQHPTIIEPAVVKY  415



>ref|XP_006476926.1| PREDICTED: uncharacterized protein LOC102609296 [Citrus sinensis]
Length=693

 Score =   171 bits (432),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 138/442 (31%), Positives = 231/442 (52%), Gaps = 31/442 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R +G  L++++D+AMM  V+A+H  D     V+P+L +IEDI  RA    P  +  V T 
Sbjct  7     RSKGRMLSATDDSAMMKQVQASHAPDGREVDVRPILSIIEDIFRRA---TPSTIDGVGTS  63

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
                +DA L++    + L+  ++  +    + S EI    S   +AH+ T+ +  +L+ Y 
Sbjct  64    E-HVDA-LDKNASPAALSGMLDVLSCDIRKISCEISCKCSGGEEAHATTMDLFNILSVYS  121

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YG+F L A+L   + LAKS+A + Q+P++LE   + +     L E
Sbjct  122   WDAKMVLSLAAFALNYGQFWLGAQLCNKNSLAKSMAVLKQLPNVLEHFNALKPQLDALIE  181

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V      ML++T  I+  K++ S+  S             A+++S   A+       A+Y
Sbjct  182   V------MLDLTKCIVEFKQLPSQYISTD-----------AQAMSTAMADT----PAAAY  220

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             +  ++ V C   IL+L  +   Y +S  +  E++TL H++S IL   +K +    Q+I +
Sbjct  221   WTFRSIVACHSQILSLAGLRDAYTASNTDAWELATLAHRVSRILEHFKKLIAICYQQIDE  280

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              +       L   L   H DN      +I  ++D  P++   G    +  +D+LRRK+V 
Sbjct  281   NRQIEAYHNLVRLLETIHMDNMKVLRALIYAKDDIQPVVD--GFSRTRVNIDVLRRKHVL  338

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVK  1611
             LL+S LD+  E I +L  +Y   K   ++ E  + IVWLPI+DR + W      +F  ++
Sbjct  339   LLISSLDLSAEEILVLDQLYTGHK---AQGEFDYAIVWLPILDRSTAWDEGYRQKFEQLQ  395

Query  1612  SSMPWFSVSHPSKIDEAVYGYL  1677
             + MPW++V HP+ I+ AV  Y+
Sbjct  396   AMMPWYTVQHPTIIEPAVVKYV  417



>ref|XP_008239364.1| PREDICTED: uncharacterized protein LOC103337969 [Prunus mume]
Length=707

 Score =   170 bits (430),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 137/434 (32%), Positives = 224/434 (52%), Gaps = 28/434 (6%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVH-YKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             S+D+A++  +R TH     H   V  +L +IE+I  RA  +  G    V      L   +
Sbjct  25    SDDSALVRQIRETHSPGQSHSVDVNQILQVIEEIFHRATHSTAG----VLVGTRELADTV  80

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E++     ++      +Y   +   EI    S   D H+ T+ +L+ L+NY W+AK V+T
Sbjct  81    EDRTTLPSVDVLFHGLSYLIQKIYCEISCQCSGGGDVHATTMELLRTLSNYTWEAKVVLT  140

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF L+A+L  TDPLAKSVA + Q+ D++E    + +V  ++  +  L   +
Sbjct  141   LAAFAVYYGEFWLVAQLCTTDPLAKSVAILKQLSDMVE---HAASVKPQIEAIDNLIKAV  197

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
              +VT  I+      SE   L+  Y       ++E   P++    +I A A + +     +
Sbjct  198   TKVTKSIVEY----SEMVKLQSHY-------ISEDTPPLSIALAHIPAAAYWVIRGILAS  246

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
              S + + L     +Y +ST E  E+S+L HKL+ I   L   ++   + I   ++    +
Sbjct  247   ASHIAI-LAGSRHEYIASTTEVWELSSLAHKLNNIHEHLTSELENCRRYIVAKRYDEDYE  305

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
              L+      H DN  +   +I  ++D  P+  G      ++ L++LRR++V LL++DL +
Sbjct  306   TLKRLFQGLHLDNLKNLRALISHKDDAQPLQIGT----TRYSLEVLRRRHVLLLITDLSL  361

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              NE I +L H+Y   KQ  +RAE ++EIVWLP+VD  +PW  AK  +F  +KS MPW+SV
Sbjct  362   SNEEIVILDHIY---KQQQNRAEVEYEIVWLPVVD-ATPWDEAKRFRFEELKSKMPWYSV  417

Query  1636  SHPSKIDEAVYGYL  1677
               P  I+  V  ++
Sbjct  418   HDPLIIEPPVIKFI  431



>emb|CBI16824.3| unnamed protein product [Vitis vinifera]
Length=650

 Score =   169 bits (429),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 232/460 (50%), Gaps = 45/460 (10%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAV--HYKVKPLLHLIEDIMPRAHATI---PGYVQSVQTQPA  537
             AS  D  +M+ + + H  D    H  +KPLL   E+I+  A  T    P   Q  QTQ  
Sbjct  21    ASLIDNPIMNQIHSIHASDGCSRHIDMKPLLRFTENILQNALPTTIDTPATPQEAQTQ--  78

Query  538   RLDAILEEKVVHSGLNEAIEAF-AYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
              L+ +LE+   + G  + ++ + A    RTS +I    +  + A++ TL V K L+++ W
Sbjct  79    -LNELLED---YDGHYDFLKLYLAQIIKRTSCKI--SCTCGQSAYAATLEVFKTLSSFTW  132

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             + K V+  AAF+  YG+F L+A+   T+ LAKS+A + Q+PD+L           K    
Sbjct  133   ETKVVLALAAFSVTYGKFWLVAQPSSTNLLAKSIAILEQLPDML---ADKEPWKPKFEAP  189

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
             + L   +L+VT  ++   E+ SE            Y      +    A     +  A Y+
Sbjct  190   SNLIKTILKVTKCVVEFWELLSE------------YMTDGRGMPTAAAH----IPTAVYW  233

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
              +   V C+   + L  +G++    T E+  +S+L HKLS I   L++ +    Q I + 
Sbjct  234   TIHGMVVCTKRTMCLTDMGQEDIDQTMEDWYLSSLDHKLSQIHDYLKEQLAVCRQHIRER  293

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFL  1434
             +     K++E  L     DN      +IC + +  P+  G  L  K+  LD+L +K V L
Sbjct  294   REIEAYKMIEHLLKTPQIDNMKILGALICAKAEQLPLFDG--LNKKRARLDVLWKKNVLL  351

Query  1435  LVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
              +S+L++P + +++L  MYLES+QDP++ ESQ+E+VWLP+VD  +P    K+  F   K+
Sbjct  352   FISELEVPYQELSILEKMYLESRQDPTKEESQYEVVWLPVVDGSTPRNEEKDRHFETQKA  411

Query  1615  SMPWFSVSHPSKIDEA-------VYGYLN*RRKPLLAVVD  1713
              M W++V HPS ++ A       V+G+    ++P+L  +D
Sbjct  412   LMTWYAVFHPSLLETAAIKYIKEVWGF---NKRPMLVALD  448



>ref|XP_009769433.1| PREDICTED: uncharacterized protein LOC104220293 isoform X2 [Nicotiana 
sylvestris]
Length=702

 Score =   169 bits (429),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 147/473 (31%), Positives = 242/473 (51%), Gaps = 39/473 (8%)
 Frame = +1

Query  316   LQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA  495
             L A+  P  R  R+R  F + S+D AM   +  TH  +     V  +L +IE I    H 
Sbjct  6     LTARPQPVSR--RERPVF-SMSDDHAMSKKILNTHSPNGREVDVDIILQVIEGIFQHIH-  61

Query  496   TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSI  675
                G +Q    + +   + LEE    +  +  +E  AY  ++ S +  GG     DAH+ 
Sbjct  62    ---GALQDSTDRESMETSKLEENASFAFDDFHLEGLAYIMHKVSCQFSGG----GDAHAT  114

Query  676   TLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEss  855
             T+ +L +L++Y WD K V+T A+F+  YGEF L+A+ + T PLAK VA + Q+PD++E +
Sbjct  115   TMEILGMLSSYQWDTKLVLTLASFSIIYGEFWLVAQKFATHPLAKMVALLKQLPDIIEHA  174

Query  856   essravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVT  1035
              + ++   +   +  L   +L++T  II  K + S+  S           E   S+S   
Sbjct  175   AALKS---RFDAINNLLKAILDITKCIIEFKRLPSQYIS-----------EDQPSMSVAF  220

Query  1036  AEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDL  1212
             A        A Y+ +K+ V C+  + +LL +  +  S+T     E+S+ THKL+ I   L
Sbjct  221   A----YFPTAVYWTIKSIVACASQLTSLLGMSNELISATTTDTWEMSSSTHKLNNISDHL  276

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMK  1392
             +  +++  + I + KHT   ++L      T  DN    + +I  ++D  P+    G    
Sbjct  277   RAELERCYEHIQEKKHTEYYQMLVHLFETTQLDNMKINKALIYIKDDLLPL--EVGTMHT  334

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             +  +D+LRRK V LL+SDLDI  E + +L  +Y ES+    R+E Q+EIVWLPI DR   
Sbjct  335   RANIDVLRRKTVLLLISDLDITPEEVLILATVYNESR---GRSELQYEIVWLPISDRSRE  391

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             W    E +F  +++ MPW+++ HPS ++ A   ++  R    +K +L  +D Q
Sbjct  392   WNEGYEHKFKELQALMPWYTLHHPSLLEPAAIKFVKERWHFSKKMMLVALDPQ  444



>ref|XP_002282165.1| PREDICTED: uncharacterized protein LOC100266247 [Vitis vinifera]
Length=712

 Score =   169 bits (429),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 232/460 (50%), Gaps = 45/460 (10%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAV--HYKVKPLLHLIEDIMPRAHATI---PGYVQSVQTQPA  537
             AS  D  +M+ + + H  D    H  +KPLL   E+I+  A  T    P   Q  QTQ  
Sbjct  21    ASLIDNPIMNQIHSIHASDGCSRHIDMKPLLRFTENILQNALPTTIDTPATPQEAQTQ--  78

Query  538   RLDAILEEKVVHSGLNEAIEAF-AYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
              L+ +LE+   + G  + ++ + A    RTS +I    +  + A++ TL V K L+++ W
Sbjct  79    -LNELLED---YDGHYDFLKLYLAQIIKRTSCKI--SCTCGQSAYAATLEVFKTLSSFTW  132

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             + K V+  AAF+  YG+F L+A+   T+ LAKS+A + Q+PD+L           K    
Sbjct  133   ETKVVLALAAFSVTYGKFWLVAQPSSTNLLAKSIAILEQLPDML---ADKEPWKPKFEAP  189

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
             + L   +L+VT  ++   E+ SE            Y      +    A     +  A Y+
Sbjct  190   SNLIKTILKVTKCVVEFWELLSE------------YMTDGRGMPTAAAH----IPTAVYW  233

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
              +   V C+   + L  +G++    T E+  +S+L HKLS I   L++ +    Q I + 
Sbjct  234   TIHGMVVCTKRTMCLTDMGQEDIDQTMEDWYLSSLDHKLSQIHDYLKEQLAVCRQHIRER  293

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFL  1434
             +     K++E  L     DN      +IC + +  P+  G  L  K+  LD+L +K V L
Sbjct  294   REIEAYKMIEHLLKTPQIDNMKILGALICAKAEQLPLFDG--LNKKRARLDVLWKKNVLL  351

Query  1435  LVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
              +S+L++P + +++L  MYLES+QDP++ ESQ+E+VWLP+VD  +P    K+  F   K+
Sbjct  352   FISELEVPYQELSILEKMYLESRQDPTKEESQYEVVWLPVVDGSTPRNEEKDRHFETQKA  411

Query  1615  SMPWFSVSHPSKIDEA-------VYGYLN*RRKPLLAVVD  1713
              M W++V HPS ++ A       V+G+    ++P+L  +D
Sbjct  412   LMTWYAVFHPSLLETAAIKYIKEVWGF---NKRPMLVALD  448



>ref|XP_006378261.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
 gb|ERP56058.1| hypothetical protein POPTR_0010s060502g, partial [Populus trichocarpa]
Length=340

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 118/349 (34%), Positives = 185/349 (53%), Gaps = 29/349 (8%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQT  528
             +R+     +SS+DTAMM  ++ATH  D   + VKPLLH++EDI  RA   + G    VQ 
Sbjct  11    MRRERSMFSSSDDTAMMKQIQATHAPDGREFSVKPLLHIVEDIFLRATPAL-GMTSIVQQ  69

Query  529   Q---PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLL  699
             Q    A+LD  LEEK + +G +E IE  +Y   + S E+    S   DAH+ TL++  L+
Sbjct  70    QGAHQAQLDE-LEEKALQNGFHETIEMLSYTINKISCEMSCKCSGGGDAHATTLAIFNLV  128

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
             +NY WD K V+  A FA  YGEF L+A+LY T+PLAK+VA + Q+PD++E +++ +    
Sbjct  129   SNYTWDEKLVLALAGFAVNYGEFWLVAQLYLTNPLAKAVALLKQLPDIIERADNMKP---  185

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI--  1053
             K  E+  L   M++V   I   KE+ S+                   ++P T E      
Sbjct  186   KFEELTSLIKVMMDVAQCIFEFKELPSQ------------------YITPDTPEMLTATA  227

Query  1054  -MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQK  1230
              +  A Y+ +++ V C+  ++ L+ +G +Y +ST E  E+S+L HK++ I   L K +  
Sbjct  228   HIPTAVYWTIRSVVACASQVMGLIGMGHEYIASTTEAWELSSLAHKVNNIHSHLMKQLTL  287

Query  1231  STQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGA  1377
               Q I + +H    + L       H DN    + +I  E+D  P+  G+
Sbjct  288   CFQHIDEKRHIEAFQTLVSLFEAFHIDNMKILKALIYAEDDQLPLFDGS  336



>ref|XP_006476924.1| PREDICTED: uncharacterized protein LOC102608617 isoform X2 [Citrus 
sinensis]
Length=693

 Score =   169 bits (428),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/461 (32%), Positives = 239/461 (52%), Gaps = 37/461 (8%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQ  531
             R +G  L++++D+AMM  V+A+H  D     V+P+L +IEDI  RA    P  +  V T 
Sbjct  7     RSKGRMLSATDDSAMMKQVQASHAPDGREVDVRPILSIIEDIFRRA---TPSTIDGVGTS  63

Query  532   PARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYW  711
                +DA L++    + L+  ++  +    + S EI    S   +AH+ T+ +  +L+ Y 
Sbjct  64    E-HVDA-LDKNASPAALSGMLDVLSCDIRKISCEISCKCSGGEEAHATTMDLFNILSVYS  121

Query  712   WDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLRE  891
             WDAK V++ AAFA  YG+F L A+L   + LAKS+A + Q+P++LE   + +     L E
Sbjct  122   WDAKMVLSLAAFALNYGQFWLGAQLCNKNSLAKSMAVLKQLPNVLEHFNALKPQLDALIE  181

Query  892   VAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasy  1071
             V      ML++T  I+  K++ S+  S             A+++S   A     +  A+Y
Sbjct  182   V------MLDLTKCIVEFKQLPSQYISTD-----------AQAVSIAMAH----IPAAAY  220

Query  1072  yvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGK  1251
             +  ++ V C    L+L  +   Y +ST E  E+S+L HK+S +L   +K +    Q+I +
Sbjct  221   WTFRSIVACYSQTLSLTGLRDAYTASTTEAWELSSLAHKVSSMLEHFKKLIAICYQQIDE  280

Query  1252  IKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVF  1431
              +       L   L   H DN      +I  ++D  P++ G      +  +D+LR+K+V 
Sbjct  281   NRQIEAYHNLVRLLETIHLDNMKVLRALIYAKDDIQPLVDG--FTKNRVNIDVLRKKHVL  338

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAES-QFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
             LL+S LD+  E I +L  MY    +DP  +E   + IVWLPIVDR   W    + +F  +
Sbjct  339   LLISSLDLSAEEILVLDQMY----RDPKASEEYHYAIVWLPIVDRSIAWDDGYQQKFEQL  394

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++ MPW++V HP+ I+ AV  Y+       +K +L  VD Q
Sbjct  395   QAMMPWYTVQHPTIIEPAVVKYIKEVWKFSKKAILVPVDPQ  435



>emb|CBI34827.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   167 bits (424),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 136/451 (30%), Positives = 232/451 (51%), Gaps = 32/451 (7%)
 Frame = +1

Query  394   MMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVH  573
             M+  + ATH+ D   + VKPLLHL+E I   A         S+  +   ++A LE+K   
Sbjct  1     MLKQIEATHEPDGREFDVKPLLHLVEQIFTCATPKSDVTFDSLDLKTNDVEA-LEDKTHQ  59

Query  574   SGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQ  753
             +G    +EA AY   R S EI    S   +AH   +SVL +++++ WDAK V+T +AFA 
Sbjct  60    AGFISTLEALAYTIDRISCEIRCKCSGGEEAHQRAISVLNMVSSHPWDAKLVLTLSAFAV  119

Query  754   QYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHK  933
              YGEF L+ + Y ++ LAKS+A + Q+P++L  S   +   + ++++ K    ML+V + 
Sbjct  120   NYGEFWLVFQSYNSNDLAKSMAILKQVPEILGRSSMLKPQFNSIKDLIK---AMLDVANC  176

Query  934   IIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVIL  1113
             I+  +E+ S+       Y  +     + +L+ +          A Y+ ++  V C+  I 
Sbjct  177   IVKFRELPSQ-------YITTDESAFSTALANIP--------IAVYWTIRCVVACASQIA  221

Query  1114  NLLAV-GRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEET  1290
              L  + G ++  ST E  EIS L HK+  I   L+  +    + I   +     ++L E 
Sbjct  222   RLKGLQGDEHPLSTSEAWEISALVHKVRNIHNHLRDKLDACHKHIDDKRRMEAYQMLLEL  281

Query  1291  LARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVI  1470
                +H+DN    + +I   ++  P+ HGA    ++  +D+ +  +V LL+S+LDI ++ +
Sbjct  282   FKTSHSDNMKVLKALIYARDNQNPLFHGAT--HRRVDIDVFKDTHVLLLISNLDISHDEL  339

Query  1471  TMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS----VS  1638
              +L  +Y ES +   R   Q+EIVWLPI+D+  PW  + +  F   ++ MPW++    + 
Sbjct  340   EVLEDIYRESLK--KRPGIQYEIVWLPIIDQSDPWMESSQKLFENHRARMPWYARHDPLR  397

Query  1639  HPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
              PS  D AV  ++       RKP+L V+  Q
Sbjct  398   SPSPEDGAVITFIKKEWHYGRKPILVVLGPQ  428



>ref|XP_008444389.1| PREDICTED: uncharacterized protein LOC103487729 [Cucumis melo]
Length=703

 Score =   167 bits (422),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 150/480 (31%), Positives = 243/480 (51%), Gaps = 45/480 (9%)
 Frame = +1

Query  304   VVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMP  483
             + AP +  +I   R +   GD      + A+   V ATH  + + + V PLL L+E I  
Sbjct  3     ISAPRKLSLIKPDRQLFAGGD------ENALTKQVLATHSEEPLEFPVTPLLSLVEQIFL  56

Query  484   RAHA-TIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNR  660
             RA   T  G  +      A+L+AI ++    + L + ++  ++   R S EI    S   
Sbjct  57    RAKLNTHQGATR------AQLEAIEDKSPSPTDLLDLLDFVSFTINRVSNEIQYKCSGAG  110

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             D H++T+ V  LL+++ WDAK V+  AAFA  YGEF LL +   TD LAK ++ + ++P+
Sbjct  111   DPHTVTMEVFNLLSSWPWDAKVVLALAAFAINYGEFWLLVQQSSTDLLAKDISLLKKLPE  170

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
             + E       V  K   + KL   +++V   I+  K +                      
Sbjct  171   IFE---RVDIVKQKFEALDKLIKSLVDVAKCIVDFKMLP------------------PHY  209

Query  1021  LSPVTAEQEN---IMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKL  1191
             ++P T E ++   ++  A Y+ +++ V C+     L+ VG +Y +S  E  E+S+L HK+
Sbjct  210   ITPDTPEMKSATTLIPTAIYWTIRSIVACAAQNAGLIGVGHEYLASASETWELSSLAHKI  269

Query  1192  SYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIH  1371
               I   L++ +      I +  H      L       H DN      +I  ++D  P++ 
Sbjct  270   DNIRKHLEQLLLACHHYINEKMHHEAYMNLVRLFEIPHIDNNKILRALIYSKDDKPPLVD  329

Query  1372  GAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
               GL  +K  L++LR+K V LL+SDLD+    ++ML  +Y ES+Q+ +R ES +E+VW+P
Sbjct  330   --GLSKEKATLEVLRKKNVLLLISDLDLSIVELSMLDQIYRESRQNKTRTESDYEVVWMP  387

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             IV+   PWT  K+ +F  +   MPW+SV+HPS I+ AV  Y+    N  +KPLL V+D Q
Sbjct  388   IVE--PPWTEEKQVKFEALLGLMPWYSVAHPSLIESAVIKYVRQVWNFIKKPLLVVLDPQ  445



>ref|XP_009628800.1| PREDICTED: uncharacterized protein LOC104119093 [Nicotiana tomentosiformis]
Length=678

 Score =   167 bits (422),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 146/464 (31%), Positives = 244/464 (53%), Gaps = 32/464 (7%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQT  528
             R+     + S+D AM   +  TH+       VK +  ++E+I   A+ ATI G +    T
Sbjct  20    RRERPVFSLSDDHAMSKKILGTHNPIGREVDVKIIFQVVEEIFQHAYPATIDGVLHGT-T  78

Query  529   QP--ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLA  702
             QP  A ++A+  E+      +  +E  AY  ++ S ++    S   D HS T+++L +L+
Sbjct  79    QPHEANIEALKLEEKASLAFDGILEGLAYIIHKVSCQLTCKCSGGGDTHSTTMAILAMLS  138

Query  703   NYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssK  882
              Y WDAK V++ AAFA  YGEF L+A+++ T PLAKS+A + Q+PD +E   S +++   
Sbjct  139   VYKWDAKLVLSLAAFAITYGEFWLVAQMFATHPLAKSLALLKQLPDTMEHHASLKSLFDA  198

Query  883   LREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMak  1062
             + E+ K+   +LEVT +II    + S+  S           E   SLS  T+     +  
Sbjct  199   INELIKV---ILEVTKRIIKFNRLPSQYIS-----------EDQPSLSVATSH----IPT  240

Query  1063  asyyvvkaavTCSLVILNLLAVGRDYYsstee-eleistltHKLSYILGDLQKAVQKSTQ  1239
             A Y+ +K+ V C+  + +LL +  +  ++T     E+S+ THKL  I   L+  ++    
Sbjct  241   AVYWTIKSIVACASQLTSLLGMNYEMIAATTSDTWEMSSSTHKLRNINDHLKSELESCCH  300

Query  1240  EIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRR  1419
              I +  H    ++L      T  DN      +I  ++D  P+    G    +  +++LRR
Sbjct  301   HIQEKMHVEYYQMLVHLFETTQFDNMKINRGMIYIKDDLLPL--EVGTTRTRASIEVLRR  358

Query  1420  KYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQF  1599
             K V LL+SDLD   E + +L H+Y ES+   +R E Q+EIVWLPIVD+   W   +E +F
Sbjct  359   KTVLLLLSDLDASPEELLVLSHIYTESR---ARPELQYEIVWLPIVDQSRGWNEEQEMKF  415

Query  1600  TLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               +++ MPW+++ HPS ++ A+  ++  R    +K +L  +D Q
Sbjct  416   KALQAIMPWYTLHHPSLLEPAIVKFVKERWHFSKKMMLVTLDPQ  459



>ref|XP_011087135.1| PREDICTED: uncharacterized protein LOC105168700 [Sesamum indicum]
Length=712

 Score =   167 bits (422),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 140/455 (31%), Positives = 235/455 (52%), Gaps = 32/455 (7%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             L  S+DT +   ++ATH  D+    V  +L +I DI+      + G +            
Sbjct  20    LMLSDDTGLRKQIQATHAHDSRSVDVDAILVIIRDILNLVSPGMDGILNGSHKHAD----  75

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
             + EE    SG +   +A A+   + S E+    S   DAH+  +++L+ L++Y WDAKAV
Sbjct  76    VAEETAALSGFDGIQDALAFLLNKISCELTCRCSGG-DAHASAMAILEFLSSYSWDAKAV  134

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +  A+F+  YG+F L+A  +  DPLAKS+A + Q+PD+LE S+  +     +  + K++ 
Sbjct  135   LALASFSVNYGQFWLIAENFTADPLAKSLAVLRQLPDILELSDVMKTRMDTINSLVKVS-  193

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
               LE+T  I    EIG     L  KY       ++    P+     +I   A Y+ +++ 
Sbjct  194   --LELTRCI---AEIG----RLPSKY-------ISHDAEPMAVAMSHI-PIAVYWTIRSL  236

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V C+  + ++L + +   S T E  EIS+L HK++ I   L+  +    Q I + KH   
Sbjct  237   VVCASQVTDILGMSQQVISLTAETWEISSLGHKVASIQDHLKTQLGLCYQHIDEKKHNEY  296

Query  1270  RKILEETLART-HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
              ++L        H +N+   + +I  ++D  P+  G   ++K  G + L  K V LL+SD
Sbjct  297   YQMLVHLFETAPHLENQRILKHLIYSKDDQHPLEVGNNKKIKV-GAEALIGKTVLLLISD  355

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDI  + + +L H+Y ES+   SR E Q+EIVWLPI+++ + W    E  F  ++S MPW
Sbjct  356   LDISLDELRILSHIYQESR---SRQEFQYEIVWLPIMEKTTTWNEEHEHTFERLQSMMPW  412

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +++ HP  ++ AV  Y+    +  +KP+L  +D Q
Sbjct  413   YTLQHPRLLERAVSRYIKEVWHYSKKPILVSLDPQ  447



>ref|XP_008221943.1| PREDICTED: uncharacterized protein LOC103321871 [Prunus mume]
Length=843

 Score =   167 bits (424),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 166/564 (29%), Positives = 259/564 (46%), Gaps = 95/564 (17%)
 Frame = +1

Query  175   PKATNLNPR---SLTTYTPHPAYPVQQAYMPA---TTTNVVSATAPPSQVVAPLQAKIIP  336
             P A N NP    +  +Y P  A P  Q+Y PA      N   A AP +Q           
Sbjct  57    PAAQNYNPALAPAAQSYDPALA-PAAQSYNPAFAPAAQNYNPAFAPAAQNYYKPPTTTRR  115

Query  337   AGRGIRK-------RGDFLASSEDTAMMDHVRATHDVDAVHYKVK--PLLHLIEDI----  477
              G    +       R  F A+S+D+A+ + + AT       Y VK  PL H+++ +    
Sbjct  116   GGDSYNRPPLLRDGRRQFSATSDDSALTNQILATDRSRDRPYDVKSVPLKHILQTVDVIL  175

Query  478   ----MPRAHAT--IPGYVQSVQTQPARLDAI-LE-EKVVHSGLNEAIEAFAYPA---YRT  624
                  P  H    +PG V +        DA+ LE EK +H+ L+   + +  P       
Sbjct  176   ARVTKPDIHGAFLVPGAVGA-------HDALNLEHEKALHATLSSLQDNYDVPTGLFNAI  228

Query  625   SFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPL  804
             S EI G + S  D +  T+ +L ++ ++ WD K V+   AFA + GEF L+A+LY T+PL
Sbjct  229   SCEIFGKWLSGEDPNKTTMEILDIVQHHDWDEKVVLVLGAFAVKDGEFWLVAQLYTTNPL  288

Query  805   AKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVK  984
             AK++  + Q+ ++LE + ++     K      L   +++VT  ++ L ++  +       
Sbjct  289   AKAIGQLKQVQEILERAGTTLKP--KFDSYNNLVRAIIKVTKCVVQLHDLQRDPH-----  341

Query  985   YRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVI-----LNLLAVGRDYYss  1149
                            VT E E+    A           S+V+     L +  +G +Y   
Sbjct  342   ---------------VTTEHESAATTAHIPTAVYWTIRSIVVAASQLLGITGMGPEY---  383

Query  1150  teeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART-------HT  1308
               E  E+S+L HKL  I   LQ       + + ++   IKRK  +E LA         H 
Sbjct  384   LTEAWELSSLAHKLENIHSHLQ-------ENLDRLYEIIKRKKDDEALAAIAYILETPHI  436

Query  1309  DNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRH-  1485
             DN     L +    D  P ++      K+  +D+L+RK V L +SD+D+ NE   M+ H 
Sbjct  437   DN--VKPLRVLFYKDDLPALYDC-YNKKRVDIDVLKRKTVILFISDIDVVNENEYMIVHN  493

Query  1486  MYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAV  1665
             MY+E +Q P+R ESQ+E+VW+PIVD    WT AK   F  ++ +M W++V HPS +   V
Sbjct  494   MYMEKRQSPARPESQYEVVWVPIVDT---WTDAKYQHFEELRRNMEWYTVFHPSVVSPTV  550

Query  1666  YGYL------N*RRKPLLAVVDTQ  1719
               Y+      N ++KPLL V+D Q
Sbjct  551   IRYIRKKDKWNFQKKPLLVVMDPQ  574



>ref|XP_007211100.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
 gb|EMJ12299.1| hypothetical protein PRUPE_ppa023699mg [Prunus persica]
Length=693

 Score =   163 bits (412),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 135/435 (31%), Positives = 222/435 (51%), Gaps = 29/435 (7%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVH-YKVKPLLHLIEDIMPRA-HATIPGYVQSVQTQPARLDAI  552
             S+D+A++  +R TH     H   V  +L +IE+I  RA H+T       V      L   
Sbjct  10    SDDSALLRQIRETHSPGRSHSVDVNQILQVIEEIFHRATHST-----AVVLAGTRELADT  64

Query  553   LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVI  732
             +E++     ++      +Y   +   EI    S   D H+ T+ +L+ L+NY W+AK V+
Sbjct  65    VEDRTTLPSVDVLFHGLSYLIQKIYCEISCQCSGGGDVHATTMELLRTLSNYSWEAKVVL  124

Query  733   TFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADK  912
             T AAFA  +GEF L+A+L  TDPLAKSVA + Q+ D++E    + +V  ++  +  L   
Sbjct  125   TLAAFAVYHGEFWLVAQLCTTDPLAKSVAILKQLSDMVE---HAASVKPQIEAIDNLITA  181

Query  913   MLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaav  1092
             +  VT  I+    + SE   L+  Y       ++E   P++    +I A A + +     
Sbjct  182   VTNVTKSIV----VCSEMVKLQSHY-------ISEDTPPLSIALAHIPAAAYWVIRGILA  230

Query  1093  TCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKR  1272
             + S + + L     +Y +ST E  E+S+L HKL  I   L   ++   Q I   ++    
Sbjct  231   SASHIAI-LAGSRHEYIASTTEVWELSSLAHKLKNIHDHLTSELENCRQYIVAKRYDEDY  289

Query  1273  KILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD  1452
             + L       H DN  +   +I  ++D  P+  G     +++ L++LRR++V LL++DL 
Sbjct  290   ETLRRLFQGLHLDNLKNLRALISHKDDAQPLQIGT---TRQYSLEVLRRRHVLLLITDLS  346

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
             + NE I +L H+Y   KQ  +RAE ++ IVWLP+VD  + W  AK  +F  +KS MPW++
Sbjct  347   LSNEEIVILDHIY---KQQQNRAEVEYGIVWLPVVD-ATTWDEAKRFRFEELKSKMPWYA  402

Query  1633  VSHPSKIDEAVYGYL  1677
             V  P  I+  V  ++
Sbjct  403   VHDPQIIEPPVIKFI  417



>ref|XP_009359246.1| PREDICTED: uncharacterized protein LOC103949845 isoform X1 [Pyrus 
x bretschneideri]
Length=842

 Score =   164 bits (415),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 158/559 (28%), Positives = 260/559 (47%), Gaps = 74/559 (13%)
 Frame = +1

Query  172   VPKATNLNPRSL---TTYTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAG  342
             +P A N NP  +     Y P P  P  Q Y PA  +   S  AP +       A   P  
Sbjct  45    MPVAQNYNPAPMPVVQNYNPTPM-PTAQNYNPARVSAAQSYNAPQAPGAQSYNAPQAPGA  103

Query  343   R-------GIRKRGDFL-------------ASSEDTAMMDHVRATHDVDAVHYKV-----  447
             +       G R+ GD+               +S+D+ + + + A+    A  Y V     
Sbjct  104   QYYNKPTAGGRRGGDYYNRPLPKDGRRFSSTASDDSMLTNQILASDKSHARPYDVTLLSL  163

Query  448   KPLLHLIEDIMPRA-----HATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYP  612
             K +L  ++ I+ R      H+T+ G +          DA+  EK  H+ ++   + +  P
Sbjct  164   KHILQTVDVILSRVTQPDIHSTVTGAL----VPGTHADALEHEKASHAIISSLPDNYDVP  219

Query  613   AY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLAR  783
                    S EI   + S  DA+  T+ +L  + +Y WD K V+   AFA + GE+ L+A 
Sbjct  220   TSLFNAISCEIFCKWLSGEDANKTTMDILDTVQHYDWDEKVVLALGAFAVKDGEYWLVAH  279

Query  784   LYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSE  963
             LY T+PLAK+V  + Q+ ++LE + +      K      L   +L VT  I+ L ++   
Sbjct  280   LYTTNPLAKAVGQLKQVQEILEHAGTRLKP--KFDAYNNLVRAVLNVTKGIVQLHDL---  334

Query  964   EKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYY  1143
                    +R  +    AES     A    ++  A Y+ +++ V  +  +L +  +G ++ 
Sbjct  335   -------HRNPVMTTEAES-----AATTALIPTAVYWTIRSIVVAATQLLGITGMGPEH-  381

Query  1144  ssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYS  1323
                 E  E+S+L HKL  I   L++ + +    I + K   +   +   L   H DN  S
Sbjct  382   --MTEAWELSSLAHKLENIHSHLKENLDRLLDIIKRKKEEQELSEISYILESPHIDN--S  437

