BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25798_g3_i1 len=1540 path=[12976:0-66 13808:67-71 13813:72-83
13825:84-92 6707:93-1539]

Length=1540
                                                                      Score     E

ref|XP_011075343.1|  PREDICTED: zeatin O-glucosyltransferase-like       472   1e-158   
ref|XP_009596925.1|  PREDICTED: zeatin O-glucosyltransferase-like       464   1e-155   
ref|XP_009768605.1|  PREDICTED: zeatin O-glucosyltransferase-like       461   2e-154   
emb|CDP14134.1|  unnamed protein product                                454   1e-151   
ref|XP_011078913.1|  PREDICTED: zeatin O-glucosyltransferase-like       453   4e-151   
ref|XP_011075345.1|  PREDICTED: zeatin O-glucosyltransferase-like       449   1e-149   
emb|CDP12478.1|  unnamed protein product                                447   2e-149   
ref|XP_009782889.1|  PREDICTED: zeatin O-glucosyltransferase-like       448   3e-149   
ref|XP_004249235.1|  PREDICTED: zeatin O-glucosyltransferase-like       445   2e-148   
ref|XP_009796347.1|  PREDICTED: zeatin O-glucosyltransferase-like       444   5e-148   
ref|XP_009600543.1|  PREDICTED: zeatin O-glucosyltransferase-like       445   6e-148   
ref|XP_009626493.1|  PREDICTED: zeatin O-glucosyltransferase-like       444   2e-147   
ref|XP_009760629.1|  PREDICTED: zeatin O-glucosyltransferase-like       443   2e-147   
ref|XP_009586606.1|  PREDICTED: zeatin O-glucosyltransferase-like       440   2e-146   
ref|XP_009595637.1|  PREDICTED: zeatin O-glucosyltransferase-like       439   8e-146   
ref|XP_009796345.1|  PREDICTED: zeatin O-glucosyltransferase-like       439   9e-146   
dbj|BAK55742.1|  UDP-glucose glucosyltransferase                        439   1e-145   
ref|XP_009589266.1|  PREDICTED: zeatin O-glucosyltransferase-like       440   1e-145   
emb|CDP14133.1|  unnamed protein product                                438   3e-145   
emb|CDP14137.1|  unnamed protein product                                436   8e-145   
emb|CDP14138.1|  unnamed protein product                                437   1e-144   
ref|XP_009783803.1|  PREDICTED: zeatin O-glucosyltransferase-like       435   2e-144   
gb|EYU18710.1|  hypothetical protein MIMGU_mgv1a005799mg                435   2e-144   
gb|EYU20759.1|  hypothetical protein MIMGU_mgv1a017976mg                434   6e-144   
ref|XP_002284381.1|  PREDICTED: zeatin O-glucosyltransferase-like       432   3e-143   Vitis vinifera
ref|XP_009766032.1|  PREDICTED: zeatin O-glucosyltransferase-like       431   1e-142   
ref|XP_006351251.1|  PREDICTED: zeatin O-glucosyltransferase-like       429   3e-142   
ref|XP_011075344.1|  PREDICTED: zeatin O-glucosyltransferase-like       431   4e-142   
emb|CDP14139.1|  unnamed protein product                                429   4e-142   
ref|XP_006351250.1|  PREDICTED: zeatin O-glucosyltransferase-like       429   7e-142   
ref|XP_009625755.1|  PREDICTED: zeatin O-glucosyltransferase-like       429   9e-142   
ref|XP_002322723.2|  putative glucosyltransferase family protein        424   9e-140   Populus trichocarpa [western balsam poplar]
emb|CDP14140.1|  unnamed protein product                                422   2e-139   
ref|XP_009796092.1|  PREDICTED: zeatin O-glucosyltransferase-like       423   2e-139   
ref|XP_002278696.2|  PREDICTED: zeatin O-glucosyltransferase            424   2e-139   Vitis vinifera
ref|XP_004249229.2|  PREDICTED: zeatin O-glucosyltransferase-like       423   3e-139   
ref|XP_010269695.1|  PREDICTED: zeatin O-glucosyltransferase-like       424   4e-139   
ref|XP_011039446.1|  PREDICTED: zeatin O-glucosyltransferase-like...    422   4e-139   
ref|XP_004303646.1|  PREDICTED: zeatin O-glucosyltransferase-like       422   4e-139   
gb|KHN07349.1|  Zeatin O-glucosyltransferase                            423   6e-139   
ref|XP_003521165.2|  PREDICTED: zeatin O-glucosyltransferase-like       422   8e-139   
dbj|BAJ53203.1|  JHL06B08.4                                             421   2e-138   
ref|XP_006351249.1|  PREDICTED: zeatin O-glucosyltransferase-like       421   2e-138   
ref|XP_006475704.1|  PREDICTED: zeatin O-glucosyltransferase-like       421   2e-138   
ref|XP_006421301.1|  hypothetical protein CICLE_v10004886mg             420   2e-138   
ref|XP_010279538.1|  PREDICTED: zeatin O-glucosyltransferase-like       419   1e-137   
gb|EYU18711.1|  hypothetical protein MIMGU_mgv1a023637mg                415   1e-136   
ref|XP_010673139.1|  PREDICTED: zeatin O-glucosyltransferase-like       415   2e-136   
emb|CDP14132.1|  unnamed protein product                                413   4e-136   
ref|XP_010319172.1|  PREDICTED: zeatin O-glucosyltransferase-like       417   5e-136   
gb|KDP26082.1|  hypothetical protein JCGZ_21115                         413   7e-136   
ref|XP_002532135.1|  UDP-glucosyltransferase, putative                  414   7e-136   Ricinus communis
ref|XP_002308926.1|  putative glucosyltransferase family protein        414   8e-136   Populus trichocarpa [western balsam poplar]
ref|XP_009363193.1|  PREDICTED: zeatin O-glucosyltransferase-like...    413   1e-135   
ref|XP_010672878.1|  PREDICTED: zeatin O-glucosyltransferase-like...    413   1e-135   
gb|AAL92461.1|  putative glucosyltransferase                            412   2e-135   Solanum lycopersicum
ref|XP_004498042.1|  PREDICTED: zeatin O-glucosyltransferase-like       412   2e-135   
ref|XP_011075346.1|  PREDICTED: zeatin O-glucosyltransferase-like       412   3e-135   
ref|XP_010672879.1|  PREDICTED: zeatin O-glucosyltransferase-like...    412   5e-135   
ref|XP_006350170.1|  PREDICTED: zeatin O-glucosyltransferase-like       411   8e-135   
dbj|BAJ53204.1|  JHL06B08.5                                             411   1e-134   
ref|XP_004237101.1|  PREDICTED: zeatin O-glucosyltransferase-like       410   2e-134   
gb|KHN14960.1|  Zeatin O-glucosyltransferase                            411   3e-134   
ref|XP_004251001.1|  PREDICTED: zeatin O-glucosyltransferase-like       409   3e-134   
gb|AIE12482.1|  UGT11                                                   408   1e-133   
gb|KEH28644.1|  zeatin O-glucosyltransferase-like protein               407   1e-133   
ref|XP_002532137.1|  UDP-glucosyltransferase, putative                  405   6e-133   Ricinus communis
ref|XP_010279537.1|  PREDICTED: zeatin O-glucosyltransferase-like       407   8e-133   
emb|CDP14136.1|  unnamed protein product                                407   9e-133   
ref|XP_011048089.1|  PREDICTED: zeatin O-glucosyltransferase-like       405   1e-132   
ref|XP_006349063.1|  PREDICTED: zeatin O-glucosyltransferase-like       405   2e-132   
ref|XP_010671477.1|  PREDICTED: zeatin O-glucosyltransferase-like       405   2e-132   
gb|KDP26081.1|  hypothetical protein JCGZ_21114                         404   2e-132   
ref|XP_003519074.1|  PREDICTED: zeatin O-glucosyltransferase            404   3e-132   
gb|KEH20810.1|  zeatin O-glucosyltransferase-like protein               405   3e-132   
ref|XP_010279539.1|  PREDICTED: zeatin O-glucosyltransferase-like       404   4e-132   
gb|KEH40483.1|  zeatin O-glucosyltransferase-like protein               403   8e-132   
ref|XP_006351402.1|  PREDICTED: zeatin O-glucosyltransferase-like       403   1e-131   
ref|XP_004251002.1|  PREDICTED: zeatin O-glucosyltransferase-like       402   1e-131   
ref|XP_009777653.1|  PREDICTED: zeatin O-glucosyltransferase-like       403   1e-131   
ref|XP_007028692.1|  UDP-glucosyltransferase, putative                  401   1e-130   
ref|XP_004249252.1|  PREDICTED: zeatin O-glucosyltransferase-like       400   1e-130   
ref|XP_010672884.1|  PREDICTED: zeatin O-glucosyltransferase-like       399   3e-130   
emb|CAN74373.1|  hypothetical protein VITISV_010199                     427   3e-130   Vitis vinifera
ref|XP_009363195.1|  PREDICTED: zeatin O-glucosyltransferase-like...    399   6e-130   
ref|XP_010092094.1|  Zeatin O-glucosyltransferase                       399   6e-130   
gb|KDO36524.1|  hypothetical protein CISIN_1g039436mg                   394   7e-129   
ref|XP_002308931.2|  putative glucosyltransferase family protein        394   4e-128   Populus trichocarpa [western balsam poplar]
ref|XP_008346617.1|  PREDICTED: zeatin O-glucosyltransferase-like       392   1e-127   
ref|XP_010672888.1|  PREDICTED: zeatin O-glucosyltransferase-like       392   2e-127   
ref|XP_009628740.1|  PREDICTED: zeatin O-glucosyltransferase-like       392   2e-127   
ref|XP_004168290.1|  PREDICTED: zeatin O-glucosyltransferase-like       390   1e-126   
ref|XP_008244258.1|  PREDICTED: zeatin O-glucosyltransferase-like       390   1e-126   
ref|XP_009363212.1|  PREDICTED: zeatin O-glucosyltransferase-like       389   1e-126   
ref|XP_004150614.1|  PREDICTED: zeatin O-glucosyltransferase-like       388   4e-126   
ref|XP_010672887.1|  PREDICTED: zeatin O-glucosyltransferase-like       389   9e-126   
ref|XP_006351401.1|  PREDICTED: zeatin O-glucosyltransferase-like       384   4e-125   
ref|XP_010056886.1|  PREDICTED: zeatin O-glucosyltransferase-like       385   9e-125   
ref|XP_006351384.1|  PREDICTED: zeatin O-glucosyltransferase-like       385   1e-124   
ref|XP_008455786.1|  PREDICTED: zeatin O-glucosyltransferase-like...    383   6e-124   
gb|EYU20761.1|  hypothetical protein MIMGU_mgv1a022179mg                382   1e-123   
ref|XP_009400942.1|  PREDICTED: zeatin O-xylosyltransferase-like        381   3e-123   
ref|XP_007145587.1|  hypothetical protein PHAVU_007G251100g             380   5e-123   
gb|AAM09517.1|AF489877_1  putative glucosyltransferase                  380   7e-123   Phaseolus lunatus
ref|XP_010672886.1|  PREDICTED: zeatin O-xylosyltransferase-like        380   9e-123   
ref|XP_010673138.1|  PREDICTED: zeatin O-glucosyltransferase-like       380   1e-122   
ref|XP_007204339.1|  hypothetical protein PRUPE_ppa005515mg             379   2e-122   
ref|XP_010024031.1|  PREDICTED: zeatin O-glucosyltransferase-like       379   2e-122   
ref|XP_007028693.1|  UDP-glucosyltransferase, putative                  379   3e-122   
gb|KCW90138.1|  hypothetical protein EUGRSUZ_A02330                     378   4e-122   
sp|Q9ZSK5.1|ZOG_PHALU  RecName: Full=Zeatin O-glucosyltransferase...    377   5e-122   Phaseolus lunatus
ref|XP_006355036.1|  PREDICTED: zeatin O-glucosyltransferase-like       379   7e-122   
gb|AAM09516.1|AF489876_1  putative glucosyltransferase                  377   8e-122   Phaseolus lunatus
ref|XP_007140338.1|  hypothetical protein PHAVU_008G103900g             377   1e-121   
ref|XP_003537252.1|  PREDICTED: zeatin O-glucosyltransferase-like       376   2e-121   
ref|XP_003519079.1|  PREDICTED: zeatin O-glucosyltransferase-like       375   3e-121   
ref|XP_010673140.1|  PREDICTED: zeatin O-glucosyltransferase-like       375   5e-121   
ref|XP_007162168.1|  hypothetical protein PHAVU_001G129900g             375   9e-121   
gb|EPS57763.1|  hypothetical protein M569_17054                         374   1e-120   
gb|EYU20762.1|  hypothetical protein MIMGU_mgv1a027163mg                374   2e-120   
ref|XP_009624070.1|  PREDICTED: zeatin O-xylosyltransferase-like        374   3e-120   
ref|XP_007145588.1|  hypothetical protein PHAVU_007G251200g             373   4e-120   
ref|XP_009766031.1|  PREDICTED: zeatin O-glucosyltransferase-like       373   4e-120   