Query  1324  AELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITML-RHMYLES  1500
               L +    D  P ++      K+  +D+L+RK V L +SD+D+ +E   M+ + MYLE 
Sbjct  438   KPLRVLFYKDDQPALYDC-YNKKRVDIDVLKRKVVILFLSDIDVVHENEYMIVQQMYLEK  496

Query  1501  KQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL-  1677
             +Q+P+R ESQ+E+VW+PIVD    WT AK  QF  ++ +M W+++ HPS + + V  Y+ 
Sbjct  497   RQNPTRTESQYEVVWVPIVDI---WTDAKYQQFEDLRRNMEWYTLFHPSVVPKTVIRYIR  553

Query  1678  -----N*RRKPLLAVVDTQ  1719
                  N  +KPLL V+D Q
Sbjct  554   KQDKWNYGKKPLLVVMDPQ  572



>ref|XP_004516128.1| PREDICTED: uncharacterized protein LOC101508220 [Cicer arietinum]
Length=729

 Score =   163 bits (412),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 144/453 (32%), Positives = 237/453 (52%), Gaps = 31/453 (7%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH-ATIPGYVQSVQTQPARLDAIL  555
             S+D+ ++  + + HD + + Y VKPLL ++EDI+ R+  ++  G+V S+ T  + +D + 
Sbjct  26    SDDSILVKKIVSDHDPERLDYDVKPLLEIVEDILRRSTLSSDSGHV-SMGT-LSHIDHV-  82

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E++         +EA +    R S EI     S+ DAHS T+S+  ++  Y WD K V+ 
Sbjct  83    EDRSHLPVYTNRLEALSVKIDRISVEISYKILSDIDAHSTTVSIFDMITTYEWDVKLVLA  142

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LLA ++ T+ LAKS+A + Q+P ++E S S +     L +V  +   +
Sbjct  143   LAAFALNYGEFWLLAHIHDTNQLAKSMAILKQLPGIMEHSSSLKPRFDTLNDVVSV---I  199

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             LEVT  +I       E  +++ +Y       + E +S  T    +I   A Y+ +++ V 
Sbjct  200   LEVTKCVI-------EFNAIQTRY-------ITEDVSAYTTASNHI-PIACYWCIRSIVA  244

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I +L  +G + ++S +     +    KL  I   L K +    + I ++       
Sbjct  245   CVAQITSLTTLGYEIFTSNDAWELSTLA-FKLRNIADHLTKLLHSCREHIAQVVVAEAYG  303

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKH-GLDILRRKYVFLLVSDLD  1452
             IL +  ++ H DN    + +I  ++D  P+  G    MKK   L+ LRRK V LL S L+
Sbjct  304   ILRDLFSKPHIDNMKILKALIYSQDDILPLYDGV---MKKRVSLEGLRRKNVLLLFSGLE  360

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
                + + +L  +Y ESK    R ES++E+VW+PIVD+ S WT  K++Q   ++ SMPW S
Sbjct  361   FSTDELLILEQIYNESKAHAPRQESRYELVWIPIVDQTSEWTDQKKNQLENMRESMPWHS  420

Query  1633  VSHPSKIDEAVYGYLN----*RRKPLLAVVDTQ  1719
             V  P  I +AV  ++      + K +L V+D Q
Sbjct  421   VYDPLVISKAVIWFIQSEWKYKNKAILVVLDPQ  453



>ref|XP_008340128.1| PREDICTED: uncharacterized protein LOC103403085 [Malus domestica]
Length=873

 Score =   164 bits (414),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 177/607 (29%), Positives = 272/607 (45%), Gaps = 89/607 (15%)
 Frame = +1

Query  34    NPPKMAQTTINNTGRPMSESTTRA-----TDTTPLVPRTAPNTPHNPVHEIVPKATNLNP  198
             NPP  A  + NN   P +++   A      +  P     A N  +NP    +P A N NP
Sbjct  41    NPPVPATQSYNNPPAPAAQNYNPAPIAAVQNYNPAPMLAAQN--YNPAP--LPAAQNYNP  96

Query  199   RS-LTTYTPHPAY-PVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGD--  366
                LT    +PA  P  Q+Y         S  AP +      Q    P   G R+ GD  
Sbjct  97    APMLTAQNYNPALVPAAQSYNAPQAPGAQSYNAPQATGA---QYYNKPTAGG-RRGGDYY  152

Query  367   ----------FLASSEDTAMMDHVRATHDVDAVHYKV-----KPLLHLIEDIMPRA----  489
                       F ++S+D+ + + + A+    A  Y V     K +L  ++ I+ R     
Sbjct  153   NRPLPKDGRRFSSTSDDSMLTNQILASDKSRARPYDVALLSLKHILQTVDVILSRVTQPD  212

Query  490   -HATIPGYVQSVQTQPARLDAILEEKVVH---SGLNEAIEAFAYPAYRTSFEIIGGYSSN  657
              H+T+ G +       A  DA+  EK  H   SGL +  +         S EI   + S 
Sbjct  213   IHSTVTGAL----VTGAHADALEHEKASHAIMSGLPDNYDVPTSLFNAISCEIFCTWLSG  268

Query  658   RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIP  837
              DA+  T+ +L ++ +Y WD K V+   AFA + GE+ L+A LY T+PLAK+V  + Q+ 
Sbjct  269   EDANKTTMDILDIVQHYDWDEKVVLALGAFAVKDGEYWLVAHLYTTNPLAKAVGQLKQVQ  328

Query  838   DLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAE  1017
             ++LE + +S     K      L   +L VT  I+ L ++  +                  
Sbjct  329   EILEHAGTSLKP--KFDAYNNLVRAVLNVTKCIVQLHDLHHD------------------  368

Query  1018  SLSPV-TAEQENIMakasyyvvkaavTCSLVI-----LNLLAVGRDYYssteeeleistl  1179
                P+ T E E+    A           S+V+     L +  +G ++     E  E+S+L
Sbjct  369   ---PIMTTEAESAATTALIPTAVYWTIRSIVVAATQLLGITGMGPEH---VTEAWELSSL  422

Query  1180  tHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPT  1359
              HKL  I G L++ + +    I   K   +   +   L   H DN  +  L +    D  
Sbjct  423   AHKLETIHGHLKENLNRLLDIIKTKKEEQELSEIAYILESPHIDN--TKPLRVLFYKDDQ  480

Query  1360  PIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITML-RHMYLESKQDPSRAESQFE  1536
             P ++      K+  +D+L+RK V L +SD+D  NE   M+ + MYLE +Q+ +R ESQ+E
Sbjct  481   PALYDC-YSKKRVDIDVLKRKVVILFLSDIDFINENEYMIVQQMYLEKRQNATRPESQYE  539

Query  1537  IVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL------N*RRKPL  1698
             +VW+PIVD    WT AK  QF  ++ SM WF+V HPS + + V  Y+      N  +KPL
Sbjct  540   VVWVPIVDT---WTDAKYQQFEELRRSMEWFTVFHPSVVSKTVIRYMRKQDKWNYGKKPL  596

Query  1699  LAVVDTQ  1719
             L V+D Q
Sbjct  597   LVVMDPQ  603



>emb|CAN83923.1| hypothetical protein VITISV_026533 [Vitis vinifera]
Length=673

 Score =   162 bits (410),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 132/456 (29%), Positives = 214/456 (47%), Gaps = 67/456 (15%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAV--HYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
             AS  D  +M+ + + H  D    H  +KPLL   E+I+  A                   
Sbjct  12    ASLIDNPIMNQIHSIHASDGCSRHIDMKPLLRFTENILQNA-------------------  52

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                        L   I+  A P   TS     G S    A++ TL V K L+++ W+ K 
Sbjct  53    -----------LPTTIDTPATPQAYTSISCTCGQS----AYAATLEVFKTLSSFXWETKV  97

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAF+  YG+F L+A+   T+ LAKS+A + Q+PD+L           K    + L 
Sbjct  98    VLALAAFSVTYGKFWLVAQPSXTNLLAKSIAILEQLPDML---ADKEPWKPKFEAPSNLI  154

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               +L+VT  ++   E+ SE            Y      +    A     +  A Y+ +  
Sbjct  155   KTILKVTKCVVEFWELLSE------------YMTXGRGMPTAAAH----IPTAVYWTIHG  198

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
              V C+   + L  +G++    T E+  +S+L HKLS I   L++ +    Q I + +   
Sbjct  199   MVVCTKRTMCLTDMGQEDIDQTMEDWYLSSLDHKLSQIHDYLKEQLAVCRQHIRERREIE  258

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               K++E  L     DN      +IC + +  P+     L  K+  LD+L +K V L +S+
Sbjct  259   AYKMIEHLLKTPQIDNMKILGALICAKAEQLPLFDX--LNKKRARLDVLWKKNVLLFISE  316

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             L++P + +++L  MYLES+QDP++ ESQ+E+VWLP+VD  +PW   K+  F   K+ M W
Sbjct  317   LEVPYQELSILEKMYLESRQDPTKEESQYEVVWLPVVDGSTPWNEEKDRHFETQKAXMXW  376

Query  1627  FSVSHPSKIDEA-------VYGYLN*RRKPLLAVVD  1713
             + V HPS ++ A       V+G+    ++P+L  +D
Sbjct  377   YXVFHPSLLETAAIKYIKEVWGF---NKRPMLVALD  409



>ref|XP_004299166.1| PREDICTED: uncharacterized protein LOC101294943 [Fragaria vesca 
subsp. vesca]
Length=703

 Score =   162 bits (409),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 138/448 (31%), Positives = 232/448 (52%), Gaps = 31/448 (7%)
 Frame = +1

Query  340   GRGIRKRGDFLASSEDTAMMDHVRATHDVDAVH-YKVKPLLHLIEDIMPRAHATIPGYVQ  516
             G  +R+       S+DTA++  +R TH     H   VKP+LH+ ++I  R+     G + 
Sbjct  9     GPKMRRENRGSLQSDDTALVRQIRETHVPGRSHIVDVKPILHVTDEIFHRSSVVTDGGI-  67

Query  517   SVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKL  696
                   A +D+ LE++    G +  ++  +Y   +   EI  G  S  D H+ TL +L+ 
Sbjct  68    ---LLGAHVDS-LEDRTSSLGYDVLLQGLSYLIQKIYIEI--GCQSCADVHASTLELLRS  121

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             L+NY W+AK V+T AAF+  YGEF L+A+L  T+ LAK VA + Q+ DL+E    +  V 
Sbjct  122   LSNYSWEAKVVLTLAAFSIYYGEFWLVAQLCATNSLAKPVAILKQLSDLIE---HAATVK  178

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIM  1056
              +L  +  L   + +VT +I+   ++      L+ +Y       ++E   P+     +I 
Sbjct  179   PQLEAIDNLIKAITKVTKRIVECADM----VKLQSQY-------ISEDQPPLMTAMAHIP  227

Query  1057  akasyyvvkaavTCSLVILNLLAVGR-DYYssteeeleistltHKLSYILGDLQKAVQKS  1233
             A A + +       S +  ++L  GR +Y +ST E  E+S+L HKL+ I   L   ++  
Sbjct  228   AAAYWAIRGILACASHI--SVLTGGRYEYVASTTEVWELSSLAHKLNNIDEHLNSELENC  285

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              + I + ++    K L       H DN  +   +I  ++D  P++   G    +  L++L
Sbjct  286   RRHIVEKRYDEDYKNLIHLFQSLHLDNMKNLRALISHKDDVQPLV--IGRSQVRCSLEVL  343

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             RRK+V LL++DL +  E + +L H++   K   SR E ++E VWLPIVD  + W  AK++
Sbjct  344   RRKHVLLLITDLSLSYEEVLILEHIH---KDQQSRGEIEYEFVWLPIVD-AALWNEAKKE  399

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL  1677
             +F  +KS MPW++V  P  I+  V  ++
Sbjct  400   RFEDLKSRMPWYAVHDPLIIEPPVIKFI  427



>ref|XP_006408537.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
 gb|ESQ49990.1| hypothetical protein EUTSA_v10020146mg [Eutrema salsugineum]
Length=739

 Score =   162 bits (409),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 141/478 (29%), Positives = 240/478 (50%), Gaps = 50/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             ++IPA  G+        SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA     
Sbjct  24    EMIPATTGLT------MSSDESMMLKLIQHTHSPDAREVQVRGLLSLVEDILDRA-----  72

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
               + S  +  + L    E+K++ S +   ++  +Y   R   EI     +  DAH IT+S
Sbjct  73    -TLNSDDSNSSMLPLPTEDKLMQSSVMSVLDNVSYAIDRVGCEIAYKSLTGSDAHEITMS  131

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  132   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  189

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L +   L  +M  VT  ++ L E+     SL+                P  +  
Sbjct  190   ESVSQGLND---LIQEMKSVTACVVELSELPDRYISLE---------------DPQLSRI  231

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  232   VSTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLSETL  291

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I K + +   K+L      TH DN      +I  +N  TP+    GL  +K  L
Sbjct  292   RLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALIHPKNHTTPL--QDGLTKRKVHL  349

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+++      ++   +E+VW+PIVD    
Sbjct  350   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRRNLLGMDGKSHMPYEVVWVPIVDPIED  409

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP     + +F  +++ MPW++V  P  I+  V  ++  R     KP+L V+D Q
Sbjct  410   FERSP---ILQKRFEALRAPMPWYTVDSPKLIERHVVEFMRERWHFMNKPILVVIDPQ  464



>ref|XP_010694662.1| PREDICTED: uncharacterized protein LOC104907427 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score =   162 bits (410),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 139/480 (29%), Positives = 230/480 (48%), Gaps = 69/480 (14%)
 Frame = +1

Query  343   RGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV  522
             RG  + G FL +S+D ++   V   H+ DA +  ++PL  L++DI+  A  T+ G     
Sbjct  113   RGTERGGIFL-TSDDHSLARQVEQLHNPDARNVNIRPLFLLVQDIIEHATQTVDG-----  166

Query  523   QTQPARLDAILEEKVVH-----SGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                   L+AI +++ ++      G  E  E       R S EI     S  DAH+ TLSV
Sbjct  167   ----TSLNAISQKEPMYPKFSLDGFQEVPE-LPLIVERISCEITSKVLSGVDAHNTTLSV  221

Query  688   LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
             L +L ++ W+AK V++ AAFA  +G+F LL ++Y T+ LAKS+A I ++P ++E      
Sbjct  222   LSMLQHFSWEAKVVLSLAAFALTFGDFWLLVQIYSTNSLAKSMALIKRLPMMVE---HEG  278

Query  868   avssKLREVAKLADKMLEVTHKIIALKE-----IGSEEKSLKV---KYRVSLYKELAESL  1023
                ++      L   MLE    ++   E     I +E+  +K     + +++Y  +  ++
Sbjct  279   GFKNQFEATNVLIRAMLETIKCMVEFGELPTVYITAEDPEVKAAISHFPIAVYWVIRSAV  338

Query  1024  SPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYIL  1203
             +  T                        I  L + G +Y ++T +  E+S   HKL  I 
Sbjct  339   AAATH-----------------------ITTLSSRGLEYGTATSQSWELSNWAHKLKNIS  375

Query  1204  GDLQKAVQKSTQEIGKIK----HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIH  1371
               L+  + K    IG+ +    + + RKI+ +T+   H DN      +I   +D  P+  
Sbjct  376   DHLRNTLSKLYHLIGEKRDVDTYNMIRKIVYQTI---HIDNMKVLYALISANDDVPPLYD  432

Query  1372  GAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
             G     ++  LD LRR+ V L +S LDI  E + +L   Y ESK         ++IVW+P
Sbjct  433   GPA--KRRVHLDTLRRRNVLLFISGLDITQEELFILEQSYTESKV------HSYDIVWIP  484

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +VD    W+   + +   ++++MPW+SV HPS I  AV  +     + R KP+L V+D Q
Sbjct  485   VVDHSVEWSDMMQAKLENLQATMPWYSVHHPSLIRNAVVKFFREDWHFRGKPILVVLDPQ  544



>ref|XP_008389748.1| PREDICTED: uncharacterized protein LOC103452052 [Malus domestica]
Length=832

 Score =   161 bits (408),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 173/608 (28%), Positives = 274/608 (45%), Gaps = 111/608 (18%)
 Frame = +1

Query  34    NPPKMAQTTINNTGRPMSESTTRATDTTPLVPRTAPNTPHNPVHEIVPKATNLNPRSLTT  213
             NPP  A    NN   P +    R  D  P                 VP A N       T
Sbjct  20    NPPLPAAQNYNN---PPAAPAARNYDQAP-----------------VPAAQNY------T  53

Query  214   YTPHPAYPVQQAYMPATTTNVVSATAPPSQVVAPLQAKIIPAGR-------GIRKRGDFL  372
              TP PA    Q Y PA      + TAP +       A   PAG+       G R+ GD  
Sbjct  54    QTPIPA---AQNYNPALVPAAQNYTAPDAPGAQNYNAPRAPAGQYYNNPTAGGRRGGDHY  110

Query  373   A-------------SSEDTAMMDHVRATHDVDAVHYKV-----KPLLHLIEDIMPRAHAT  498
                           +S+D+ + + + A+    A  Y V     K +L  ++ I+  +H T
Sbjct  111   NRPLLKTGRRQSSITSDDSMLTNQILASDKSHARPYDVTLLSLKHILQTVDVIL--SHVT  168

Query  499   IP---GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNR  660
              P   G         A  DA+  +K +++ ++   + +  P       S E+   + S  
Sbjct  169   QPDIHGIFTGAPVPGAHADALEHDKALYATMSGVHDNYDVPTSLFNEISCEMFCKWQSGE  228

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             DA+ IT+ +L ++ +Y WD K V+   AFA + GE+ L+A+LY  +PLAK+V  + Q+ +
Sbjct  229   DANKITMDILDIVQHYDWDEKVVLALGAFAVKDGEYWLVAQLYTANPLAKAVGQLKQVQE  288

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
             +LE + +S     K      L   +L VT  I+ L +               L+++   +
Sbjct  289   ILERAGTSLKT--KFDAYNNLVRAVLNVTKCIVQLHD---------------LHRDPHLT  331

Query  1021  LSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYI  1200
                 +A    ++  A Y+ V++ V     +L +  +G +Y     E  E+S+L HKL  I
Sbjct  332   TEAKSAANTALIPTAVYWTVRSIVVAGSQLLGITGMGPEY---VTETWELSSLAHKLENI  388

Query  1201  LGDLQKAVQKSTQEIGKIKHTIKRKILEETLART-------HTDNKYSAELIICGENDPT  1359
                L+         + +++  I+RK  +E LA         H DN  +  L +    D  
Sbjct  389   HSHLK-------DNLDRLQDIIQRKKDDEALAAIAYILETPHIDN--TKPLRVLFYKDDL  439

Query  1360  PIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI--PNEVITMLRHMYLESKQDPSRAESQF  1533
             P ++    + K+  +D+L+RK V L +SDLD+   NE I +++ MY+E + +P+R ESQ+
Sbjct  440   PALYDCYTK-KRVDIDVLKRKVVILFLSDLDVVHENEYI-IVQQMYMEKRHNPTRPESQY  497

Query  1534  EIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL------N*RRKP  1695
             E+VW+PIVD    WT AK  QF  V+ +M WF+V HPS +   V  Y+      N  +KP
Sbjct  498   EVVWVPIVDM---WTDAKYQQFEEVRRNMEWFTVFHPSVVSPTVIRYIRKQDKWNYVKKP  554

Query  1696  LLAVVDTQ  1719
             LL V+D Q
Sbjct  555   LLVVMDPQ  562



>ref|XP_009124044.1| PREDICTED: uncharacterized protein LOC103848961 isoform X1 [Brassica 
rapa]
Length=741

 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 140/478 (29%), Positives = 240/478 (50%), Gaps = 48/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +IIPA  G+        SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA     
Sbjct  24    EIIPATTGLT------MSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRATLDSD  77

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
                 SV   P   D    +K++ S +   +++ +Y   R + EI     +  DAH IT+S
Sbjct  78    DSNASVSMLPLPTD----DKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMS  133

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  134   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  191

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L ++ +   +M  VT  ++ L E+     +L                 P  +  
Sbjct  192   ESVSQGLNDLLR---EMKSVTACVVELSELPGRYITLD---------------DPQLSRI  233

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  234   ISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETL  293

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I K + +   K+L      TH DN      +I  +N   P+    GL  +K  L
Sbjct  294   RLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALIHPKNHTMPL--QDGLTKRKVHL  351

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ----FEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+     A+ +    +E+VW+PIVD    
Sbjct  352   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRSSLLGADGKSHMPYEVVWVPIVDPIED  411

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP   + + +F  +++ MPW++V  P  ++  V  ++  R    +KP+L V+D Q
Sbjct  412   YERSP---SLQKKFEALRAPMPWYTVDSPKLVERHVGEFMRERGHFMKKPILVVLDPQ  466



>ref|XP_010496279.1| PREDICTED: uncharacterized protein LOC104773380 [Camelina sativa]
Length=740

 Score =   159 bits (402),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 236/461 (51%), Gaps = 44/461 (10%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             SS++  M+  ++ TH  DA   +V+ LL L+EDI+ RA       + S  T  + L    
Sbjct  37    SSDENMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA------TLDSQDTNASMLPLPT  90

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  DAH IT+SV + L+++ WD K V+T
Sbjct  91    EDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMSVFEHLSSFHWDGKLVLT  150

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  +  +VS  L ++ +   +M
Sbjct  151   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLESVSQGLNDLIR---EM  205

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      +L++ LS +          A Y+ +++ V 
Sbjct  206   KSVTACVVELSE-------LPDRYITPDVPQLSKILSTIPI--------AVYWTIRSVVA  250

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E S L +KL  I   L + ++   + I K +     K
Sbjct  251   CISQINMITAMGHEMMNTQMDLWETSMLANKLKNIHDHLAETLRLCYRHIEKQRSAESLK  310

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L      TH DN      +I  ++D +P+    G+  +K  LD+LRRK V LL+SDL+I
Sbjct  311   VLHSLFDTTHIDNMKILTALIHPKSDISPL--QDGMTKRKVHLDVLRRKTVLLLISDLNI  368

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD-----RRSPWTGAKEDQFTLV  1608
               + +++   +Y ES+++      ++   +E+VW+PIVD      RSP     + +F  +
Sbjct  369   LLDELSIFEQIYTESRRNLVGVDGKSHMPYEVVWVPIVDPIEDYERSP---NLQKKFEAL  425

Query  1609  KSSMPWFSVSHPSKID----EAVYGYLN*RRKPLLAVVDTQ  1719
             +  MPW++V  P  I+    E V G  +   KP+L V+D Q
Sbjct  426   RQDMPWYTVDSPKLIERHVVEFVRGRWHFMNKPILVVIDPQ  466



>gb|KFK37630.1| hypothetical protein AALP_AA3G008200 [Arabis alpina]
Length=740

 Score =   159 bits (402),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 135/478 (28%), Positives = 243/478 (51%), Gaps = 50/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             ++IPA  G+        SS++  M+  ++ TH  DA   +V+ LLHL+EDI+ RA     
Sbjct  25    EMIPATTGLT------MSSDENMMLKLIQHTHSPDAREVQVRGLLHLVEDILDRA-----  73

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
               + S  +  ++L    E+K++ S +   +++ +Y   R + EI     +  DAH IT+S
Sbjct  74    -TLDSDDSNSSKLPLPTEDKLIQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMS  132

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  133   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  190

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L ++ +   +M  VT  ++ L E+ +       +Y      +L+  ++ +    
Sbjct  191   ESVSQGLNDLIR---EMKSVTACVVELSELPN-------RYITPEDPQLSRIIATIP---  237

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
                   A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  238   -----IAVYWTIRSVVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETL  292

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I + + +   K+L      TH DN      +I       P+    GL   K  L
Sbjct  293   KLCYRHIERQRSSESLKVLHSLFDTTHIDNMKILTALIHPNTHIAPL--HDGLTKSKVHL  350

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+++      ++   +E+VW+P+VD    
Sbjct  351   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRRNLMGVDGKSHMPYEVVWVPVVDPIED  410

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP     + +F  +++ MPW++V  P  ++  V  ++  R    +KP+L V+D Q
Sbjct  411   FERSP---TLQKKFEALRAPMPWYTVDSPKLVERHVVEFMRERYHFMKKPILVVIDPQ  465



>gb|KCW55913.1| hypothetical protein EUGRSUZ_I01711 [Eucalyptus grandis]
Length=591

 Score =   157 bits (398),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 120/347 (35%), Positives = 194/347 (56%), Gaps = 26/347 (7%)
 Frame = +1

Query  694   LLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessrav  873
             +LA++ WDAK V+T AA A  YGEF LLA+   ++ LAK++A + Q+  +++     +  
Sbjct  1     MLAHFSWDAKLVLTMAALAFHYGEFWLLAQARYSNQLAKAMAMLKQMTSIMDHLGELK--  58

Query  874   ssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI  1053
                L  +  L   MLEVT  ++ LKE+ S   S +V         L+++++ VT      
Sbjct  59    --SLDALNSLIQAMLEVTRCVVKLKELASAYISREVP-------ALSDAMAHVTT-----  104

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
                A Y+ +++AV C+  I NL   G +Y +ST E  E+STL HKL  I   LQK +   
Sbjct  105   ---AVYWTIRSAVACASQITNLTTFGYEYIASTTEAWELSTLNHKLKNIYEHLQKQIDIC  161

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              Q I + ++    + L       H DN    + +I  ++D  P++ G     K+  +++L
Sbjct  162   NQYIEEKQYLEAYQTLLNLFETIHNDNMKILKALIYPKDDILPLVEGNS--KKRVNIEVL  219

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSPWTGAKE  1590
             RR+ V LL+S LDI  + +++L  M+ ESK   ++ E  Q+E+VW+P+VD    WT   +
Sbjct  220   RRRNVLLLISWLDISQDELSILEDMHSESKLHATQHEIHQYEVVWIPMVDCSVKWTDPMQ  279

Query  1591  DQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              QF  ++S+MPW++V HPS IDEAV  ++    + R+KP+L ++D Q
Sbjct  280   KQFEALQSTMPWYTVYHPSLIDEAVIRFIKEKWHYRKKPILVLLDPQ  326



>ref|XP_009124045.1| PREDICTED: uncharacterized protein LOC103848961 isoform X2 [Brassica 
rapa]
Length=739

 Score =   159 bits (401),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 138/478 (29%), Positives = 242/478 (51%), Gaps = 50/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +IIPA  G+        SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA     
Sbjct  24    EIIPATTGLT------MSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA-----  72

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
               + S  +  + L    ++K++ S +   +++ +Y   R + EI     +  DAH IT+S
Sbjct  73    -TLDSDDSNASMLPLPTDDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMS  131

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  132   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  189

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L ++ +   +M  VT  ++ L E+     +L                 P  +  
Sbjct  190   ESVSQGLNDLLR---EMKSVTACVVELSELPGRYITLD---------------DPQLSRI  231

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  232   ISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETL  291

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I K + +   K+L      TH DN      +I  +N   P+    GL  +K  L
Sbjct  292   RLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALIHPKNHTMPL--QDGLTKRKVHL  349

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ----FEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+     A+ +    +E+VW+PIVD    
Sbjct  350   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRSSLLGADGKSHMPYEVVWVPIVDPIED  409

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP   + + +F  +++ MPW++V  P  ++  V  ++  R    +KP+L V+D Q
Sbjct  410   YERSP---SLQKKFEALRAPMPWYTVDSPKLVERHVGEFMRERGHFMKKPILVVLDPQ  464



>ref|XP_004501847.1| PREDICTED: uncharacterized protein LOC101501922 [Cicer arietinum]
Length=705

 Score =   158 bits (400),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 147/474 (31%), Positives = 253/474 (53%), Gaps = 39/474 (8%)
 Frame = +1

Query  313   PLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH  492
             P Q    P    ++K     ++S+D+AMM  V++TH  D     VKPL+ ++++I+ +  
Sbjct  5     PRQLPAAPNKMQLKKERRMFSTSDDSAMMKQVQSTHAPDGREIDVKPLIQIVDEILIQII  64

Query  493   A-TIPGY--VQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRD  663
             A ++ G+  V+  Q       A+ E         + ++A A+   + S E+    S   D
Sbjct  65    ARSVEGHDRVKPEQETMETAAALAE--------FDMLDALAFIINKISCELSCKCSGGGD  116

Query  664   AHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDL  843
             AH+ T+ +L  L++Y W AK V+T AAFA  +GEF L+A+   ++ LAKSVA + Q+PD+
Sbjct  117   AHASTMVLLNYLSSYPWHAKVVLTLAAFAVIFGEFWLVAQSSGSNTLAKSVALLKQLPDI  176

Query  844   LEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESL  1023
             +E+S S R     L ++ K A   L+VT  I+  KE+ SE               ++E +
Sbjct  177   VENSVSLRPQFDALNKLVKAA---LDVTMCIVEFKELPSE--------------YISEDV  219

Query  1024  SPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYIL  1203
              P++    +I   A+Y+V+++ V C+  I +L+ +  +  SS  E  E+S+L HK++ I 
Sbjct  220   PPMSVASAHI-PIAAYWVIRSIVACASQIASLIGMRNEAISSATEAWELSSLAHKVNSIY  278

Query  1204  GDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGL  1383
               L+  +    Q I + +H      L       H DN      +I  ++D  P+I G   
Sbjct  279   EHLKNQLALCYQAIDEKRHIEAFHNLIRLFETVHVDNMKIMRALIYAKDDIPPLIDGT--  336

Query  1384  EMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDR  1563
                K  L++LRRK+V LL+SDLD+  E I +L ++Y +++   SR E+ +E+VW+P+VD 
Sbjct  337   TKLKVSLEVLRRKHVLLLISDLDLSQEEIMILDNLYKDAR---SRGETHYEMVWIPVVD-  392

Query  1564  RSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVD  1713
             ++ W    + +F  +++SMPW+SV  P  I+ +V  Y+    N  ++ +L  +D
Sbjct  393   KATWNEVNKQKFEYLQASMPWYSVRDPFIIEPSVIKYIKEVWNFTKRAILVALD  446



>emb|CDX77080.1| BnaC04g38750D [Brassica napus]
Length=739

 Score =   159 bits (401),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 138/478 (29%), Positives = 241/478 (50%), Gaps = 50/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +IIPA  G+        SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA     
Sbjct  24    EIIPATTGLT------MSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA-----  72

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
               + S  +  + L    ++K++ S +   +++ +Y   R + EI     +  DAH IT+S
Sbjct  73    -TLDSDDSNASMLPLPTDDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMS  131

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  132   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  189

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L ++ +   +M  VT  ++ L E+     +L                 P  +  
Sbjct  190   ESVSQGLNDLIR---EMKSVTACVVELSELPGRYITLD---------------DPQLSRI  231

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  232   ISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETL  291

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I K + +   K+L      TH DN      +I  +N   P+    GL  +K  L
Sbjct  292   RLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALIHPKNHTMPL--QDGLTKRKVHL  349

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ----FEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+     A+ +    +E+VW+PIVD    
Sbjct  350   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRSSLLGADGKSHMPYEVVWVPIVDPIED  409

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP   + + +F  +++ MPW++V  P  ++  V  ++  R     KP+L V+D Q
Sbjct  410   YERSP---SLQKKFEALRAPMPWYTVDSPKLVERHVVEFMRERWHFMNKPILVVLDPQ  464



>ref|XP_010435652.1| PREDICTED: uncharacterized protein LOC104719422 [Camelina sativa]
Length=740

 Score =   158 bits (400),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 237/461 (51%), Gaps = 44/461 (10%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             SS++  M+  ++ TH  DA   +V+ LL L+EDI+ RA       + S  T  + L    
Sbjct  37    SSDENMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA------TLDSQDTNASMLPLPT  90

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  DAH IT+SV + L+++ WD K V+T
Sbjct  91    EDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMSVFEHLSSFHWDGKLVLT  150

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  +  +VS  L ++ +   +M
Sbjct  151   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLESVSQGLNDLIR---EM  205

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      +L++ LS +          A Y+ +++ V 
Sbjct  206   KSVTACVVELSE-------LPDRYITPDVPQLSKILSTIPI--------AVYWTIRSVVA  250

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E S L +KL  I   L + ++   + I K + +   K
Sbjct  251   CISQINMITAMGHEMMNTQMDLWETSMLANKLKNIHDHLAETLRLCYRHIEKQRSSESLK  310

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L      TH DN      +I  ++  TP+    G+  +K  LD+LRRK V LL+SDL+I
Sbjct  311   VLHSLFDTTHIDNMKILTALIHPKSHITPL--QDGMTKRKVHLDVLRRKTVLLLISDLNI  368

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD-----RRSPWTGAKEDQFTLV  1608
               + +++   +Y ES+++      ++   +E+VW+PIVD      RSP     + +F  +
Sbjct  369   LLDELSIFEQIYTESRRNLVGVDGKSHMPYEVVWVPIVDPIEDYERSP---NLQKKFEAL  425

Query  1609  KSSMPWFSVSHPSKID----EAVYGYLN*RRKPLLAVVDTQ  1719
             +  MPW++V  P+ I+    E V G  +   KP+L V+D Q
Sbjct  426   RQDMPWYTVDSPNLIERHVVEFVRGRWHFMNKPILVVIDPQ  466



>emb|CDY37506.1| BnaA05g33710D [Brassica napus]
Length=739

 Score =   158 bits (400),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 138/478 (29%), Positives = 241/478 (50%), Gaps = 50/478 (10%)
 Frame = +1

Query  325   KIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIP  504
             +IIPA  G+        SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA     
Sbjct  24    EIIPATTGLT------MSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA-----  72

Query  505   GYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLS  684
               + S  +  + L    ++K++ S +   +++ +Y   R + EI     +  DAH IT+S
Sbjct  73    -TLDSDDSNASMLPLPTDDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMS  131

Query  685   VLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssess  864
             V + L+++ WD K V+T AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + 
Sbjct  132   VFEHLSSFHWDGKLVLTLAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTL  189

Query  865   ravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQ  1044
              +VS  L ++ +   +M  VT  ++ L E+     +L                 P  +  
Sbjct  190   ESVSQGLNDLLR---EMKSVTACVVELSELPGRYITLD---------------DPQLSRI  231

Query  1045  ENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAV  1224
              + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L + +
Sbjct  232   ISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHLAETL  291

Query  1225  QKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             +   + I K + +   K+L      TH DN      +I  +N   P+    GL  +K  L
Sbjct  292   RLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALIHPKNHTMPL--QDGLTKRKVHL  349

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ----FEIVWLPIVD----  1560
             D+LRRK V LL+SDL+I  + +++   +Y ES+     A+ +    +E+VW+PIVD    
Sbjct  350   DVLRRKTVLLLISDLNILQDELSIFEQIYTESRSSLLGADGKSHMPYEVVWVPIVDPIED  409

Query  1561  -RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
               RSP   + + +F  +++ MPW++V  P  ++  V  ++  R     KP+L V+D Q
Sbjct  410   YERSP---SLQKKFEALRAPMPWYTVDSPKLVERHVVEFMRERWHFMNKPILVVLDPQ  464



>ref|NP_001241461.1| uncharacterized protein LOC100789215 [Glycine max]
 gb|ADN32786.1| sieve element occlusion d [Glycine max]
Length=705

 Score =   157 bits (398),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 146/461 (32%), Positives = 240/461 (52%), Gaps = 36/461 (8%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQT  528
             RK     ++S+D+AM   V+ATH  D     VKP+L ++++I+ R  A T+ GY      
Sbjct  19    RKERQRFSTSDDSAMTKQVQATHAPDGREIDVKPILQIVDEILVRFIARTVEGYEVKRDQ  78

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 + A L E        + +++ AY   + S E+    S   DAHS T+ +L  +++Y
Sbjct  79    DALEMTAALAE-------FDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLNYISSY  131

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              W AK V+T AAFA  +GEF L+A+L   + LAKSVA + Q+PD+ E+  S +     L 
Sbjct  132   AWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDIAENFMSMKPHFEALI  191

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K A   ++VT  I+  KE+ SE               ++E   P++    +I   AS
Sbjct  192   RLVKAA---MDVTMCIVEFKELPSE--------------YISEDTPPMSVASTHI-PIAS  233

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+V+++ V CS  I + + +  +  SST E  E+S+L HK+S I   L+  +    Q I 
Sbjct  234   YWVIRSIVACSSQISSFIGMRNESISSTTEAWELSSLAHKVSSIYEHLKNQLVLCYQYID  293

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
               +H      L       H DN      +I  ++D  P++ G      +  L++LRRK+V
Sbjct  294   DKRHIEAFHNLIRLFETVHVDNMKILRALIYAKDDVLPLVDGTA--KSRVSLEVLRRKHV  351

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLD+  E I +L ++Y +++   +R ++Q+E+VW+PIVD ++ W    + +F  +
Sbjct  352   LLLISDLDLSQEEILVLDNLYKDAR---ARGDTQYEMVWIPIVD-KATWNDMSKQKFEYL  407

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +S M W+SV  P  I+ +   Y+    N  +K +L  +D Q
Sbjct  408   QSLMAWYSVYDPFIIEPSAVKYIKEVWNFSKKAILVALDPQ  448



>ref|XP_002884266.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60525.1| hypothetical protein ARALYDRAFT_477347 [Arabidopsis lyrata subsp. 
lyrata]
Length=740

 Score =   158 bits (399),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 234/461 (51%), Gaps = 44/461 (10%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             SS++  M+  ++ TH  DA   +V+ LL L+EDI+ RA       + S  T  + L    
Sbjct  37    SSDENMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA------TLDSEDTNASMLPLPT  90

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  DAH IT+SV + L+++ WD K V+T
Sbjct  91    EDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMSVFEHLSSFHWDGKLVLT  150

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  +  +VS  L ++ +   +M
Sbjct  151   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLESVSQGLNDLIR---EM  205

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      +L+  LS +          A Y+ +++ V 
Sbjct  206   KSVTACVVELSE-------LPDRYITPDVPQLSRILSTIP--------IAVYWTIRSVVA  250

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E S L +KL  I   L + ++   + I K + +   K
Sbjct  251   CISQINMITAMGHEMMNTQMDLWETSMLANKLKNIHDHLAETLRLCYRHIEKQRSSESLK  310

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L      TH DN      +I  +   TP+    GL  +K  LD+LRRK V LL+SDL+I
Sbjct  311   VLHSLFNTTHIDNMKILTALIHPKPHITPL--QDGLTKRKVHLDVLRRKTVLLLISDLNI  368

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD-----RRSPWTGAKEDQFTLV  1608
               + +++   +Y ES+++      ++   +E+VW+P+VD      RSP     + +F  +
Sbjct  369   LQDELSIFEQIYTESRRNLVGVDGKSHMPYEVVWVPVVDPIEDFERSP---ILQKKFEDL  425

Query  1609  KSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             +  MPW+SV  P  I+  V  ++  R     KP+L V+D Q
Sbjct  426   RDPMPWYSVDSPKLIERHVVEFMRGRWHFMNKPILVVIDPQ  466



>ref|XP_010030737.1| PREDICTED: uncharacterized protein LOC104420628 [Eucalyptus grandis]
Length=667

 Score =   157 bits (397),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 224/457 (49%), Gaps = 71/457 (16%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             R   + + ED  M   V  TH  D+   +V+PLL+L+EDI+ RA   +            
Sbjct  10    RSIMMMADEDL-MRKQVEETHASDSRELEVEPLLNLVEDILVRATTDV----------DT  58

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWD  717
              L  +L EK +  G                           +AH  TLS+L+++A++ WD
Sbjct  59    DLAPVLLEKALTGG---------------------------EAHETTLSILQVVAHFPWD  91

Query  718   AKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVA  897
             AK V+T AAFA  YG+F LL ++Y ++ LAK +A + Q+P  +ES  +  +   KL    
Sbjct  92    AKPVLTLAAFAFNYGQFWLLNQVYSSNQLAKPIAILKQLPVTMESMGALESRLDKLN---  148

Query  898   KLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyv  1077
              L   MLEVT  +  LKE+ S   S +V         L+ +++PV            Y+ 
Sbjct  149   SLIQAMLEVTGFLADLKELSSAFGSKEV-------PALSAAMAPVPV--------VVYWT  193

Query  1078  vkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIK  1257
             +++AV+C+  I N  +   +Y +S     E+STL HKL  I     K +         I 
Sbjct  194   IRSAVSCASQITNFTSFSHEYITSATGAQELSTLDHKLKSINEHFPKQI--------IIC  245

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             H + R   E        DN    + +I  ++D  P++ G     K+  +++L+ K V+LL
Sbjct  246   HRLVRVATERFDEAMRIDNMKILKFLIYPKDDILPLVDGTT--EKRVNIEVLKGKKVWLL  303

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAE-SQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
             +S+LDI    +++L+ ++ ESK   +  E  Q E+VW+P+VD    WT  K+ QF + +S
Sbjct  304   ISELDISQHELSILKQIHSESKLHETTNEIHQHEMVWIPMVDHSVQWTKQKQKQFEVHQS  363

Query  1615  SMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVD  1713
             +MPW++V HP  I +    ++    + R KP+L V+D
Sbjct  364   TMPWYTVCHPRLISKVAIQFVEEKWHFRNKPILVVLD  400



>gb|KHG30263.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=633

 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 128/388 (33%), Positives = 203/388 (52%), Gaps = 41/388 (11%)
 Frame = +1

Query  535   ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
               +DA L+++     ++ A++A AY  ++   E+    S   DAH+ T+ +L +L++Y W
Sbjct  6     GHIDA-LDDRTNSYVIDGALDALAYIVHKICCEVSCKCSGGGDAHATTMGILNMLSSYSW  64

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             DAK V+T AAFA  +GEF L+ +L  ++ LAKSVA + Q+PD+LE S++ +     L   
Sbjct  65    DAKVVLTLAAFAVNFGEFWLIVQLCTSNSLAKSVALLKQLPDILEHSQTLKRHFDALN--  122

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
              KL + M++VT  I+   E+ SE  S+ V               P++    +I   A+Y+
Sbjct  123   -KLINAMIDVTKCIVEFTELPSEFISIDV--------------PPLSTAMAHI-PTATYW  166

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
             ++ + V C+  I  L+ +  ++ +ST E  E+S+L HK+S I   LQ  +    Q I + 
Sbjct  167   IIWSVVACAAQITGLVGMRHEFITSTSEAWELSSLAHKVSSIHEHLQGLLHLCYQRIDEE  226

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGEN-------DPTPIIHGAGLEMKKHGLDIL  1413
             K     +    T+     DN      I   E        D T +++           D+L
Sbjct  227   KLMEAFEDFRRTIETPQMDNLKILLKIFRKEETYYLLNPDKTKVLN-----------DVL  275

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             RRK+V LL+SDLDI  E I +L  +Y   K +    E  +EI+WLPIVD RS W    E 
Sbjct  276   RRKHVLLLISDLDISQEEIRVLEALY---KGERVSCELNYEILWLPIVD-RSTWNDGYEQ  331

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL  1677
             +F  ++S MPW++V+HP  I+ AV  Y+
Sbjct  332   KFLSLQSIMPWYTVNHPFAIEPAVIKYI  359



>gb|KHG30262.1| hypothetical protein F383_10527 [Gossypium arboreum]
Length=646

 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 128/388 (33%), Positives = 203/388 (52%), Gaps = 41/388 (11%)
 Frame = +1

Query  535   ARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWW  714
               +DA L+++     ++ A++A AY  ++   E+    S   DAH+ T+ +L +L++Y W
Sbjct  6     GHIDA-LDDRTNSYVIDGALDALAYIVHKICCEVSCKCSGGGDAHATTMGILNMLSSYSW  64

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             DAK V+T AAFA  +GEF L+ +L  ++ LAKSVA + Q+PD+LE S++ +     L   
Sbjct  65    DAKVVLTLAAFAVNFGEFWLIVQLCTSNSLAKSVALLKQLPDILEHSQTLKRHFDALN--  122

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
              KL + M++VT  I+   E+ SE  S+ V               P++    +I   A+Y+
Sbjct  123   -KLINAMIDVTKCIVEFTELPSEFISIDV--------------PPLSTAMAHI-PTATYW  166

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
             ++ + V C+  I  L+ +  ++ +ST E  E+S+L HK+S I   LQ  +    Q I + 
Sbjct  167   IIWSVVACAAQITGLVGMRHEFITSTSEAWELSSLAHKVSSIHEHLQGLLHLCYQRIDEE  226

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGEN-------DPTPIIHGAGLEMKKHGLDIL  1413
             K     +    T+     DN      I   E        D T +++           D+L
Sbjct  227   KLMEAFEDFRRTIETPQMDNLKILLKIFRKEETYYLLNPDKTKVLN-----------DVL  275

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             RRK+V LL+SDLDI  E I +L  +Y   K +    E  +EI+WLPIVD RS W    E 
Sbjct  276   RRKHVLLLISDLDISQEEIRVLEALY---KGERVSCELNYEILWLPIVD-RSTWNDGYEQ  331

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL  1677
             +F  ++S MPW++V+HP  I+ AV  Y+
Sbjct  332   KFLSLQSIMPWYTVNHPFAIEPAVIKYI  359



>ref|XP_007137986.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09980.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=747

 Score =   157 bits (398),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 145/461 (31%), Positives = 239/461 (52%), Gaps = 36/461 (8%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQT  528
             RK     ++S+D+AM   V+ATH  D     VKP+L ++++I+ R  A T+ GY      
Sbjct  61    RKERRMFSTSDDSAMTKQVQATHAPDGREIDVKPILQIVDEILVRFIARTVEGYEVKRDQ  120

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 + A+L E        + +++ AY   + S E+    S   DAHS T+ +L  +++Y
Sbjct  121   DALEMTAVLAE-------FDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLGYMSSY  173

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              W AK V+T AAFA  +GEF L+A+L   + LAKSVA + Q+PDL E+  S +     L 
Sbjct  174   AWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDLAENFMSLKPHFEALI  233

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K A   +EVT  I+  KE+ SE               ++E   P++    +I   AS
Sbjct  234   RLVKAA---MEVTTCIVQFKELPSE--------------YISEDTPPMSVASTHI-PIAS  275

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+V+++ V C+  I +L+    +  SST E  E+S+L HK++ I   L+  +    Q I 
Sbjct  276   YWVIRSIVACASQIASLIGTRNESISSTTEAWELSSLAHKVTSIHEHLKNQLILCYQYID  335

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
               +H      L       H DN      +I  ++D  P++ G      +  L++LRRK+V
Sbjct  336   DKRHIEAFHNLTRLFETVHVDNMKILRALIYAKDDILPLVDGT--TKSRASLEVLRRKHV  393

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLD+  E I +L ++Y +++   SR ++ +E+VW+P+VD ++ W    + +F  +
Sbjct  394   LLLISDLDLSQEEILVLDNLYKDAR---SRGDTHYEMVWIPVVD-KAVWNDVNKQKFEYL  449

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +S M W+SV  P  I+ +   Y+    N  +  +L  +D Q
Sbjct  450   QSLMAWYSVCDPFIIEPSAVKYIKEVWNFSKTAILVALDPQ  490



>ref|XP_006299972.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
 gb|EOA32870.1| hypothetical protein CARUB_v10016185mg [Capsella rubella]
Length=1488

 Score =   159 bits (403),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 138/461 (30%), Positives = 236/461 (51%), Gaps = 44/461 (10%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             SS++  M+  ++ TH  DA   +V+ LL L+EDI+ RA       + S  T  + L    
Sbjct  785   SSDENMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA------TLDSEDTNASMLPLPT  838

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  DAH IT+SV + L+++ WD K V+T
Sbjct  839   EDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHEITMSVFEHLSSFHWDGKLVLT  898

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  +  +VS  L ++ +   +M
Sbjct  899   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLESVSQGLNDLIR---EM  953

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      +L++ LS +          A Y+ +++ V 
Sbjct  954   KSVTACVVELSE-------LPDRYITPDVPQLSKILSTIPI--------AVYWTIRSVVA  998

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E S L +KL  I   L + ++   + I K + +   K
Sbjct  999   CISQINMITAMGHEMMNTQMDLWETSMLANKLKNIHDHLSETLRLCYRHIEKQRSSESLK  1058

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L      TH DN      +I  ++  TP+    G+  +K  LD+LRRK V LL+SDL+I
Sbjct  1059  VLHSLFDTTHIDNMKILTALIHPKSHITPL--QDGMTKRKVHLDVLRRKTVLLLISDLNI  1116

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD-----RRSPWTGAKEDQFTLV  1608
               + +++   +Y ES+++      ++   +E+VW+PIVD      RSP     + +F  +
Sbjct  1117  LLDELSIFEQIYTESRRNLVGVDGKSHMPYEVVWVPIVDPIEDYERSP---NLQKKFEAL  1173

Query  1609  KSSMPWFSVSHPSKID----EAVYGYLN*RRKPLLAVVDTQ  1719
             +  MPW++V  P  I+    E V G  +   KP+L V+D Q
Sbjct  1174  RQDMPWYTVDSPQLIERHVVEFVRGRWHFMNKPILVVIDPQ  1214


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 142/332 (43%), Gaps = 61/332 (18%)
 Frame = +1

Query  46   MAQT-TINNTGRPMSESTTRATDTTPLVPRTAPNTPHNPVHE---IVPKATNLNPRSLTT  213
            MAQ   +N+   P ++   R +    L+PR+A         E   +VPK    NP +  T
Sbjct  1    MAQRFQLNSKALPAADPLKRVS----LIPRSAEQKLPESSGERRPVVPKNHEDNPFADQT  56

Query  214  YTPHPAYPVQ------------------QAYMPATTTNVVSATA-----PPSQVVAPLQA  324
               H A P +                   A+ P  + NV+ A +     P S     L  
Sbjct  57   NDHHVAAPAEYGKVMDHETDKLGSIVPKTAHHPHPSENVLDANSRHSLNPRSLGHNSLGG  116

Query  325  KIIPAGR-GIRKRGD-FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT  498
            +  P  +    K G    + S+D AM D V  TH  D + + VK LL +++DI       
Sbjct  117  RFGPGKKQAFHKNGRPMFSLSDDRAMADRVLKTHTPDMIFFDVKTLLSVVDDI-------  169

Query  499  IPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSIT  678
               +V S+ +   ++D     K +H G +  +         TS    G +  +R+  + T
Sbjct  170  FKSHVPSMDSSAPKIDC----KCLHGGESHGM--------MTS----GLHLDSRN--TTT  211

Query  679  LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             SVL L++ Y WDAK V+  AA A +YG F LLA  + T+ L KS+A I Q+P +     
Sbjct  212  FSVLSLVSKYRWDAKLVLVLAALAVKYGVFLLLAETHATNQLTKSLALIKQLPSIFSRQN  271

Query  859  ssravssKLREVAKLADKMLEVTHKIIALKEI  954
            +      K R    L   M+++T  II + ++
Sbjct  272  TLHQRLEKTR---ILMQDMVDLTTTIIQIYQL  300


 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 67/121 (55%), Gaps = 13/121 (11%)
 Frame = +1

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIV  1542
             + HGAG+  ++ G+++L +K+V LLVSDL+   + + +L  +Y E+ Q        FEI+
Sbjct  414   LYHGAGVSKRRVGINVLTQKHVLLLVSDLENIEKELYILESLYTEAWQ------QSFEIL  467

Query  1543  WLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA----VYGYLN*RRKPLLAVV  1710
             W+P+ D    WT A + +F  +  +M W+ +  P K+  A    V  +   + +P+L  +
Sbjct  468   WVPVQDF---WTEADDAKFEALHMNMRWYVLGEPRKLRRAAMTFVRKWWGFKNRPILVAL  524

Query  1711  D  1713
             D
Sbjct  525   D  525



>ref|XP_008374367.1| PREDICTED: uncharacterized protein LOC103437653 [Malus domestica]
Length=712

 Score =   156 bits (395),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 233/458 (51%), Gaps = 30/458 (7%)
 Frame = +1

Query  319   QAKIIPAGRGIR--KRGDFLASSEDTAMMDHVRATHD---VDAVHYKVKPLLHLIEDIMP  483
             Q  +  A + IR  KR      S+D+A++  +R TH     D+    V  +L +IE+I  
Sbjct  4     QQHLPAAAKQIRRDKRTSSAPQSDDSALVRQIRDTHTPGRFDSHSVDVNQILQVIEEIF-  62

Query  484   RAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRD  663
               H T  G+   +   P  LD + E++   S ++      +Y   +   EI    S   D
Sbjct  63    --HRTPHGHAGGLLGTPEHLDTV-EDRTPLSSVDVLFHGLSYLIQKIYCEITCQCSGGAD  119

Query  664   AHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDL  843
             AH+  + +L+ L++Y W+AK  IT AA++  YGEF L+ +L  TD LAKS+AT+ Q+ D+
Sbjct  120   AHTSAIELLRTLSSYPWEAKVAITLAAYSVYYGEFWLVVQLCTTDSLAKSLATLKQLSDI  179

Query  844   LEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESL  1023
             +E ++S +    +L  +  L   +L VT +I+      SE  +++ +Y       ++E  
Sbjct  180   VEHADSVKP---QLEAINNLNKAILNVTKRIVEY----SEMVNMQSQY-------VSEDK  225

Query  1024  SPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYIL  1203
              P++    +I A A + +     + S + + L     +Y +ST E  E+S+L HKL+ I 
Sbjct  226   PPLSIALAHIPAAAYWVIRGILASASHIAI-LTGSRLEYVASTTEVWELSSLAHKLNNIH  284

Query  1204  GDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGL  1383
               L   ++   Q I   ++  + + L       H DN  +   +I   +D  P+    G 
Sbjct  285   DHLTNELENCRQHIVAKRYDEEYETLRRLFQSLHLDNLRNLRALISHRDDIQPL--QIGT  342

Query  1384  EMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDR  1563
                + GL++LRR++V LL++DL + NE I +L H+Y + ++ P   E ++E VW+P+VD 
Sbjct  343   TKSRSGLEVLRRRHVLLLITDLSLSNEXILILDHIYKDKQKRP---EVEYEFVWIPMVD-  398

Query  1564  RSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL  1677
              + W  AK  +F  +KS M W++V  P  I+  V  ++
Sbjct  399   TNVWDEAKXLRFEDLKSRMQWYTVYDPXIIEPPVVKFI  436



>ref|XP_002526960.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35447.1| conserved hypothetical protein [Ricinus communis]
Length=685

 Score =   156 bits (394),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 136/461 (30%), Positives = 220/461 (48%), Gaps = 54/461 (12%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQ  525
             I+  G   A S++ ++M  V+ TH  D   + V+ LL+++EDI+    +  I   + + Q
Sbjct  14    IKSEGSMAALSDEDSLMKLVQETHAPDDRKFDVRTLLNVLEDILINCESREIESIMPATQ  73

Query  526   TQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLAN  705
             T     D             E +E+ +Y   + S EI     S  D H  T+S L +L+N
Sbjct  74    THKETPD----------NSREVLESLSYIIDKLSSEISYKVLSGADGHRTTISFLNMLSN  123

Query  706   YWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQI-PDLLEssessravssK  882
             Y WD+K V+   AFA  YGEF L+A +  ++P AK++AT+ Q  P +LE + +S   +  
Sbjct  124   YSWDSKLVLIMLAFALNYGEFWLIAEIRFSNPFAKTMATLKQFRPFILEYAATSLKPT--  181

Query  883   LREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMak  1062
                +  L   M EVT  ++ + E+ SE         +  Y EL+  +   T         
Sbjct  182   FDALNNLIRVMREVTKCVVEVGELSSE---------IPAYLELSALVQRAT---------  223

Query  1063  asyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQE  1242
               Y+   +A+ C+  I  L  +      + +   E+STL  KL  I   L+  +    Q+
Sbjct  224   --YWTTISAMACATQINTLAKLDN----ADQLAGELSTLADKLQNIHDRLRSQLTICYQQ  277

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
                 K  +  ++L       H DN    + +IC +ND  P+  G     K+  +D+LR+K
Sbjct  278   ----KDDMSYQMLLNLFKSVHIDNMKILKALICSKNDIQPLFDGYT--KKRVNIDVLRQK  331

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              V LL+SDL IP+  I  L   Y  +          FE+VW+PI+DR   W    + QF 
Sbjct  332   NVLLLISDLHIPDYEIFFLETHYRIT------GNHLFEVVWIPIMDRTIKWNDLGQKQFE  385

Query  1603  LVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVD  1713
              ++S MPW++V HP++ID+ V  ++    +   KP+L V+D
Sbjct  386   SLQSKMPWYTVYHPTQIDKVVIKFIKEVWHFNNKPILVVLD  426



>ref|NP_186817.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF01551.1|AC009325_21 unknown protein [Arabidopsis thaliana]
 gb|AAP37684.1| At3g01680 [Arabidopsis thaliana]
 dbj|BAF00055.1| hypothetical protein [Arabidopsis thaliana]
 gb|ADN32814.1| sieve element occlusion b [Arabidopsis thaliana]
 gb|AEE73702.1| uncharacterized protein AT3G01680 [Arabidopsis thaliana]
Length=740

 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 135/461 (29%), Positives = 235/461 (51%), Gaps = 44/461 (10%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA       + S  T  + L    
Sbjct  37    SSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA------TLDSEDTNASMLPLPT  90

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  D+H IT+SV + L+++ WD K V+T
Sbjct  91    EDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDSHEITMSVFEHLSSFQWDGKLVLT  150

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  +  +VS  L ++ +   +M
Sbjct  151   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLESVSQGLNDLIR---EM  205

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      +L+  LS +          A Y+ +++ + 
Sbjct  206   KSVTACVVELSE-------LPDRYITPDVPQLSRILSTIPI--------AVYWTIRSVIA  250

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E S L +KL  I   L + ++   + I K + +   K
Sbjct  251   CISQINMITAMGHEMMNTQMDLWETSMLANKLKNIHDHLAETLRLCYRHIEKQRSSESLK  310

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             +L      TH DN      ++  +   TP+    GL  +K  LD+LRRK V LL+SDL+I
Sbjct  311   VLHSLFDTTHIDNMKILTALVHPKPHITPL--QDGLTKRKVHLDVLRRKTVLLLISDLNI  368

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD-----RRSPWTGAKEDQFTLV  1608
               + +++   +Y ES+++      ++   +E+VW+P+VD      RSP     + +F  +
Sbjct  369   LQDELSIFEQIYTESRRNLVGVDGKSHMPYEVVWVPVVDPIEDFERSP---ILQKKFEDL  425

Query  1609  KSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             +  MPW+SV  P  I+  V  ++  R     KP+L V+D Q
Sbjct  426   RDPMPWYSVDSPKLIERHVVEFMRGRWHFMNKPILVVIDPQ  466



>ref|XP_010248721.1| PREDICTED: uncharacterized protein LOC104591550 [Nelumbo nucifera]
Length=718

 Score =   155 bits (393),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 141/465 (30%), Positives = 235/465 (51%), Gaps = 45/465 (10%)
 Frame = +1

Query  352   RKR-GDFLASSEDTAM-MDHVRATHDVDA--VHYKVKPLLHLIEDIMPRAHATIPGYVQS  519
             RKR        +D+ M M  V ATH  D   V  K K LL ++EDI+ RA  T   +V  
Sbjct  28    RKRDSSLFGPLDDSGMIMADVIATHASDGRLVDVKTKLLLQVVEDILERASPTRAAHV--  85

Query  520   VQTQPARLDAI--LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLK  693
               TQ A ++A+  + E+ +H  + + I           F   G  +  RD H + L +L 
Sbjct  86    --TQ-AHMEAVEYMTEEGIHGVVADTIRKIGS---EIQFHCSG--TGRRDLHPLALDLLT  137

Query  694   LLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessrav  873
              L+ Y WD KAVI  AAF   YG+F L +++  T+ LAKS++ + Q+P++L     ++ +
Sbjct  138   TLSMYSWDTKAVIVMAAFGINYGDFWLTSQICTTNSLAKSLSVLKQVPEVLS--HVNKML  195

Query  874   ssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI  1053
               +L  ++ L   ML++T  +       +E   L V Y             P  +   N+
Sbjct  196   KPRLDALSNLIRGMLDLTKSL-------TEFYDLPVGYLSGF---------PAMSMASNL  239

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
             +  A Y+++++ + C+    ++L+VG   +       ++STL +KL  I   L+  + + 
Sbjct  240   VPTAVYWIIRSVLVCTSQFNSILSVG---HHQDMGSWDVSTLAYKLGDIHAHLKDQLTRC  296

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              +EI + K     + L      T  DN     ++I   +D  P++   G    + G+++L
Sbjct  297   HKEIEERKLNEVYQTLVRLFDTTQVDNLRVLRVLIHSIDDHQPLLD--GFTKTRVGVEVL  354

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
              +K V LL+SDLDI  E +T+L ++Y E  Q  +++E  +E+VWLP+V   S W  AK+ 
Sbjct  355   GKKTVVLLISDLDITAEELTVLENVYGELSQQ-TKSEKAYEMVWLPVVQNSSGWMPAKQQ  413

Query  1594  Q-FTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVD  1713
             + F  ++S+MPW+S+ HPS +  AV  Y+       +KPLL V+D
Sbjct  414   ETFKRLQSAMPWYSLHHPSLLHPAVIQYMKEVWQYEKKPLLVVLD  458



>gb|KDP46378.1| hypothetical protein JCGZ_10218 [Jatropha curcas]
Length=688

 Score =   155 bits (392),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 143/461 (31%), Positives = 229/461 (50%), Gaps = 68/461 (15%)
 Frame = +1

Query  379   SEDTAMMDHVRATHD--VDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAI  552
             S+D A+   +  TH    D   + VKPLL ++ED+       +     + +T    LD  
Sbjct  20    SDDNALTKQINDTHGHPDDVREFDVKPLLQMVEDVFDFKTNDV-----TQETVADSLDQN  74

Query  553   LEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVI  732
              + + V   L + I+           E  GG       H IT+  LK L NY W AK VI
Sbjct  75    TKARYVFESLVDLIDKIGSEIDNKCREGAGG-------HEITMGTLKKLPNYSWGAKLVI  127

Query  733   TFAAFAQQYGEFGLL-ARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             T AAFA  YGEF ++  + Y +D LAKS+A + Q+  +L+        S ++ E+ +L +
Sbjct  128   TLAAFAMNYGEFWVVKVKYYESDMLAKSIARLKQLTRVLD------ESSGQVDEMKRLIE  181

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              M+ +   I+ LKE+ S      +    S+++  AE   P+T           Y+ +++ 
Sbjct  182   VMINIAKCILKLKELPS------LSTMTSIHR--AEEKLPITV----------YWTIRSM  223

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
             V CS +I  L+ +  D   S  E  E+S+LT+KLS +  +L   ++   +EI K     +
Sbjct  224   VACSSLITGLMGM-EDERISATETWELSSLTNKLSDMHKNLNAQLENCYKEIDKEN---Q  279

Query  1270  RKILEE--TLART-HTDNKYSAELIICGENDPTPIIHGAGLEMKKHG---LDILRRKYVF  1431
              K  +E  TL +T   DN    + +ICG++DP P+       +K  G   +D+L  K V 
Sbjct  280   EKAFQELKTLTKTDQNDNMQILKALICGKDDPLPLF------IKDKGRVKIDVLCNKNVL  333

Query  1432  LLVSDLDIPNEVITMLRHMYLESKQDPSRAES---QFEIVWLPIVDRRSPWTGAKEDQFT  1602
             LL+SDLDI  + I ML +  ++  +D  + +    Q+EIVWLPI+D    W    +D+F 
Sbjct  334   LLISDLDISEDDIFMLTN--IQESRDLRKEQQEGHQYEIVWLPIID----WKDDMQDRFK  387

Query  1603  LVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVD  1713
              ++  M W+S+ HPS ID  V  ++    +  +KP+L V+D
Sbjct  388   KLQDGMTWYSICHPSLIDRGVIRFVREEWHFEKKPILVVLD  428



>ref|XP_010550173.1| PREDICTED: uncharacterized protein LOC104821101 [Tarenaya hassleriana]
Length=732

 Score =   155 bits (392),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 236/458 (52%), Gaps = 40/458 (9%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             S ++  M+  ++ TH  DA  ++V  LL L+EDI+ RA  T+           +R  A  
Sbjct  30    SGDENVMLKLIQHTHSPDAREFEVGGLLSLVEDILDRA--TLDA------DDASRFPAST  81

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             E+K++ S +   +++ +Y   R + EI     +  DAH IT+SV + L+++ WD K V+T
Sbjct  82    EDKMLQSHMMSVLDSVSYAVDRVACEIAYKSLTGSDAHQITMSVFEHLSSFHWDGKLVLT  141

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA  YGEF LL + Y  + LAKS+A +  +P  +++  + ++VS+ L ++ +   +M
Sbjct  142   LAAFALNYGEFWLLVQFYSKNQLAKSLAMLKLVP--VQNRVTLQSVSTSLNDLIR---EM  196

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
               VT  ++ L E       L  +Y      EL+ +++ +          A Y+ +++ V 
Sbjct  197   KNVTRCVVELSE-------LPGRYITPEVPELSRTIASIP--------IAVYWTIRSVVA  241

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C   I  + A+G +  ++  +  E+S L +KL  I   L + ++   + I   + +   K
Sbjct  242   CIAQINMITAMGHEMMNTQMDSWEVSMLANKLKNIHEHLSETLRLCHRYIEGQRSSEALK  301

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
              L      TH DN    + +I  ++D +P+    G+  KK  LD+LRRK V LL+SDL+I
Sbjct  302   KLYALFEATHIDNMKVLKALIYPKDDISPL--QDGITKKKVHLDVLRRKTVLLLISDLNI  359

Query  1456  PNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVDRRSPWTGA--KEDQFTLVKSS  1617
               + +     +Y +S+++      +    +E+VW+P+VD    +  +   + +F  ++S+
Sbjct  360   SQDELRTFEQIYTDSRKNLMGHDGKTHMPYEVVWIPVVDPIDDYDRSLPLQKKFEALRST  419

Query  1618  MPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             MPWFSV  P  I   V  ++  R     KP+LAV+D Q
Sbjct  420   MPWFSVDSPKIIQRHVVKFMRERWHFMNKPILAVLDPQ  457



>ref|XP_007221911.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
 gb|EMJ23110.1| hypothetical protein PRUPE_ppa001579mg [Prunus persica]
Length=799

 Score =   155 bits (392),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 155/552 (28%), Positives = 247/552 (45%), Gaps = 101/552 (18%)
 Frame = +1

Query  172   VPKATNLNPR---SLTTYTPHPAYPVQQAYMPA---TTTNVVSATAPPSQVVAPLQAKII  333
             VP A N NP    +  +Y P  A P  Q+Y PA      N   A AP +Q          
Sbjct  44    VPAAQNYNPALAPAAQSYDPALA-PAAQSYNPAFAPAAQNYNPAFAPAAQNYYKPPTTTR  102

Query  334   PAGRGIRKRG--DFLASSEDTAMMDHVRATHDVDAVHYKVK--PLLHLIEDIMPRAHATI  501
               G    + G   F A+S+D+A+ + + AT       Y VK  PL H++           
Sbjct  103   RGGDSYNRPGRRQFSATSDDSALTNQILATDRSRDRPYDVKSIPLKHIL-----------  151

Query  502   PGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITL  681
                 Q+V    AR+     +  +H        AF  P       I G + S  D +  T+
Sbjct  152   ----QTVDVILARV----TKPDIHG-------AFLVP-------IFGKWLSGEDPNKTTM  189

Query  682   SVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsses  861
              +L ++ ++ WD K V+   AFA + GEF L+A+LY T+PLAK++  + Q+ ++LE + +
Sbjct  190   DILDIVQHHDWDEKVVLVLGAFAVKDGEFWLVAQLYTTNPLAKAIGQLKQVQEILERAGT  249