ref|XP_011078914.1|  PREDICTED: zeatin O-xylosyltransferase-like        372   8e-120   
ref|XP_010056748.1|  PREDICTED: zeatin O-glucosyltransferase-like       371   5e-119   
ref|XP_004249738.1|  PREDICTED: zeatin O-glucosyltransferase-like       370   1e-118   
ref|XP_009586605.1|  PREDICTED: zeatin O-xylosyltransferase-like        369   1e-118   
ref|XP_007145589.1|  hypothetical protein PHAVU_007G251300g             369   2e-118   
ref|XP_010056875.1|  PREDICTED: zeatin O-xylosyltransferase-like        368   3e-118   
ref|XP_010056814.1|  PREDICTED: zeatin O-glucosyltransferase-like       368   4e-118   
ref|XP_006367370.1|  PREDICTED: zeatin O-glucosyltransferase-like       368   6e-118   
gb|AAM09514.2|AF489874_1  zeatin O-glucosyltransferase                  367   7e-118   Glycine max [soybeans]
ref|XP_003535886.2|  PREDICTED: zeatin O-glucosyltransferase            367   1e-117   
ref|XP_009390153.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    364   9e-117   
gb|KCW90127.1|  hypothetical protein EUGRSUZ_A02318                     364   1e-116   
ref|XP_009796346.1|  PREDICTED: zeatin O-glucosyltransferase-like       363   3e-116   
gb|EYU37237.1|  hypothetical protein MIMGU_mgv1a026906mg                362   5e-116   
ref|XP_006355035.1|  PREDICTED: zeatin O-glucosyltransferase-like       363   6e-116   
ref|XP_006351248.1|  PREDICTED: zeatin O-glucosyltransferase-like       363   6e-116   
ref|XP_006356483.1|  PREDICTED: zeatin O-glucosyltransferase-like       362   6e-116   
ref|XP_009777022.1|  PREDICTED: zeatin O-xylosyltransferase-like        362   7e-116   
ref|XP_004243014.1|  PREDICTED: zeatin O-glucosyltransferase-like       361   1e-115   
ref|XP_004236911.1|  PREDICTED: zeatin O-xylosyltransferase-like        362   1e-115   
ref|XP_006366184.1|  PREDICTED: zeatin O-glucosyltransferase-like       361   2e-115   
ref|XP_004236593.1|  PREDICTED: zeatin O-xylosyltransferase-like        361   2e-115   
ref|XP_010024020.1|  PREDICTED: zeatin O-glucosyltransferase-like       360   3e-115   
gb|KCW90137.1|  hypothetical protein EUGRSUZ_A02329                     359   6e-115   
ref|XP_009614885.1|  PREDICTED: zeatin O-glucosyltransferase-like       360   7e-115   
ref|XP_008455780.1|  PREDICTED: zeatin O-glucosyltransferase-like       360   8e-115   
gb|AIE12481.1|  UGT12                                                   359   1e-114   
ref|XP_008455787.1|  PREDICTED: zeatin O-glucosyltransferase-like...    358   2e-114   
gb|KCW90135.1|  hypothetical protein EUGRSUZ_A02326                     358   2e-114   
ref|XP_010090213.1|  Zeatin O-xylosyltransferase                        357   8e-114   
ref|XP_007145586.1|  hypothetical protein PHAVU_007G251000g             356   1e-113   
ref|XP_006357999.1|  PREDICTED: zeatin O-glucosyltransferase-like       355   3e-113   
ref|XP_009600299.1|  PREDICTED: zeatin O-glucosyltransferase-like       354   6e-113   
ref|XP_009796343.1|  PREDICTED: zeatin O-glucosyltransferase-like       353   2e-112   
ref|XP_010056810.1|  PREDICTED: zeatin O-glucosyltransferase-like       353   3e-112   
ref|XP_010668171.1|  PREDICTED: zeatin O-glucosyltransferase-like       353   4e-112   
ref|XP_006351294.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    352   8e-112   
ref|XP_004236592.1|  PREDICTED: zeatin O-xylosyltransferase-like        352   8e-112   
ref|XP_009785030.1|  PREDICTED: zeatin O-glucosyltransferase-like       352   1e-111   
gb|EPS60351.1|  hypothetical protein M569_14451                         350   1e-111   
ref|XP_004249250.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    351   1e-111   
ref|XP_010112354.1|  Zeatin O-glucosyltransferase                       354   2e-111   
ref|XP_010910133.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    349   7e-111   
gb|KCW90115.1|  hypothetical protein EUGRSUZ_A02308                     348   1e-110   
gb|KCW90124.1|  hypothetical protein EUGRSUZ_A02314                     348   2e-110   
ref|XP_010090218.1|  Zeatin O-glucosyltransferase                       345   6e-109   
gb|KCW90136.1|  hypothetical protein EUGRSUZ_A02328                     343   1e-108   
ref|XP_009792172.1|  PREDICTED: zeatin O-glucosyltransferase-like       343   2e-108   
gb|EYU18708.1|  hypothetical protein MIMGU_mgv1a019962mg                343   4e-108   
ref|XP_008794220.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    341   9e-108   
gb|KGN54644.1|  hypothetical protein Csa_4G415920                       340   4e-107   
ref|XP_010024011.1|  PREDICTED: zeatin O-glucosyltransferase-like       338   4e-107   
ref|XP_010090216.1|  Zeatin O-glucosyltransferase                       339   1e-106   
ref|XP_009611304.1|  PREDICTED: zeatin O-glucosyltransferase-like       339   1e-106   
ref|XP_010056820.1|  PREDICTED: zeatin O-xylosyltransferase-like        338   4e-106   
ref|XP_004150609.1|  PREDICTED: zeatin O-glucosyltransferase-like       337   5e-106   
ref|XP_010918854.1|  PREDICTED: zeatin O-glucosyltransferase-like       336   9e-106   
ref|XP_010056828.1|  PREDICTED: zeatin O-glucosyltransferase-like       336   9e-106   
ref|XP_006356394.1|  PREDICTED: zeatin O-xylosyltransferase-like        337   1e-105   
ref|XP_006350268.1|  PREDICTED: zeatin O-glucosyltransferase-like       335   2e-105   
gb|KCW90130.1|  hypothetical protein EUGRSUZ_A02321                     335   2e-105   
ref|XP_004169069.1|  PREDICTED: zeatin O-glucosyltransferase-like       334   7e-105   
gb|KCW90129.1|  hypothetical protein EUGRSUZ_A02320                     333   9e-105   
ref|XP_009620161.1|  PREDICTED: zeatin O-glucosyltransferase-like...    333   1e-104   
ref|XP_010312401.1|  PREDICTED: zeatin O-glucosyltransferase-like       331   1e-104   
gb|KGN54645.1|  UDP-glucosyltransferase                                 332   7e-104   
ref|XP_004150612.1|  PREDICTED: zeatin O-glucosyltransferase-like       332   9e-104   
ref|XP_004169070.1|  PREDICTED: zeatin O-glucosyltransferase-like       330   1e-103   
ref|XP_009620160.1|  PREDICTED: zeatin O-glucosyltransferase-like...    330   2e-103   
gb|EPS66453.1|  hypothetical protein M569_08324                         328   6e-103   
ref|XP_011075348.1|  PREDICTED: zeatin O-glucosyltransferase-like       328   8e-103   
ref|XP_008455779.1|  PREDICTED: zeatin O-xylosyltransferase-like        328   2e-102   
ref|XP_010056863.1|  PREDICTED: zeatin O-glucosyltransferase-like       327   4e-102   
gb|KCW90134.1|  hypothetical protein EUGRSUZ_A02323                     326   7e-102   
ref|XP_009598914.1|  PREDICTED: zeatin O-glucosyltransferase-like       327   7e-102   
gb|EYU18707.1|  hypothetical protein MIMGU_mgv1a005868mg                325   1e-101   
ref|XP_008808448.1|  PREDICTED: zeatin O-glucosyltransferase-like       325   2e-101   
gb|EYU18709.1|  hypothetical protein MIMGU_mgv1a024073mg                323   7e-101   
ref|XP_006351296.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    322   1e-100   
ref|XP_006351295.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    322   1e-100   
ref|XP_006355031.1|  PREDICTED: zeatin O-glucosyltransferase-like       320   8e-100   
ref|XP_006605211.1|  PREDICTED: zeatin O-glucosyltransferase-like       315   4e-99    
ref|XP_010312115.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    317   1e-98    
gb|EMT20809.1|  Putative cis-zeatin O-glucosyltransferase               314   3e-97    
ref|XP_009779217.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   2e-96    
ref|XP_004236910.1|  PREDICTED: zeatin O-glucosyltransferase-like       311   3e-96    
ref|XP_009593501.1|  PREDICTED: zeatin O-xylosyltransferase-like        307   9e-95    
dbj|BAJ89478.1|  predicted protein                                      301   3e-92    
gb|KCW86031.1|  hypothetical protein EUGRSUZ_B02735                     299   4e-92    
ref|XP_009390437.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    299   1e-91    
ref|XP_010312121.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    296   2e-91    
ref|XP_008806810.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    298   3e-91    
ref|XP_003580302.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    298   4e-91    
ref|XP_010312120.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    296   6e-91    
ref|XP_006351297.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    294   8e-91    
ref|XP_010312119.1|  PREDICTED: zeatin O-xylosyltransferase-like ...    296   9e-91    
gb|ACD03254.1|  UDP-glycosyltransferase UGT93B9                         296   2e-90    Avena strigosa
ref|XP_004976466.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    295   6e-90    
ref|XP_003580303.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    294   1e-89    
dbj|BAJ94231.1|  predicted protein                                      294   1e-89    
ref|XP_006854306.1|  hypothetical protein AMTR_s00039p00102080          293   5e-89    
gb|ADG56506.1|  putative cis-zeatin O-glucosyltransferase               291   1e-88    
ref|XP_004239467.1|  PREDICTED: zeatin O-glucosyltransferase-like       291   1e-88    
gb|EAY95124.1|  hypothetical protein OsI_16941                          291   2e-88    Oryza sativa Indica Group [Indian rice]
ref|NP_001053526.1|  Os04g0556500                                       290   3e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006350111.1|  PREDICTED: zeatin O-glucosyltransferase-like       290   3e-88    
ref|NP_001136576.1|  hypothetical protein                               290   3e-88    Zea mays [maize]
emb|CAH67400.1|  OSIGBa0137D06.1                                        290   3e-88    Oryza sativa [red rice]
ref|XP_008667332.1|  PREDICTED: hypothetical protein isoform X1         290   4e-88    
emb|CDP14135.1|  unnamed protein product                                285   1e-87    
ref|XP_004975978.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    288   2e-87    
ref|XP_004252081.1|  PREDICTED: zeatin O-glucosyltransferase-like       287   5e-87    
gb|AEV76976.1|  cis-zeatin O-glucosyltransferase 1                      286   2e-86    
ref|XP_010918553.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    286   2e-86    
ref|XP_004243637.1|  PREDICTED: zeatin O-xylosyltransferase-like        285   3e-86    
ref|XP_004978175.1|  PREDICTED: uncharacterized protein LOC101764819    296   1e-85    
ref|XP_004241956.1|  PREDICTED: zeatin O-glucosyltransferase-like       283   2e-85    
ref|XP_002448305.1|  hypothetical protein SORBIDRAFT_06g024960          283   2e-85    Sorghum bicolor [broomcorn]
ref|NP_001053574.1|  Os04g0565400                                       283   3e-85    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003580300.2|  PREDICTED: cis-zeatin O-glucosyltransferase ...    283   5e-85    
ref|XP_009603042.1|  PREDICTED: zeatin O-glucosyltransferase-like       280   5e-85    
sp|Q6JAH0.1|CZOG_SORBI  RecName: Full=Putative cis-zeatin O-gluco...    280   2e-84    Sorghum bicolor [broomcorn]
ref|XP_002448306.1|  hypothetical protein SORBIDRAFT_06g024970          280   2e-84    Sorghum bicolor [broomcorn]
ref|XP_010319171.1|  PREDICTED: zeatin O-xylosyltransferase-like        277   2e-84    
ref|XP_008657045.1|  PREDICTED: cis-zeatin O-glucosyltransferase 2      279   5e-84    