Query  862   sravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAE  1041
             +     K      L   ++ VT  ++ L ++  +                      VT E
Sbjct  250   TLKP--KFESYNNLVRAIINVTKCVVQLHDLQRDPH--------------------VTTE  287

Query  1042  QENIMakasyyvvkaavTCSLVI-----LNLLAVGRD-------YYssteeeleistltH  1185
              E+    A           S+V+     L +  +G D       +Y ++   L  +    
Sbjct  288   HESAATTAHIPTAVYWTIRSIVVAASQLLGITGMGPDDKFIVFHFYLASIRYLTETWELS  347

Query  1186  KLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART-------HTDNKYSAELIICG  1344
              L++ L ++   +Q++   + +I   IKRK  +E LA         H DN     L +  
Sbjct  348   SLAHKLENIHSHLQENLDRLYEI---IKRKKDDEALAAIAYILETPHIDN--VKPLRVLF  402

Query  1345  ENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITML-RHMYLESKQDPSRA  1521
               D  P ++      K+  +D+L+RK V L +SDLD+ NE   M+ ++MY+E +  P R 
Sbjct  403   YKDDLPALYDC-YNKKRVDIDVLKRKTVILFISDLDVVNENEYMIVQNMYMEKRHSPVRP  461

Query  1522  ESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL------N*  1683
             ESQ+E+VW+PIVD    WT AK  QF  ++ +M W++V HPS +   V  Y+      N 
Sbjct  462   ESQYEVVWVPIVDT---WTDAKYQQFEELRRNMEWYTVFHPSVVSPTVIRYIRKKDKWNF  518

Query  1684  RRKPLLAVVDTQ  1719
             ++KPLL V+D Q
Sbjct  519   QKKPLLVVMDPQ  530



>ref|XP_004310159.1| PREDICTED: uncharacterized protein LOC101309120 [Fragaria vesca 
subsp. vesca]
Length=779

 Score =   153 bits (387),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 154/534 (29%), Positives = 247/534 (46%), Gaps = 79/534 (15%)
 Frame = +1

Query  220   PHPAYPVQQAYMPAT----TTNVVSATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSED  387
             P   Y  Q A +P T    +    +   PP Q +          GR  R++   L S + 
Sbjct  18    PQNTYAAQNALVPQTKAPSSLRRDNYRKPPYQQL----------GRDGRRQLSTLTSDDS  67

Query  388   ---TAMMDHVRATHD--VDAVHYKVKPLLHLIEDIMPR-------AHATIPGYVQSVQTQ  531
                T +MD  R +HD   D+    +K +L  ++ I  R       A+  +PG   +V   
Sbjct  68    GLITQVMDTDR-SHDRPYDSTPVSLKHILQAVDVIFSRVTKPDVHANLLVPG--SAVVPT  124

Query  532   PARLDAILE-EKVVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLL  699
              A  +A+   EK + + L+   + +  P       S EI   + S  DA+  T+ +L ++
Sbjct  125   GAHTEALEHHEKALLASLSSLHDNYEIPVSLFNAISCEIFCKWMSGEDANKTTMDILHIV  184

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
              NY WD K V+   AF+ + GEF L+A+LY T+ LAK+V T+ Q+P++LE + +      
Sbjct  185   QNYDWDEKVVLALGAFSVKDGEFWLVAQLYNTNVLAKAVGTLRQLPEILERTSTVLKS--  242

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa  1059
             K      L   + +VT  I+ L+E+  +               L   L   T+   +I  
Sbjct  243   KFDAYNNLVTTVFKVTKCIVQLQEVRRD-------------PHLTPELESTTSGTAHIPT  289

Query  1060  kasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQ  1239
                + +    +  S  +L +  +G D+     E  E+S+L+HKL  I   LQ+       
Sbjct  290   AVYWTIRSIVIAAS-QLLGITGMGPDH---VTEAWELSSLSHKLENIHSHLQET------  339

Query  1240  EIGKIKHTIKRKILEETLART-------HTDNKYSAELIICGENDPTPIIHGAGLEMKKH  1398
              + ++   I+RK  +E LA         H DN  +  ++   ++ P       G   ++ 
Sbjct  340   -LNRLYDIIQRKKDDEALAAIAYILETPHVDNTKTLRVLFYKDDQPALY---DGYNKRRV  395

Query  1399  GLDILRRKYVFLLVSDLDIPNEVITML-RHMYLESKQDPSRAESQFEIVWLPIVDRRSPW  1575
              +D+L+RK V L +SDL++  E   M+   MY E +Q P+R ESQ+EIVW+PI D    W
Sbjct  396   DVDVLKRKVVILFLSDLNVAQENEYMIADQMYSEKRQFPTRPESQYEIVWVPIEDN---W  452

Query  1576  TGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL------N*RRKPLLAVVDTQ  1719
             T AK  QF  +++ M W+SV HPS +   V  Y+      N  +KPLL V+D Q
Sbjct  453   TEAKYQQFETLRNGMEWYSVYHPSVVSPTVIRYIRKQDKWNFVKKPLLVVMDPQ  506



>gb|KEH35012.1| sieve element occlusion protein [Medicago truncatula]
Length=706

 Score =   152 bits (385),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 145/464 (31%), Positives = 251/464 (54%), Gaps = 39/464 (8%)
 Frame = +1

Query  349   IRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQ  525
             ++K     ++S+D+AM   V+ATH  D     VKPL+ ++++I+ +  A ++ G+ + V+
Sbjct  18    LKKERRMFSTSDDSAMTKQVQATHAPDGREIDVKPLIQIVDEILIQIIARSVEGH-EHVK  76

Query  526   TQPARLD--AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLL  699
              +   L+  A L E        + ++A A+   + S E+    S   DAH+ T+ +L  L
Sbjct  77    HEQDTLETSAALAE-------FDMLDALAFIINKISCELSCKCSGGGDAHASTMVLLNYL  129

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
             ++Y W AK V+T AAFA  +GEF L+A+   ++ LAKSVA + Q+PD++E+S S R    
Sbjct  130   SSYPWHAKVVLTLAAFAVIFGEFWLVAQSSVSNTLAKSVALLKQLPDIVENSVSLRPQFD  189

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa  1059
              L ++ K A   L+VT  I+  K++ SE               ++E   P++    +I  
Sbjct  190   ALNKLVKAA---LDVTMCIVEFKDLPSE--------------YISEDAPPMSVASAHI-P  231

Query  1060  kasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQ  1239
              A+Y+V+++ V C+  I +L+ +  +  SS  E  E+S+L HK++ I   L+  +    Q
Sbjct  232   IATYWVIRSIVACASQIASLIGMRNEAISSASEAWELSSLAHKVTSIYEHLKNQLALCYQ  291

Query  1240  EIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRR  1419
              I + KH      L       H DN      +I  ++D  P+I G      +  L++LRR
Sbjct  292   SIDEKKHIEAFLYLVHLFETVHVDNMKILRALIYAKDDIPPLIDGTT--KLRVSLEVLRR  349

Query  1420  KYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQF  1599
             K+V LL+SDLD+  E I +L ++Y +++   SR E+ +E+VW+P+VD ++ W    + +F
Sbjct  350   KHVLLLISDLDLSLEEIMILDNLYKDAR---SRGETHYEMVWIPVVD-KATWNEVNKQKF  405

Query  1600  TLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
               ++S+MPW SV  P  I+ +V  Y+    N  ++ +L  +D Q
Sbjct  406   EYLQSTMPWHSVRDPFIIEPSVIKYIKEVWNYTKRAILVALDPQ  449



>emb|CDY28669.1| BnaCnng05550D [Brassica napus]
Length=745

 Score =   152 bits (385),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 134/482 (28%), Positives = 242/482 (50%), Gaps = 48/482 (10%)
 Frame = +1

Query  313   PLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH  492
             P   +++PA       G    SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA 
Sbjct  24    PRTTEMVPAT----STGGLTMSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA-  78

Query  493   ATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHS  672
                   + S  +  + L    E+K++ S +   +++ +Y   R + EI     +  DAH 
Sbjct  79    -----TLDSDDSNASMLPLPTEDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHE  133

Query  673   ITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEs  852
             IT+SV + L+++ W  K V+T AAFA  YGEF LL + +  + LAKS+A +  +P  +++
Sbjct  134   ITMSVFEHLSSFHWHGKLVLTLAAFALNYGEFWLLVQFHSKNQLAKSLAMLKLVP--VQN  191

Query  853   sessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV  1032
               +  +VS  L ++ +   +M  VT  ++ L E+     +L+                P 
Sbjct  192   RVTLESVSHGLNDLIR---EMKSVTACVVELSELPDRYITLE---------------DPH  233

Query  1033  TAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDL  1212
              +   + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L
Sbjct  234   LSRIISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHL  293

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMK  1392
              + ++   + I K + +   K+L      TH DN      ++  +N  TP+  G+    +
Sbjct  294   AETLRLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALVHPKNHTTPLQDGST--KR  351

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD  1560
             K  LD+LRRK V LL+SDL+I  + +++   +Y ES+++      ++   +E+VW+PIVD
Sbjct  352   KVHLDVLRRKTVLLLISDLNILEDELSIFEQIYTESRRNLQGIDGKSHMPYEVVWVPIVD  411

Query  1561  -----RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVD  1713
                   R P   + +++F  ++  MPW++V  P  I+  V  ++  R     KP+L V+D
Sbjct  412   PIEDYERYP---SLQNKFEALREPMPWYTVDSPKLIERHVVEFMRERWHFMNKPILVVLD  468

Query  1714  TQ  1719
              Q
Sbjct  469   PQ  470



>ref|XP_009124817.1| PREDICTED: uncharacterized protein LOC103849857 [Brassica rapa]
Length=745

 Score =   152 bits (384),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 134/482 (28%), Positives = 241/482 (50%), Gaps = 48/482 (10%)
 Frame = +1

Query  313   PLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAH  492
             P   +++PA       G    SS+++ M+  ++ TH  DA   +V+ LL L+EDI+ RA 
Sbjct  24    PRTTEMVPAT----STGGLTMSSDESMMLKLIQQTHSPDAREVQVRGLLSLVEDILDRA-  78

Query  493   ATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHS  672
                   + S  +  + L    E+K++ S +   +++ +Y   R + EI     +  DAH 
Sbjct  79    -----TLDSDDSNASMLPLPTEDKLMQSSMMSVLDSVSYAIDRVACEIAYKSLTGSDAHE  133

Query  673   ITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEs  852
             IT+SV + L+++ W  K V+T AAFA  YGEF LL + +  + LAKS+A +  +P  +++
Sbjct  134   ITMSVFEHLSSFHWHGKLVLTLAAFALNYGEFWLLVQFHSKNQLAKSLAMLKLVP--VQN  191

Query  853   sessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPV  1032
               +  +VS  L ++ +   +M  VT  ++ L E+     +L                 P 
Sbjct  192   RVTLESVSHGLNDLIR---EMKSVTACVVELSELPDRYITLD---------------DPH  233

Query  1033  TAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDL  1212
              +   + +  A Y+ +++ V C   I  + A+G +  ++  +  E S L +KL  I   L
Sbjct  234   LSRIISTIPIAVYWTIRSIVACISQINMITAMGHEMMNTQMDSWETSMLANKLKNIHDHL  293

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMK  1392
              + ++   + I K + +   K+L      TH DN      ++  +N  TP+  G+    +
Sbjct  294   AETLRLCYRHIEKQRSSESLKMLHSLFDTTHIDNMKILTALVHPKNHTTPLQDGST--KR  351

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQD----PSRAESQFEIVWLPIVD  1560
             K  LD+LRRK V LL+SDL+I  + +++   +Y ES+++      ++   +E+VW+PIVD
Sbjct  352   KVHLDVLRRKTVLLLISDLNILEDELSIFEQIYTESRRNLQGIDGKSHMPYEVVWVPIVD  411

Query  1561  -----RRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVD  1713
                   R P   + +++F  ++  MPW++V  P  I+  V  ++  R     KP+L V+D
Sbjct  412   PIEDYERYP---SLQNKFEALREPMPWYTVDSPKLIERHVVEFMRERWHFMNKPILVVLD  468

Query  1714  TQ  1719
              Q
Sbjct  469   PQ  470



>ref|XP_009359245.1| PREDICTED: uncharacterized protein LOC103949844 [Pyrus x bretschneideri]
Length=746

 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 150/506 (30%), Positives = 239/506 (47%), Gaps = 63/506 (12%)
 Frame = +1

Query  283   ATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPL--  456
             A  P S+     +  ++  GR   ++  F  +++D+A+++ +  T       Y+V PL  
Sbjct  9     AVNPTSRGAGHNRPPLLKQGRDGHRQ--FSTTADDSALVNQIMLTDKSHDHPYEVPPLAV  66

Query  457   ---LHLIEDIMPRA-----HATI--PGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFA  606
                L  IE I+ R      H  I  PG +    T     DA+  EK +H+ L+   ++  
Sbjct  67    TQILQTIEAILSRVTKPDIHDGILVPGALAPAATHA---DALEHEKTLHANLSTLHDSVD  123

Query  607   YPAYRTSF-----EIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFG  771
              P   + F     +++  +    DA+  T+++L ++ +Y WD K V+   AFA + GEF 
Sbjct  124   VP--HSVFNAIHSKLMCTFVQGEDANKTTMNILDIVQHYDWDEKVVLALGAFAIKDGEFW  181

Query  772   LLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKE  951
             L+A+ Y T+PLA++V  + Q+ ++LE + +S     K      L   + +VT  I+ L+E
Sbjct  182   LVAQKYTTNPLARAVGQLKQLQEILERAGTSLKT--KFDAYNSLVRAIFKVTKTIVHLQE  239

Query  952   IGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVIL--NLLA  1125
             I ++ +                 LSP   E +   A A           ++V+    LL 
Sbjct  240   IHNDPQ-----------------LSP---EIKATAATAQTPTAVYWTIRAIVVAASQLLG  279

Query  1126  VGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTH  1305
             +         E  E+S+L HKL  I   L+  + +  Q I K K       +   L   H
Sbjct  280   ITGSEPEYVTEAWELSSLAHKLENIFDHLEDILDRLHQLIWKNKEEEAFNTIARILETPH  339

Query  1306  TDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI--PNEVITML  1479
              DN  S  L +    D  P ++  G   K+  +D+L+RK V L ++DLD+   NE I +L
Sbjct  340   MDN--SKPLRVLFYKDDQPALYD-GYNKKRVDIDVLKRKVVILFITDLDVVHENEYIIVL  396

Query  1480  RHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDE  1659
             + MY E  Q+P+R ESQ+E+VW+PI D    WT AK  QF  +K SM W +V HPS +  
Sbjct  397   Q-MYSEKLQNPTRPESQYEVVWVPITD---AWTEAKYQQFESLKDSMQWHTVFHPSVVSP  452

Query  1660  AVYGYL------N*RRKPLLAVVDTQ  1719
              V  Y+      N  +KPLL V+D Q
Sbjct  453   IVVRYIRDPRKWNFAKKPLLVVMDPQ  478



>ref|NP_001241263.1| uncharacterized protein LOC100811452 [Glycine max]
 gb|ADN32785.1| sieve element occlusion c [Glycine max]
Length=698

 Score =   150 bits (378),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 142/461 (31%), Positives = 238/461 (52%), Gaps = 36/461 (8%)
 Frame = +1

Query  352   RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQT  528
             R+     ++S+D+AM   V ATH  D     VKP+L ++++I+ R  A T+ G+      
Sbjct  12    RRERRMFSTSDDSAMTKQVEATHAPDGREIDVKPILQIVDEILVRFIARTVEGHEVKRDQ  71

Query  529   QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                 + A L E        + +++ AY   + S E+    S   DAHS T+ +L  +++Y
Sbjct  72    DALEMTAALAE-------FDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLNYMSSY  124

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              W AK V+T AAFA  +GEF L+A+L   + LAKSVA + Q+PD+ E+  S +     L 
Sbjct  125   AWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDIAENFMSLKPHFEALI  184

Query  889   EVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakas  1068
              + K A   ++VT  I+  KE+ SE               ++E   P++    +I   AS
Sbjct  185   RLVKAA---MDVTMCIVEFKELPSE--------------YISEDTPPMSVASTHI-PIAS  226

Query  1069  yyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIG  1248
             Y+V+++ V CS  I +L+ +  +  SST E  E+S+L HK+S I   L+  +    Q I 
Sbjct  227   YWVIRSIVACSSQIASLVGMRNESISSTTEAWELSSLAHKVSSIYEHLKNQLVLCYQYID  286

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
               +H      L       H DN      +I  ++D  P++ G      +  L++LRRK+V
Sbjct  287   DKRHIEAFHNLIRLFETVHVDNMKILRALIYAKDDVLPLVDGT--TKSRVSLEVLRRKHV  344

Query  1429  FLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLV  1608
              LL+SDLD+  E I +L ++Y +++   +R ++ +E+VW+P+VD ++ W    + +F  +
Sbjct  345   LLLISDLDLSQEEILVLDNLYKDAR---ARGDTHYEMVWIPVVD-KATWNETSKQKFEYL  400

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +S M W+SV  P  I+ +   Y+    N  +  +L  +D Q
Sbjct  401   QSLMAWYSVYDPFIIEPSAIKYIKEVWNFSKTAILVALDPQ  441



>ref|XP_009359248.1| PREDICTED: uncharacterized protein LOC103949845 isoform X2 [Pyrus 
x bretschneideri]
Length=775

 Score =   150 bits (378),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 143/498 (29%), Positives = 240/498 (48%), Gaps = 77/498 (15%)
 Frame = +1

Query  346   GIRKRGDFL-------------ASSEDTAMMDHVRATHDVDAVHYKV-----KPLLHLIE  471
             G R+ GD+               +S+D+ + + + A+    A  Y V     K +L  ++
Sbjct  45    GGRRGGDYYNRPLPKDGRRFSSTASDDSMLTNQILASDKSHARPYDVTLLSLKHILQTVD  104

Query  472   DIMPRA-----HATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAY---RTS  627
              I+ R      H+T+ G +          DA+  EK  H+ ++   + +  P       S
Sbjct  105   VILSRVTQPDIHSTVTGAL----VPGTHADALEHEKASHAIISSLPDNYDVPTSLFNAIS  160

Query  628   FEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLA  807
              EI   + S  DA+  T+ +L  + +Y WD K V+   AFA + GE+ L+A LY T+PLA
Sbjct  161   CEIFCKWLSGEDANKTTMDILDTVQHYDWDEKVVLALGAFAVKDGEYWLVAHLYTTNPLA  220

Query  808   KSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKY  987
             K+V  + Q+ ++LE + +      K      L   +L VT  I+ L ++          +
Sbjct  221   KAVGQLKQVQEILEHAGTRLKP--KFDAYNNLVRAVLNVTKGIVQLHDL----------H  268

Query  988   RVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeele  1167
             R  +    AES     A    ++  A Y+ +++ V  +  +L +  +G ++     E  E
Sbjct  269   RNPVMTTEAES-----AATTALIPTAVYWTIRSIVVAATQLLGITGMGPEH---MTEAWE  320

Query  1168  istltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART-------HTDNKYSA  1326
             +S+L HKL  I   L+       + + ++   IKRK  E+ L+         H DN  S 
Sbjct  321   LSSLAHKLENIHSHLK-------ENLDRLLDIIKRKKEEQELSEISYILESPHIDN--SK  371

Query  1327  ELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITML-RHMYLESK  1503
              L +    D  P ++      K+  +D+L+RK V L +SD+D+ +E   M+ + MYLE +
Sbjct  372   PLRVLFYKDDQPALYDC-YNKKRVDIDVLKRKVVILFLSDIDVVHENEYMIVQQMYLEKR  430

Query  1504  QDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL--  1677
             Q+P+R ESQ+E+VW+PIVD    WT AK  QF  ++ +M W+++ HPS + + V  Y+  
Sbjct  431   QNPTRTESQYEVVWVPIVD---IWTDAKYQQFEDLRRNMEWYTLFHPSVVPKTVIRYIRK  487

Query  1678  ----N*RRKPLLAVVDTQ  1719
                 N  +KPLL V+D Q
Sbjct  488   QDKWNYGKKPLLVVMDPQ  505



>gb|EYU17767.1| hypothetical protein MIMGU_mgv1a002070mg [Erythranthe guttata]
Length=719

 Score =   149 bits (376),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 133/452 (29%), Positives = 227/452 (50%), Gaps = 31/452 (7%)
 Frame = +1

Query  379   SEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             S+D A+   ++ATHD D   + ++ +L ++ DI+      I G +        +   I E
Sbjct  27    SDDNALRKQIQATHDYDGRLFDLESILIIVNDILNLVSPGIDGILNG----SGKHAVIRE  82

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
             E    +G +   +  A+   + S E         D H+ ++ +L  L++Y W+AKA I  
Sbjct  83    ETAALTGFDGIHDTLAFLLNKVSCEC--SGGGGGDGHASSIEILNSLSSYTWEAKAAIAL  140

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             A+F+  Y +F L+A  + TDPLAKSVA + Q+PD++    S   + S+   +  L   +L
Sbjct  141   ASFSVNYAQFWLVANRFTTDPLAKSVALLKQLPDIIN--LSDHVIKSRFDTINNLVKDLL  198

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
             E+T  I                 R+   K ++E + P+     +    A Y++V+  V C
Sbjct  199   ELTTCIAKFS-------------RLMPSKYISEDVEPMAVAIAH-FPVAVYWIVRILVAC  244

Query  1099  SLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKI  1278
             +  +  ++ + R  +SST E  E+S+L HK+S I   L+  +    Q I + K+T   + 
Sbjct  245   ASQVTEIIGLNRQVFSSTAETWELSSLGHKVSKIHDHLKTQLGLCYQYIDEKKNTDYFQT  304

Query  1279  LEETLART-HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             L      T H DN+     +I  ++D  P++ GA   +K  G++ L+ K V LLVSDLDI
Sbjct  305   LVRLFETTPHFDNQRILGQLIYLKDDLQPLVIGANKNIKV-GVEALKGKTVLLLVSDLDI  363

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
               + + +L H+Y ESK   +R +  +EIVW+P+V+R        E +F  ++  MPW+++
Sbjct  364   SQDELRILSHIYQESK---TRPDFHYEIVWVPVVERTIKRNEEHELKFEQLQGKMPWYTL  420

Query  1636  SHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              H S ++ AV  Y+       +KP+L  +D Q
Sbjct  421   HHHSLLEPAVVRYIKEFWQFTKKPILVSLDPQ  452



>gb|KDO82146.1| hypothetical protein CISIN_1g005245mg [Citrus sinensis]
Length=527

 Score =   147 bits (371),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 91/213 (43%), Positives = 128/213 (60%), Gaps = 7/213 (3%)
 Frame = +1

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C+  IL L+ +G +Y  ST E  E+S+L HK++ I   L + ++   Q I + +     +
Sbjct  61    CAGQILGLIGMGHEYIISTTETWELSSLAHKINSIYNHLLQQLKLCHQLIEEKRQIESYQ  120

Query  1276  ILEETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD  1452
              L   +   H DN K    L+I  ++D  P++       +K  +D+LRRK V LLVSDLD
Sbjct  121   ALVRLMETIHIDNMKVLNRLLIHTKDDQLPLVECPT--KRKVSIDVLRRKSVLLLVSDLD  178

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
             + NE + +L  MY ES+Q  SR ESQ+E+VWLPIVDR +PWT AKE +F  ++  MPWFS
Sbjct  179   VSNEELFLLEQMYRESRQLSSRTESQYEVVWLPIVDRSTPWTEAKEHKFEALQYMMPWFS  238

Query  1633  VSHPSKIDEAVYGY----LN*RRKPLLAVVDTQ  1719
             V HPS ID AV  Y     + R+KP+L V+D Q
Sbjct  239   VHHPSAIDPAVIRYAKEKWDFRKKPILVVLDPQ  271



>ref|XP_008350940.1| PREDICTED: uncharacterized protein LOC103414321 [Malus domestica]
Length=744

 Score =   147 bits (372),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 147/510 (29%), Positives = 235/510 (46%), Gaps = 77/510 (15%)
 Frame = +1

Query  313   PLQAKIIPAGR-GIRKRGDFL-----------ASSEDTAMMDHVRAT-----HDVDAVHY  441
             PL   + P  R G R R   L            +++D A+++ +  T     H  +    
Sbjct  5     PLNKGVNPTSRDGGRNRAPLLQDGRDGHRQYSTTADDNALINQIMLTDKSHDHPYEVPSL  64

Query  442   KVKPLLHLIEDIMPRA-------HATIPGYVQSVQTQPARL--DAILEEKVVHSGLNEAI  594
              V  +L  IE I+ R           +PG +      PA +  D++  EK +H+ L+   
Sbjct  65    AVTQILQTIEAILSRFTKPDIHDGTLVPGALV-----PAAIHADSLEHEKALHANLSTLH  119

Query  595   EAFAYPAYRTSF-----EIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQY  759
             ++F  P   T F     E++       DA+   + +L ++ +Y WD K V+   AFA + 
Sbjct  120   DSFDVP--NTVFNAIQCELMSKSLQREDANKTAMDILDIVQHYDWDEKVVLALGAFAIKD  177

Query  760   GEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKII  939
             GEF LLA+ Y T+PLAK+V  + Q+ ++LE + +S     K      L   + +VT  I+
Sbjct  178   GEFWLLAQQYTTNPLAKAVGQLKQLHEILERAGTSLKP--KFDAYNNLVRVIFKVTRTIV  235

Query  940   ALKEIGSEEKSLKVKYRVSLYKELAESLSP---VTAEQENIMakasyyvvkaavTCSLVI  1110
              L+EI ++                   LSP    TA   +I     + +    V  S   
Sbjct  236   HLQEIHNDPH-----------------LSPEVKATAATAHIPTAVYWTIRAIIVAAS---  275

Query  1111  LNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEET  1290
               LL +         E  E+S+L HKL  I   L++ + +  Q I K K       +   
Sbjct  276   -QLLGITGSEPEYVTEAWELSSLAHKLENIFNHLEEILDRLHQLIQKNKDEDAFNAIARI  334

Query  1291  LARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVI  1470
             L   H DN  S  L +    D  P ++      K+  +D+L+RK V L ++DLD+ +E  
Sbjct  335   LETPHIDN--SKPLKVLFYKDDQPALYDC-YNKKRVDIDVLKRKVVILFITDLDVIHENE  391

Query  1471  TML-RHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPS  1647
              M+ + MYLE + +P+R ESQ+E+VWLPI D    WT AK  QF ++++++ W++V HPS
Sbjct  392   YMIVQQMYLEKQHNPTRPESQYEVVWLPITD---VWTDAKYQQFEMLRNNIEWYTVFHPS  448

Query  1648  KIDEAVYGYL------N*RRKPLLAVVDTQ  1719
              +   +  Y+      N  +KPLL V+D Q
Sbjct  449   VVSPIMVRYIRDPRKWNFAKKPLLVVMDPQ  478



>ref|XP_006440672.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53912.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=693

 Score =   146 bits (368),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 144/459 (31%), Positives = 229/459 (50%), Gaps = 45/459 (10%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV-QTQPARLDA  549
             AS +   MM  V A H  D     V+P+L +IEDI  RA AT P  +  V       +DA
Sbjct  12    ASDDSAKMMKQVLANHAPDGHEVDVRPILSIIEDIFRRATAT-PSKIDGVPNATHEHMDA  70

Query  550   ILEEK--VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAK  723
             + + K  V  SG  E +    +   +   EI    S   DA + T+++   L++Y WD K
Sbjct  71    LHDNKSLVAFSGTPEPLSDIIH---KICCEISCKCSGGGDALATTMALFNTLSSYSWDTK  127

Query  724   AVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKL  903
              V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E       +  +L E+  L
Sbjct  128   MVLSLAAFAVNYGEFCLVAQLCTENSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNL  184

Query  904   ADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvk  1083
                ML++T+ I+  K++ S+  S              +++S   A  +     A+Y+  +
Sbjct  185   IGAMLDLTNCIVEFKQLPSQYIS-----------NDGQAMSMDQAHYQ-----AAYWTFR  228

Query  1084  aavTCSLVILNLLAVGRDYYssteeeleistltHKLS--YILGDLQKAVQKSTQEIGKIK  1257
             + V C+  IL+L  +  +Y +ST +ELE+STL HK+S  ++  +L+K +    Q+I KI+
Sbjct  229   SIVACNSRILSLRGLRHEYTASTTDELELSTLAHKVSNIHVYENLKKQIDFWRQQIDKIR  288

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
                +   L   L + + DN      +I  E+    ++ G      +  +D+L++K+V LL
Sbjct  289   QIEEYNNLVRLLQKNNQDNIKVLRALIYAED----LVDGETRTTVQ--IDVLKKKHVLLL  342

Query  1438  VSDLD-IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
             +S LD +  E I +LR MY + K     A  +  IVWLPIVDR   W      +F  ++ 
Sbjct  343   ISSLDNLSQEEILVLRKMYKDLK-----ASKECRIVWLPIVDRSIDWQQTLY-KFESLQK  396

Query  1615  SMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
              MPW+++  P+ I  AV  Y+       +K +L  VD Q
Sbjct  397   RMPWYTIQDPATIQPAVIKYIKEEWKYSKKAILVSVDPQ  435



>ref|XP_008340127.1| PREDICTED: uncharacterized protein LOC103403084 [Malus domestica]
Length=743

 Score =   145 bits (367),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 143/506 (28%), Positives = 233/506 (46%), Gaps = 66/506 (13%)
 Frame = +1

Query  283   ATAPPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPL--  456
             A  P S+     +  ++  GR   ++  F  +++D+A+++ +  T       Y+V PL  
Sbjct  9     AVNPTSRGAGHNRPPLLKQGRDGHRQ--FSTTADDSALVNQIMLTDKSHDHPYEVPPLAV  66

Query  457   ---LHLIEDIMPRA-----HATI--PGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFA  606
                L  IE I+ R      H  I  PG +    T          EK +H+ L+   ++  
Sbjct  67    TQILQTIEAILSRVTKPDIHDGILVPGALAPAATHAEH------EKALHANLSTLHDSVD  120

Query  607   YPAYRTSFEIIGG-----YSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFG  771
              P   + F  I       ++   DA+  T+ +L ++ +Y WD KAV+   AFA + GEF 
Sbjct  121   VP--HSVFNAIHSALMCTFAQGEDANKTTMDILDIVQHYDWDEKAVLALGAFAIKDGEFW  178

Query  772   LLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKE  951
             L+++ Y T+PLA++V  + Q+ ++LE + +      K      L   + +VT  I+ L+E
Sbjct  179   LVSQQYTTNPLARAVGQLKQLQEILERAGTILKP--KFDAYNNLVGAIFKVTKTIVRLQE  236

Query  952   IGSEEKSLKVKYRVSLYKELAESLSP---VTAEQENIMakasyyvvkaavTCSLVILNLL  1122
             I ++                   LSP    TA    I     + +    V  S     L+
Sbjct  237   IHNDPH-----------------LSPEIKATAATAQIPTAVYWTIRAIVVAAS----QLV  275

Query  1123  AVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLART  1302
              +         E  E+S+L HKL  I   L++ +    Q I K K       +   L   
Sbjct  276   GITSSEPEYMTEAWELSSLAHKLENIFKHLEEILDGLYQLIQKNKEEEAFNAIARILETP  335

Query  1303  HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNE-VITML  1479
             H DN  S  L +    D  P ++  G   K+  +D+L+RK V L ++DL++ +E   T++
Sbjct  336   HMDN--SKPLRVLFYKDDQPALYD-GYNKKRVDIDVLKRKVVILFITDLNVVHENENTIV  392

Query  1480  RHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDE  1659
             + MYLE   +P+R ESQ+E+VW+PI D    WT  K  QF  +++SM W++V HPS +  
Sbjct  393   QQMYLEKGHNPTRPESQYEVVWVPITDE---WTEVKYQQFESLRNSMQWYTVFHPSVVSP  449

Query  1660  AVYGYL------N*RRKPLLAVVDTQ  1719
              V  Y+      N  +KPLL V+D Q
Sbjct  450   IVVRYIRDPRKWNFAKKPLLVVMDPQ  475



>ref|XP_010102927.1| hypothetical protein L484_018946 [Morus notabilis]
 gb|EXB94445.1| hypothetical protein L484_018946 [Morus notabilis]
Length=712

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 146/484 (30%), Positives = 243/484 (50%), Gaps = 47/484 (10%)
 Frame = +1

Query  301   QVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHY--KVKPLLHLIED  474
             Q + P  AK  P  R   +       S+D  ++  +R TH+ ++ HY   V+P+LH+IED
Sbjct  7     QALVPHPAKRDPMQRRFNQ-------SDDNMLVKQIRETHNAES-HYLVDVRPVLHVIED  58

Query  475   IMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSS  654
             I+ RA   I G +          DA+L++K V +  ++ ++      ++ S E+    S 
Sbjct  59    ILRRAAPGIDGIINGTH------DALLDDKAVVATFDDMLDGLCQIIHKISCEMFCKCSG  112

Query  655   NRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQI  834
               D H  TL++ K+L+NY W+AK V+T A F+  YGEF L+A+L  T PLAK+VA + Q+
Sbjct  113   G-DLHGSTLALFKMLSNYPWEAKVVLTLAGFSTTYGEFWLVAQLCTTTPLAKAVAHLKQV  171

Query  835   PDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELA  1014
              D+LE   +S+A+  +L  + KL + ++ VT +II   E+ +               E  
Sbjct  172   SDILE---NSQALKPQLEAINKLLNAVVNVTKRIIEFNELPT---------------EYL  213

Query  1015  ESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS  1194
                SP  A     +  A+Y+ +++ V C+  + +   +  ++ SST E  E+S+  HKL 
Sbjct  214   PHDSPQVAVVRAHIPSAAYWTIRSVVACAWQVASFTDIRYEHMSSTSEIWELSSSAHKLK  273

Query  1195  YILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHG  1374
              I   L   +    + I + ++  + + L   L   H DN    + +I   +D  P++ G
Sbjct  274   NIHDLLAAELDGCRKFIEERRYEEEYRNLIRLLEIAHLDNMKVLKALISTRDD-QPLVFG  332

Query  1375  AGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMY-----LESKQDPSRAESQFEI  1539
                   +  +D LRRK+V LL+SDLD+ +E I +L   Y      +   D     + +E+
Sbjct  333   N--PKARVSIDGLRRKHVLLLISDLDLSHEEIAILYSTYDMRLKHDGMYDVHVKGASYEL  390

Query  1540  VWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAV  1707
             VW+PIVDR   W    + +F+ + + MPW SV  P  I+  V  Y+    N  +K +L  
Sbjct  391   VWIPIVDRIVSWDEGHQKKFSDLLTLMPWHSVHSPQIIEPPVVKYIREKWNFDKKLILVS  450

Query  1708  VDTQ  1719
             +D Q
Sbjct  451   LDPQ  454



>gb|KHN05808.1| hypothetical protein glysoja_038722 [Glycine soja]
Length=673

 Score =   140 bits (353),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 138/447 (31%), Positives = 229/447 (51%), Gaps = 36/447 (8%)
 Frame = +1

Query  394   MMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQTQPARLDAILEEKVV  570
             M   V ATH  D     VKP+L ++++I+ R  A T+ G+          + A L E   
Sbjct  1     MTKQVEATHAPDGREIDVKPILQIVDEILVRFIARTVEGHEVKRDQDALEMTAALAE---  57

Query  571   HSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFA  750
                  + +++ AY   + S E+    S   DAHS T+ +L  +++Y W AK V+T AAFA
Sbjct  58    ----FDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLNYMSSYAWHAKVVLTLAAFA  113

Query  751   QQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTH  930
               +GEF L+A+L   + LAKSVA + Q+PD+ E+  S +     L  + K A   ++VT 
Sbjct  114   VIFGEFWLVAQLSAENTLAKSVALLKQLPDIAENFMSLKPHFEALIRLVKAA---MDVTM  170

Query  931   KIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVI  1110
              I+  KE+ SE               ++E   P++    +I   ASY+V+++ V CS  I
Sbjct  171   CIVEFKELPSE--------------YISEDTPPMSVASTHI-PIASYWVIRSIVACSSQI  215

Query  1111  LNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEET  1290
              +L+ +  +  SST E  E+S+L HK+S I   L+  +    Q I   +H      L   
Sbjct  216   ASLVGMRNESISSTTEAWELSSLAHKVSSIYEHLKNQLVLCYQYIDDKRHIEAFHNLIRL  275

Query  1291  LARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVI  1470
                 H DN      +I  ++D  P++ G      +  L++LRRK+V LL+SDLD+  E I
Sbjct  276   FETVHVDNMKILRALIYAKDDVLPLVDGT--TKSRVSLEVLRRKHVLLLISDLDLSQEEI  333

Query  1471  TMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSK  1650
              +L ++Y +++   +R ++ +E+VW+P+VD ++ W    + +F  ++S M W+SV  P  
Sbjct  334   LVLDNLYKDAR---ARGDTHYEMVWIPVVD-KATWNETSKQKFEYLQSLMAWYSVYDPFI  389

Query  1651  IDEAVYGYL----N*RRKPLLAVVDTQ  1719
             I+ +   Y+    N  +  +L  +D Q
Sbjct  390   IEPSAIKYIKEVWNFSKTAILVALDPQ  416



>gb|KHN13158.1| hypothetical protein glysoja_040438 [Glycine soja]
Length=669

 Score =   139 bits (350),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 126/455 (28%), Positives = 210/455 (46%), Gaps = 66/455 (15%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  +++ + +TH      + V  L  L+E+ + R+   +   VQ        +D      
Sbjct  29    DEQILEQIYSTHVHSDTKFDVDSLFTLVENTLRRSTHIVDNLVQGSHASLEHID------  82

Query  565   VVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
                    + I  F  P     + SFE+     S    H  TL++L  L+NY WDAKAV+T
Sbjct  83    -------DKIPQFNSPLCTLKQISFEMSCKPPSEEIGHRTTLAILNKLSNYEWDAKAVLT  135

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA +Y EF LLA+  PTDPLAKSVA + ++P +L    + +     + EV  L    
Sbjct  136   LAAFALEYSEFWLLAQYQPTDPLAKSVAILKRVP-VLAKPAALQKHRQAILEVNNLVKAT  194

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             L+V   I  L+++ +        Y       L  ++  +  +                  
Sbjct  195   LQVIEVIFELEKLTT--------YDTKDVPALGLAIEQIPVD------------------  228

Query  1096  CSLVILNLLAVGRDYYssteeeleistltH---KLSYILGDLQKAVQKSTQEIGKIKHTI  1266
                 I+ ++AV       T +      L+H   K++ IL  L+K +    Q+I + ++  
Sbjct  229   VYWAIITIVAVVTQIDCLTTDSEHKQELSHYGQKINIILSKLRKQITLCRQQIDEAEYY-  287

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
              RK+    L +T T+     +++I  ++ P P+  GA     K  + +L++K V+L +S 
Sbjct  288   -RKL--RKLFQTPTEIMEVFKVLIFNKDAPQPLFDGAT--KTKVDITVLKKKNVYLFISS  342

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDI  E I++LR +Y     D  +   Q++IVW+PIV+    WT     +F ++KS MPW
Sbjct  343   LDITEEEISVLRPVY-----DSIKTNDQYKIVWIPIVEE---WTEQLHKKFEVLKSKMPW  394

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             + V H   I  A Y Y+    + ++KP++ V+  Q
Sbjct  395   YVVQHSGTI--AGYKYIKEEWHFKKKPMVVVLSPQ  427



>ref|NP_001241224.1| uncharacterized protein LOC100794293 [Glycine max]
 gb|ADN32801.1| sieve element occlusion s [Glycine max]
Length=669

 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 126/456 (28%), Positives = 209/456 (46%), Gaps = 68/456 (15%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  +++ + +TH      + V  L  L+E+ + R+   +   VQ        +D      
Sbjct  29    DEQILEQIYSTHVHSDTKFDVDSLFTLVENTLRRSTHIVDNLVQGSHASLEHID------  82

Query  565   VVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
                    + I  F  P     + SFE+     S    H  TL++L  L+NY WDAKAV+T
Sbjct  83    -------DKIPQFNSPLCTLKQISFEMSCKPPSEEIGHRTTLAILNKLSNYEWDAKAVLT  135

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA +Y EF LLA+  PTDPLAKSVA + ++P +L    + +     + EV  L    
Sbjct  136   LAAFALEYSEFWLLAQYQPTDPLAKSVAILKRVP-VLAKPAALQKHRQAILEVNNLVKAT  194

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             L+V   I  L+++ +        Y       L  ++  +  +                  
Sbjct  195   LQVIEVIFELEKLTT--------YDTKDVPALGLAIEQIPVD------------------  228

Query  1096  CSLVILNLLAVGRDYYssteeeleistltH---KLSYILGDLQKAVQKSTQEIGKIKHTI  1266
                 I+ ++AV       T +      L+H   K++ IL  L+K +    Q+I + ++  
Sbjct  229   VYWAIITIVAVVTQIDCLTTDSEHKQELSHYGQKINIILSKLRKQITLCRQQIDEAQYYR  288

Query  1267  K-RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
             K RK  +     T T+     +++I  ++ P P+  GA     K  + +L++K V+L +S
Sbjct  289   KLRKFFQ-----TPTEIMEVFKVLIFNKDAPQPLFDGAT--KTKVDITVLKKKNVYLFIS  341

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
              LDI  E I++LR +Y     D  +   Q++IVW+PIV+    WT     +F ++KS MP
Sbjct  342   SLDITEEEISVLRPVY-----DSIKTNDQYKIVWIPIVEE---WTEQLHKKFEVLKSKMP  393

Query  1624  WFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             W+ V H   I  A Y Y+    + ++KP++ V+  Q
Sbjct  394   WYVVQHSGTI--AGYKYIKEEWHFKKKPMVVVLSPQ  427



>ref|XP_010674858.1| PREDICTED: uncharacterized protein LOC104890938 [Beta vulgaris 
subsp. vulgaris]
Length=690

 Score =   137 bits (345),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 127/469 (27%), Positives = 206/469 (44%), Gaps = 65/469 (14%)
 Frame = +1

Query  358   RGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA  537
             RGD L +S+D +    V   H  D     ++PL  L++DI+  A  TI        +Q  
Sbjct  47    RGDILLTSDDHSFARQVEQLHKPDGRCLDIRPLFLLVQDIIANATQTIERTSLGATSQRE  106

Query  538   RLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGY---SSNRDAHSITLSVLKLLANY  708
              ++      V      + I          S EI       S   D+H+ TLSV+ LL ++
Sbjct  107   AMNGKFSLDVF-----QGISEVPLVVESISCEITSKVLLTSGVDDSHNTTLSVVSLLQHF  161

Query  709   WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
              WDAK V++ AAFA  +G+   L ++Y T+ + KS+A                   ++  
Sbjct  162   SWDAKVVLSLAAFALTFGDLWPLVQIYSTNSVVKSMAV------------HEEGFKNQFE  209

Query  889   EVAKLADKMLEVTHKIIALKEIGS-------EEKSLKVKYRVSLYKELAESLSPVTAEQE  1047
                 L   MLE T  ++   E+ +       E K+ +  + +++Y  +  +++  T    
Sbjct  210   TTTILIKAMLETTKCMVEFGELPAISTPEDPELKAARSHFPIAVYWIIRSAVAAATH---  266

Query  1048  NIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQ  1227
                                 I  L + G  Y + T    E+S  + KL  I  D+ + + 
Sbjct  267   --------------------ITTLCSRGFKYGTGTLNSRELSNWSQKLKNISDDI-RDMS  305

Query  1228  KSTQEIGKIKHTIKRKILEETLART-HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGL  1404
             K  Q IG+ K      +++  + +T H DN     ++I   +D  P+  G     +K  L
Sbjct  306   KVYQLIGENKDNDSYNMIKRLIYQTIHIDNMKVLRVLISSNDDVPPLYDGPA--KRKVHL  363

Query  1405  DILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGA  1584
             D LRRK V LL+S LDI    +++L+  Y+ESK +       +EIVW+PIVD    W+  
Sbjct  364   DTLRRKNVLLLISGLDITEAELSVLKQCYMESKVN------SYEIVWIPIVDDSVQWSDV  417

Query  1585  KEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              + +   ++  MPW+SV HPS I + V  +       R KP+L V+D Q
Sbjct  418   MQTELEELQPQMPWYSV-HPSIIRKDVVKFFRVDWQFRGKPILVVLDPQ  465



>ref|XP_004309998.1| PREDICTED: uncharacterized protein LOC101307854 [Fragaria vesca 
subsp. vesca]
Length=596

 Score =   136 bits (342),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 175/356 (49%), Gaps = 37/356 (10%)
 Frame = +1

Query  679   LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             + +L+ + +Y WD K V+  A+FA + GEF L+A+L+ ++PLAK++  + Q+ ++LE S 
Sbjct  1     MDILERVQHYDWDEKVVLALASFAIKDGEFWLVAQLFTSNPLAKAIGQLKQMQEILERSG  60

Query  859   ssravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTA  1038
             +S     K      L + +L+VT  I+ L++I  +               LA  +   T 
Sbjct  61    TSLKA--KFEVYNNLVNAVLKVTRIIVHLQDIYHD-------------PHLATEIKATTP  105

Query  1039  EQENIMakasyyvvkaavTCSLVIL--NLLAVGRDYYssteeeleistltHKLSYILGDL  1212
                                 S+VIL   LL +         E  E+S+L HKL  I   L
Sbjct  106   TNH-------IPSAVYWTIRSIVILASQLLGITGSDPEYVTEAWELSSLAHKLESIYKHL  158

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMK  1392
             +  + +  +   K +       +E  L   H DN     ++   ++ P       G   K
Sbjct  159   EDNLNRLHELTRKYRDEEAFAAIERILESPHIDNSKPLRVLFYKDDQPALF---DGYNKK  215

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRH-MYLESKQDPSRAESQFEIVWLPIVDRRS  1569
             +  +D+LRRK V L++SDLDI  E   ++ H MY E +Q P+RAESQ+EIVW+PIVD   
Sbjct  216   RVDIDVLRRKVVILMISDLDIGQENEYIIAHQMYSEKRQFPTRAESQYEIVWVPIVDN--  273

Query  1570  PWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*RR------KPLLAVVDTQ  1719
              WT AK  QF  +++ M W+SV HPS +   V  Y+  +R      KPLL V+D Q
Sbjct  274   -WTEAKLLQFEEIRNGMEWYSVYHPSFVSPIVVKYIKDKRKWNFVKKPLLVVMDPQ  328



>gb|KDO54551.1| hypothetical protein CISIN_1g015053mg [Citrus sinensis]
Length=414

 Score =   132 bits (331),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 197/410 (48%), Gaps = 46/410 (11%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV-QTQPARLDA  549
             AS +   MM  V A H  D     V+P+L +IEDI  RA AT P  +  V       +DA
Sbjct  12    ASDDSAKMMKQVLANHAPDGHEVDVRPILSIIEDIFRRATAT-PSNIDGVPNGTQEHMDA  70

Query  550   ILEEK--VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAK  723
             + + K     SG  E +    +   +   EI    S   DA + T+++   L++Y WD K
Sbjct  71    LHDNKSPAAFSGTPEPLSDIIH---KICCEISCKCSGGGDALATTMALFNTLSSYSWDTK  127

Query  724   AVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKL  903
              V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E       +  +L E+  L
Sbjct  128   MVLSLAAFAVNYGEFWLVAQLCTENSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNL  184

Query  904   ADKMLEVTHKIIALKEIGSE---EKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
                ML++T+ I+  K++ S+        +    + Y+    +   + A            
Sbjct  185   IGAMLDLTNCIVEFKQLPSQYISNDGQAMSMDQAHYQAAYWTFRSIVA------------  232

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--YILGDLQKAVQKSTQEIG  1248
                    C+  IL+L  +  +Y +ST +ELE+STL HK+S  ++  +L+K +    Q+I 
Sbjct  233   -------CNSRILSLRGLRHEYTASTTDELELSTLAHKVSNIHVYENLKKQIDFWRQQID  285

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             KI+   +   L   L + + DN      +I  E+    ++ G      +  +D+L++K+V
Sbjct  286   KIRQIEEYNNLVRLLQKNNQDNIKVLRALIYAED----LVDGETRTTVQ--IDVLKKKHV  339

Query  1429  FLLVSDLD-IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPW  1575
              LL+S LD +  E I +LR MY + K     A  +  IVWLPIVDR   W
Sbjct  340   LLLISSLDNLSQEEILVLRKMYKDLK-----ASKECRIVWLPIVDRSIDW  384



>gb|KHN01070.1| hypothetical protein glysoja_000738 [Glycine soja]
Length=631

 Score =   132 bits (332),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 121/455 (27%), Positives = 205/455 (45%), Gaps = 76/455 (17%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  +++ + + H      + V  L  L+E+ + R+   +  +VQ         D      
Sbjct  3     DDQILEEIYSNHVGSDTKFDVDSLFTLVENTLRRSTHIVDNFVQGSHASLEHTD------  56

Query  565   VVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
                    + I  F  P     + SFE+     S+  AH  TL++L  L NY W+AKAV+T
Sbjct  57    -------DKIPQFDSPLCTLKQISFEMSCKPPSDVIAHKTTLAILNNLKNYEWNAKAVLT  109

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA +Y EF LLA+   +DPLAKSVA + ++P +L    + +     + EV  L    
Sbjct  110   LAAFALEYSEFWLLAQYQQSDPLAKSVAILKRVP-VLTRQAALQKYRQAIVEVNDLVKAT  168

Query  916   LEVTHKIIALKE---IGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
             L++  ++  L     +  E+ S+ V + +     L   +  +T E E             
Sbjct  169   LQIIFELEKLTNDLGVAIEQISVDVYWAIITIVSLTTRIDCLTTESEQ------------  216

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
                                     + E+S    K++ IL  L+K +    Q+I   ++  
Sbjct  217   ------------------------KQELSHYGQKINIILSKLKKQITLCRQQIDAAEYYR  252

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
             K +     L +T T+     +++I  ++ P P+  GA   M    + +L+RK+V+LL+S 
Sbjct  253   KLR----KLFQTPTEIMEVFKILIFNKDVPQPLYCGATKTMV--DITVLKRKHVYLLISS  306

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LDI  E I++ + +Y     D  +   Q+EIVW+PIV+    WT   +++F   K  MPW
Sbjct  307   LDITEEEISVFQTVY-----DSIKTSDQYEIVWIPIVEE---WTVEYDNKFEDFKCKMPW  358

Query  1627  FSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             ++V H   I  A Y Y+    + + KP++ V+  Q
Sbjct  359   YAVQHSGPI--AGYQYIKEEWHYKSKPMVVVLSPQ  391



>ref|XP_006476925.1| PREDICTED: uncharacterized protein LOC102608617 isoform X3 [Citrus 
sinensis]
Length=613

 Score =   132 bits (331),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 119/372 (32%), Positives = 192/372 (52%), Gaps = 32/372 (9%)
 Frame = +1

Query  619   RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTD  798
             + S EI    S   +AH+ T+ +  +L+ Y WDAK V++ AAFA  YG+F L A+L   +
Sbjct  11    KISCEISCKCSGGEEAHATTMDLFNILSVYSWDAKMVLSLAAFALNYGQFWLGAQLCNKN  70

Query  799   PLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLK  978
              LAKS+A + Q+P++LE   + +     L EV      ML++T  I+  K++ S+  S  
Sbjct  71    SLAKSMAVLKQLPNVLEHFNALKPQLDALIEV------MLDLTKCIVEFKQLPSQYISTD  124

Query  979   VKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsstee  1158
                        A+++S   A     +  A+Y+  ++ V C    L+L  +   Y +ST E
Sbjct  125   -----------AQAVSIAMAH----IPAAAYWTFRSIVACYSQTLSLTGLRDAYTASTTE  169

Query  1159  eleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELII  1338
               E+S+L HK+S +L   +K +    Q+I + +       L   L   H DN      +I
Sbjct  170   AWELSSLAHKVSSMLEHFKKLIAICYQQIDENRQIEAYHNLVRLLETIHLDNMKVLRALI  229

Query  1339  CGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSR  1518
               ++D  P++ G      +  +D+LR+K+V LL+S LD+  E I +L  MY    +DP  
Sbjct  230   YAKDDIQPLVDG--FTKNRVNIDVLRKKHVLLLISSLDLSAEEILVLDQMY----RDPKA  283

Query  1519  AES-QFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*  1683
             +E   + IVWLPIVDR   W    + +F  +++ MPW++V HP+ I+ AV  Y+      
Sbjct  284   SEEYHYAIVWLPIVDRSIAWDDGYQQKFEQLQAMMPWYTVQHPTIIEPAVVKYIKEVWKF  343

Query  1684  RRKPLLAVVDTQ  1719
              +K +L  VD Q
Sbjct  344   SKKAILVPVDPQ  355



>ref|XP_002526962.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35449.1| conserved hypothetical protein [Ricinus communis]
Length=1068

 Score =   133 bits (334),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 137/457 (30%), Positives = 239/457 (52%), Gaps = 60/457 (13%)
 Frame = +1

Query  382   EDTAMMDHVRATHDVDAVH-YKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
             +D ++M+ ++     + +  + VKPL HL+EDI+ RA       +Q+V +      A +E
Sbjct  22    DDNSIMEDLKVEGTPEDLQPFDVKPLFHLVEDIVNRA-------IQNVNSSVMDTRAYME  74

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVL-KLLANYWWDAKAVIT  735
             +K     +          AY TS        S  D H+  LS++ K+L+ + W AK ++T
Sbjct  75    DKTHKEEI----------AYNTS--------SGEDEHATLLSIINKILSGHSWVAKLILT  116

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
               AFA  YGE   LA +Y +D LAKS+A + Q+ D+    + S   +  L  V  L   M
Sbjct  117   LTAFALNYGECWRLALIYSSDQLAKSMAILKQVADI---HKLSGLSAPPLEAVNDLVKAM  173

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             ++VT  II  +++G++   L   ++V+ Y      + P+T           Y+V+++ + 
Sbjct  174   MDVTRCIIEFQDLGAQ---LDKAHQVTAYSAGLAQI-PLT----------IYWVIRSVLA  219

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI--KHTIK  1269
              +  I +L ++G +Y  S+ E+ E+  LT KL+    + +K ++K       I  K T+K
Sbjct  220   SASQITSLTSLGFNYVISSTEKEELIFLTEKLN----NKKKEIKKQQNLCLPILEKATMK  275

Query  1270  RK--ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
             ++  I++  L     DN      II  ++D  P++ G+    KK  +D+LR+K V LL+S
Sbjct  276   KRLGIIKSLLELPQVDNMNILRAIIYYKDDQQPLVDGSN---KKVDVDVLRKKLVLLLIS  332

Query  1444  DLDIPNEVITMLRHMYLESKQ-DPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSM  1620
             DLDIP + + +++ +Y +S+  +  + E QFEIVWLPIVD  S  +   + +F   ++SM
Sbjct  333   DLDIPEDDVNVVKQIYHKSRNIEQIKGEDQFEIVWLPIVDPSSSNSETAKRKFEEKRNSM  392

Query  1621  PWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             PW++V+ PS I + V   +       ++P++ V+D Q
Sbjct  393   PWYTVNQPSLIAQEVIKLVKEEWHFDKQPIIVVIDAQ  429


 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 93/179 (52%), Gaps = 14/179 (8%)
 Frame = +1

Query  1210  LQKAVQKSTQEIGKIKHTIK-RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLE  1386
             LQ ++     +I  IKH     K++ +       D     + +I G+N   P++ GA   
Sbjct  637   LQDSLIMHQGQIDVIKHIESFEKLVSQFKTTQQIDCMRVLKALISGKNHSQPLVDGAT--  694

Query  1387  MKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRR  1566
              K+  +D+LRRK + LLVSDL+I    I +  +  +  +Q   + ES + IVWLPIVD  
Sbjct  695   KKRVNIDLLRRKELLLLVSDLNIEEMDIVVKIYNGIHQQQQKQKPESSYAIVWLPIVDPA  754

Query  1567  SPWTGAKE-DQFTLVKSSMPWFSVSHPSKIDEA-------VYGYLN*RRKPLLAVVDTQ  1719
                T  +   QF  +++ MPW+SV HPS ID+A       V+G+    +K +L ++D Q
Sbjct  755   IMRTSERALKQFENLQAQMPWYSVHHPSMIDQAAMKFIIEVWGF---DQKTILVMLDQQ  810



>gb|KHG22560.1| hypothetical protein F383_04018 [Gossypium arboreum]
Length=592

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 131/454 (29%), Positives = 225/454 (50%), Gaps = 59/454 (13%)
 Frame = +1

Query  391   AMMDHVRATHDVDAVHYKVKPLL----HLIEDIMPRAHATIPGYVQSVQTQPARLDAILE  558
              M + +R+TH  D     V  +L    +++  I+P  + ++ G++ +   Q    DA   
Sbjct  11    GMNERIRSTHVPDGRVVDVTSVLQVTRNVLRHIIPNINLSMNGHIDASDDQTNLSDA---  67

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
                     + A++A     +    E+    S   DAH+ T+++   L++Y W AK V+T 
Sbjct  68    --------DGALDAL----HEICCELSCKCSRGGDAHATTMAIFNKLSSYSWGAKVVLTL  115

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             AAFA  +GEF L+A+L  ++ LAKSVA + Q PD+LE S++ +     L   +KL + M+
Sbjct  116   AAFAVNFGEFWLIAQLCTSNSLAKSVALLKQ-PDILEHSQTLKTHFDAL---SKLINAMV  171

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
             +VT  I+ L E+ S       KY       L+ +++ + A    I+         + V C
Sbjct  172   DVTKCIVELTELPS-------KYISIDEPPLSTAMAHIHAATYWII--------SSVVVC  216

Query  1099  SLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKI  1278
                I  L+ +  ++ +ST +  E+S+LTHK+S I   +Q  +    Q I + K     + 
Sbjct  217   VGQITGLIGMRHEFITSTSDAWELSSLTHKVSSIHEHVQSRLCLCYQRIDEKKLMEAFEH  276

Query  1279  LEETLARTHTDNKYSAELIIC-GENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
              + T+     DN    + I    EN   P       E  +  +++LR+K+V LL+SDLDI
Sbjct  277   FKRTIETPQVDNLMILQNIFGREENVLNP-------ERAQVYINVLRKKHVLLLISDLDI  329

Query  1456  PNEVITMLRHMYLESKQDPSRAESQ--FEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWF  1629
               E I +L  +Y E      R  S+  +EI+WLPIVD R+ W    ++ F+ ++S+M W+
Sbjct  330   SQEEIRVLEVVYKE------RVSSRLNYEIIWLPIVD-RTTWNDGYKENFSTMQSNMSWY  382

Query  1630  SVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             +V +   I+ AV  Y+       +KP++  ++ Q
Sbjct  383   TVRNHVAIEPAVVKYIREEWGFVKKPIVVTLNPQ  416



>ref|XP_006477599.1| PREDICTED: uncharacterized protein LOC102631158 [Citrus sinensis]
Length=693

 Score =   129 bits (324),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 139/462 (30%), Positives = 220/462 (48%), Gaps = 51/462 (11%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV-QTQPARLDA  549
             AS +   MM  V A H  D     V+P+L +IEDI  RA AT P  +  V       +DA
Sbjct  12    ASDDSAKMMKQVLANHAPDGHEVDVRPILSIIEDIFRRATAT-PSNIDGVPNGTQEHMDA  70

Query  550   ILEEK--VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAK  723
             + + K     SG  E +    +   +   EI    S   DA + T+++   L++Y WD K
Sbjct  71    LHDNKSPAAFSGTPEPLSDIIH---KICCEISCKCSGGGDALATTMALFNTLSSYSWDTK  127

Query  724   AVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKL  903
              V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E       +  +L E+  L
Sbjct  128   MVLSLAAFAVNYGEFWLVAQLCTENSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNL  184

Query  904   ADKMLEVTHKIIALKEIGSE---EKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
                ML++T+ I+  K++ S+        +    + Y+    +   + A            
Sbjct  185   IGAMLDLTNCIVEFKQLPSQYISNDGQAMSMDQAHYQAAYWTFRSIVA------------  232

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--YILGDLQKAVQKSTQEIG  1248
                    C+  IL+L  +  +Y +ST +ELE+STL HK+S  ++  +L+K +    Q+I 
Sbjct  233   -------CNSRILSLRGLRHEYTASTTDELELSTLAHKVSNIHVYENLKKQIDFWRQQID  285

Query  1249  KIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYV  1428
             KI+   +   L   L + + DN      +I  E+    ++ G      +  +D+L++K+V
Sbjct  286   KIRQIEEYNNLVRLLEKNNQDNIKVLRALIYAED----LVDGETRTTVQ--IDVLKKKHV  339

Query  1429  FLLVSDLDIP-NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTL  1605
              LL+S LD    E I +LR MY + K     A  +  IVWLPIVDR   W      +F  
Sbjct  340   LLLISSLDDLSQEEILVLRKMYKDLK-----ASKECRIVWLPIVDRSIDWQQTLY-KFES  393

Query  1606  VKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             ++  MPW+++  P+ I  AV  Y+       +K +L  VD Q
Sbjct  394   LQKRMPWYTIQDPAMIQPAVIKYIKEEWKYSKKAILVSVDPQ  435



>ref|XP_006446667.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
 gb|ESR59907.1| hypothetical protein CICLE_v10015478mg [Citrus clementina]
Length=403

 Score =   121 bits (304),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 103/181 (57%), Gaps = 6/181 (3%)
 Frame = +1

Query  1183  HKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTP  1362
             HKL  +   L   ++   + I   K+      L+     +H DN      +I  ++D  P
Sbjct  15    HKLRNMHTHLSSLLENCHKYIHDKKYLEALHNLKTLFEMSHIDNMRILRALIYPKDDLLP  74

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIV  1542
             ++ GA     +  L++LRRK V LL+SDLDI  E + +L  +Y E++Q  +R ESQ+E+V
Sbjct  75    LVDGA--TKTRVNLEVLRRKMVLLLISDLDISQEEVIILEQLYSEARQHQTRHESQYEVV  132

Query  1543  WLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVV  1710
             WLPIVD   PWT  K+ QF  ++S+MPW++V HPS ID AV  ++       +KP+L V+
Sbjct  133   WLPIVDPNMPWTDNKQKQFQSLQSAMPWYTVYHPSLIDRAVIQFIKEEWQFGKKPILVVL  192

Query  1711  D  1713
             D
Sbjct  193   D  193



>gb|KDO40196.1| hypothetical protein CISIN_1g046837mg [Citrus sinensis]
Length=658

 Score =   124 bits (311),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 144/486 (30%), Positives = 235/486 (48%), Gaps = 86/486 (18%)
 Frame = +1

Query  346   GIRKRGDFLASSEDTAMM------DHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
              +R     +++S+D+A M      +H  A H+VD     V+P+L +IEDI  RA AT   
Sbjct  2     ALRNDLRMISASDDSAKMMKQVLANHAPAGHEVD-----VRPILSIIEDIFRRATAT---  53

Query  508   YVQSVQTQPARLDAILEEKVVHSGL---NEAIEAFAYPA------YRTSFEIIGGYSSNR  660
                     P+ +D +   K  H      N+++ AF+ P       ++   EI        
Sbjct  54    --------PSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEI--SCKGGG  103

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             DA + T+++ K L++Y WDAK V++ AAFA  YGEF L+A+L   + LA SVA + Q+P 
Sbjct  104   DALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLP-  162

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
               E      A+  +  E+  L   ML++T+ I+  K++ S              + ++  
Sbjct  163   --EIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPS--------------RYISND  206

Query  1021  LSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--  1194
                ++ +Q++    A+Y+  ++ V C+  IL+   +   Y  ST  ELE+STLT+K+S  
Sbjct  207   GKAMSMDQDH--YHAAYWTFRSIVACNSRILSFRGL---YTPSTTHELELSTLTYKVSNI  261

Query  1195  YILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDN------KYSAELIICGENDP  1356
             ++  +L K ++   Q+I KI+   +   L   L + + DN         AE ++ GE   
Sbjct  262   HVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRT  321

Query  1357  TPIIHGAGLEMKKHGLDILRRKYVFLLVSD-LDIPNEVITMLRHMYLESKQDPSRAESQF  1533
             T  IH            +L++K+V LL+S   DI  E I  L +MY + K+       + 
Sbjct  322   TVQIH------------VLKKKHVLLLISRPDDISQEEILFLSNMYKDLKE-----SKEC  364

Query  1534  EIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLL  1701
              IVWLPIVD       A  D+F  ++  MPW+S+  P+ I  AV  Y+       +K ++
Sbjct  365   RIVWLPIVDGSIDRQQAL-DKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAII  423

Query  1702  AVVDTQ  1719
               VD Q
Sbjct  424   VSVDPQ  429



>gb|KCW55915.1| hypothetical protein EUGRSUZ_I01713 [Eucalyptus grandis]
Length=275

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 117/211 (55%), Gaps = 9/211 (4%)
 Frame = +1

Query  334  PAGRGIRKRGD--FLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
            PA + + K GD   +  S+D AMM  V  TH  D     VKPLL L+EDI+ RA  T+  
Sbjct  13   PAMQRLIKGGDRSMIMMSDDIAMMKQVTDTHAPDGREVDVKPLLLLVEDILNRA--TLTA  70

Query  508  YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
                    P   +  +E+K   +  N  ++  +Y   R S E+     +  +AH+ TLS+
Sbjct  71   STGPTMGSPYAEN--MEDKGYQASFNAVLDVLSYTIERISCELSAKALTGGEAHATTLSI  128

Query  688  LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
              +LA + WDAK V+T AAFA  YGEF LLA++Y T+ LAKS+A + Q+P ++E    S 
Sbjct  129  CNMLAPFSWDAKLVLTLAAFAFNYGEFWLLAQIYTTNQLAKSMAILKQLPMIME---HSG  185

Query  868  avssKLREVAKLADKMLEVTHKIIALKEIGS  960
            A+ S+   +  L   ML+VT  ++ LK++ S
Sbjct  186  ALKSRFDALNGLIQAMLKVTRCVVDLKDLPS  216



>ref|XP_006440670.1| hypothetical protein CICLE_v10023346mg [Citrus clementina]
 gb|ESR53910.1| hypothetical protein CICLE_v10023346mg [Citrus clementina]
Length=757

 Score =   122 bits (305),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 141/480 (29%), Positives = 236/480 (49%), Gaps = 73/480 (15%)
 Frame = +1

Query  346   GIRKRGDFLASSEDTAMM------DHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
              +R     +++S+D+A M      +H  A H+VD     V+P+L +IEDI  RA AT   
Sbjct  2     ALRNDLRMISASDDSAKMMKQVLANHAPAGHEVD-----VRPILSIIEDIFRRATAT---  53

Query  508   YVQSVQTQPARLDAILEEKVVHSGL---NEAIEAFAYPA------YRTSFEIIGGYSSNR  660
                     P+ +D +   K  H      N+++ AF+ P       ++   EI        
Sbjct  54    --------PSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEI--SCKGGG  103

Query  661   DAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPD  840
             DA + T+++ K L++Y WDAK V++ AAFA  YGEF L+A+L   + LA SVA + Q+P 
Sbjct  104   DALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLP-  162

Query  841   LLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAES  1020
               E      A+  +  E+  L   ML++T+ I+  K++ S              + ++  
Sbjct  163   --EIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPS--------------RYISND  206

Query  1021  LSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--  1194
                ++ +Q++    A+Y+  ++ V C+  IL+   +   Y  ST  ELE+STLT+K+S  
Sbjct  207   GKAMSMDQDH--YHAAYWTFRSIVACNSRILSFRGL---YTPSTTHELELSTLTYKVSNI  261

Query  1195  YILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHG  1374
             ++  +L K ++   Q+I KI+   +   L   L + + DN      +I  E+    ++  
Sbjct  262   HVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAED----LVDD  317

Query  1375  AGLEMKKHGLDILRRKYVFLLVSD-LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
               L  K+  + +L++K+V LL+S   DI  E I  L +MY + K+       +  IVWLP
Sbjct  318   FYL-CKQVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKE-----SKECRIVWLP  371