emb|CBI29809.3|  unnamed protein product                                289   6e-84    
emb|CAH66756.1|  OSIGBa0158F05.5                                        279   8e-84    Oryza sativa [red rice]
ref|NP_001053572.1|  Os04g0565200                                       278   1e-83    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004240219.1|  PREDICTED: zeatin O-xylosyltransferase-like        278   2e-83    
ref|XP_009620405.1|  PREDICTED: zeatin O-xylosyltransferase-like        274   3e-83    
ref|NP_001141165.1|  uncharacterized protein LOC100273251               277   3e-83    Zea mays [maize]
tpg|DAA36500.1|  TPA: cis-zeatin O-glucosyltransferase                  277   5e-83    
ref|XP_004976467.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    276   6e-83    
ref|NP_001105017.1|  cis-zeatin O-glucosyltransferase 1                 276   2e-82    Zea mays [maize]
tpg|DAA36492.1|  TPA: cis-zeatin O-glucosyltransferase 1                275   3e-82    
gb|AAL75980.1|AF466203_9  putative cis-zeatin O-glucosyltransferase     275   3e-82    Zea mays [maize]
ref|XP_009762775.1|  PREDICTED: zeatin O-glucosyltransferase-like       274   4e-82    
gb|ABR17639.1|  unknown                                                 274   5e-82    Picea sitchensis
ref|XP_002446923.1|  hypothetical protein SORBIDRAFT_06g024950          274   6e-82    Sorghum bicolor [broomcorn]
gb|AEV76977.1|  cis-zeatin O-glucosyltransferase 2a                     273   6e-82    
ref|NP_001053527.1|  Os04g0556600                                       273   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004253377.1|  PREDICTED: zeatin O-glucosyltransferase-like       273   1e-81    
gb|ACD03259.1|  UDP-glycosyltransferase UGT93B8                         273   2e-81    Avena strigosa
ref|XP_009783802.1|  PREDICTED: zeatin O-glucosyltransferase-like       265   5e-81    
dbj|BAK03215.1|  predicted protein                                      271   6e-81    
emb|CAH67401.1|  OSIGBa0137D06.2                                        270   1e-80    Oryza sativa [red rice]
ref|XP_002446275.1|  hypothetical protein SORBIDRAFT_06g012280          270   2e-80    Sorghum bicolor [broomcorn]
ref|XP_010322862.1|  PREDICTED: zeatin O-glucosyltransferase-like       270   3e-80    
ref|XP_004251744.1|  PREDICTED: zeatin O-glucosyltransferase-like       269   4e-80    
ref|XP_003580304.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    269   7e-80    
ref|XP_006652647.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    268   1e-79    
ref|XP_006652626.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    267   2e-79    
ref|XP_004976465.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    265   1e-78    
gb|KHN41707.1|  Zeatin O-glucosyltransferase                            261   1e-78    
ref|XP_002437484.1|  hypothetical protein SORBIDRAFT_10g027940          265   1e-78    Sorghum bicolor [broomcorn]
ref|XP_002448302.1|  hypothetical protein SORBIDRAFT_06g024930          266   2e-78    Sorghum bicolor [broomcorn]
ref|XP_010673142.1|  PREDICTED: zeatin O-glucosyltransferase-like       260   5e-78    
gb|EMT11108.1|  Cis-zeatin O-glucosyltransferase 2                      263   2e-77    
dbj|BAJ89296.1|  predicted protein                                      262   3e-77    
gb|AGT16463.1|  cis-zeatin O-glucosyltransferase                        260   7e-77    
ref|XP_006854316.1|  hypothetical protein AMTR_s00039p00113770          259   3e-76    
ref|XP_004958585.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    258   6e-76    
gb|AAT42163.1|  putative cis-zeatin O-glucosyltransferase               256   3e-75    
gb|EAY95122.1|  hypothetical protein OsI_16939                          256   5e-75    
ref|XP_002448304.1|  hypothetical protein SORBIDRAFT_06g024946          254   2e-74    
emb|CDM83291.1|  unnamed protein product                                251   2e-73    
ref|XP_009772115.1|  PREDICTED: zeatin O-glucosyltransferase-like       243   9e-73    
ref|XP_010319528.1|  PREDICTED: zeatin O-xylosyltransferase-like        248   2e-72    
ref|XP_010090211.1|  Zeatin O-xylosyltransferase                        244   2e-72    
ref|XP_006653661.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    247   3e-72    
ref|XP_006347256.1|  PREDICTED: zeatin O-glucosyltransferase-like       243   2e-71    
ref|XP_004252079.1|  PREDICTED: zeatin O-glucosyltransferase-like       244   4e-71    
ref|NP_001060532.1|  Os07g0660500                                       242   1e-69    
gb|EMS67468.1|  Cis-zeatin O-glucosyltransferase 1                      241   2e-69    
gb|EMT30722.1|  hypothetical protein F775_52510                         240   4e-69    
ref|XP_004240222.1|  PREDICTED: zeatin O-glucosyltransferase-like       237   9e-69    
ref|XP_003565056.1|  PREDICTED: putative cis-zeatin O-glucosyltra...    236   1e-67    
ref|XP_008670630.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    236   2e-67    
ref|XP_003562518.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    234   7e-67    
ref|XP_006368054.1|  PREDICTED: zeatin O-glucosyltransferase-like       228   9e-67    
gb|ACB88212.1|  UFGT3                                                   227   3e-64    
ref|XP_009774568.1|  PREDICTED: zeatin O-glucosyltransferase-like       218   6e-63    
ref|XP_006421300.1|  hypothetical protein CICLE_v10005382mg             220   7e-63    
gb|KHN43714.1|  Zeatin O-glucosyltransferase                            212   4e-61    
ref|XP_010090197.1|  Zeatin O-xylosyltransferase                        209   7e-60    
gb|KHN08928.1|  Zeatin O-glucosyltransferase                            205   1e-58    
gb|EEE67749.1|  hypothetical protein OsJ_25448                          210   6e-58    
ref|XP_002463331.1|  hypothetical protein SORBIDRAFT_02g041935          207   2e-56    
gb|AGT16462.1|  cis-zeatin O-glucosyltransferase                        202   1e-55    
emb|CAE01866.2|  OSJNBb0012E24.10                                       199   1e-54    
ref|NP_001053525.1|  Os04g0556400                                       199   1e-54    
ref|XP_006355034.1|  PREDICTED: zeatin O-glucosyltransferase-like       186   2e-50    
gb|EMT11093.1|  Cis-zeatin O-glucosyltransferase 1                      182   4e-49    
ref|XP_006358040.1|  PREDICTED: zeatin O-xylosyltransferase-like        176   8e-48    
gb|AEV76978.1|  cis-zeatin O-glucosyltransferase 2b                     178   2e-47    
ref|XP_006854286.1|  hypothetical protein AMTR_s00039p00077780          180   2e-47    
gb|EYU18712.1|  hypothetical protein MIMGU_mgv1a004882mg                182   3e-47    
ref|XP_009796221.1|  PREDICTED: zeatin O-xylosyltransferase-like        176   6e-47    
ref|XP_009603993.1|  PREDICTED: zeatin O-xylosyltransferase-like        177   6e-45    
ref|XP_010090199.1|  hypothetical protein L484_016535                   170   1e-44    
ref|XP_002990617.1|  hypothetical protein SELMODRAFT_448116             170   4e-43    
gb|ABK24743.1|  unknown                                                 165   3e-41    
ref|XP_010525697.1|  PREDICTED: crocetin glucoside glucosyltransf...    164   3e-41    
gb|EMS51286.1|  Cis-zeatin O-glucosyltransferase 1                      158   4e-41    
ref|XP_008453923.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       164   8e-41    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      162   4e-40    
ref|XP_006848530.1|  hypothetical protein AMTR_s00169p00020090          160   9e-40    
gb|ABR18451.1|  unknown                                                 160   1e-39    
ref|XP_006373304.1|  hypothetical protein POPTR_0017s11400g             160   2e-39    
ref|XP_004152080.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       160   2e-39    
ref|XP_003551588.1|  PREDICTED: soyasapogenol B glucuronide galac...    159   5e-39    
gb|KHN40682.1|  UDP-glycosyltransferase 73B4                            158   7e-39    
ref|XP_010112115.1|  UDP-glycosyltransferase 90A1                       157   1e-38    
emb|CBI39456.3|  unnamed protein product                                156   2e-38    
dbj|BAG31952.1|  UGT73A13                                               156   3e-38    
gb|AIE12475.1|  UGT10                                                   156   4e-38    
dbj|BAA83484.1|  UDP-glucose: flavonoid 7-O-glucosyltransferase         155   4e-38    
ref|XP_009762776.1|  PREDICTED: zeatin O-glucosyltransferase-like       151   6e-38    
ref|XP_006854284.1|  hypothetical protein AMTR_s00039p00077500          149   6e-38    
ref|XP_011090397.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       155   7e-38    
emb|CDY13143.1|  BnaA09g16740D                                          154   1e-37    
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    154   1e-37    
gb|AFJ52948.1|  UDP-glycosyltransferase 1                               154   2e-37    
ref|XP_004252080.1|  PREDICTED: zeatin O-glucosyltransferase-like       147   2e-37    
ref|XP_004306178.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       154   2e-37    
ref|XP_008449848.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    153   2e-37    
gb|ACU21253.1|  unknown                                                 147   3e-37    
gb|KGN43909.1|  hypothetical protein Csa_7G073450                       153   3e-37    
ref|XP_003623422.1|  Anthocyanin 3'-O-beta-glucosyltransferase          153   3e-37    
emb|CAN66825.1|  hypothetical protein VITISV_008970                     153   3e-37    
ref|XP_008442743.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       153   4e-37    
gb|AGP25113.1|  uridine diphosphate glycosyltransferase                 152   6e-37    
gb|EYU32729.1|  hypothetical protein MIMGU_mgv11b017767mg               152   6e-37    
ref|XP_009381878.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       152   6e-37    
ref|XP_010467418.1|  PREDICTED: UDP-glycosyltransferase 90A1-like...    152   6e-37    
ref|XP_007140178.1|  hypothetical protein PHAVU_008G090500g             152   6e-37    
gb|EAZ31597.1|  hypothetical protein OsJ_15738                          149   7e-37    
ref|XP_009136271.1|  PREDICTED: UDP-glycosyltransferase 73B5-like       152   8e-37    
ref|XP_010649358.1|  PREDICTED: crocetin glucoside glucosyltransf...    151   1e-36    
emb|CDX79437.1|  BnaC03g17730D                                          151   1e-36    
ref|XP_008454970.1|  PREDICTED: scopoletin glucosyltransferase-like     151   1e-36    
ref|XP_010655153.1|  PREDICTED: scopoletin glucosyltransferase          151   2e-36    
ref|XP_006423821.1|  hypothetical protein CICLE_v10028465mg             150   2e-36    
gb|ABR17572.1|  unknown                                                 151   2e-36    
dbj|BAF99027.1|  UDP-glucose:sesaminol 2'-O-glucoside-O-glucosylt...    150   2e-36    
ref|XP_011076907.1|  PREDICTED: beta-D-glucosyl crocetin beta-1,6...    151   2e-36    
ref|XP_006294087.1|  hypothetical protein CARUB_v10023081mg             151   2e-36    
ref|XP_004142256.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    150   2e-36    
ref|XP_011073829.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       150   3e-36    
gb|AES79645.2|  UDP-glucosyltransferase family protein                  150   3e-36    