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             IVD       A  D+F  ++  MPW+S+  P+ I  AV  Y+       +K ++  VD Q
Sbjct  372   IVDGSIDRQQAL-DKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQ  430



>gb|KDO37241.1| hypothetical protein CISIN_1g014387mg [Citrus sinensis]
Length=425

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 6/142 (4%)
 Frame = +1

Query  1300  THTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITML  1479
             +H DN      +I  ++D  P++ GA     +  L++LRRK V LL+SDLDI  E + +L
Sbjct  26    SHIDNMRILRALIYPKDDLLPLVDGA--TKTRVNLEVLRRKMVLLLISDLDISQEEVIIL  83

Query  1480  RHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDE  1659
               +Y E++Q  +R ESQ+E+VWLPIVD   PWT  K+ QF  ++S+MPW++V HPS ID 
Sbjct  84    EQLYSEARQHQTRHESQYEVVWLPIVDPNMPWTDNKQKQFQSLQSAMPWYTVYHPSLIDR  143

Query  1660  AVYGYLN*R----RKPLLAVVD  1713
             AV  ++       +KP+L V+D
Sbjct  144   AVIQFIKEEWQFGKKPILVVLD  165



>ref|XP_006376885.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
 gb|ERP54682.1| hypothetical protein POPTR_0012s09220g [Populus trichocarpa]
Length=733

 Score =   120 bits (300),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 227/491 (46%), Gaps = 67/491 (14%)
 Frame = +1

Query  289   APPSQVVAPLQAKIIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLI  468
             A  S  + P   ++IP    +         S  + MM  VRA+H  D     VKP+L +I
Sbjct  2     ASNSMQITPAMNQVIPNELWVS------LESNGSTMMKAVRASHAPDGRKVDVKPMLRII  55

Query  469   EDIMPRAHATI-------PGYVQSVQTQPARLDAILEE-----KVVHSGL---NEAIEAF  603
             ++I+ RA   I        G ++      + +DA L+      K V S L   N  I + 
Sbjct  56    DNILLRAAPAIVEGTYEDKGLLEEEIFSRSDVDAKLKTLASIIKKVSSELFSHNNLILSG  115

Query  604   AYPAYRTSFEIIGGY--------SSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQY  759
              + A     + I  Y        S  RD H+  + +L  L++Y WDAK V+T AAF   Y
Sbjct  116   TFKANSNVNQTIIPYGMDCKCTCSGGRDVHATIMMLLDTLSSYSWDAKVVLTVAAFIVNY  175

Query  760   G-EFGLL-ARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHK  933
             G EF L  +       LA+S+A + Q+ D+ + ++ S+A   K+  + KL   ++ VT  
Sbjct  176   GHEFLLFTSSEAKNSALAQSLAFLKQLRDITDHAKFSKA---KIDAITKLIKGIMAVT--  230

Query  934   IIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa---kasyyvvkaavTCSL  1104
                             KY V L+    ES++   A   N MA   KA+Y+ + + V C+ 
Sbjct  231   ----------------KYIVELHNLPPESIATDEAPMSNAMAYIPKAAYWTMLSVVICAS  274

Query  1105  VILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
              I +L   G +  +   +   +++   K+  IL   +   ++   E  K  +      L 
Sbjct  275   YIASL--SGSEETTELLDLSRLASEGSKMLVILKSYKTIYKEYEDEKCKTAYWD----LV  328

Query  1285  ETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNE  1464
             +T + TH+DN    + ++  ++      H  G   K+  ++ LR K+VFLL S LDI  E
Sbjct  329   KTFSSTHSDNMTVLKTLLLAKDGKQ---HLVGHTSKRIHIEELREKHVFLLASGLDISKE  385

Query  1465  VITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHP  1644
              I +L  +Y E+K   S+ E Q+E+VW+P+V++   W   K+ +F  + + MPW+++  P
Sbjct  386   EIDILGKLYQEAK---SKGEVQYEVVWIPVVEKTISWDQEKQQKFEQILAMMPWYAMPEP  442

Query  1645  SKIDEAVYGYL  1677
             SKI   V  Y+
Sbjct  443   SKIKAEVIKYI  453



>gb|KHG11411.1| Ornithine aminotransferase [Gossypium arboreum]
Length=684

 Score =   119 bits (298),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 119/434 (27%), Positives = 214/434 (49%), Gaps = 52/434 (12%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D   ++ +R++H  D     VKP+L +   ++          + ++      +DA  +++
Sbjct  26    DDDKIEQIRSSHVSDGHVVDVKPILQITGKVL----------LHTMNGGSGHIDA-FDDQ  74

Query  565   VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAA  744
              + S ++ A +A        S    GG     DAH+ T+++  +L++Y W AK V+T AA
Sbjct  75    TILSAVDGAHDAVNKICSELSSRCSGG----EDAHATTMAIFNMLSSYSWGAKVVLTLAA  130

Query  745   FAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEV  924
             FA ++GEF L+++L  ++ LAKS+A +++ PD+LE+S + +     L   +KL + M++V
Sbjct  131   FAVKFGEFWLISQLCTSNSLAKSMA-LLKRPDILENSPTLKPYFDAL---SKLINAMIDV  186

Query  925   THKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSL  1104
             T  I+ L E+ S       KY       L+ +++ +      I+         + V C+ 
Sbjct  187   TECIVELTELPS-------KYIPIDEPPLSTTMAHIYFATYRII--------WSVVACAR  231

Query  1105  VILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
              I  L+ +  ++ + T + L++S+L HK   I   LQ  ++   + + +       +  +
Sbjct  232   QITGLVGIRHEFITRTLDALDLSSLAHKFRSIHEYLQFQLRLCNEHMNEKMLMEALEDFK  291

Query  1285  ETLARTHTDN-KYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPN  1461
              T+     DN K    +    EN   P       +  K  +++LRRK+V LL+SDLDI  
Sbjct  292   RTIETPQVDNLKILQNIFGKEENLFNP-------DKTKVSINVLRRKHVLLLISDLDISQ  344

Query  1462  EVITMLRHMYLESKQDPSRAES--QFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
             E I +L  +Y E      R  S   +EI+WLPIVD ++ W    + + + ++S M W++V
Sbjct  345   EEIRVLEVVYKE------RVSSGRNYEIIWLPIVD-KTAWNDGCQ-KISSLQSIMSWYTV  396

Query  1636  SHPSKIDEAVYGYL  1677
             SH   I  AV  Y+
Sbjct  397   SHQFSIKPAVIKYI  410



>gb|KDP47163.1| hypothetical protein JCGZ_00054 [Jatropha curcas]
Length=748

 Score =   117 bits (292),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 6/143 (4%)
 Frame = +1

Query  1303  HTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLR  1482
             H DN    + +I  ++D  P+  GA    K+   D+LRRK+V L ++DL++P + +  L 
Sbjct  349   HVDNIEVLKHLIYAKDDQLPLYDGAA--KKRSSFDVLRRKHVLLYITDLELPKDELPTLN  406

Query  1483  HMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEA  1662
              MY E++Q P   ES +E+VW P+VD  +PW  A++ QF  ++S MPWFSV HP  +D A
Sbjct  407   GMYNEARQLPLATESNYEVVWFPVVDWSTPWNNAQQKQFKYLQSRMPWFSVYHPLLLDPA  466

Query  1663  VYGYLN----*RRKPLLAVVDTQ  1719
             V  Y+       +KPLL V+D Q
Sbjct  467   VIKYIKQVWCFNKKPLLVVLDPQ  489



>gb|KDO35949.1| hypothetical protein CISIN_1g044845mg, partial [Citrus sinensis]
Length=359

 Score =   114 bits (284),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 117/212 (55%), Gaps = 9/212 (4%)
 Frame = +1

Query  328  IIPAGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPG  507
            + P  +G + R     +S+D  ++  V+ TH  D    +VKPL+H++E I   A  +I G
Sbjct  146  MTPMMKGDKFR---FTTSDDNTLLKQVQGTHLPDGRVIEVKPLIHIVEGIFKLADPSI-G  201

Query  508  YVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSV  687
             +  ++T+ A L+A LE+K   +     +E  AY   R S EI    S   DAH   LS+
Sbjct  202  AISDLETR-ASLEA-LEDKTYQTDSLGMLEVLAYIIDRISCEITCKCSGGGDAHVTALSI  259

Query  688  LKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessr  867
            L ++++Y WDAK  +  +AFA  YGEF L+A+ Y T+ LAK+VA + Q+P++LE    + 
Sbjct  260  LNMVSSYSWDAKLALALSAFAVTYGEFWLVAQSYTTNQLAKAVAILKQLPEILE---HTH  316

Query  868  avssKLREVAKLADKMLEVTHKIIALKEIGSE  963
             +  +   +  L   M+EV+  I+   E+ S+
Sbjct  317  VLKPQFDAIKNLVTAMVEVSKCIVQFNELPSQ  348



>ref|XP_008224125.1| PREDICTED: uncharacterized protein LOC103323883 [Prunus mume]
Length=882

 Score =   117 bits (292),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 126/461 (27%), Positives = 212/461 (46%), Gaps = 65/461 (14%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDA-VHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
             L S  D  ++D + ATH V+    +    L  ++E+I+  A  T+   VQ  Q     + 
Sbjct  233   LFSMSDKKILDQIYATHYVNVDTSFDEDSLFEIVENILKHAIQTVDKIVQGTQVHEENI-  291

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                EEK + +  +  +      A     +  G     + AH   L +L  L+NY W+AKA
Sbjct  292   ---EEKPLMANFSTPLCILKSIASEMQCKPPG----EKVAHETALVILNKLSNYSWEAKA  344

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+T AAFA +YGEF LLA+   +D LAKS++ + ++P LL+      +   K R+     
Sbjct  345   VLTLAAFAMEYGEFWLLAQAQESDRLAKSISILKRVPFLLK-----PSNLQKRRQAVVEL  399

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLS--PVTAEQENIMakasyyvv  1080
             + +++VT ++I + +   +  S    Y      ELA ++   PV A              
Sbjct  400   NNLIKVTMQVIGIFDQFEKLSS----YDPRDVPELALAMEHIPVDA--------------  441

Query  1081  kaavTCSLVILNLLAVGRDYYssteeeleistl---tHKLSYILGDLQ---KAVQKSTQE  1242
                      IL L+A        T +E +   L     K+ +IL  L    K  +K  ++
Sbjct  442   ------YWAILTLVACATKVTILTSDEDKEHDLVPYAQKIHFILNKLNVQLKICRKQVED  495

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
                 +    RKI      RT T+ K   + +I  +++  P+I G+  +     +DILR+K
Sbjct  496   AEAYRRI--RKIF-----RTPTEIKEVFKALIFSKDNVQPLIDGSTEQTVD--IDILRKK  546

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              + L +S LDI ++ I++L+ +Y     + ++ E Q +IVW+PIV++   WT     +F 
Sbjct  547   NILLFLSSLDITDDDISILKPIY-----EFTKKEDQHKIVWIPIVEQ---WTNELRKKFE  598

Query  1603  LVKSSMPWFSV--SHPSKIDEAVYGYLN*RRKPLLAVVDTQ  1719
              ++  MPW++V  S P      +    N + KP L V+  Q
Sbjct  599   TLRIKMPWYTVQISAPIAGIRFIKEEWNFKGKPTLVVMSPQ  639



>ref|XP_008224124.1| PREDICTED: uncharacterized protein LOC103323881 [Prunus mume]
Length=666

 Score =   115 bits (289),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 126/461 (27%), Positives = 212/461 (46%), Gaps = 65/461 (14%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDA-VHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLD  546
             L S  D  ++D + ATH V+    +    L  ++E+I+  A  T+   VQ  Q     + 
Sbjct  17    LFSMSDKKILDQIYATHYVNVDTSFDEDSLFEIVENILKHAIQTVDKIVQGTQVHEENI-  75

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                EEK + +  +  +      A     +  G     + AH   L +L  L+NY W+AKA
Sbjct  76    ---EEKPLMANFSTPLCILKSIASEMQCKPPG----EKVAHETALVILNKLSNYSWEAKA  128

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+T AAFA +YGEF LLA+   +D LAKS++ + ++P LL+      +   K R+     
Sbjct  129   VLTLAAFAMEYGEFWLLAQAQESDRLAKSISILKRVPFLLK-----PSNLQKRRQAVVEL  183

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLS--PVTAEQENIMakasyyvv  1080
             + +++VT ++I + +   +  S    Y      ELA ++   PV A              
Sbjct  184   NNLIKVTMQVIGIFDQFEKLSS----YDPRDVPELALAMEHIPVDA--------------  225

Query  1081  kaavTCSLVILNLLAVGRDYYssteeeleistl---tHKLSYILGDLQ---KAVQKSTQE  1242
                      IL L+A        T +E +   L     K+ +IL  L    K  +K  ++
Sbjct  226   ------YWAILTLVACATKVTILTSDEDKEHDLVPYAQKIHFILNKLNVQLKICRKQVED  279

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
                 +    RKI      RT T+ K   + +I  +++  P+I G+  +     +DILR+K
Sbjct  280   AEAYRRI--RKIF-----RTPTEIKEVFKALIFSKDNVQPLIDGSTEQTV--DIDILRKK  330

Query  1423  YVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFT  1602
              + L +S LDI ++ I++L+ +Y     + ++ E Q +IVW+PIV++   WT     +F 
Sbjct  331   NILLFLSSLDITDDDISILKPIY-----EFTKKEDQHKIVWIPIVEQ---WTNELRKKFE  382

Query  1603  LVKSSMPWFSV--SHPSKIDEAVYGYLN*RRKPLLAVVDTQ  1719
              ++  MPW++V  S P      +    N + KP L V+  Q
Sbjct  383   TLRIKMPWYTVQISAPIAGIRFIKEEWNFKGKPTLVVMSPQ  423



>ref|XP_007221903.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
 gb|EMJ23102.1| hypothetical protein PRUPE_ppa015869mg [Prunus persica]
Length=647

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 123/460 (27%), Positives = 213/460 (46%), Gaps = 73/460 (16%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDA-VHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEE  561
             D  ++D + ATH V+    +    L  ++E+I+  A  T+   VQ  Q     +    EE
Sbjct  3     DKKILDQIYATHYVNVDTSFDEDSLFEIVENILKHAIQTVDKIVQGTQVHEENI----EE  58

Query  562   KVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFA  741
             K + +  +  +      A     +  G     + AH   L++L  L+NY W+AKAV+T A
Sbjct  59    KPLKANFSTPLCILKSIASEMQCKPPG----EKVAHETALAILNKLSNYSWEAKAVLTLA  114

Query  742   AFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLE  921
             AF+ +YGEF LLA+   +D LAKS++ + ++P LL+      +   K R+     + +++
Sbjct  115   AFSMEYGEFWLLAQAQESDRLAKSISILKRVPFLLK-----PSNLQKRRQAVLELNNLIK  169

Query  922   VTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLS--PVTAEQENIMakasyyvvkaavT  1095
             VT ++I + +   +  S    Y      ELA ++   PV A                   
Sbjct  170   VTMRVIGIFDQFEKLSS----YDPKDVPELALAMEHIPVDA-------------------  206

Query  1096  CSLVILNLLAVGRDYYssteeeleistl---tHKLSYILGDLQ---KAVQKSTQEIGKIK  1257
                 IL L+A        T +E +   L     K+ +IL  L    K  +K  ++    +
Sbjct  207   -YWAILTLVACATKVTILTSDEDKEHDLVPYAQKIHFILNKLNMQLKICRKQVEDAEAYR  265

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
                 RKI      RT T+ K   + +I  +++  P+I G+  +     +DILR+K + L 
Sbjct  266   RI--RKIF-----RTPTEIKEVFKALIFSKDNVQPLIDGSTKQTV--DIDILRKKNILLF  316

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             +S LDI ++ I++L+ +Y     + ++ E Q +IVW+PIV++   WT     +F  ++  
Sbjct  317   LSSLDITDDDISILKPIY-----EFTKKEDQHKIVWIPIVEQ---WTDELRKKFETLRIM  368

Query  1618  MPWFSVSHPSKIDEAVYGY------LN*RRKPLLAVVDTQ  1719
             MPW++V    +I   + G+       N + KP L V+  Q
Sbjct  369   MPWYTV----QISAPIAGFRFIKEEWNFKGKPTLVVMSPQ  404



>ref|XP_007225209.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
 gb|EMJ26408.1| hypothetical protein PRUPE_ppa002007mg [Prunus persica]
Length=730

 Score =   114 bits (285),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 15/187 (8%)
 Frame = +1

Query  1183  HKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTP  1362
             HKL  I   LQ+ + K  Q I KIK       +   L   H DN  S  L +    D  P
Sbjct  282   HKLENIFNHLQENLNKLHQIIQKIKDEDAFNAIARILESPHIDN--SKPLRVLFYKDDQP  339

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDI--PNEVITMLRHMYLESKQDPSRAESQFE  1536
              ++  GL  K+  +D+L+RK V L +SDLD+   NE + ++++MY+E +Q+  R ESQFE
Sbjct  340   ALYD-GLNKKRVDVDVLKRKVVILFISDLDVVLGNEYM-IVQNMYMEKRQNLGRPESQFE  397

Query  1537  IVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*RR------KPL  1698
             IVW+PI D    WT AK  QF  ++ +M W+SV HPS +   V  Y+  +R      KPL
Sbjct  398   IVWVPITDE---WTAAKYQQFENLRDNMEWYSVFHPSVVSPIVVRYIRDQRKWNFVKKPL  454

Query  1699  LAVVDTQ  1719
             L V+D Q
Sbjct  455   LVVMDPQ  461


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 114/218 (52%), Gaps = 21/218 (10%)
 Frame = +1

Query  334  PAGRGIRKRGDFLASSEDTAMMDHVRAT---HD--VDAVHYKVKPLLHLIEDIMPRAHAT  498
            PA R  R++  F ++S+D+A+++ +  T   HD   +     VK +L  IE I+ R    
Sbjct  22   PALRDGRRQ--FSSTSDDSALVNQILLTDKSHDRPYEVSSLAVKNILQTIEAILSRG-TP  78

Query  499  IPGYVQSVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAH  669
            +P    +        DA+  EK + + L+   E+F  P +     S EI+    +  DA+
Sbjct  79   VPAATHA--------DALEHEKALRASLSTLSESFDVPNHVFNAISCEILCKSLAGEDAN  130

Query  670  SITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLE  849
              T+ +L ++ NY WD K V+   AFA + GEF L+A+LY ++PLAK+V  + Q+ ++LE
Sbjct  131  KTTMDILDIVQNYDWDEKVVLALGAFAVKDGEFWLVAQLYTSNPLAKAVGQLKQLQEILE  190

Query  850  ssessravssKLREVAKLADKMLEVTHKIIALKEIGSE  963
               +   +  K      L   +L+VT  II L+E+ ++
Sbjct  191  --RAGTVLKPKFDGYNNLVKAVLKVTKSIIQLQELQND  226



>gb|KHG17606.1| hypothetical protein F383_20800 [Gossypium arboreum]
Length=497

 Score =   112 bits (279),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 187/354 (53%), Gaps = 40/354 (11%)
 Frame = +1

Query  679   LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             +++   L++Y W AK V+T AAFA  +GEF L+A+L  ++ LAKSVA + Q PD+LE S+
Sbjct  1     MAIFNKLSSYSWGAKVVLTLAAFAVNFGEFWLIAQLCTSNSLAKSVALLKQ-PDILEHSQ  59

Query  859   ssravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTA  1038
             + +     L   +KL + M+ VT  I+ L E+ S+            Y  + E   P++ 
Sbjct  60    TLKTHFDAL---SKLINAMVNVTKCIVELTELPSK------------YISIDEP--PLST  102

Query  1039  EQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQK  1218
                +I   A+Y+++ + V C   I  L+ + +++  ST +  E+S+L HK+S I   LQ 
Sbjct  103   AMAHI-HTATYWIISSVVVCVGQITGLMGMRQEFTISTSDAWELSSLAHKVSSIHEHLQS  161

Query  1219  AVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIIC-GENDPTPIIHGAGLEMKK  1395
              ++   + I + K     +  + T+     DN    + I    EN   P       E  +
Sbjct  162   RLRLCYERIDEKKLMEDFEHFKRTIETPQVDNLMILQNIFGREENVLNP-------ERAQ  214

Query  1396  HGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQ--FEIVWLPIVDRRS  1569
               +++LR+K+V LL+SDLDI  E I +L  +Y E      R  S+  +EI+WLPIVD R+
Sbjct  215   VYINVLRKKHVLLLISDLDISQEEIRVLEVVYKE------RVSSRLNYEIIWLPIVD-RT  267

Query  1570  PWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
              W    ++ F+ ++S+M W++V +   I+ AV  Y+       +KP++  ++ Q
Sbjct  268   TWNDGYKENFSTMQSNMSWYTVRNHVAIEPAVVKYIREEWGFVKKPIVVTLNPQ  321



>ref|XP_002526961.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35448.1| conserved hypothetical protein [Ricinus communis]
Length=677

 Score =   113 bits (282),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 111/382 (29%), Positives = 186/382 (49%), Gaps = 47/382 (12%)
 Frame = +1

Query  619   RTSFEIIGGYSSN-RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPT  795
             R S EI      N  D  + TLS+  +LA Y WDAK V+T AAFA  Y +F LL RLYP+
Sbjct  59    RISSEICYSTQINGADVDATTLSLFNMLAKYSWDAKLVLTMAAFALNYAKFFLLLRLYPS  118

Query  796   D--PLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEK  969
                 + K++ATI  +P + E +  S    S   E+ KL   M++ T  ++  +++     
Sbjct  119   TNRTIIKTLATIKGLPFIFEYTNESIKCRSD--EIDKLIQAMMDATRSVVKFRKLPPVYI  176

Query  970   SLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYss  1149
             SL+           A +LS   A    ++               L+I +++A   ++ S 
Sbjct  177   SLE-----------ASALSTALAHIPTVVY--------------LIIRSIVACSTEFASF  211

Query  1150  teeeleistltHKLSYILGDLQKA-VQKSTQEIGKIKHTIKRKILEETLA------RTHT  1308
             T   L       +L+  L  +Q+  V K   EI + +H  K++ +E  L         + 
Sbjct  212   TNVALGTVRELSELTEKL--VQRCNVLKQQLEICQ-EHIEKKRNVEAYLKLLNCFDTANK  268

Query  1309  DNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHM  1488
             DN  S +  I  ++   P+ +GA    K+  +++LRRK V LL+S LDI  + + +L+ +
Sbjct  269   DNIESLKAFIKAKDGDLPLFNGAT--KKEVDINVLRRKNVLLLISGLDISQDELWILKLI  326

Query  1489  YLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTL-VKSSMPWFSVSHPSKIDEAV  1665
             + E+    +R E Q+E+VW+PI +     T   E++    +K +MPW+SV +P+ ID+ V
Sbjct  327   FREANIIATRHERQYEVVWVPITNHSVQRTDLMENEIIKNLKYTMPWYSVQNPTLIDKVV  386

Query  1666  YGYL----N*RRKPLLAVVDTQ  1719
                +    + R   +L  +D+Q
Sbjct  387   IKLIKEVWHFRNNTVLVALDSQ  408



>gb|AGV54562.1| sieve element occlusion c [Phaseolus vulgaris]
Length=512

 Score =   112 bits (279),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 113/205 (55%), Gaps = 11/205 (5%)
 Frame = +1

Query  352  RKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHA-TIPGYVQSVQT  528
            RK     ++S+D+AM   V+ATH  D     VKP+L ++++I+ R  A T+ GY      
Sbjct  12   RKERRMFSTSDDSAMTKQVQATHAPDGREIDVKPILQIVDEILVRFIARTVEGYEVKRDQ  71

Query  529  QPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANY  708
                + A+L E        + +++ AY   + S E+    S   DAHS T+ +L  +++Y
Sbjct  72   DALEMTAVLAE-------FDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLGYMSSY  124

Query  709  WWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLR  888
             W AK V+T AAFA  +GEF L+A+L   + LAKSVA + Q+PDL E+  S +     L 
Sbjct  125  AWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDLAENFMSLKPHFEALI  184

Query  889  EVAKLADKMLEVTHKIIALKEIGSE  963
             + K A   +EVT  I++ KE+ SE
Sbjct  185  RLVKAA---MEVTTCIVSFKELPSE  206



>ref|XP_010087773.1| hypothetical protein L484_016343 [Morus notabilis]
 gb|EXB29854.1| hypothetical protein L484_016343 [Morus notabilis]
Length=686

 Score =   112 bits (280),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 112/432 (26%), Positives = 208/432 (48%), Gaps = 53/432 (12%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             L +  D  +++ + ATH      +    L  ++E+I+ RA   +   VQ  Q     +  
Sbjct  30    LFTLSDPKVLELIYATHVHADESFDEDSLFVIVENILKRATQIVDKVVQGSQVHVENI--  87

Query  550   ILEEKVVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDA  720
               EE+   +        F+ P     + S E+         AH  TLS+L  L+ Y W+A
Sbjct  88    --EERTPKAN-------FSVPLCTLKQISSELSCKARGEEIAHKTTLSILNKLSTYSWEA  138

Query  721   KAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAK  900
             KAV+T AAFA ++G+F LLA    TD LAKS+AT+ ++  L++      A   + R+   
Sbjct  139   KAVLTLAAFAMEFGDFWLLAHHQQTDQLAKSLATLKRVSVLVK-----PAEIQRRRQAIL  193

Query  901   LADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvv  1080
               + +++ T ++IA   I  E + L + Y +     +  +L  +  +         Y+ +
Sbjct  194   ELNNLIKTTMQVIA---IFDEFEKLSLNYDLKDVPGITIALDRLPVD--------VYWSI  242

Query  1081  kaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKH  1260
              + V CS  I  L       Y       +++    K+ YIL  L+  +    ++I + + 
Sbjct  243   LSVVACSTKICALTNDEETAY-------DLAPYAQKVHYILNKLKIQLMFCKKQIEEAES  295

Query  1261  TIK-RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
               + RKI +     T T+     + +I  +++  P+I G+    K   ++++R++YV L 
Sbjct  296   YRRLRKIFQ-----TPTEIMEVFKALIFSKDNVQPLIDGST--NKTVNIEVIRKRYVLLY  348

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
             ++ LDI +E I++++ +Y     D ++ + Q++IVW+PIV+R   WT  +   F ++++ 
Sbjct  349   ITGLDISDEDISVIKPVY-----DATKKDDQYKIVWVPIVER---WTDEQRKNFEILRAK  400

Query  1618  MPWFSVSHPSKI  1653
             MPW+ V + S I
Sbjct  401   MPWYVVQYFSPI  412



>emb|CAN65453.1| hypothetical protein VITISV_003897 [Vitis vinifera]
Length=689

 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/198 (34%), Positives = 111/198 (56%), Gaps = 4/198 (2%)
 Frame = +1

Query  370  LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             ++SED  M+  + ATH+ D   + V PLLHL+E I   A         S+  +   ++A
Sbjct  21   FSASEDNMMLKQIEATHEPDGREFDVNPLLHLVEQIFTCATPKSDVTFDSLDLKTNDVEA  80

Query  550  ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
             LE+K   +G    +EA AY   R S EI    S   +AH   +SVL +++++ WDAK V
Sbjct  81   -LEDKTHQAGFISTLEALAYTIDRISCEIRCKCSGGEEAHQRAISVLNMVSSHPWDAKLV  139

Query  730  ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
            +  +AFA  YGEF L+ + Y ++ LAKS+A + Q+P++L  S   +   + ++++ K   
Sbjct  140  LXLSAFAVNYGEFWLVFQSYNSNDLAKSMAILKQVPEILGRSSMLKPQFNSIKDLIK---  196

Query  910  KMLEVTHKIIALKEIGSE  963
             ML+V + I+  +E+ S+
Sbjct  197  AMLDVANCIVKFRELPSQ  214


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 65/114 (57%), Gaps = 10/114 (9%)
 Frame = +1

Query  1393  KHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSP  1572
             K  +D+ +  +V LL+S+LDI ++ + +L  +Y ES +   R   Q+EIVWLPI+D+  P
Sbjct  312   KVDIDVFKDTHVLLLISNLDISHDELEVLEDIYRESLK--KRPGIQYEIVWLPIIDQSDP  369

Query  1573  WTGAKEDQFTLVKSSMPWFS----VSHPSKIDEAVYGYLN*R----RKPLLAVV  1710
             W  + +  F   ++ MPW++    +  PS  D AV  ++       RKP+L V+
Sbjct  370   WMESSQKLFENHRARMPWYTRHDPLRSPSPEDGAVITFIKKEWHYGRKPILVVL  423



>ref|XP_006440671.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
 gb|ESR53911.1| hypothetical protein CICLE_v10019121mg [Citrus clementina]
Length=581

 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 113/360 (31%), Positives = 182/360 (51%), Gaps = 50/360 (14%)
 Frame = +1

Query  679   LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             +++   L++Y WD K V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E   
Sbjct  1     MALFNTLSSYSWDTKMVLSLAAFAVNYGEFCLVAQLCTENSLANSVAVLKQLP---EIPA  57

Query  859   ssravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTA  1038
                 +  +L E+  L   ML++T+ I+  K++ S+  S              +++S   A
Sbjct  58    GYDGLKPQLDELNNLIGAMLDLTNCIVEFKQLPSQYIS-----------NDGQAMSMDQA  106

Query  1039  EQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--YILGDL  1212
               +     A+Y+  ++ V C+  IL+L  +  +Y +ST +ELE+STL HK+S  ++  +L
Sbjct  107   HYQ-----AAYWTFRSIVACNSRILSLRGLRHEYTASTTDELELSTLAHKVSNIHVYENL  161

Query  1213  QKAVQKSTQEIGKIKHTIKRKILEETLARTHTDN------KYSAELIICGENDPTPIIHG  1374
             +K +    Q+I KI+   +   L   L + + DN         AE ++ GE   T  I  
Sbjct  162   KKQIDFWRQQIDKIRQIEEYNNLVRLLQKNNQDNIKVLRALIYAEDLVDGETRTTVQI--  219

Query  1375  AGLEMKKHGLDILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQDPSRAESQFEIVWLP  1551
                       D+L++K+V LL+S LD +  E I +LR MY + K     A  +  IVWLP
Sbjct  220   ----------DVLKKKHVLLLISSLDNLSQEEILVLRKMYKDLK-----ASKECRIVWLP  264

Query  1552  IVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYLN*R----RKPLLAVVDTQ  1719
             IVDR   W      +F  ++  MPW+++  P+ I  AV  Y+       +K +L  VD Q
Sbjct  265   IVDRSIDWQQTLY-KFESLQKRMPWYTIQDPATIQPAVIKYIKEEWKYSKKAILVSVDPQ  323



>ref|XP_004310160.1| PREDICTED: uncharacterized protein LOC101309418 [Fragaria vesca 
subsp. vesca]
Length=745

 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 180/410 (44%), Gaps = 54/410 (13%)
 Frame = +1

Query  559   EKVVHSGLNEAIEAFAYPAYR--------TSFEIIGG--------YSSNRDAHSITLSVL  690
             E      L E +E FA P+ R        + F  I G           + +   I + +L
Sbjct  93    EGAYEDTLQETMEHFASPSSRHGSYGVPTSVFIAISGKLFTKKWLTGEDDNKQKIAMGIL  152

Query  691   KLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessra  870
               +  Y W  K V+    FA + GE  L+A+LY T  LAK +  + Q+P+LLE +E+   
Sbjct  153   YAVHQYDWQEKVVLVLGTFAVKNGELWLVAQLYTTYALAKEIGKLEQLPELLERAETDLK  212

Query  871   vssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQEN  1050
                K      L   +L VT  II L+EI  +  S                L   T   + 
Sbjct  213   S--KFEAYNNLVKAVLRVTKLIIRLQEIRHDPDS-------------TPELESTTNSTDF  257

Query  1051  IMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQK  1230
              +A A Y+ + + V  +   + + ++  DY     E  E+S    KL  I  DL++ +  
Sbjct  258   HIATAVYWTIWSLVVSASHFVGITSMDPDY---NIETWELSFSIQKLETIQSDLEETINS  314

Query  1231  STQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDI  1410
                 I + K       + + L   H DN    +++   ++ P           K+ G   
Sbjct  315   LNDAIQRKKDDEALAAIADILENPHVDNIKPLKVLFFKDDQPALY----DCYRKRRG---  367

Query  1411  LRRKYVFLLVSDLDIPNEVITML-RHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAK  1587
                K V L ++DLDI +E   M+ + MY+E + +P + ESQ+EIVW+PIVD    WT  K
Sbjct  368   ---KVVILFLTDLDILHEKEYMIVQQMYMEKRHEPLKPESQYEIVWVPIVD---SWTEDK  421

Query  1588  EDQFTLVKSSMPWFSVSHPSKIDEAVYGYL------N*RRKPLLAVVDTQ  1719
              +QF  ++++M W+S+  PS +   V  Y+      N   KPLL V+D Q
Sbjct  422   YEQFESIRNAMEWYSIYLPSVVSPTVIRYIRKEDKWNFVNKPLLVVMDPQ  471



>ref|XP_006378262.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
 gb|ERP56059.1| hypothetical protein POPTR_0010s060501g, partial [Populus trichocarpa]
Length=357

 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = +1

Query  1402  LDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTG  1581
             LD+LRR+ V LL+SDL+I +E +++L+ MY E+++ P R ESQ+E+VWLP+VDR SPW+ 
Sbjct  3     LDVLRRRSVLLLISDLEISHEELSVLQQMYSEARELPGRPESQYEVVWLPVVDRSSPWSE  62

Query  1582  AKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              K+  F   +  MPW+SV  PS +D AV  Y+    +  ++PLL V+D Q
Sbjct  63    TKQKLFEDFQRIMPWYSVYQPSLLDVAVIRYIKEVWHFNKRPLLVVLDPQ  112



>ref|XP_007137985.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
 gb|ESW09979.1| hypothetical protein PHAVU_009G171300g [Phaseolus vulgaris]
Length=584