gb|ABK25199.1|  unknown                                                 150   3e-36    
gb|KCW88801.1|  hypothetical protein EUGRSUZ_A01139                     150   3e-36    
ref|XP_010510162.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       150   3e-36    
ref|XP_006827589.1|  hypothetical protein AMTR_s00009p00235050          150   4e-36    
ref|XP_010046570.1|  PREDICTED: UDP-glycosyltransferase 73B4-like       150   4e-36    
ref|XP_003533678.1|  PREDICTED: soyasapogenol B glucuronide galac...    150   4e-36    
ref|XP_008342497.1|  PREDICTED: UDP-glycosyltransferase 90A1-like       150   5e-36    
gb|KFK36553.1|  hypothetical protein AALP_AA4G138600                    150   5e-36    
ref|XP_009604940.1|  PREDICTED: crocetin glucoside glucosyltransf...    149   5e-36    
gb|EYU37652.1|  hypothetical protein MIMGU_mgv1a005524mg                149   5e-36    
ref|XP_006361192.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    149   5e-36    
emb|CAN81633.1|  hypothetical protein VITISV_034564                     149   6e-36    
ref|XP_006367679.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    149   6e-36    
ref|XP_004250486.1|  PREDICTED: crocetin glucoside glucosyltransf...    149   7e-36    
ref|XP_006367680.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    149   7e-36    
ref|XP_008241363.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       149   8e-36    
ref|XP_009141176.1|  PREDICTED: UDP-glycosyltransferase 74D1            148   9e-36    
ref|XP_010516907.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       149   9e-36    
ref|XP_007157726.1|  hypothetical protein PHAVU_002G093300g             149   1e-35    
emb|CDY63987.1|  BnaA04g21090D                                          149   1e-35    
ref|XP_003623427.1|  Anthocyanin 3'-O-beta-glucosyltransferase          149   1e-35    
gb|EPS71017.1|  hypothetical protein M569_03738                         148   1e-35    
ref|XP_006367682.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    148   1e-35    
ref|XP_002273858.1|  PREDICTED: UDP-glycosyltransferase 90A1-like       148   1e-35    
ref|XP_009143556.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       148   2e-35    
ref|XP_010513015.1|  PREDICTED: UDP-glycosyltransferase 73C4-like       149   2e-35    
ref|XP_006845512.1|  hypothetical protein AMTR_s00019p00160900          148   2e-35    
ref|XP_008456584.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    148   2e-35    
ref|XP_010516905.1|  PREDICTED: UDP-glycosyltransferase 73C4            148   2e-35    
ref|XP_011003186.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       148   2e-35    
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...    147   2e-35    
ref|XP_003632051.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       147   3e-35    
ref|XP_010935519.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       147   3e-35    
ref|XP_006373303.1|  hypothetical protein POPTR_0017s11380g             147   3e-35    
ref|XP_006845578.1|  hypothetical protein AMTR_s00019p00196150          147   3e-35    
ref|XP_006294083.1|  hypothetical protein CARUB_v10023077mg             147   3e-35    
ref|NP_181216.1|  UDP-glucosyl transferase 73C3                         147   4e-35    
gb|ABR18046.1|  unknown                                                 147   4e-35    
ref|XP_002282952.2|  PREDICTED: scopoletin glucosyltransferase-like     147   4e-35    
ref|XP_004238697.1|  PREDICTED: crocetin glucoside glucosyltransf...    146   4e-35    
ref|XP_009133097.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    147   4e-35    
ref|XP_006410851.1|  hypothetical protein EUTSA_v10017544mg             147   5e-35    
ref|XP_008380687.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       147   6e-35    
ref|XP_006492641.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       147   6e-35    
ref|XP_009119412.1|  PREDICTED: UDP-glycosyltransferase 73B5            146   6e-35    
ref|XP_009349650.1|  PREDICTED: UDP-glycosyltransferase 90A1-like       146   6e-35    
gb|ADV71369.1|  glycosyltransferase GT14A05                             146   7e-35    
ref|XP_004250485.1|  PREDICTED: crocetin glucoside glucosyltransf...    145   7e-35    
ref|XP_007201973.1|  hypothetical protein PRUPE_ppa004786mg             146   7e-35    
ref|XP_009133096.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       146   7e-35    
ref|XP_010469679.1|  PREDICTED: UDP-glycosyltransferase 74D1            145   8e-35    
ref|XP_004252303.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       146   8e-35    
ref|XP_003599976.1|  Limonoid UDP-glucosyltransferase                   146   8e-35    
ref|XP_004249992.1|  PREDICTED: crocetin glucoside glucosyltransf...    145   8e-35    
ref|NP_181218.1|  UDP-glycosyltransferase 73C5                          146   9e-35    
ref|XP_007011136.1|  UDP-glucosyl transferase 73B3                      146   9e-35    
ref|XP_010935521.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       146   9e-35    
emb|CDX89662.1|  BnaC03g45760D                                          145   1e-34    
gb|ABR18376.1|  unknown                                                 145   1e-34    
emb|CDX70579.1|  BnaC03g06630D                                          145   1e-34    
emb|CDX71221.1|  BnaC07g05000D                                          145   1e-34    
ref|XP_010489475.1|  PREDICTED: UDP-glycosyltransferase 90A1-like       145   1e-34    
emb|CDX69555.1|  BnaA10g19040D                                          145   1e-34    
ref|XP_003518710.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      145   1e-34    
gb|KCW57684.1|  hypothetical protein EUGRSUZ_H00447                     145   1e-34    
ref|XP_002271587.2|  PREDICTED: crocetin glucoside glucosyltransf...    145   1e-34    
gb|AES79656.2|  UDP-glucosyltransferase family protein                  145   1e-34    
ref|XP_010069359.1|  PREDICTED: crocetin glucosyltransferase 3-like     145   1e-34    
ref|XP_010069360.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       145   1e-34    
ref|XP_004492515.1|  PREDICTED: soyasapogenol B glucuronide galac...    145   1e-34    
ref|XP_010069358.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       145   1e-34    
gb|KFK30045.1|  hypothetical protein AALP_AA7G209900                    145   1e-34    
gb|AFN26666.1|  UGT73C10                                                145   1e-34    
ref|XP_006409549.1|  hypothetical protein EUTSA_v10022663mg             145   1e-34    
ref|XP_004250484.1|  PREDICTED: crocetin glucoside glucosyltransf...    144   2e-34    
ref|XP_010505227.1|  PREDICTED: UDP-glycosyltransferase 73C5-like       145   2e-34    
ref|XP_009132814.1|  PREDICTED: UDP-glycosyltransferase 74D1            145   2e-34    
ref|XP_006848527.1|  hypothetical protein AMTR_s00169p00014200          145   2e-34    
ref|XP_002968730.1|  hypothetical protein SELMODRAFT_231223             145   2e-34    
ref|XP_006410852.1|  hypothetical protein EUTSA_v10016558mg             145   2e-34    
ref|XP_003623438.1|  UDP-glucuronosyltransferase 2A1                    145   2e-34    
ref|XP_006410305.1|  hypothetical protein EUTSA_v10016638mg             144   2e-34    
ref|XP_006367681.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    144   2e-34    
ref|XP_003623451.1|  UDP-glucuronosyltransferase 2B4                    145   2e-34    
ref|XP_002529691.1|  UDP-glucosyltransferase, putative                  145   2e-34    
ref|XP_010914943.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       145   2e-34    
ref|XP_010414087.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       144   2e-34    
ref|XP_010918860.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       144   2e-34    
ref|XP_009350819.1|  PREDICTED: UDP-glycosyltransferase 92A1-like       145   2e-34    
ref|XP_010530759.1|  PREDICTED: UDP-glucosyl transferase 73B2-like      144   2e-34    
emb|CDP12002.1|  unnamed protein product                                144   3e-34    
gb|KFK30051.1|  hypothetical protein AALP_AA7G210600                    144   3e-34    
ref|XP_006365665.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    144   3e-34    
ref|XP_004230756.2|  PREDICTED: scopoletin glucosyltransferase-like     145   3e-34    
gb|ACJ72160.1|  UGT3                                                    144   3e-34    
ref|XP_009143554.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       144   3e-34    
ref|XP_010927997.1|  PREDICTED: UDP-glycosyltransferase 89B1-like       144   3e-34    
ref|XP_010479272.1|  PREDICTED: UDP-glycosyltransferase 73C5            144   3e-34    
ref|XP_008241361.1|  PREDICTED: UDP-glycosyltransferase 73C1-like       144   3e-34    
gb|KDO49691.1|  hypothetical protein CISIN_1g042970mg                   144   4e-34    
ref|XP_007162805.1|  hypothetical protein PHAVU_001G182200g             144   4e-34    
ref|XP_009400633.1|  PREDICTED: cis-zeatin O-glucosyltransferase ...    140   4e-34    
ref|XP_002979729.1|  hypothetical protein SELMODRAFT_177943             144   4e-34    
ref|NP_180734.1|  UDP-glucosyl transferase 74D1                         144   4e-34    
ref|XP_008454969.1|  PREDICTED: scopoletin glucosyltransferase-like     144   4e-34    
emb|CDY36633.1|  BnaA07g04240D                                          144   4e-34    
ref|XP_006492609.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       144   4e-34    
ref|XP_006352206.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    143   4e-34    
ref|XP_003552284.1|  PREDICTED: soyasapogenol B glucuronide galac...    144   5e-34    
ref|XP_009143555.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    144   5e-34    
gb|AFJ52949.1|  UDP-glycosyltransferase 1                               144   5e-34    
gb|KCW57681.1|  hypothetical protein EUGRSUZ_H00443                     144   5e-34    
gb|ABR16160.1|  unknown                                                 144   5e-34    
emb|CDY33195.1|  BnaC04g08440D                                          144   5e-34    
ref|XP_003623458.1|  Cytokinin-O-glucosyltransferase                    144   5e-34    
gb|AAM61249.1|  putative glucosyltransferase                            143   5e-34    
ref|XP_010069357.1|  PREDICTED: crocetin glucosyltransferase 3-like     144   5e-34    
emb|CDX84548.1|  BnaA03g16820D                                          144   5e-34    
ref|XP_003622870.1|  Cytokinin-O-glucosyltransferase                    144   6e-34    
ref|XP_008231983.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    143   6e-34    
ref|XP_010507583.1|  PREDICTED: UDP-glycosyltransferase 73C4-like       144   6e-34    
ref|XP_006346605.1|  PREDICTED: UDP-glycosyltransferase 73C3-like       143   6e-34    
gb|KFK40015.1|  hypothetical protein AALP_AA3G318900                    143   6e-34    
ref|XP_006423818.1|  hypothetical protein CICLE_v10028312mg             143   6e-34    
ref|XP_004137108.1|  PREDICTED: UDP-glucose flavonoid 3-O-glucosy...    143   7e-34    
ref|XP_003521422.1|  PREDICTED: UDP-glycosyltransferase 73C6-like       143   7e-34    
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   143   8e-34    



>ref|XP_011075343.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=478

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 267/460 (58%), Positives = 344/460 (75%), Gaps = 6/460 (1%)
 Frame = +2

Query  38    VGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNL  217
             V V VVM+PLPAQGHLNQ LHLSRLI+A+ IPVH+ G  TH RQA  R+HGWDP A+ N+
Sbjct  22    VSVAVVMVPLPAQGHLNQLLHLSRLISAYNIPVHFVGTTTHNRQAKLRIHGWDPSAITNI  81

Query  218   HFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             +FH    PHF +P P+P+A+ KFPTQ++P+  A++ LR+P   L++ +S    RVVV+ D
Sbjct  82    YFHDFPTPHFSNPLPDPNAAIKFPTQILPLLRASTLLRQPVYDLVQRISATVGRVVVVYD  141

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             S+M +VVQD+ S+ NAE Y F+ ISAF+ YSF+WE TGKP V P  A ++  +PS EGCF
Sbjct  142   SMMPYVVQDICSIPNAESYCFQSISAFSLYSFYWEATGKP-VLPTEAKLVEEVPSMEGCF  200

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLT  751
              PEF E  K+Q      +SGDL N+ R IE L++DL+ KE  TG +  WA+GP NPVS  
Sbjct  201   PPEFAEISKLQLNARKFNSGDLYNTSRVIEGLYVDLMAKEKTTGTERNWALGPFNPVSKP  260

Query  752   DSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                 T NR   +EWLD+QE +SV+FVSFG+T+SLSNEQI+EL  GLE S QKFIWV+RD 
Sbjct  261   QRKETDNRGACMEWLDKQELNSVIFVSFGTTSSLSNEQISELALGLERSEQKFIWVLRDA  320

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GDVF      RRA +PE YEERV GRGV+VR+WAPQLEILGHPS GGF+SHCGWNSC+
Sbjct  321   DKGDVFQG--EVRRAPLPEKYEERVEGRGVIVRDWAPQLEILGHPSTGGFISHCGWNSCI  378

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPIAAWPMHSDQPRNA LIT+VL++G+ + DW+RR+E V    + + V++L+AS
Sbjct  379   ESISMGVPIAAWPMHSDQPRNAVLITKVLRIGVEIKDWSRRDEVVSSTTVEKSVRRLMAS  438

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+E+RRRA EL  ++++ +  GG    E++ F+AHI+R
Sbjct  439   GEGDEIRRRAEELGDAVRKCVMKGGITNMEMDDFIAHISR  478



>ref|XP_009596925.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=458

 Score =   464 bits (1193),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 266/458 (58%), Positives = 338/458 (74%), Gaps = 17/458 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLPAQGHLNQ LHLSRLI+A+ +P+HY G  TH RQA  RV GWDP ++  +HF
Sbjct  15    VAVVMVPLPAQGHLNQLLHLSRLISAYHLPLHYVGTTTHTRQAKIRVQGWDPHSISIIHF  74

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P ++ PPPNP +STKFP+QLMP F AT HLR P  +L+R L+   KRV+VI DSL
Sbjct  75    HEFSTPSYEIPPPNPQSSTKFPSQLMPSFHATCHLRDPITSLLRELARCNKRVIVIYDSL  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             + W+++D PS+ N E Y FR ISA   +S   +  GK         +  ++PS +GCF  
Sbjct  135   IAWLLRDAPSIANVECYSFRSISALNIHSLALDFAGK--------SIDANLPSIQGCFTQ  186

Query  584   EFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGF-QWAIGPLNPVSLTDS  757
             EF EF ++Q  F +  +SGDL NSC EIE L++DL+ KE      QWA+GPLNPV L D 
Sbjct  187   EFLEFSRVQTEFRELVNSGDLYNSCYEIEGLYLDLLAKEKPVSHKQWAVGPLNPVILYDK  246

Query  758   INTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              ++N RHK LEWLD+QE +SV+FVSFG+TTSLS+++I EL  GLE+S Q+FIWV+RD D+
Sbjct  247   KDSNKRHKCLEWLDKQEPNSVIFVSFGTTTSLSDKEIKELAMGLEQSKQRFIWVLRDADK  306

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F      R+ E+P+GYEERV+GRG++VR+WAPQLEILGH S GGFMSHCGWNSCMES
Sbjct  307   GDIFTGD--IRKVELPKGYEERVKGRGLIVRDWAPQLEILGHLSTGGFMSHCGWNSCMES  364

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPI AWPMHSDQPRNA L+T+VLK+GI L DWA R+E V    + E VK+L+ S E
Sbjct  365   ISMGVPIIAWPMHSDQPRNAFLVTDVLKIGIVLKDWALRDELVTSVIVKECVKRLMDSVE  424

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G++MR+RA ELS+S+ +    GGG   E++SF+AHITR
Sbjct  425   GDKMRQRAIELSKSVVD----GGGSGKEMDSFIAHITR  458



>ref|XP_009768605.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=458

 Score =   461 bits (1185),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 268/458 (59%), Positives = 329/458 (72%), Gaps = 17/458 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLPAQGHLNQ LHLSRLI+A+ +P+HY G  TH RQA  RV GWDP ++ N+HF
Sbjct  15    VAVVMVPLPAQGHLNQLLHLSRLISAYHLPLHYVGTTTHTRQAKIRVQGWDPHSISNIHF  74

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P  + PPPNP +STKFP+QLMP F AT HLR P  +L+R L+   KRV+VI DSL
Sbjct  75    HEFSTPSCEIPPPNPQSSTKFPSQLMPSFHATCHLRDPITSLLRELARCNKRVIVIYDSL  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             + WV+QD P + N E Y FR ISA   +S   E  GK            ++PS EGCF  
Sbjct  135   IAWVLQDAPFIANVECYSFRSISALNIHSLALEFAGK--------STEPNLPSIEGCFTQ  186

Query  584   EFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKE-SKTGFQWAIGPLNPVSLTDS  757
             EF EF ++Q  F +  +SGDL NSC EIE L++DL+ KE S +  QWA+GPLNPV   D 
Sbjct  187   EFSEFSRVQTEFRELVNSGDLYNSCYEIEGLYLDLLAKEKSASHKQWAVGPLNPVIPYDK  246

Query  758   INTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              ++N RHK LEWLD+QE +SV+FVSFG+TTSLS+ +I EL  GLE+  QKFIWV+RD D+
Sbjct  247   KDSNKRHKCLEWLDKQEPNSVIFVSFGTTTSLSDNEIEELAIGLEQRQQKFIWVLRDADK  306

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F      R+ E+P+GYEERV GRG++VR+WAPQLEILGH S GGFMSHCGWNSCMES
Sbjct  307   GDIFTGD--VRKVELPKGYEERVIGRGLIVRDWAPQLEILGHLSTGGFMSHCGWNSCMES  364

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPI AWPMHSDQPRNA L+T VLK+G+ L DWA R E V    + E VK+L+ S E
Sbjct  365   ISMGVPIIAWPMHSDQPRNAFLVTNVLKIGVVLKDWALREELVTSVMVEECVKRLMDSVE  424

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G++MR RA EL QS+ +    GGG   E++SF+ HITR
Sbjct  425   GDKMRERAVELRQSVVD----GGGSHKEMDSFITHITR  458



>emb|CDP14134.1| unnamed protein product [Coffea canephora]
Length=478

 Score =   454 bits (1168),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 255/459 (56%), Positives = 336/459 (73%), Gaps = 6/459 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLP QGHLNQ LHLSRLI+++ IPVHY G ATH RQA  RV GWDPLA+ N+HF
Sbjct  22    VTVVMVPLPLQGHLNQLLHLSRLISSYNIPVHYVGTATHTRQAKVRVQGWDPLAISNIHF  81

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P +++PPP+P+A TKFPTQL+PV  A+  LR P +AL++ LS   +R+VVI DS+
Sbjct  82    HEFSTPSYEAPPPDPNAPTKFPTQLIPVLNASVKLREPVHALLQQLSSTTRRLVVICDSV  141

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHMPSPEGCFI  580
               +V++DV  + NAE Y F  ISAF  Y+F WE+ GKP V  PE    L  +PS E    
Sbjct  142   TPYVIKDVGLIPNAESYTFISISAFAIYTFSWEQEGKPRVFEPEILEALESLPSHESSIP  201

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLI--GKESKTGFQWAIGPLNPVSLTD  754
              E  +F+K+Q+      SGDL N+CR IE  ++DL+   K + +  QWA+GP NPV +  
Sbjct  202   QEVTDFLKLQKESMPIISGDLYNTCRFIEGPYLDLLAKAKTADSHKQWAVGPFNPVEING  261

Query  755   SINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
               NT  RH  LEWLD+Q  +SV+FV FGS TS+S+E+  ++  GLE+SGQKFIW+++DGD
Sbjct  262   QKNTEQRHYCLEWLDKQGPNSVIFVCFGSNTSVSHEEAAQIAIGLEKSGQKFIWILKDGD  321

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +GD+F      RRA++P G+EER  GRG++VR+WAPQLEILGH S GGFMSHCGWNSCME
Sbjct  322   QGDIFKG--EVRRAQLPGGFEERTEGRGIIVRDWAPQLEILGHSSTGGFMSHCGWNSCME  379

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVP+AAWPMHS+QPRNA ++ +VLK+G+S+ DW+RR+E V    +   V++L+ SA
Sbjct  380   SISMGVPVAAWPMHSEQPRNAIILEKVLKIGLSVRDWSRRDELVTSMAVENAVRRLMDSA  439

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EGEEMR+RA ELS+++K+ +  GG  R E++SF+AHI R
Sbjct  440   EGEEMRQRAKELSKAVKDSVMEGGTSRLEMDSFIAHIRR  478



>ref|XP_011078913.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=472

 Score =   453 bits (1165),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 260/470 (55%), Positives = 336/470 (71%), Gaps = 8/470 (2%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             ENG    + V VV  M+PLPAQGHLNQ LHLSRL++A  IPV+Y G+ATHIRQA  RVHG
Sbjct  7     ENGNHKESQVAVV--MVPLPAQGHLNQLLHLSRLVSASSIPVYYVGSATHIRQAKLRVHG  64

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             W+P  + N+HF       F +PPP+P+ S KFP+QL+P   A+ HLR P    +  LS  
Sbjct  65    WNPSTIANVHFQEFPPTPFHNPPPDPNQSKKFPSQLLPSLSASIHLRNPVYKFVAQLSSS  124

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGP-EAAGVL  547
              +RVVVI DSLM +VVQD+ SLQNAE Y FRCI AFT YSFHWE  G+PD  P EAA VL
Sbjct  125   FRRVVVIYDSLMSYVVQDIDSLQNAESYCFRCIPAFTLYSFHWEAAGRPDDVPAEAAAVL  184