 Score =   110 bits (275),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 185/351 (53%), Gaps = 28/351 (8%)
 Frame = +1

Query  679   LSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEsse  858
             + +L  +++Y W AK V+T AAFA  +GEF L+A+L   + LAKSVA + Q+PDL E+  
Sbjct  1     MVLLGYMSSYAWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDLAENFM  60

Query  859   ssravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTA  1038
             S +     L  + K A   +EVT  I+  KE+ SE               ++E   P++ 
Sbjct  61    SLKPHFEALIRLVKAA---MEVTTCIVQFKELPSE--------------YISEDTPPMSV  103

Query  1039  EQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQK  1218
                +I   ASY+V+++ V C+  I +L+    +  SST E  E+S+L HK++ I   L+ 
Sbjct  104   ASTHI-PIASYWVIRSIVACASQIASLIGTRNESISSTTEAWELSSLAHKVTSIHEHLKN  162

Query  1219  AVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKH  1398
              +    Q I   +H      L       H DN      +I  ++D  P++ G      + 
Sbjct  163   QLILCYQYIDDKRHIEAFHNLTRLFETVHVDNMKILRALIYAKDDILPLVDGT--TKSRA  220

Query  1399  GLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWT  1578
              L++LRRK+V LL+SDLD+  E I +L ++Y +++   SR ++ +E+VW+P+VD ++ W 
Sbjct  221   SLEVLRRKHVLLLISDLDLSQEEILVLDNLYKDAR---SRGDTHYEMVWIPVVD-KAVWN  276

Query  1579  GAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
                + +F  ++S M W+SV  P  I+ +   Y+    N  +  +L  +D Q
Sbjct  277   DVNKQKFEYLQSLMAWYSVCDPFIIEPSAVKYIKEVWNFSKTAILVALDPQ  327



>ref|XP_010650779.1| PREDICTED: uncharacterized protein LOC100255955 isoform X2 [Vitis 
vinifera]
Length=691

 Score =   110 bits (275),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 132/458 (29%), Positives = 223/458 (49%), Gaps = 55/458 (12%)
 Frame = +1

Query  382   EDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT----IPG-YVQSVQTQPARLD  546
             E   ++ ++  THD +      + LL  +E+IM   H T    +PG Y  ++  +  R  
Sbjct  18    EQDILIKNILLTHDPNGCFLDSELLLCAMENIM--CHTTSEIRVPGLYFDAMARKIVR--  73

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                + +VV S      E      ++ S EI+   S   D+H+ T+ +  +L NY WDAK 
Sbjct  74    ---DIEVVGSQ-----EPLGLIIHKISREILCKCSVEGDSHTRTMVLFDMLRNYRWDAKV  125

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAFA  YG+  LL +  P +PLA S+A + Q+P       +  A+  + + +  LA
Sbjct  126   VLVLAAFATCYGQLWLLMQPCPVNPLAISIAMLKQLPS------NFSALRPRFKALNLLA  179

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               M +V   II         +SL +K  V L KE       VT  Q   +  ++Y+V+K+
Sbjct  180   KAMADVAKCIIKF-------ESLPIK-DVKLDKETM----TVTKSQ---IYLSAYWVIKS  224

Query  1087  avTCSLVILNLLAVGRDYYssteeel-eistltHKLSYILGDLQKAVQKSTQEIGKIKHT  1263
              +TCS  I +L A+  ++ SS      E+ +L +KL  I   L+  V    Q+I    H 
Sbjct  225   TLTCSSQIRDLTAMKLEHSSSITVAAWELLSLVYKLGRICSQLRWQVDVCHQQIETKLH-  283

Query  1264  IKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
               +K+L+ +   T  DN+    ++    +D TP+I  +    KK G+  L+ K V  +VS
Sbjct  284   --QKLLDLS-EETQVDNQEVLHMLFALRDD-TPLIDCSS--QKKLGVSELKNKVVICIVS  337

Query  1444  DLD-IP-NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
               + +P  E++ +++  Y     +  + E  +EIVW+PI    + WT A+E  F  +  S
Sbjct  338   KPEPLPIEELLFLVQQTYDHPHHN--KLERSYEIVWVPIPSSDT-WTEAEERSFDFLCYS  394

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +PW+SV  P  +   V  ++    N + +P++ V+D+Q
Sbjct  395   LPWYSVRQPWLLCSEVVTFIKQKWNFKDEPIMVVLDSQ  432



>ref|XP_003590763.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32807.1| sieve element occlusion b [Medicago truncatula]
 gb|AES61014.1| sieve element occlusion protein [Medicago truncatula]
Length=669

 Score =   109 bits (273),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 216/454 (48%), Gaps = 59/454 (13%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  +++ +  TH      +  + L ++  +I+ R+   +   +Q  Q     LD I    
Sbjct  26    DEHILEEIYVTHVHSDTKFDAESLFNIAGNILTRSTHVVDNVLQGHQGGLEHLDNINPPA  85

Query  565   VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAA  744
                S L    +  +  + +   E I        A+  TL++LK L+NY W AK V+T +A
Sbjct  86    SFTSPLCTLKQINSEMSCKAPGEEI--------AYKTTLAILKKLSNYSWVAKGVLTLSA  137

Query  745   FAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEV  924
             F+ +YGEF LL++  PT+PLAKS+  I ++P L           SK   + K  +++LE+
Sbjct  138   FSLEYGEFWLLSQNLPTEPLAKSLGIIKRVPQL-----------SKPEALKKHRNEILEL  186

Query  925   THKIIA---LKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
              + I A   + EI  E + L  ++ +     LA +L     +                  
Sbjct  187   NNLIKATWQVIEIIIELERLNSRHDIKEVPALAPALEQFPVD------------------  228

Query  1096  CSLVILNLLAVGRDYYssteeeleistltH---KLSYILGDLQKAVQKSTQEIGKIKHTI  1266
                VI+ ++A+   +   T    +   L+H   K++ I+  L+K V + T +I + ++  
Sbjct  229   VYWVIITIVAIVTQFECLTTNSDKRQDLSHFGQKINIIISKLRKHVSQCTIQIDEAEY--  286

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDP-TPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
               K+L + L +T T+     ++++  ++ P  PI  G+   +    +++L++K VFL +S
Sbjct  287   -NKLLRK-LFQTPTEIMEVFKVLVFWKDTPKAPIYDGSTKTLV--NIEVLKKKDVFLFIS  342

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
              LDI  E I++L  +Y   K    +  SQ +IVW+PIV+    W    + +F  +KS MP
Sbjct  343   TLDISQEDISILIPIYDHIK----KTGSQHKIVWVPIVEE---WNDKLKKKFDSLKSKMP  395

Query  1624  WFSVSH--PSKIDEAVYGYLN*RRKPLLAVVDTQ  1719
             W+ + H  P K  + +   L+ ++KPL  V+  Q
Sbjct  396   WYVLHHFAPIKGIKYIKEELHFKQKPLFVVLSPQ  429



>gb|KDO54552.1| hypothetical protein CISIN_1g015053mg [Citrus sinensis]
Length=347

 Score =   106 bits (265),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 102/323 (32%), Positives = 168/323 (52%), Gaps = 33/323 (10%)
 Frame = +1

Query  616   YRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPT  795
             ++   EI    S   DA + T+++   L++Y WD K V++ AAFA  YGEF L+A+L   
Sbjct  25    HKICCEISCKCSGGGDALATTMALFNTLSSYSWDTKMVLSLAAFAVNYGEFWLVAQLCTE  84

Query  796   DPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSL  975
             + LA SVA + Q+P   E       +  +L E+  L   ML++T+ I+  K++ S+  S 
Sbjct  85    NSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNLIGAMLDLTNCIVEFKQLPSQYIS-  140

Query  976   KVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYsste  1155
                          +++S   A  +     A+Y+  ++ V C+  IL+L  +  +Y +ST 
Sbjct  141   ----------NDGQAMSMDQAHYQ-----AAYWTFRSIVACNSRILSLRGLRHEYTASTT  185

Query  1156  eeleistltHKLS--YILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAE  1329
             +ELE+STL HK+S  ++  +L+K +    Q+I KI+   +   L   L + + DN     
Sbjct  186   DELELSTLAHKVSNIHVYENLKKQIDFWRQQIDKIRQIEEYNNLVRLLQKNNQDNIKVLR  245

Query  1330  LIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQ  1506
              +I  E+    ++ G      +  +D+L++K+V LL+S LD +  E I +LR MY + K 
Sbjct  246   ALIYAED----LVDGETRTTVQ--IDVLKKKHVLLLISSLDNLSQEEILVLRKMYKDLK-  298

Query  1507  DPSRAESQFEIVWLPIVDRRSPW  1575
                 A  +  IVWLPIVDR   W
Sbjct  299   ----ASKECRIVWLPIVDRSIDW  317



>ref|XP_003590766.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32806.1| sieve element occlusion a [Medicago truncatula]
 gb|AES61017.1| sieve element occlusion protein [Medicago truncatula]
Length=664

 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 122/454 (27%), Positives = 216/454 (48%), Gaps = 57/454 (13%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQS--VQTQPARLDAILE  558
             D  +++ + +TH      +  + L ++  +I+ R+   +  +VQ    QT   +LD I  
Sbjct  26    DEHILEEIYSTHVHSDTKFDAEYLFNIAGNILTRSTHVVDNFVQGHEQQTSLEQLDNINP  85

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
                  S L    +  +  A +   E I        A+  TL++L  L+NY W AK V+T 
Sbjct  86    PASFTSPLCTLKKINSEMACKAPGEEI--------AYRTTLAILNKLSNYSWVAKGVLTL  137

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLL--EssessravssKLREVAKLADK  912
             +AFA +YGEF LL++  PT+PLAKS+A + ++P L   E  +  R    ++  + K   +
Sbjct  138   SAFALEYGEFWLLSQYLPTEPLAKSLAIMKRVPQLTKPELLKKHRYAVLEVNNLIKATSQ  197

Query  913   MLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLS--PVTAEQENIMakasyyvvka  1086
             ++++   IIAL+ + S       ++ +     LA +L   PV      I   A    ++ 
Sbjct  198   LIDI---IIALERLNS-------RHDIKEVPALAPALEQFPVDVYWVIITIVAIVTQIEC  247

Query  1087  avTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
               T S    +L   G+                 K++ I+  L+K V + T +I + ++  
Sbjct  248   LTTDSEERQDLSQFGQ-----------------KINIIISKLRKHVSQITIQIDEAEY--  288

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDP-TPIIHGAGLEMKKHGLDILRRKYVFLLVS  1443
               K+L++ L +T T+     +++I  ++ P TPI  G+   +    +D+L++K VFL +S
Sbjct  289   -NKLLKK-LFQTPTEIMEVFKVLIFWKDTPQTPIYCGSTKTLV--NIDVLKKKDVFLFIS  344

Query  1444  DLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMP  1623
              LDI  E I+ +  +Y        +  SQ +IVW+PIV+    W      +F  +KS MP
Sbjct  345   TLDICQEDISTMIRIY----DHIQKTGSQHQIVWIPIVEE---WNDRGRKKFDSLKSKMP  397

Query  1624  WFSVSHPSKID--EAVYGYLN*RRKPLLAVVDTQ  1719
             W+ + H + I     +   L+ +  PL+ V+ TQ
Sbjct  398   WYVLHHFATIKGIRFIKEELHFKLNPLVVVLSTQ  431



>ref|XP_002282178.2| PREDICTED: uncharacterized protein LOC100255955 isoform X1 [Vitis 
vinifera]
Length=693

 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 128/459 (28%), Positives = 218/459 (47%), Gaps = 55/459 (12%)
 Frame = +1

Query  382   EDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT----IPGYVQSVQTQPARLDA  549
             E   ++ ++  THD +      + LL  +E+IM   H T    +PG            DA
Sbjct  18    EQDILIKNILLTHDPNGCFLDSELLLCAMENIM--CHTTSEIRVPGLY---------FDA  66

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
             +  + V    +  + E      ++ S EI+   S   D+H+ T+ +  +L NY WDAK V
Sbjct  67    MARKIVRDIEVVGSQEPLGLIIHKISREILCKCSVEGDSHTRTMVLFDMLRNYRWDAKVV  126

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +  AAFA  YG+  LL +  P +PLA S+A + Q+P       +  A+  + + +  LA 
Sbjct  127   LVLAAFATCYGQLWLLMQPCPVNPLAISIAMLKQLPS------NFSALRPRFKALNLLAK  180

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              M +V   II  +       SL +K  V L KE       VT  Q   +  ++Y+V+K+ 
Sbjct  181   AMADVAKCIIKFE-------SLPIK-DVKLDKETM----TVTKSQ---IYLSAYWVIKST  225

Query  1090  vTCSLVILNLLAVGRDYYssteeelei---stltHKLSYILGDLQKAVQKSTQEIGKIKH  1260
             +TCS  I +L A+  +   S+   +      +L +KL  I   L+  V    Q+I    H
Sbjct  226   LTCSSQIRDLTAMKLEQVHSSSITVAAWELLSLVYKLGRICSQLRWQVDVCHQQIETKLH  285

Query  1261  TIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLV  1440
                +K+L+ +   T  DN+    ++    +D TP+I  +    KK G+  L+ K V  +V
Sbjct  286   ---QKLLDLS-EETQVDNQEVLHMLFALRDD-TPLIDCSS--QKKLGVSELKNKVVICIV  338

Query  1441  SDLD-IP-NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
             S  + +P  E++ +++  Y     +  + E  +EIVW+PI    + WT A+E  F  +  
Sbjct  339   SKPEPLPIEELLFLVQQTYDHPHHN--KLERSYEIVWVPIPSSDT-WTEAEERSFDFLCY  395

Query  1615  SMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             S+PW+SV  P  +   V  ++    N + +P++ V+D+Q
Sbjct  396   SLPWYSVRQPWLLCSEVVTFIKQKWNFKDEPIMVVLDSQ  434



>ref|XP_006483987.1| PREDICTED: uncharacterized protein LOC102625281 [Citrus sinensis]
Length=716

 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 121/458 (26%), Positives = 213/458 (47%), Gaps = 46/458 (10%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             ++S +D  ++  +  +HD D      + +L  +E+IM  A A+       V       DA
Sbjct  44    ISSMQDDVLIKELFLSHDPDGRRLDSEQVLRAMENIMCYATAS------EVPVSDEYGDA  97

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
                    +  +  + E   +   + + EI+   S   D H  T+ V  L+ NY WDAK V
Sbjct  98    FAMNNASNIEVVGSQEPLGHTICKIAREILCKCSGEGDLHKRTMIVFDLVGNYRWDAKVV  157

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +  AAFA  YGEF L+ +LYP + LA SVA + Q+P       +   +  + + ++ L  
Sbjct  158   LVLAAFATSYGEFWLIMQLYPRNLLAVSVAMLKQLP------CNVSMLKPRFKALSLLVK  211

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              M+EVT  II       E + L + + + + KE+      ++  + +I   A+Y+V++++
Sbjct  212   AMVEVTKCII-------EFEGLPIAH-LMMDKEM------ISTTKSHIF-IAAYWVIRSS  256

Query  1090  vTCSLVILNLLAVGRDY-YssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
             + CS  I +L+A+  +   S+     E+S+   +LS I   L++ V    Q+     H  
Sbjct  257   LNCSSHINDLIAMKSENPNSNAIAAWELSSFVSRLSSICSHLRRQVDACRQQTETKLH--  314

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L + L  +  DN+    ++   +ND  P+   +     K G+  L+ K V LLVS 
Sbjct  315   --QKLVDLLKESQIDNQEVLHVLFALKND-FPLKDCS--TQAKLGVSELKDKVVILLVSK  369

Query  1447  LDIPNEVITMLRHMYLESKQD---PSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
                P  +      + +    D       E  ++IVW+PI    + WT  +E  F L   S
Sbjct  370   ---PELLPLEKLFLLVHQTYDHPHNKNLEESYKIVWVPISSSET-WTDVEERNFELFSCS  425

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +PW+SV  P  ++ AV   +    N + +P++ V+D+Q
Sbjct  426   LPWYSVRQPQLLNSAVVNLIKQEWNFKEEPIMVVLDSQ  463



>emb|CAN61289.1| hypothetical protein VITISV_032473 [Vitis vinifera]
Length=723

 Score =   108 bits (270),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/153 (36%), Positives = 94/153 (61%), Gaps = 6/153 (4%)
 Frame = +1

Query  1273  KILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLD  1452
             ++L       H DN      +I  ++D  P++ G+    ++  +D+LRRK V LL+S L 
Sbjct  308   QMLLNLFXSIHIDNMKILRALISPKDDVQPLLEGS--TKRRVNIDVLRRKNVLLLISGLS  365

Query  1453  IPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFS  1632
             I ++ +++L  +Y ES+   +R ESQ+E+VW+P+VDR   WT A +D+F  ++++MPW+S
Sbjct  366   ISHDELSILXQIYNESRXHGTRMESQYEVVWIPVVDRSVVWTDAMQDRFVTLQATMPWYS  425

Query  1633  VSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             V  P+ I +AV  ++    + R KP+L V+D Q
Sbjct  426   VYTPTLIXKAVIRFIKEVWHFRNKPILVVLDPQ  458



>ref|XP_006438202.1| hypothetical protein CICLE_v10030798mg [Citrus clementina]
 gb|ESR51442.1| hypothetical protein CICLE_v10030798mg [Citrus clementina]
Length=740

 Score =   108 bits (269),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 120/458 (26%), Positives = 213/458 (47%), Gaps = 46/458 (10%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             ++S +D  ++  +  +HD D      + +L  +E+IM  A A+       V       DA
Sbjct  68    ISSMQDDVLIKELFLSHDPDGRRLDSEQVLRAMENIMCYATAS------EVPVSDEHGDA  121

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAV  729
                    +  +  + E   +   + + EI+   S   D H+ T+ V  L+ NY WDAK V
Sbjct  122   FAMNNASNIEVVGSQEPLGHTICKIAREILCKCSGEGDLHTRTMIVFDLVGNYRWDAKVV  181

Query  730   ITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLAD  909
             +  AAFA  YGEF L+ +LYP + LA SVA + Q+P       +   +  + + ++ L  
Sbjct  182   LVLAAFATSYGEFWLIMQLYPRNLLAVSVAMLKQLP------CNVSMLKPRFKALSLLVK  235

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
              M+EVT  II       E + L + + + + KE+      ++  + +I   A+Y+V++++
Sbjct  236   AMVEVTKCII-------EFEGLPIAH-LMMDKEM------ISTTKSHIF-IAAYWVIRSS  280

Query  1090  vTCSLVILNLLAVGRDY-YssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTI  1266
             + CS  I +L+A+  +   S+     E+S+   +LS I   L++ V    Q+     H  
Sbjct  281   LNCSSHINDLIAMKSENPNSNAIAAWELSSFVSRLSSICSHLRRQVDACRQQTETKLH--  338

Query  1267  KRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSD  1446
               + L + L  +  DN+    ++   +ND  P+   +     K G+  L+ K V LLVS 
Sbjct  339   --QKLVDLLKESQIDNQEVLHVLFALKND-FPLKDCS--TQAKLGVSELKDKVVILLVSK  393

Query  1447  LDIPNEVITMLRHMYLESKQD---PSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSS  1617
                P  +      + +    D       E  ++IVW+PI    + W   +E  F L   S
Sbjct  394   ---PELLPLEKLFLLVHQTYDHPHNKNLEESYKIVWVPISSSET-WIDVEERNFELFSCS  449

Query  1618  MPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             +PW+SV  P  ++ AV   +    N + +P++ V+D+Q
Sbjct  450   LPWYSVRQPQLLNSAVVNLIKQEWNFKEEPIMVVLDSQ  487



>ref|XP_007044875.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY00707.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=690

 Score =   107 bits (268),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 120/475 (25%), Positives = 219/475 (46%), Gaps = 63/475 (13%)
 Frame = +1

Query  337   AGRGIRKRGDFLASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQ  516
             +G   ++   FL   +D  ++  +  +HD D  H   + LL  +E+IM  A  +      
Sbjct  6     SGSFWQRSKSFL---DDEILIKKLLLSHDPDGRHLDSEMLLCAVENIMFYATTS------  56

Query  517   SVQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKL  696
              V  +PA  DA L+  + +  L  + E   +  Y+ + E++       D H+ T+++  L
Sbjct  57    EVSDKPA--DANLKSHISNIELIGSQEPLVHTIYKIAHEMLCKCPGKGDLHTRTMALFDL  114

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             L NY W AK  +  A FA  YGEF L+ +L P   LA S+A   Q+P       S   + 
Sbjct  115   LGNYGWAAKVTLALAGFATSYGEFCLIMQLRPHISLAVSLADFKQLPS------SISILK  168

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIM  1056
              +++ +  L   M+++T  II  + + +            L     E+L+ + +E    +
Sbjct  169   PQVKALRLLVKTMVDLTKCIIEFEGLPA-----------VLVGPYIENLAAMKSE----I  213

Query  1057  akasyyvvkaavTCSLVILNLLAVGRD--YYssteeeleistltHKLSYILGDLQKAVQK  1230
                +Y+++++ + CS  I NL A+  +  Y +      E+ +L ++LS I   L+  V  
Sbjct  214   YVTAYWIIRSTLACSSQITNLKAMKPEQVYSNIIIAAWELLSLDYRLSSIYSHLRPLVDA  273

Query  1231  STQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGEND------PTPIIHGAGLEMK  1392
               Q+     H     + EE    +H DN+   +++   ++D      PT +         
Sbjct  274   FRQQTEAKLHQKLLNLFEE----SHIDNQEVLQMLFALKDDLPLKDCPTQV---------  320

Query  1393  KHGLDILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQDP-SRAESQFEIVWLPIVDRR  1566
             K G+  L+ K V LLVS  D +P E +  L H   ++   P  + E  +E++W+PI    
Sbjct  321   KLGVSELKSKVVLLLVSKPDLLPLEQLFFLVH---QTYDHPHKKVEGSYEMIWVPISCSE  377

Query  1567  SPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             + WT A+E  F  + +S+P +SV  P  ++ AV  ++    N   + ++ V+D++
Sbjct  378   T-WTDAEEKWFNFLSNSIPCYSVRQPWSLNSAVINFMKQEWNYGDEAIMVVLDSE  431



>gb|KEH42743.1| sieve element occlusion protein [Medicago truncatula]
Length=664

 Score =   106 bits (265),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 118/450 (26%), Positives = 216/450 (48%), Gaps = 49/450 (11%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPA--RLDAILE  558
             D  +++ + +TH      +  + L ++  +I+ R+   +  +VQ  + Q +  +LD I  
Sbjct  26    DEHILEEIYSTHVHSDTKFDAEYLFNIAGNILTRSTHVVDNFVQGHEYQASVEQLDNINP  85

Query  559   EKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITF  738
                  S L    +  +  A +   E I        A+  TL++L  L+NY W AK V+T 
Sbjct  86    PANFTSPLCTLKKINSEMACKAPGEEI--------AYKTTLAILNKLSNYSWVAKGVLTL  137

Query  739   AAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKML  918
             +AFA +YG+F LL++  PT+PLAKS+A + ++P L +     +   + L EV  L     
Sbjct  138   SAFALEYGDFWLLSQYLPTEPLAKSLAIMKRVPQLTKPESLKKHRYAIL-EVNNLIKATW  196

Query  919   EVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTC  1098
             +V   II L+ + S       ++ +     LA +L     +   ++            T 
Sbjct  197   QVIDIIIELERLNS-------RHDIKEVPALAPALEQFPVDVYWVI-----------NTI  238

Query  1099  SLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKI  1278
               ++  +  +  D    +EE  ++S    K++ I+  L+K V + T +I + ++    K+
Sbjct  239   VAIVTQIECLTTD----SEERQDLSQFGQKINIIISKLRKHVSQITIQIDEAEY---NKL  291

Query  1279  LEETLARTHTDNKYSAELIICGENDP-TPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
             L++ L +T T+     +++I  ++ P TPI  G+   +    +D+L++K VFL +S LDI
Sbjct  292   LKK-LFQTPTEIMEVFKVLIFWKDTPQTPIYCGSTKTLV--NIDVLKKKDVFLFISTLDI  348

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
               E I+ +  +Y        +  SQ +IVW+PIV+    W      +F  +KS MPW+ +
Sbjct  349   CQEDISTMIRIY----DHIQKTGSQHQIVWIPIVEE---WNDRGRKKFDSLKSKMPWYVL  401

Query  1636  SHPSKID--EAVYGYLN*RRKPLLAVVDTQ  1719
              H + I     +   L+ +  PL+ V+ TQ
Sbjct  402   HHFATIKGIRFIKEELHFKLNPLVVVLSTQ  431



>ref|XP_004304991.1| PREDICTED: uncharacterized protein LOC101294285 [Fragaria vesca 
subsp. vesca]
Length=670

 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 119/447 (27%), Positives = 215/447 (48%), Gaps = 48/447 (11%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             DT ++D +  TH      +    L  ++E I+ RA  T+   VQ  Q     +    EE+
Sbjct  23    DTKILDDIYTTHVHADDSFDDDSLFIIVESILKRATQTVDKIVQGTQVHVEDI----EEQ  78

Query  565   VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVITFAA  744
                +  +  +          S E+         AH  TL++L  L+NY W+AKA +T AA
Sbjct  79    TPKANFSVPLCTLK----GISCEMQCKPPGEEIAHKTTLAILHKLSNYSWEAKASLTLAA  134

Query  745   FAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEV  924
             FA ++GE  LLA L  ++ LA+S+A + ++P LL+ S+  +   + L E+  L    LEV
Sbjct  135   FAMEFGEIWLLAELRESNHLARSIAILKRLPVLLKDSQLHKRRQAIL-ELNNLIKATLEV  193

Query  925   THKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavTCSL  1104
                I    ++ +        Y +    EL+ +L  V A+         Y+ +   V C+ 
Sbjct  194   ITCIDQFNKLSN--------YDLKDVPELSGTLDHVPAD--------VYWAIMTVVACAT  237

Query  1105  VILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILE  1284
              I  LL    D      +E ++S  + K+ ++L +L+  +      I  I++  K K   
Sbjct  238   KI-TLLTSDED------KEFDLSPYSQKIHFVLNNLKTQLTICRARIEVIENYKKLK---  287

Query  1285  ETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNE  1464
               L RT T+     + ++  +++  P++  +  +     ++ILRRK V   +S LDI ++
Sbjct  288   -KLFRTPTEIMEIVKGLLFTKDNVQPLVDCSTKQTA--SIEILRRKNVLFFISSLDITDD  344

Query  1465  VITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHP  1644
              I++L+ ++  +K+D     +Q++IVW+PIV++   WT     +  ++K+ MPW++V + 
Sbjct  345   DISILKPVHEFTKKD-----NQYKIVWIPIVEQ---WTDELRKKSEILKNKMPWYTVQYS  396

Query  1645  SKID--EAVYGYLN*RRKPLLAVVDTQ  1719
               I   + +    N + KPLL V++ Q
Sbjct  397   GPIAGIKFIKEEWNFKGKPLLVVMNPQ  423



>gb|KCW55914.1| hypothetical protein EUGRSUZ_I01712 [Eucalyptus grandis]
Length=449

 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 99/184 (54%), Gaps = 7/184 (4%)
 Frame = +1

Query  1183  HKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTP  1362
             HKL  I   LQK +    Q I + +     + L       H DN    + +I  ++D  P
Sbjct  3     HKLKNIYEHLQKQIDICKQYIEEKRDIEAYQTLLNLFETIHIDNMKVLKALIYPKDDILP  62

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESK-QDPSRAESQFEI  1539
             ++ G     K+  L++LRR+ V LL+S LDI  + +++L  ++ ESK     R  +Q+E+
Sbjct  63    LVEGTS--KKRVNLEVLRRRNVLLLISGLDISQDELSILEQIHGESKLHTTQRQINQYEV  120

Query  1540  VWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAV  1707
             VW+PIVDR   WT   + QF  ++S MPW++V HP+ I +    ++    + R KP+L V
Sbjct  121   VWIPIVDRSVKWTDPVQKQFEALQSRMPWYTVYHPNLIHKVAIRFIREQWHFRNKPILVV  180

Query  1708  VDTQ  1719
             +D Q
Sbjct  181   LDPQ  184



>emb|CBI16822.3| unnamed protein product [Vitis vinifera]
Length=721

 Score =   104 bits (260),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 121/465 (26%), Positives = 221/465 (48%), Gaps = 47/465 (10%)
 Frame = +1

Query  382   EDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT----IPG-YVQSVQTQPARLD  546
             E   ++ ++  THD +      + LL  +E+IM   H T    +PG Y  ++  +  R  
Sbjct  18    EQDILIKNILLTHDPNGCFLDSELLLCAMENIM--CHTTSEIRVPGLYFDAMARKIVR--  73

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                + +VV S      E      ++ S EI+   S   D+H+ T+ +  +L NY WDAK 
Sbjct  74    ---DIEVVGSQ-----EPLGLIIHKISREILCKCSVEGDSHTRTMVLFDMLRNYRWDAKV  125

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAFA  YG+  LL +  P +PLA S+A + Q+P       +  A+  + + +  LA
Sbjct  126   VLVLAAFATCYGQLWLLMQPCPVNPLAISIAMLKQLPS------NFSALRPRFKALNLLA  179

Query  907   DKMLEVTHKIIA-----LKEIGSEEKSLKV---KYRVSLYKELAESLSPVTAEQENIMak  1062
               M +V   II      +K++  +++++ V   +  +S Y  +  +L+  +  ++    K
Sbjct  180   KAMADVAKCIIKFESLPIKDVKLDKETMTVTKSQIYLSAYWVIKSTLTCSSQIRDLTAMK  239

Query  1063  asyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQE  1242
                 + ++ + C   ++      R   S T    E+ +L +KL  I   L+  V    Q+
Sbjct  240   LEQIIHRSNLACHKPLMFSEFHFRHSSSITVAAWELLSLVYKLGRICSQLRWQVDVCHQQ  299

Query  1243  IGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRK  1422
             I    H   +K+L+ +   T  DN+    ++    +D TP+I  +    KK G+  L+ K
Sbjct  300   IETKLH---QKLLDLS-EETQVDNQEVLHMLFALRDD-TPLIDCSS--QKKLGVSELKNK  352

Query  1423  YVFLLVSDLD-IP-NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQ  1596
              V  +VS  + +P  E++ +++  Y     +  + E  +EIVW+PI    + WT A+E  
Sbjct  353   VVICIVSKPEPLPIEELLFLVQQTYDHPHHN--KLERSYEIVWVPIPSSDT-WTEAEERS  409

Query  1597  FTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
             F  +  S+PW+SV  P  +   V  ++    N + +P++ V+D+Q
Sbjct  410   FDFLCYSLPWYSVRQPWLLCSEVVTFIKQKWNFKDEPIMVVLDSQ  454



>ref|XP_003590760.1| Sieve element-occluding protein [Medicago truncatula]
 gb|ADN32808.1| sieve element occlusion c [Medicago truncatula]
 gb|AES61011.1| sieve element occlusion protein [Medicago truncatula]
Length=671

 Score =   104 bits (259),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 115/438 (26%), Positives = 190/438 (43%), Gaps = 58/438 (13%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  ++D + +TH      +    L  L ++ + R+   +   VQ  +    + D      
Sbjct  27    DDQILDQIYSTHVHSDTKFDAASLFTLAQNTLARSTHIVDSVVQGTKVSLEQADD-----  81

Query  565   VVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
                      I  F+ P       S E+     S   AH  TL++L  L++Y W+AKAV+T
Sbjct  82    ------KSLIPNFSSPLCTLKSISSEMSCKPPSEEIAHKTTLAILNKLSHYDWEAKAVLT  135

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              +AFA ++GEF LL +   TDPLAKSVA + ++P +L    + +     + E+  L    
Sbjct  136   LSAFALEFGEFWLLEQHLSTDPLAKSVALLKRVP-ILAKPAAIQKHRQAITELNSLVKIT  194

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             L+V   I+ L  +     +     +V    ELA    PV      I   A    +   +T
Sbjct  195   LQVIEFILELDYLNDRYDT-----KVVPALELAYEQIPVDVYWTIITIAAIVTQLDCLIT  249

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
              S     L   G+                 K++ IL  L+K +    Q+I   K+  + K
Sbjct  250   ESEHKQELSHYGQ-----------------KINIILSRLRKQITVCRQQIDTAKYIQELK  292

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDI---LRRKYVFLLVSD  1446
                  L +T T+       +I  ++ P  +  GA     K  +DI   L++K V+L VS 
Sbjct  293   ----KLLQTPTEITVVLSFLIFPKDVPQLLYDGAT----KTTVDINVVLKKKNVYLFVST  344

Query  1447  LDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPW  1626
             LD+  E IT +R +Y     +  +   Q++IVW+PIV+    W      +F +++S MPW
Sbjct  345   LDVTEEEITAVRSVY-----ESIKTNEQYKIVWIPIVE---GWNEQLRKKFDILRSKMPW  396

Query  1627  FSVSHPSKIDEAVYGYLN  1680
             + V +   I  A + ++N
Sbjct  397   YVVQNVENI--AGFKFIN  412



>ref|XP_004288434.1| PREDICTED: uncharacterized protein LOC101297774 [Fragaria vesca 
subsp. vesca]
Length=671

 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 119/450 (26%), Positives = 213/450 (47%), Gaps = 48/450 (11%)
 Frame = +1

Query  376   SSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAIL  555
             +  D  ++D +  TH      +    L  ++E I+ RA  T+   VQ  Q     +    
Sbjct  20    AKSDKKILDDIYTTHVHADDSFDDDSLFIIVESILKRATQTVDKIVQGTQVHVEDI----  75

Query  556   EEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
             EE+   +  +  +          S E+         AH  TL++L  L+ Y W+AKA +T
Sbjct  76    EEQTPKANFSVPLCTLK----GISCEMQCKPPGEEIAHETTLAILHKLSKYSWEAKASLT  131

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKM  915
              AAFA ++GEF LLA L  ++ LA+S+A + ++P LL+ S+  +   + L E+  L    
Sbjct  132   LAAFAMEFGEFWLLAELRESNHLARSIAILKRLPVLLKPSQLHKRRQAIL-ELNNLIKAT  190