Query  548   NHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WA  721
               +P  + CF PEF+EF ++QR      SGD+ NS R +E  ++DL+ +   TG +  WA
Sbjct  185   KEIPDLDDCFSPEFDEFSRLQRVSGKIFSGDIYNSSRAMEGFYLDLVAERKITGTEKLWA  244

Query  722   IGPLNPVSLTDSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             +GP NPV   +  ++ +RH+ L+WLDRQ  +SV+FVSFG+T+ LSNEQ+ EL  GLE S 
Sbjct  245   VGPFNPVVFPEKKSSRSRHECLDWLDRQSPNSVIFVSFGTTSLLSNEQVQELAFGLERSQ  304

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
              KF+WVVRD D+GD+F      R++E+PEG EERV+ RG++VR+WAPQLEILGHPS  GF
Sbjct  305   HKFVWVVRDADKGDIFTGE--VRKSELPEGLEERVKERGIIVRDWAPQLEILGHPSTAGF  362

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             MSHCGWNSC+ESISMGVP+A WPMHSDQP NA  +T+VL++G+ + DWARR+E V    +
Sbjct  363   MSHCGWNSCIESISMGVPMATWPMHSDQPINAVFVTKVLRIGLEVKDWARRDEVVSSSTV  422

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                V++L+AS EG+EMR+RA EL  +++  +  GG    E++SF+ HITR
Sbjct  423   ECAVRRLMASEEGDEMRKRAQELGAAVRNSVMEGGSSSKEMDSFITHITR  472



>ref|XP_011075345.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=479

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 266/469 (57%), Positives = 328/469 (70%), Gaps = 4/469 (1%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             +   G     V VVM+PLPAQGHLNQ LHLSRLIAA+ IP+H+    TH  QA  R+HGW
Sbjct  11    DAQNGSTPSQVAVVMVPLPAQGHLNQLLHLSRLIAAYNIPIHFVSTTTHNHQAKLRLHGW  70

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQ  373
             +PL   N+HFH  S+P FQSP  NP+AS KFP+ L P+F   SHLRRP  AL++ LS   
Sbjct  71    NPLTAANIHFHDFSIPEFQSPTANPNASNKFPSHLQPLFNTVSHLRRPVAALLQTLSHTT  130

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH  553
              RVVV+ DSLM  VVQDV S+ NAE Y F  ISAF+ + + WE   +    P   G+   
Sbjct  131   HRVVVVHDSLMSSVVQDVFSIPNAESYIFHSISAFSVFWYFWEGLEQEKPLPVEEGLEKQ  190

Query  554   MPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIG  727
             +PS + CF PEF EFI  ++ +  + SG L N+CR IE  ++DLI K +    Q  WAIG
Sbjct  191   VPSLDDCFTPEFMEFIVSEQKYMSSCSGYLYNACRVIEGRYMDLIEKLTGNENQKHWAIG  250

Query  728   PLNPVSLT-DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQK  904
             P NP+ LT    +  RH+ L+WLD+QE  SVLFVSFG+TTSL +EQI EL  GLEES   
Sbjct  251   PFNPLELTGKKPDGPRHECLKWLDKQEPKSVLFVSFGTTTSLPDEQIKELATGLEESEVT  310

Query  905   FIWvvrdgdrgdvfddgEAA-RRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             FIWV+RD DRGD+    E   R+ E+P+G+EERV+ RGVVVR+WAPQLEILGH + GGFM
Sbjct  311   FIWVLRDADRGDMTAGDEGTMRKVELPKGFEERVKERGVVVRDWAPQLEILGHFATGGFM  370

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNSCMESISMGVPIAAWPMHSDQPRNA L+TEVLK+G+   DWARR+E V    I 
Sbjct  371   SHCGWNSCMESISMGVPIAAWPMHSDQPRNAVLMTEVLKIGLVAKDWARRDETVKASTIS  430

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +K+L+ S EGEE+R+RA EL  +++  +A GG  R E++SFVAHITR
Sbjct  431   RVLKRLMGSGEGEEIRQRAQELHGAVRRAVADGGITRLEMDSFVAHITR  479



>emb|CDP12478.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   447 bits (1151),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 260/456 (57%), Positives = 331/456 (73%), Gaps = 7/456 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLN  LHLS LI++H IPV+Y G ATHIRQA  RV GWDPL + N++FH  S
Sbjct  1     MVPLPAQGHLNPLLHLSCLISSHNIPVYYIGLATHIRQAKVRVQGWDPLVISNINFHEFS  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
             +P +++PPPNP+A TKFP QL+P+F+A+  LR P  AL+  LS   KR+VVI DS M +V
Sbjct  61    IPCYETPPPNPNAGTKFPVQLVPLFYASIKLREPVYALLEQLSRATKRLVVIFDSAMPYV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG-PEAAGVLNHMPSPEGCFIPEFE  592
             +QD   + N E Y F    AF  Y+F WE  GKP +  PE   +L  +PS E C  PE  
Sbjct  121   IQDAHLIPNVESYSFSIFPAFYCYAFIWELEGKPTLAEPELLDLLKVLPSNERCTPPEMM  180

Query  593   EFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNPVSLTDSI-N  763
             EFIK+Q+      SG LLN+CREIE  ++DL+ K S      QWA+GPLNPV + D + N
Sbjct  181   EFIKLQQDSKPIISGYLLNTCREIEGPYLDLLTKTSIIDNDKQWAVGPLNPVVIIDGLKN  240

Query  764   TN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             +N RH  LEWLD+Q +DSV+FVSFGSTTSLS+E+  E+  GLE+SGQKFIWV+RD D+GD
Sbjct  241   SNKRHYCLEWLDKQAQDSVIFVSFGSTTSLSDEEAAEVAIGLEKSGQKFIWVLRDADKGD  300

Query  941   vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESIS  1120
             +F+     RRA++ EG+EE + GRG+VVREWAPQLE+L H S GGFMSHCGWNSCMESIS
Sbjct  301   IFEG--EVRRAKLLEGFEESIEGRGIVVREWAPQLEVLAHSSTGGFMSHCGWNSCMESIS  358

Query  1121  MGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaege  1300
             MGVP+AAWPMH+DQP NA L+ ++LK+G+ + DW+RR+E V    I   V++L+ SAEGE
Sbjct  359   MGVPVAAWPMHTDQPWNAVLMEKLLKIGLPVRDWSRRDEPVTSVTIENAVRRLMNSAEGE  418

Query  1301  emrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EMR+RA ELS+ +K  +  GG  R E +SF+AHI R
Sbjct  419   EMRQRAKELSKIIKGSVTEGGVSRLETDSFIAHIRR  454



>ref|XP_009782889.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=482

 Score =   448 bits (1153),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 322/460 (70%), Gaps = 11/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             +VVV++P PAQGHLNQ L LS LIA++ I +HY    TH  QA  RVHG D  +V N+HF
Sbjct  18    IVVVVVPFPAQGHLNQLLQLSCLIASYNIQIHYVSTKTHNLQAKLRVHGLD--SVSNIHF  75

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P F SP PNP++S  FP+ L P F A++HLR+P   L+  LS   KRV++I+DSL
Sbjct  76    HAFSTPTFISPSPNPNSSITFPSHLQPSFEASTHLRKPVKKLLHTLSAKNKRVIIINDSL  135

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG VVQD  SL+NAE Y F  +SAFT + F WE  G+P   P  A +L  +PS EGCF  
Sbjct  136   MGSVVQDFVSLENAEAYTFHSVSAFTLFLFIWETMGRP--FPIDAEILKDLPSLEGCFSS  193

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPVSLTDS  757
             +FE F+K +  +   +SG + N+CR IE+ F+DL+ KE   G   QWA+GP NPV+L+ +
Sbjct  194   DFERFLKTEYEYMKFNSGKIYNTCRVIESPFLDLLSKEQINGNKKQWALGPFNPVTLSGT  253

Query  758   I---NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                 N   HK L WLD+QE +SVL+VSFG+TTS S+EQI E+  GLE+S QKFIW     
Sbjct  254   KKGSNIRSHKCLLWLDKQEPNSVLYVSFGTTTSFSDEQIKEMAIGLEQSKQKFIW--VLR  311

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D        +  R+ E+P+G+E+RV+ + +V+R+WAPQLEIL H S+GGFM HCGWNSCM
Sbjct  312   DADKGNVFTKDLRQIELPKGFEDRVKEKAIVIRDWAPQLEILSHSSIGGFMCHCGWNSCM  371

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPI AWPMHSDQPRN  LIT++LK+G+ + +WARR E V    + + V+KL+AS
Sbjct  372   ESISMGVPIVAWPMHSDQPRNTVLITKILKVGLVVKEWARRQEIVTSNMVQKAVEKLMAS  431

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+EMR RA +LS +L++ +AVGG  R EL+SF++HITR
Sbjct  432   KEGDEMRNRAKDLSAALRKSVAVGGVKRMELDSFISHITR  471



>ref|XP_004249235.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=437

 Score =   445 bits (1144),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 255/458 (56%), Positives = 332/458 (72%), Gaps = 32/458 (7%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+PLPAQGHLNQ LHLSRLI+A+ +P+H+AGAA H+RQA +R+HGW+P++   + F
Sbjct  9     VAIVMIPLPAQGHLNQLLHLSRLISAYNLPLHFAGAAVHLRQAKNRIHGWNPVSTSTVKF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P++++P PNP+++TKFP+QLMP F AT HLR P  +L++ LS + +RV+VI DSL
Sbjct  69    HELPIPNYETPLPNPNSTTKFPSQLMPSFHATIHLRHPITSLLQELSRNYRRVIVIYDSL  128

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             + WV+QD PS+ N E Y FR IS F+ YS  W+++                        P
Sbjct  129   IAWVLQDTPSIPNVECYSFRSISVFSIYS--WDKSS---------------------VTP  165

Query  584   EFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKE-SKTGFQWAIGPLNPVSLTDS  757
             EF E+ ++Q  F +  +SG+L NSC EIE L++D + KE S    QWAIGPLNPV   D 
Sbjct  166   EFTEYSRVQFEFREIVNSGNLYNSCYEIEGLYLDFVAKEKSARNKQWAIGPLNPVKQFDK  225

Query  758   INT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              N+   HK + WLD QE +SV+FVSFG+TT+ S+EQI EL  GLE+S Q+FIWV+R+ D+
Sbjct  226   KNSLISHKCMNWLDEQEPNSVIFVSFGTTTTFSDEQIKELAIGLEKSEQRFIWVLREADK  285

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F     +R  E+PEGYEERV  RGV+VR+WAPQLEILGH S GGFMSHCGWNSCMES
Sbjct  286   GDIFTG--ESREVELPEGYEERVGKRGVIVRDWAPQLEILGHESTGGFMSHCGWNSCMES  343

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPI AWPMHSDQPRNA L+TEVLK+G+ L DWA+R+E V    + E VK+L+ SAE
Sbjct  344   ISMGVPILAWPMHSDQPRNAVLVTEVLKIGVELRDWAKRDELVSSVAVAECVKRLMDSAE  403

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+R  ELS+S+ +    GGG   E+ SF+AHITR
Sbjct  404   GDEMRQRVMELSKSVVD----GGGSGREMASFIAHITR  437



>ref|XP_009796347.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=451

 Score =   444 bits (1142),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 329/455 (72%), Gaps = 8/455 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ LHLSRL++++ IPV+Y G   HI+QA  R HG+DPL + N+HFH   
Sbjct  1     MVPLPAQGHLNQLLHLSRLVSSYNIPVYYVGTIAHIQQAKIRAHGFDPLNITNIHFHEFQ  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL-SVDQKRVVVISDSLMGW  412
              P F++P PNP+AS KFP QLMP F+AT HLR P  AL+R L S + K+VVVI+D+LM W
Sbjct  61    TPSFETPLPNPNASNKFPNQLMPSFYATFHLREPVCALVRELLSKNLKKVVVINDNLMNW  120

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFE  592
             VVQD+P + N E Y     SAF +YSF WE  GKP V P        +PS   CF  EF 
Sbjct  121   VVQDLPEMPNTECYSLNSTSAFFSYSFLWELKGKP-VLP-GTEYYEDIPSILDCFPTEFW  178

Query  593   EFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPV--SLTDSIN  763
             E++K+Q  F      G+L NS R IE+L++DL+ KE     QWAIGP NP+    T   +
Sbjct  179   EYLKIQEQFDGKIHCGELYNSSRVIESLYLDLMSKEKDGMKQWAIGPFNPLEPKETSKDS  238

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH+SL WLD+QE++SV+FVSFG+TTSL +E++ EL  GLE+S QKFIWV+RD D+GDV
Sbjct  239   NKRHESLHWLDKQEQNSVIFVSFGTTTSLCDEEVKELAIGLEKSEQKFIWVLRDADKGDV  298

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             F      R+ ++PEGYEE+++GRG++VR+WAPQLEIL H S GGFMSHCGWNSCMESIS 
Sbjct  299   FTS--EVRKVQLPEGYEEKIKGRGIIVRDWAPQLEILAHNSTGGFMSHCGWNSCMESISF  356

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPIAAWPMHSDQPRN+ L+T+ LK+G+++  W RR+E      +   VK L+AS +G+E
Sbjct  357   GVPIAAWPMHSDQPRNSQLVTKYLKLGLTVRPWTRRDELATSEMVENAVKTLMASPQGDE  416

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+RAA+LS ++K+ +  GG  R E++SF+AHITR
Sbjct  417   MRKRAADLSNAIKKSVTDGGVNRAEMDSFIAHITR  451



>ref|XP_009600543.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=472

 Score =   445 bits (1144),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 259/465 (56%), Positives = 329/465 (71%), Gaps = 9/465 (2%)
 Frame = +2

Query  26    GGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLA  205
             G  +  +VVV++P PAQGHLNQ L L +LIA++ I VHY    TH  QA  RVH  DP +
Sbjct  11    GQKNHDIVVVVVPFPAQGHLNQLLQLCKLIASYNIKVHYVTTKTHTHQAKLRVH--DPFS  68

Query  206   VPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVV  385
             + N++FH  S P F SPPPNP+AS KFP  L P F ATSHLR+P   L+R LS   +R+V
Sbjct  69    IVNIYFHEFSTPFFISPPPNPNASIKFPCHLQPSFEATSHLRKPVAKLLRVLSSKSQRIV  128

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSP  565
             +I DSLMG VVQD   L NAE Y F  +SAFT + F WE  G+P      A +L  +PS 
Sbjct  129   IIHDSLMGSVVQDFVYLPNAEAYAFHSVSAFTLFLFIWENMGRP--FNIDANMLKDVPSL  186

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNP  739
             EGCF PEFE+FIK +  +   +SG + N+C+ IE  F+DL+ KE  S    QWA+GP NP
Sbjct  187   EGCFSPEFEKFIKNEYDYLKFNSGRIYNTCKVIEGPFLDLLSKEQISNNTKQWALGPFNP  246

Query  740   VSLTDSI--NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             V +      +  RHK L WLD+Q ++SV+FVSFG+TTS S+EQI E+  GLE+S QKF+W
Sbjct  247   VLVQHGTKGSNKRHKCLSWLDKQGQNSVIFVSFGTTTSFSDEQIKEMAIGLEKSEQKFVW  306

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD D+G+VF   + +R+ E+P+G+EERV+ RGVV+R+WAPQLEIL H SVGGFMSHCG
Sbjct  307   VLRDADKGNVFAK-DHSRKIELPKGFEERVKERGVVLRDWAPQLEILAHSSVGGFMSHCG  365

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESISMGVPIAAWPMHSDQPRN  L+T++LK+GI + DW RR+E V    +   V+
Sbjct  366   WNSCMESISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEVVTSAMVQAAVE  425

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             KL+ S EGEEMR RA +LS +LK  +A GG    EL+SF++HITR
Sbjct  426   KLMVSKEGEEMRSRAMDLSAALKISVAEGGIKNMELDSFISHITR  470



>ref|XP_009626493.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=472

 Score =   444 bits (1141),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 259/459 (56%), Positives = 324/459 (71%), Gaps = 9/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             +VVV++P PAQGHLNQ L L +LIA++ I VHY    TH  QA  RVH  DP ++ N+HF
Sbjct  17    IVVVVVPFPAQGHLNQLLQLCKLIASYNIKVHYVTTKTHTHQAKLRVH--DPFSIDNIHF  74

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P F SPPPN +AS KFP  L P F ATSHLR+P   L+R LS   +R+V+I DSL
Sbjct  75    HEFSTPFFISPPPNLNASIKFPCHLQPSFEATSHLRKPVAKLLRVLSSKSQRIVIIHDSL  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG VVQD   L NAE Y F  +SAFT + F WE  G+P      A +L  +PS EGCF P
Sbjct  135   MGSVVQDFVYLPNAEAYAFHSVSAFTLFLFIWENMGRP--FNIDANMLKDVPSLEGCFSP  192

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDS  757
             EFE+FIK +  +   +SG + N+C+ IE  F+DL+ KE  S    QWA+GP NPV +   
Sbjct  193   EFEKFIKNEYDYLKFNSGRIYNTCKVIEGPFLDLLSKEQISNNKKQWALGPFNPVLVQHG  252

Query  758   IN--TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                 T RHK L WLD+QE +SV+FVSFG+TTS S+EQI E+  GLE+S QKF+WV+RD D
Sbjct  253   TKGCTQRHKCLIWLDKQEPNSVIFVSFGTTTSFSDEQIKEIAIGLEKSEQKFVWVLRDAD  312

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +G+VF   + +R  E+P+G+EERV+ RGVV+R+WAPQLEIL H SVGGFMSHCGWNSCME
Sbjct  313   KGNVFAK-DQSRNIELPKGFEERVKERGVVLRDWAPQLEILAHSSVGGFMSHCGWNSCME  371

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVPIAAWPMHSDQPRN  L+T++LK+GI + DW RR+E V    +   V+KL+ S 
Sbjct  372   SISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEVVTSLMVQAAVEKLMVSK  431

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EGE MR RA +LS +LK  +A GG    EL+SF++HITR
Sbjct  432   EGEGMRNRAMDLSAALKISVAEGGIKNMELDSFISHITR  470



>ref|XP_009760629.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=472

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 255/465 (55%), Positives = 328/465 (71%), Gaps = 9/465 (2%)
 Frame = +2

Query  26    GGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLA  205
             G  +  +VVV++P PAQGHLNQ L L +LIA++ + VHY    TH  QA  RVH  DP +
Sbjct  11    GQKNHDIVVVVVPFPAQGHLNQLLQLCKLIASYNVKVHYVTTKTHTHQAKLRVH--DPFS  68

Query  206   VPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVV  385
               N+HFH  S P F SPPPNP+ S KFP  L P F ATSHLR+P   L+R LS   +R +
Sbjct  69    FVNIHFHEFSTPFFVSPPPNPNVSIKFPCHLQPSFEATSHLRKPVAKLLRVLSSKSQRAI  128

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSP  565
             +I DSLMG VVQD   L NAE Y F  +SAFT + F WE  G+P      A +L  +PS 
Sbjct  129   IIHDSLMGSVVQDFVYLPNAEAYAFHSVSAFTLFLFIWENMGRP--FNIDANMLKDVPSL  186

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNP  739
             E CF PEFE+FI+ +  +   +SG + N+C+ IE  F+DL+ KE  S    QWA+GP NP
Sbjct  187   EDCFSPEFEKFIRNEYDYLKFNSGKIYNTCKVIEGPFLDLLSKEQISNNKKQWALGPFNP  246

Query  740   VSLTDSI--NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             V +      +T RHK L WLD+Q ++SV+FVSFG+TTS S+EQI E+  GLE+S QKF+W
Sbjct  247   VLVQHGTKGSTKRHKCLSWLDKQGQNSVIFVSFGTTTSFSDEQIKEMAIGLEKSEQKFVW  306

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD D+G+VF   + +R+ ++P+G+EERV+ +GVV+R+WAPQLEIL H SVGGFMSHCG
Sbjct  307   VLRDADKGNVFAK-DQSRKIDLPKGFEERVKEKGVVLRDWAPQLEILAHSSVGGFMSHCG  365

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESISMGVPIAAWPMHSDQPRN  L+T++LK+GI + DW RR+E V    +   V+
Sbjct  366   WNSCMESISMGVPIAAWPMHSDQPRNTILVTKILKVGIVVKDWTRRHEMVTSIMVQAAVE  425

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             KL+AS EGEEMR RA +LS +LK+ +A GG    EL+SF++HITR
Sbjct  426   KLMASKEGEEMRNRAMDLSAALKKSVAEGGIKNMELDSFISHITR  470



>ref|XP_009586606.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=453

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 260/458 (57%), Positives = 331/458 (72%), Gaps = 12/458 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQFLHLSRLI+ + IPVHY G   HI+QA  RVHG+DPL + N+ FH   
Sbjct  1     MVPLPAQGHLNQFLHLSRLISMYNIPVHYVGTNAHIQQAKTRVHGFDPLTITNIQFHEFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL--SVDQKRVVVISDSLMG  409
              P +++P PNP+A  KFP+QL+P FFA SHLR P  +L R L  + +  +VVVI D+LM 
Sbjct  61    TPSYETPSPNPNAPHKFPSQLIPSFFAASHLREPVCSLARELASTTNVNKVVVIYDNLMI  120

Query  410   WVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHMPSPEGCFIPE  586
              VVQD+P + N E Y F  ISAF  YS+ WE  GK  + G E       +PS +GCF  +
Sbjct  121   GVVQDLPEMPNTECYCFNPISAFHRYSYFWEVKGKTLLPGTEH---YEDIPSVKGCFSAD  177

Query  587   FEEFIKMQR-PFW-DASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDS-  757
             F E++K Q  PF    S G+L NS R IE L++DL+ KE      WAIGP NPV LT+  
Sbjct  178   FWEYLKAQVVPFVGKISCGELFNSSRVIEGLYLDLMAKEFNNPKLWAIGPFNPVVLTEKN  237

Query  758   -INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               ++ RHKSL+WLD+QE +SV+FVSFG+TTSLSNE+I E+  GLEES QKFIWV+RD D+
Sbjct  238   KDSSERHKSLDWLDKQEHNSVIFVSFGTTTSLSNEEIKEIAIGLEESEQKFIWVLRDADK  297

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF   +  R+ ++PEGYEER++GRG++VR+WAPQLEIL H S GGFMSHCGWNSCMES
Sbjct  298   GDVFASED--RKIQLPEGYEERIKGRGIIVRDWAPQLEILAHSSTGGFMSHCGWNSCMES  355

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             IS GVPIAAWPMHSDQPRN+ L+T+ LK+G+++  W RR+E V    +   VK L+ S E
Sbjct  356   ISFGVPIAAWPMHSDQPRNSQLVTKYLKIGVTVRPWTRRDEHVTSEMVENTVKTLMDSTE  415

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+RAA LS ++K+ +  GG  R E++SF+AHITR
Sbjct  416   GDEMRKRAAVLSNAIKKSVMDGGMNRAEMDSFIAHITR  453



>ref|XP_009595637.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=471

 Score =   439 bits (1129),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 244/460 (53%), Positives = 319/460 (69%), Gaps = 11/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             +VVV++P PAQGHLNQ L LS LIA++ I +HY    TH  QA  RVHG D  +  N+HF
Sbjct  18    IVVVVVPFPAQGHLNQLLQLSCLIASYNIKIHYVSTKTHNLQAKLRVHGLDSFS--NIHF  75