Query  916   LEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaavT  1095
             LEV   I    +I          Y +    EL+ +L  V  +         Y+ +   V 
Sbjct  191   LEVITCIDQFNKISI--------YDLKDVPELSGTLDHVPVD--------VYWAIMTVVA  234

Query  1096  CSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIKRK  1275
             C+  I  LL    D      +E ++S  + K+ ++L  L+  +      I  I++  K K
Sbjct  235   CATKI-TLLTSDED------KEFDLSPYSQKIHFVLNKLKTQLTICRARIEFIENYKKLK  287

Query  1276  ILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDI  1455
                  L RT T+     + ++  +++  P++  +  +     ++ILRRK V   +S LDI
Sbjct  288   ----KLFRTPTEIMEIFKGLLFTKDNVQPLVDCSTKQTV--SIEILRRKNVLFFISSLDI  341

Query  1456  PNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV  1635
              ++ I++L+ ++  +K+D     +Q++IVW+PIV++   WT     +F ++K+ MPW++V
Sbjct  342   TDDDISILKPVHEFTKKD-----NQYKIVWIPIVEQ---WTDELRKKFEILKNKMPWYTV  393

Query  1636  SHPSKID--EAVYGYLN*RRKPLLAVVDTQ  1719
              +   I   + +    N + KPLL V++ Q
Sbjct  394   QYSGPIAGIKFIKEEWNFKGKPLLVVMNPQ  423



>emb|CAN82617.1| hypothetical protein VITISV_012086 [Vitis vinifera]
Length=699

 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 126/466 (27%), Positives = 215/466 (46%), Gaps = 63/466 (14%)
 Frame = +1

Query  382   EDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHAT----IPG-YVQSVQTQPARLD  546
             E   ++ ++  THD +      + LL  +E+IM   H T    +PG Y  ++  +  R  
Sbjct  18    EQDILIKNILLTHDPNGCFLDSELLLCAMENIM--CHTTSEIRVPGLYFDAMARKIVR--  73

Query  547   AILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKA  726
                + +VV S      E      ++ S EI+   S   D+H+ T+ +  +L NY WDAK 
Sbjct  74    ---DIEVVGSQ-----EPLGLIIHKISREILCKCSVEGDSHTRTMVLFDMLRNYRWDAKV  125

Query  727   VITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKLA  906
             V+  AAFA  YG+  LL +  P +PLA S+A + Q+P       +  A+  + + +  LA
Sbjct  126   VLVLAAFATCYGQLWLLMQPCPVNPLAISIAMLKQLPS------NFSALRPRFKALNLLA  179

Query  907   DKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvka  1086
               M +V   II         +SL +K  V L KE       VT  Q   +  ++Y+V+K+
Sbjct  180   KAMADVAKCIIKF-------ESLPIK-DVKLDKETM----TVTKSQ---IYLSAYWVIKS  224

Query  1087  avTCSLVILNLLAVGRD---------YYssteeeleistltHKLSYILGDLQKAVQKSTQ  1239
              +TCS  I +L A+  +          Y            +  ++    +L   V K   
Sbjct  225   TLTCSSQIRDLTAMKLEQIIHRSNLACYKPLMFSEFHFRHSSSITVAAWELLSLVYK---  281

Query  1240  EIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRR  1419
              +G+I  T   + L +    T  DN+    ++    +D TP+I  +    KK G+  L+ 
Sbjct  282   -LGRICKTKLHQKLLDLSEETQVDNQEVLHMLFALRDD-TPLIDCSS--QKKLGVSELKN  337

Query  1420  KYVFLLVSDLD-IP-NEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             K V  +VS  + +P  E++ +++  Y     +  + E  +EIVW+PI    + WT A+E 
Sbjct  338   KVVICMVSKPEPLPIEELLFLVQQTYDHPHHN--KLERSYEIVWVPIPSSDT-WTEAEER  394

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              F  +  S+PW+SV  P  +   V  ++    N + +P++ V+D+Q
Sbjct  395   SFDFLCYSLPWYSVRQPWLLCSEVVTFIKQKWNFKDEPIMVVLDSQ  440



>ref|XP_008224078.1| PREDICTED: uncharacterized protein LOC103323835 [Prunus mume]
Length=681

 Score =   102 bits (253),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 114/429 (27%), Positives = 211/429 (49%), Gaps = 56/429 (13%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDA  549
             L +  D  +++ + ATH  +   + V  L  + E+I+ R+   +   VQ  Q     +D 
Sbjct  29    LFTMSDNKILELIYATHVHEDDSFDVDSLFLVTENIIKRSTQNVDSIVQGTQVHVDTID-  87

Query  550   ILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRD-----AHSITLSVLKLLANYWW  714
                EK   +       +F+ P    + + IG   S +      +H  TL++L  ++NY W
Sbjct  88    ---EKPPKA-------SFSSPL--CTLKSIGCEMSCKPPGEEISHKSTLAILNKVSNYSW  135

Query  715   DAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREV  894
             ++KAV+  AAFA +YGEF LLA+++ +D LAKS+A + ++P LL+ ++  +   + + E+
Sbjct  136   ESKAVLALAAFALEYGEFWLLAKIHQSDLLAKSLAILKRVPVLLKPADLQKRRQA-VMEL  194

Query  895   AKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
               L    L+V   I  L+++ +        Y       LA ++  +  +         Y+
Sbjct  195   NVLIKTTLQVIECIFQLEKLST--------YDPKDVPALAVAMDHIPVD--------VYW  238

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKI  1254
              +   V C+  I  L +    +Y       ++S    K+ YIL  L+  +    ++I + 
Sbjct  239   SIITIVACATKITLLTSDEEKHY-------DLSQFAQKIHYILNKLKIQLLICKKQIEEA  291

Query  1255  KHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFL  1434
             +   K + L +T A      K     +I  ++   PII G+    K   +D+LRRKYV L
Sbjct  292   ETYRKLRKLFQTPAEVMEVFK----ALIFTKDTVQPIIDGS--TNKTVNIDVLRRKYVLL  345

Query  1435  LVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKS  1614
              +S LDI ++ I++L+ +Y     + ++ E +++IVW+PIV++   WT     +F L+++
Sbjct  346   FISTLDISDDDISILKPVY-----EGTKKEDKYKIVWIPIVEQ---WTDELRKKFELLRA  397

Query  1615  SMPWFSVSH  1641
              MPW++V +
Sbjct  398   KMPWYTVQY  406



>gb|KDO54550.1| hypothetical protein CISIN_1g015053mg [Citrus sinensis]
Length=355

 Score = 97.8 bits (242),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 95/322 (30%), Positives = 152/322 (47%), Gaps = 34/322 (11%)
 Frame = +1

Query  373   ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV-QTQPARLDA  549
             AS +   MM  V A H  D     V+P+L +IEDI  RA AT P  +  V       +DA
Sbjct  12    ASDDSAKMMKQVLANHAPDGHEVDVRPILSIIEDIFRRATAT-PSNIDGVPNGTQEHMDA  70

Query  550   ILEEK--VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAK  723
             + + K     SG  E +    +   +   EI    S   DA + T+++   L++Y WD K
Sbjct  71    LHDNKSPAAFSGTPEPLSDIIH---KICCEISCKCSGGGDALATTMALFNTLSSYSWDTK  127

Query  724   AVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKL  903
              V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E       +  +L E+  L
Sbjct  128   MVLSLAAFAVNYGEFWLVAQLCTENSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNL  184

Query  904   ADKMLEVTHKIIALKEIGSE---EKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyy  1074
                ML++T+ I+  K++ S+        +    + Y+    +   + A            
Sbjct  185   IGAMLDLTNCIVEFKQLPSQYISNDGQAMSMDQAHYQAAYWTFRSIVA------------  232

Query  1075  vvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLS--YILGDLQKAVQKSTQEIG  1248
                    C+  IL+L  +  +Y +ST +ELE+STL HK+S  ++  +L+K +    Q+I 
Sbjct  233   -------CNSRILSLRGLRHEYTASTTDELELSTLAHKVSNIHVYENLKKQIDFWRQQID  285

Query  1249  KIKHTIKRKILEETLARTHTDN  1314
             KI+   +   L   L + + DN
Sbjct  286   KIRQIEEYNNLVRLLQKNNQDN  307



>ref|XP_010904539.1| PREDICTED: uncharacterized protein LOC105031937 [Elaeis guineensis]
Length=595

 Score =   100 bits (248),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 100/363 (28%), Positives = 182/363 (50%), Gaps = 33/363 (9%)
 Frame = +1

Query  646   YSS-NRDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVAT  822
             YSS +R  H+ T++VL+LL  + W  K VI  AA A  +G+F L+ +LYPT+PLA S+A+
Sbjct  4     YSSMDRSLHATTMAVLELLGKHSWSTKLVIVLAAVATSFGDFWLITQLYPTNPLALSIAS  63

Query  823   IVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLY  1002
             +  + + +E    ++++  KL+    L +KM+ VT  ++       E + L ++Y    Y
Sbjct  64    MKGLRNKIE---VTKSLEQKLKAFRYLVEKMVSVTKCMV-------EFEMLPMQYTTLDY  113

Query  1003  KELAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistlt  1182
               +A   + +      ++        +++V C+  I +L+ +  ++ S+     E+ +  
Sbjct  114   DAMAAMKTQIHIASYWVI--------RSSVACTSQITSLIVLSFEHTSTITATWELWSSA  165

Query  1183  HKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTP  1362
              K+S +   L+K      Q+I    ++    + EE     H DN+     +   ++D  P
Sbjct  166   RKVSDMDNFLKKQFNIFHQQIENKINSGLSHLFEE----VHLDNQKVLSTLFALKDD-YP  220

Query  1363  IIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIV  1542
             +      E  K G+ +LR K V L +S L I  E + ++        Q+ S  E  F IV
Sbjct  221   LRDYRSEE--KVGVVVLRNKEVILFISTLTIKLEKLLLIIQQLQNHPQNES--EKPFVIV  276

Query  1543  WLPIVDRRSPWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVV  1710
             W+PIV    PW+ A+E  F  + + MPW+S+  PSK+  +V  ++    + +  P++ V+
Sbjct  277   WVPIV-FSIPWSDAEERAFKKMANIMPWYSLYEPSKLSLSVTKFIQEMWHFQGDPIMVVL  335

Query  1711  DTQ  1719
             DT+
Sbjct  336   DTK  338



>gb|AES61036.2| sieve element occlusion protein [Medicago truncatula]
Length=668

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 119/452 (26%), Positives = 204/452 (45%), Gaps = 55/452 (12%)
 Frame = +1

Query  385   DTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEK  564
             D  +M  + +TH      + V+ L ++  +I+ R+   +   VQ  Q     LD      
Sbjct  26    DIQIMGEIYSTHVHSDTKFDVESLFNIAANILRRSTYIVENVVQGNQGGLEPLDN-----  80

Query  565   VVHSGLNEAIEAFAYPAY---RTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAKAVIT  735
                        +F  P     + + E+       + A+  TL++LK L+N  W  K V+T
Sbjct  81    ------THPPASFTPPLCILKKINSEMSCKAPGEKIAYETTLTILKKLSNNLWVEKGVLT  134

Query  736   FAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLL--EssessravssKLREVAKLAD  909
              +AFA +YGEF  L++  PT+PLAKS+A + ++P L   E+ +  R    +L  + K   
Sbjct  135   LSAFAIEYGEFWNLSQHLPTEPLAKSLAIMKRVPQLTKTEALKKHRNEILELNNLIKATW  194

Query  910   KMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMakasyyvvkaa  1089
             K++E+   II L+ + S     KV       +E      PV      I        ++  
Sbjct  195   KVIEI---IIELERLNSLHDIKKVPALALALEEF-----PVDVFWVIITIVTIVTQIECL  246

Query  1090  vTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKSTQEIGKIKHTIK  1269
              T S     L   G                 HK+S I+  L   V + T  I + ++   
Sbjct  247   TTDSNSRQKLSQFG-----------------HKISIIINKLTNHVAQCTIYIDEAEYI--  287

Query  1270  RKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDL  1449
              K+L++ L +T T+     +++I  ++ P   I+    +     +++L++K VFL +S L
Sbjct  288   -KLLKK-LFQTPTEVMEVFKVLIFRKDAPKESIYDGSTKTLV-DIEVLKKKEVFLFISTL  344

Query  1450  DIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKEDQFTLVKSSMPWF  1629
             +I  E I++L  +Y   K+      SQ++IVW+P+VD    WT     +F  +KS MPW+
Sbjct  345   NISQEDISILIPIYDHLKE----TGSQYKIVWIPVVDE---WTDKLRKKFDSLKSKMPWY  397

Query  1630  SVSH--PSKIDEAVYGYLN*RRKPLLAVVDTQ  1719
              + H  P K  + +   L+  +KPL+ V+  Q
Sbjct  398   VLHHFAPIKGIKYIKEELHFNQKPLVVVLSPQ  429



>ref|XP_008224130.1| PREDICTED: uncharacterized protein LOC103323887 [Prunus mume]
Length=757

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 215/466 (46%), Gaps = 72/466 (15%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVH--YKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARL  543
             L +  DT +++ + ATH V   H    V  L  + E I+  +       V  ++    R+
Sbjct  30    LFARTDTKILEGIYATHVVCHEHDALNVDSLFSITESILKCSKQI----VDHIEQMTPRV  85

Query  544   DAILEEKVVHSGLNEAIEAFAYP-AYRTSFEIIGGYS--------SNRDAHSITLSVLKL  696
             +A            E I+    P  + T+  I+              +++H  TL +L  
Sbjct  86    NA------------ETIDGITIPPNFSTTLCILKSIVREVPCKAPGEKNSHDATLKILSK  133

Query  697   LANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravs  876
             +  Y W+AKAV+  AAF+ +YGEF L+A+   +D LAKSVA +  +P LL+     +   
Sbjct  134   VPKYSWEAKAVLALAAFSLEYGEFWLIAQHQRSDQLAKSVACLKGVPVLLKPENLKQRGK  193

Query  877   sKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIM  1056
             + L ++  +    LEV   I+ L+++             S+Y E+ E    +T+ +++I 
Sbjct  194   A-LAQLNNMIMTTLEVIDCILELEKLS------------SIYNEVKELREILTSARKDI-  239

Query  1057  akasyyvvkaavTCSLVILNLLAVGRDYYssteeelei---stltHKLSYILGDLQKAVQ  1227
                        V     I+  +A G ++   T +E +         K++ IL +L+  ++
Sbjct  240   ----------PVNVYWCIVTTVACGTNFTLLTSDEGKSHDLVQYAQKITIILKNLKGQLK  289

Query  1228  KSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLD  1407
                +EI K++  +K K L +         K    LI   ++  T I +G   ++ +  +D
Sbjct  290   SCNKEIEKLQTYMKLKQLFQVPTEIMEAIK---TLIFFKDDMKTTIFYGFTKKLVQ--ID  344

Query  1408  ILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAK  1587
             ILR+K + L +S L+I +  I++     LE   + ++ + +++IVW+PI +    W   +
Sbjct  345   ILRKKNMLLFISSLNISDGYISL-----LEPIHELTKKKDEYKIVWIPIAEE---WHEEQ  396

Query  1588  EDQFTLVKSSMPWFSV----SHPSKIDEAVYGYLN*RRKPLLAVVD  1713
             + +F  ++  MPW+++    +H S I + +    N + KP+L V++
Sbjct  397   QIKFQTLRDKMPWYTINQTNAHISGI-KYIKEDWNFKGKPMLVVLN  441



>ref|XP_008224484.1| PREDICTED: uncharacterized protein LOC103324225 [Prunus mume]
Length=688

 Score = 98.2 bits (243),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 118/468 (25%), Positives = 211/468 (45%), Gaps = 73/468 (16%)
 Frame = +1

Query  370   LASSEDTAMMDHVRATHDVDAVH--YKVKPLLHLIEDIMPRAHATIPGYVQSVQTQPARL  543
             L S  DT +++ + ATH V   H  + V  L  + E I+  +   +              
Sbjct  30    LFSMTDTEILEGIYATHVVSHEHDRFDVHSLFSITESILKCSKQIVDN------------  77

Query  544   DAILEEKV--VHSGLNEAIEAFAYPAYRTSFEIIGGYS--------SNRDAHSITLSVLK  693
                +E+KV  VH+   E I     P + T   ++              ++AH  TL +L 
Sbjct  78    ---IEQKVPRVHAETMEGITI--TPGFSTPLCVLKSIVREVPCKAPGEKNAHDATLKILS  132

Query  694   LLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessrav  873
              ++ Y W+AKAV+  AAF+ +YGEF L A+   +D LA SVA +  +P LL+     +  
Sbjct  133   KVSKYSWEAKAVLALAAFSLEYGEFWLSAQHQQSDQLAMSVAFLKGVPILLKPENLKK--  190

Query  874   ssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENI  1053
               + R +  L + ++     I  + ++   EK        S Y ++ E L  + A     
Sbjct  191   --RGRAITDLNNVIMSTLQVIDCIFQL---EKH-------STYNDVKE-LREILANARKD  237

Query  1054  MakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSYILGDLQKAVQKS  1233
             ++   Y+ +   V C+    N+  +  D         ++     K++ IL  L++ ++  
Sbjct  238   ISVNVYWCIITTVACAT---NITLLTSD----EGNSQDLVQYAQKITIILSKLKQQLKIC  290

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDIL  1413
              +EI K++  +K K L +         K    LI    N  T I  G+  ++    +DIL
Sbjct  291   EEEIEKLQAYMKLKQLFQIPTEIMEVMKI---LIFFKHNVETTIFDGSTKKLV--NIDIL  345

Query  1414  RRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVDRRSPWTGAKED  1593
             + K V L +S L+I  + I  L+ +Y     D ++  ++++IVW+PIV++   WT   + 
Sbjct  346   KTKNVLLFISSLEISEDYIARLKPIY-----DFTKENNEYKIVWIPIVEK---WTEDLQP  397

Query  1594  QFTLVKSSMPWFSVSHPSKIDEAVYG--YL----N*RRKPLLAVVDTQ  1719
             +F  +++ MPW++V      D  + G  Y+    N   KP+L V++T+
Sbjct  398   KFEALRAKMPWYTVGQA---DAHIAGIKYIKEDWNFNGKPMLVVLNTK  442



>ref|XP_008224486.1| PREDICTED: uncharacterized protein LOC103324227 [Prunus mume]
Length=808

 Score = 98.2 bits (243),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 95/360 (26%), Positives = 173/360 (48%), Gaps = 40/360 (11%)
 Frame = +1

Query  658   RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIP  837
             ++AH  TL +L  ++ Y W+AKAV+  AAF+ +YGEF L A+   +D LA SVA +  +P
Sbjct  99    KNAHDATLKILSKVSKYSWEAKAVLALAAFSLEYGEFWLSAQHQQSDQLAMSVAFLKGVP  158

Query  838   DLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAE  1017
              LL+     +    + R +  L + ++     I  + ++         KY ++ Y ++ E
Sbjct  159   ILLKPENLKK----RGRAITDLNNVIMSTLQVIDCIFQLE--------KYSIT-YNDVKE  205

Query  1018  SLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeeleistltHKLSY  1197
              L  + A     ++   Y+ +   V C+    N+  +  D         ++     K++ 
Sbjct  206   -LREILANARKDISVNVYWCIITTVACAT---NITLLTSD----EGNSHDLVQYAQKITI  257

Query  1198  ILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGA  1377
             IL  L++ ++   +EI K++  +K K L +         K    LI    N  T I  G+
Sbjct  258   ILNKLKQQMKICKEEIEKLQTYMKLKQLFQIPTEIMEVMKI---LIFFKHNAETTIFDGS  314

Query  1378  GLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIV  1557
               ++    +DILR K V L +S L+I  + I  LR +Y     D ++  ++++IVW+PIV
Sbjct  315   TEKLV--NIDILRTKNVLLFISSLEISEDYIARLRPVY-----DFTKDNNEYKIVWIPIV  367

Query  1558  DRRSPWTGAKEDQFTLVKSSMPWFSVSHPS------KIDEAVYGYLN*RRKPLLAVVDTQ  1719
             ++   WT   + +F  +++ MPW++V          K  + +    N   KP+L V++T+
Sbjct  368   EK---WTKDLQRKFEALRAKMPWYTVGQAGAHIAGIKCIKYIKEDWNFNGKPMLVVLNTK  424



>ref|XP_010040608.1| PREDICTED: uncharacterized protein LOC104429456 [Eucalyptus grandis]
Length=633

 Score = 97.8 bits (242),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 86/143 (60%), Gaps = 9/143 (6%)
 Frame = +1

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             H I+++++       H DN    + +I  E+D  P++ G      + GL++LR+K V LL
Sbjct  281   HLIQKRLMR-LFDEIHLDNLTMLKHLIYAEDDIQPLVDGT--TKSRVGLEVLRKKTVLLL  337

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVD---RRSPWTGAKEDQFTLV  1608
             +SDLDI  E + +L H+Y ES+   +R E+QFEIVWLPIVD   + + W    +  F  +
Sbjct  338   ISDLDISFEDMELLDHIYRESR---ARPENQFEIVWLPIVDIAPKSAAWDMTHQQIFETL  394

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL  1677
             +S MPW++V HPS ++ AV  Y+
Sbjct  395   QSIMPWYTVHHPSILEPAVIKYI  417



>gb|KDO54553.1| hypothetical protein CISIN_1g015053mg [Citrus sinensis]
Length=346

 Score = 94.7 bits (234),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 67/200 (34%), Positives = 101/200 (51%), Gaps = 10/200 (5%)
 Frame = +1

Query  373  ASSEDTAMMDHVRATHDVDAVHYKVKPLLHLIEDIMPRAHATIPGYVQSV-QTQPARLDA  549
            AS +   MM  V A H  D     V+P+L +IEDI  RA AT P  +  V       +DA
Sbjct  12   ASDDSAKMMKQVLANHAPDGHEVDVRPILSIIEDIFRRATAT-PSNIDGVPNGTQEHMDA  70

Query  550  ILEEK--VVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLLANYWWDAK  723
            + + K     SG  E +    +   +   EI    S   DA + T+++   L++Y WD K
Sbjct  71   LHDNKSPAAFSGTPEPLSDIIH---KICCEISCKCSGGGDALATTMALFNTLSSYSWDTK  127

Query  724  AVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravssKLREVAKL  903
             V++ AAFA  YGEF L+A+L   + LA SVA + Q+P   E       +  +L E+  L
Sbjct  128  MVLSLAAFAVNYGEFWLVAQLCTENSLANSVAVLKQLP---EIPAGYDGLKPQLDELNNL  184

Query  904  ADKMLEVTHKIIALKEIGSE  963
               ML++T+ I+  K++ S+
Sbjct  185  IGAMLDLTNCIVEFKQLPSQ  204



>gb|KDP46376.1| hypothetical protein JCGZ_10216 [Jatropha curcas]
Length=1116

 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 122/446 (27%), Positives = 224/446 (50%), Gaps = 60/446 (13%)
 Frame = +1

Query  445   VKPLLHLIEDIMPRAHATIPGYVQSVQTQPARLDAILEEKVVHSGLNEAI---EAFAYPA  615
             VKPLL+L+EDI+ RA       +++V +    + A +E+    S   EA+   E F +  
Sbjct  61    VKPLLNLVEDIVNRA-------IRNVTSTVLDIRAYMED---DSHQEEAVYLRENFNFIL  110

Query  616   YRTSFEIIGGYSSNRDAHSITLSVL-KLLANYWWDAKAVITFAAFAQQYGEFGLLARLYP  792
              + S++I    SS    H    S+L K+L ++ W+ + ++T  AFA  YGE   LA +Y 
Sbjct  111   DQISYKIAYHTSSKEHPHRTVKSILFKILKDHSWEDRLILTLTAFALNYGECWHLALIYS  170

Query  793   TDPLAKSVATIVQIPDLLEssessravssKLREVAKLADKMLEVTHKIIALKEIGSEEKS  972
             +  LA+S++ + Q+ D+    +     S  L+ V  L   +++VT  II  +        
Sbjct  171   SRQLAESLSILKQVADI---HKQPDHSSPPLQAVNDLVMAIMDVTRCIIDFQ--------  219

Query  973   LKVKYRVSLYKELAESLSPVTA-EQENIMakasyyvvkaavTCSLVILNLLAVGRDYYss  1149
              +V+Y++    +    L P+ A E+ N +  A Y+ +++ +  +  I   +++G +Y  S
Sbjct  220   -RVQYQLGRLNK--SKLEPLEAMERVNYIPIAIYWTIRSVLVAASKITRFISMGLNYVIS  276

Query  1150  teeeleistltHKLSYILGDLQKAVQKSTQEIGKI--KHTI--KRKILEETLARTHTDNK  1317
               E+ E+      L+ +L + ++ +QK  ++      + TI  +++I++  +     DN 
Sbjct  277   GIEKAELI----DLTEVLTEKRQRLQKLKEDFNSCLEEATILKRQEIIKSLMEVPQVDNM  332

Query  1318  YSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLE  1497
                  +   +NDP  +I     + +K  L++LR+K V LL+SDLDI  E I ++  +Y +
Sbjct  333   NILRALFYYKNDPQQLIQ----KQEKFELEVLRKKLVLLLISDLDISEEDIRIVEDIYSK  388

Query  1498  SKQDPSRAESQFEIVWLPIVDRRSPWTGAKED---QFTLVKSSMPWFSVSHPSKIDEAV-  1665
             S        ++ EIVWLPI+D+   W   +ED   +F   +S+M W++V  PS I + V 
Sbjct  389   STTKTGHQANRLEIVWLPIIDQPKDW--EREDTKVKFEKKQSAMKWYTVHQPSLIAKEVI  446

Query  1666  --------YGYLN*RRKPLLAVVDTQ  1719
                     +G     ++P++ V+D Q
Sbjct  447   KLAKEEWHFG-----KQPIIVVIDAQ  467



>ref|XP_007225527.1| hypothetical protein PRUPE_ppa026573mg [Prunus persica]
 gb|EMJ26726.1| hypothetical protein PRUPE_ppa026573mg [Prunus persica]
Length=722

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 96/362 (27%), Positives = 180/362 (50%), Gaps = 51/362 (14%)
 Frame = +1

Query  658   RDAHSITLSVLKLLANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIP  837
             +++H  TL +L  +  Y W+AKAV+  A+F+ +YGEF L A+   +D LAKSVA +  +P
Sbjct  86    KNSHDATLKILSKVPKYSWEAKAVLALASFSLEYGEFWLTAQHQRSDQLAKSVACLKGVP  145

Query  838   DLLEssessravssKLREVAKLADKM---LEVTHKIIALKEIGSEEKSLKVKYRVSLYKE  1008
              LL+       +  + + VA+L + +   LEV   I+ L+++             S+Y E
Sbjct  146   VLLK----PENLKQRGKSVAQLNNVIMSTLEVIDCILELEKLS------------SIYNE  189

Query  1009  LAESLSPVTAEQENIMakasyyvvkaavTCSLVILNLLAVGRDYYssteeelei---stl  1179
             + E    +T+ +++I           +V     I+  +A G ++   T +E +       
Sbjct  190   VKELREILTSARKDI-----------SVNVYWCIITTVACGTNFTLLTSDEGKSHDLVQY  238

Query  1180  tHKLSYILGDLQKAVQKSTQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGENDPT  1359
               K++ IL +L+  ++   +EI K++  +K K     L +  T+   + + +I  ++D  
Sbjct  239   AQKITIILKNLKGQLKSCNKEIEKLQIYMKLK----QLFQIPTEIMEAIKTLIFFKDDMK  294

Query  1360  PIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEI  1539
               I   G   K   +DILR K V L +S L+I +  I++     LE   + ++   +++I
Sbjct  295   TTIFD-GFTKKLVQIDILRTKNVLLFISSLNISDGYISL-----LEPIHELTKKNDEYKI  348

Query  1540  VWLPIVDRRSPWTGAKEDQFTLVKSSMPWFSV----SHPSKIDEAVYGYLN*RRKPLLAV  1707
             VW+PI +    W   ++ +F  ++  MPW+++    +H S I + V    N + KP+L V
Sbjct  349   VWIPIAEE---WHEQQQIKFQTLRDKMPWYTINQTNAHISGI-KYVKEDWNFKGKPMLVV  404

Query  1708  VD  1713
             ++
Sbjct  405   LN  406



>ref|XP_010045508.1| PREDICTED: uncharacterized protein LOC104434233 [Eucalyptus grandis]
Length=1094

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 84/143 (59%), Gaps = 9/143 (6%)
 Frame = +1

Query  1258  HTIKRKILEETLARTHTDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLL  1437
             H I++ ++       H DN    + +I  E+D  P++ G      + GL++LR+K V LL
Sbjct  395   HLIQKHLIR-LFDEIHLDNMTMLKHLIYAEDDIQPLVDGT--TKSRVGLEVLRKKTVLLL  451

Query  1438  VSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVD---RRSPWTGAKEDQFTLV  1608
             +SDLDI  E + +L H+Y ES+   +R E+QFEIVW PIVD   + + W    +  F  +
Sbjct  452   ISDLDISFEDMVLLDHIYRESR---ARPENQFEIVWFPIVDIDPKSAAWDMTHQQIFETL  508

Query  1609  KSSMPWFSVSHPSKIDEAVYGYL  1677
             +S MPW++V HPS ++ AV  Y+
Sbjct  509   QSIMPWYTVHHPSILEPAVIKYI  531


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 78/135 (58%), Gaps = 9/135 (7%)
 Frame = +1

Query  1285  ETLARTH-TDNKYSAELIICGENDPTPIIHGAGLEMKKHGLDILRRKYVFLLVSDLDIPN  1461
             +TL R    DN    + +I  +ND  P++ G      +  L++LR+K V LL+SDLDI  
Sbjct  35    QTLVRLFDVDNMTILKHLIYAKNDIQPLVDGT--TRLRVSLEVLRKKTVLLLISDLDIAI  92

Query  1462  EVITMLRHMYLESKQDPSRAESQFEIVWLPIVD---RRSPWTGAKEDQFTLVKSSMPWFS  1632
             E I  L ++Y E     +R E+QFE+VWLPIVD   + +      + +F  ++S MPW++
Sbjct  93    EDIEFLNYIYREYH---ARPENQFEMVWLPIVDIDPKSAASDMTHQQKFEELQSIMPWYT  149

Query  1633  VSHPSKIDEAVYGYL  1677
             V HPS ++ AV  Y+
Sbjct  150   VHHPSILEPAVIRYI  164


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +1

Query  1402  LDILRRKYVFLLVSDLDIPNEVITMLRHMYLESKQDPSRAESQFEIVWLPIVD---RRSP  1572
             L+ LR+K V LL+SD DI  E I +L  MY ES   P   E++FEIVWLPIVD   + + 
Sbjct  787   LEELRKKTVLLLISDFDIATEDIELLNRMYRESNAMP---ENRFEIVWLPIVDIDPQSAA  843

Query  1573  WTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL  1677
             W    + +F  ++SSM W++V HP  ++  +  Y+
Sbjct  844   WDVIHQQKFEELQSSMSWYTVHHPLILEPVMIKYI  878



>ref|XP_007044876.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY00708.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=634

 Score = 95.5 bits (236),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 106/414 (26%), Positives = 193/414 (47%), Gaps = 54/414 (13%)
 Frame = +1

Query  520   VQTQPARLDAILEEKVVHSGLNEAIEAFAYPAYRTSFEIIGGYSSNRDAHSITLSVLKLL  699
             V  +PA  DA L+  + +  L  + E   +  Y+ + E++       D H+ T+++  LL
Sbjct  9     VSDKPA--DANLKSHISNIELIGSQEPLVHTIYKIAHEMLCKCPGKGDLHTRTMALFDLL  66

Query  700   ANYWWDAKAVITFAAFAQQYGEFGLLARLYPTDPLAKSVATIVQIPDLLEssessravss  879
              NY W AK  +  A FA  YGEF L+ +L P   LA S+A   Q+P       S   +  
Sbjct  67    GNYGWAAKVTLALAGFATSYGEFCLIMQLRPHISLAVSLADFKQLPS------SISILKP  120

Query  880   KLREVAKLADKMLEVTHKIIALKEIGSEEKSLKVKYRVSLYKELAESLSPVTAEQENIMa  1059
             +++ +  L   M+++T  II  + + +            L     E+L+ + +E    + 
Sbjct  121   QVKALRLLVKTMVDLTKCIIEFEGLPA-----------VLVGPYIENLAAMKSE----IY  165

Query  1060  kasyyvvkaavTCSLVILNLLAVGRD--YYssteeeleistltHKLSYILGDLQKAVQKS  1233
               +Y+++++ + CS  I NL A+  +  Y +      E+ +L ++LS I   L+  V   
Sbjct  166   VTAYWIIRSTLACSSQITNLKAMKPEQVYSNIIIAAWELLSLDYRLSSIYSHLRPLVDAF  225

Query  1234  TQEIGKIKHTIKRKILEETLARTHTDNKYSAELIICGEND------PTPIIHGAGLEMKK  1395
              Q+     H     + EE    +H DN+   +++   ++D      PT +         K
Sbjct  226   RQQTEAKLHQKLLNLFEE----SHIDNQEVLQMLFALKDDLPLKDCPTQV---------K  272

Query  1396  HGLDILRRKYVFLLVSDLD-IPNEVITMLRHMYLESKQDP-SRAESQFEIVWLPIVDRRS  1569
              G+  L+ K V LLVS  D +P E +  L H   ++   P  + E  +E++W+PI    +
Sbjct  273   LGVSELKSKVVLLLVSKPDLLPLEQLFFLVH---QTYDHPHKKVEGSYEMIWVPISCSET  329

Query  1570  PWTGAKEDQFTLVKSSMPWFSVSHPSKIDEAVYGYL----N*RRKPLLAVVDTQ  1719
              WT A+E  F  + +S+P +SV  P  ++ AV  ++    N   + ++ V+D++
Sbjct  330   -WTDAEEKWFNFLSNSIPCYSVRQPWSLNSAVINFMKQEWNYGDEAIMVVLDSE  382



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4921153598812