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S P F SP PNP++S KFP+ L P F +++HLR+P   L+  LS   KRV++I+DSL
Sbjct  76    HAFSTPTFISPSPNPNSSIKFPSHLQPSFESSTHLRKPVKKLLHTLSAKHKRVIIINDSL  135

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG VVQD  SL NAE Y F  +SAFT + F WE  G+P   P  A +L  +PS EGCF P
Sbjct  136   MGSVVQDFVSLGNAEAYTFHSVSAFTLFLFIWENMGRP--FPIDAEILKDIPSLEGCFSP  193

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPVSLTDS  757
             EFE F+K +  +   +SG + N+CR IE+ F+DL+ KE  +G   QWA+GP NPV+L+ +
Sbjct  194   EFERFLKTEYEYMKFNSGKIYNTCRVIESPFLDLLSKEQLSGNKKQWALGPFNPVTLSGT  253

Query  758   I---NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                 N    K L WLD+QE +SVL+VSFG+TTS S+EQI E+  GLE+S QKFIW     
Sbjct  254   KKGSNIRSDKCLLWLDKQEPNSVLYVSFGTTTSFSDEQIKEMAIGLEQSKQKFIW--VLR  311

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D        +  R+ E+P+G+EERV+ +G++VR+WAPQLEIL H S+GGFMSHCGWNSCM
Sbjct  312   DADKGDVFTKDLRQIELPKGFEERVKEKGILVRDWAPQLEILSHSSIGGFMSHCGWNSCM  371

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPI AWPMHSDQPRN  LIT++LK+G+ + +WARR E V    + + V+ L+AS
Sbjct  372   ESISMGVPIIAWPMHSDQPRNTVLITKILKVGLVVKEWARRQELVTSNMVQKAVEILMAS  431

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+EMR R  +LS + ++ +A GG    EL+SF++HITR
Sbjct  432   KEGDEMRNRVKDLSAAFRKSVAEGGVKSMELDSFISHITR  471



>ref|XP_009796345.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=465

 Score =   439 bits (1128),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 258/467 (55%), Positives = 336/467 (72%), Gaps = 10/467 (2%)
 Frame = +2

Query  23    KGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPL  202
             K  ++  + VVM+PLPAQGHLNQ LHLSRL++++ IPVHY G  THI+QA  R HG+DP+
Sbjct  4     KWTSNSSIAVVMVPLPAQGHLNQLLHLSRLVSSYNIPVHYVGTTTHIQQAKIRAHGFDPV  63

Query  203   AVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRN-LSVDQKR  379
              + N+HFH    P F++P PNP+AS KFP  LMP F+AT HLR P  AL+R  LS + K+
Sbjct  64    TITNIHFHEYQTPSFETPLPNPNASNKFPNHLMPSFYATFHLREPICALVRKFLSANTKK  123

Query  380   VVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHM  556
             VVVI D+LM  VVQD+  + N E Y F   SAF +YSF WE  GKP + G E     + +
Sbjct  124   VVVIYDNLMNCVVQDLHEMPNTECYSFNSTSAFMSYSFLWEFKGKPVLPGTEH---YDDI  180

Query  557   PSPEGCFIPEFEEFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPL  733
             PS   CF  EF +F+K+Q  F      G L NS R IE+L++DL+ KE     QWAIGP 
Sbjct  181   PSILDCFPTEFWDFLKIQEQFDGKIHCGKLYNSSRVIESLYLDLMAKEYDGLKQWAIGPF  240

Query  734   NPVSLTD-SINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKF  907
             NP+   + S ++N RH+SL+WL +QE +SV+FVSFG+TTSL +E++ EL  GLE+S QKF
Sbjct  241   NPLEPKEKSKDSNKRHESLDWLGKQEPNSVIFVSFGTTTSLCDEEVKELAIGLEKSEQKF  300

Query  908   IWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             IWV+RD D+GDVF      R+ ++PEGYEER++ RG++VR+WAPQLEIL H S GGFMSH
Sbjct  301   IWVLRDADKGDVFTS--EVRKVQLPEGYEERIKERGIIVRDWAPQLEILAHSSTGGFMSH  358

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMES+SMGVPIAAWPMHSDQPRN+ L+T+ LK+G+++  W RR+E V    I   
Sbjct  359   CGWNSCMESMSMGVPIAAWPMHSDQPRNSQLVTKYLKIGLTVRPWTRRDELVTSEIIENV  418

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             VK L+AS EG+EMR+RAA+LS ++K+ +   G  R E++SF+AHITR
Sbjct  419   VKILMASTEGDEMRKRAADLSNTIKKSVKDDGINRAEMDSFIAHITR  465



>dbj|BAK55742.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=479

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 320/459 (70%), Gaps = 6/459 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PL  QGHLNQ LHLS LI+++ IPVHY G ATH RQA  R  GWDPLAV N+HF
Sbjct  23    VTVVMVPLLLQGHLNQILHLSCLISSYNIPVHYVGTATHTRQAKARAQGWDPLAVSNIHF  82

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S+P +++PPP+P+A TK+P QL+PV  A+  LR P  AL++ LS   +R+VV+ DS+
Sbjct  83    HEFSVPSYETPPPDPNAPTKYPLQLIPVLNASISLREPVYALLQQLSTTTRRLVVVCDSV  142

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHMPSPEGCFI  580
               +V++DV  + NAE Y F  ISAFT  +F WE+ GKP V  PE    L  +PS EG   
Sbjct  143   TPYVIKDVGLIPNAESYSFTSISAFTMCTFSWEQEGKPRVFEPEILEALESLPSHEGSLP  202

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTD  754
                 +F+K+Q      SSGDL N+CR IE  ++DL+ K     +  QWA+GP NPV + +
Sbjct  203   QGVIDFLKLQEESKPISSGDLYNTCRFIEGPYLDLLAKARAGDSHKQWAVGPFNPVEINE  262

Query  755   SINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
               +T  RH  LEWLD+Q  +SV+FV FGS T++S+E+  ++  GLE+SGQKFIW     D
Sbjct  263   HKDTEQRHYCLEWLDKQGPNSVIFVCFGSNTTVSDEEAKQIAIGLEKSGQKFIW--ILRD  320

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
                     E  RRA++PEG+EER  GRG++VR WAPQLEILGH S GGFMSHCGWNSCME
Sbjct  321   GDQGDVFKEEVRRAQLPEGFEERTEGRGIIVRNWAPQLEILGHSSTGGFMSHCGWNSCME  380

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW+RR E V    +   V++L+ +A
Sbjct  381   SISMGVPVAAWPMHSDQPRNAILLEKVLKIGLIVRDWSRREELVTSITVENAVRRLMDTA  440

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EGEE+R+RA ELS+++K  +  GG  R E++SF+AHI R
Sbjct  441   EGEEIRQRAKELSKTVKASVMEGGISRLEMDSFIAHIRR  479



>ref|XP_009589266.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=508

 Score =   440 bits (1131),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 258/469 (55%), Positives = 335/469 (71%), Gaps = 11/469 (2%)
 Frame = +2

Query  20    TKGGADVG-VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWD  196
             T    DV  V VVM+PLPAQGHLNQ LHLSRL++++ I VHY G   HI+QA  R HG+D
Sbjct  45    TSSPQDVAQVAVVMVPLPAQGHLNQLLHLSRLVSSYNIHVHYVGTIAHIQQAKIRAHGFD  104

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL-SVDQ  373
             PL   N+HFH    P F++P PNP+AS KFP QLMP F+AT HLR    AL+R L S + 
Sbjct  105   PLTTTNIHFHEFQTPSFETPLPNPNASNKFPNQLMPSFYATFHLRESVCALVRELLSKNL  164

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLN  550
             K+VVVI D+LM WVVQD+P + N E Y F   SAF +YSF WE  GKP + G E      
Sbjct  165   KKVVVIYDNLMNWVVQDLPEMPNTECYSFNSTSAFFSYSFLWELKGKPVLPGTEH---YE  221

Query  551   HMPSPEGCFIPEFEEFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIG  727
              +PS   CF  EF E++K+Q  F      G+L NS R IE+L++DL+ KE     QWAIG
Sbjct  222   DIPSVLDCFTTEFWEYLKIQEQFDGKIHCGELYNSSRVIESLYLDLMAKEYDGLKQWAIG  281

Query  728   PLNPVSLTD-SINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             P NP+   + S ++N R++SL+WLD+QE++SV+FVSFG+TTSL +E++ EL  GLE+S Q
Sbjct  282   PFNPLEPKEKSKDSNKRYESLDWLDKQERNSVIFVSFGTTTSLCDEEVKELAIGLEKSEQ  341

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             KFIWV+RD D+GDVF      R+ ++PEGYEE+++GRG++VR+WAPQLEIL H S GGFM
Sbjct  342   KFIWVLRDADKGDVFTS--EVRKVQLPEGYEEKIQGRGIIVRDWAPQLEILAHNSTGGFM  399

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNSCMESIS GVPIA WPMHSDQPRN+ L+T+ LK+G+++  W RR+E V    + 
Sbjct  400   SHCGWNSCMESISFGVPIATWPMHSDQPRNSQLVTKYLKIGLTVRPWTRRDELVTSEMVE  459

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               VK L+AS +G+EMR+RAA+LS ++K+ +  GG    E++SF+ HITR
Sbjct  460   NAVKTLMASPQGDEMRKRAADLSNAIKKSVTDGGVNCAEMDSFITHITR  508



>emb|CDP14133.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 334/462 (72%), Gaps = 11/462 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PL  QGHLNQ LHLSRLI+++ IPVHY G ATH RQA  RV GWDPLA+ N+HF
Sbjct  24    VTVVMVPLLLQGHLNQLLHLSRLISSYNIPVHYVGTATHTRQAKVRVQGWDPLAISNIHF  83

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P +++PPP+P+A TKFP QL+P+  A+  LR P  AL++ LS   +R+VVI DS+
Sbjct  84    HDFPVPSYETPPPDPNAPTKFPVQLIPMLKASIKLREPVYALLQQLSSTTRRLVVIYDSV  143

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHMPSPEGCFI  580
               +V+QDV  + NAE Y F  +SAFT Y++ WE+ GKP V  PE    L ++PS      
Sbjct  144   TPYVIQDVDLIPNAESYSFMSVSAFTAYAYSWEKIGKPRVLEPEILEALENLPSHASSLP  203

Query  581   PEFEEFIKMQ---RPFWDASSGDLLNSCREIEALFIDLIGKESKTGF--QWAIGPLNPVS  745
              E ++FIK+Q   +P   +S GDL N+CR IE  ++DL+ K S      QWA+GP NPV 
Sbjct  204   QELKDFIKLQNESKPI--SSGGDLYNTCRFIEGPYLDLLAKASAADSHKQWAVGPFNPVE  261

Query  746   LTDSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             + +  NT  RH  LEWLD+Q  + V+FV FGS TS+S+E+ T++  GLE+SG+KFIW+++
Sbjct  262   INEQKNTGQRHYCLEWLDKQGPNWVIFVCFGSNTSVSDEEATQIAIGLEKSGKKFIWILK  321

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             DGD+GDVF      RR ++P G+EER  GRG++VR+WAPQLEILGH S GGFMSHCGWNS
Sbjct  322   DGDQGDVFKG--EVRRVQLPGGFEERTEGRGIIVRDWAPQLEILGHSSTGGFMSHCGWNS  379

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESISMGVP+AAWPMH+DQ RNA L+ +VLK+G+S+ DW+R++E      +   V++L+
Sbjct  380   CMESISMGVPVAAWPMHTDQYRNAILLEKVLKIGLSVRDWSRQDELETSMAVENAVRRLM  439

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              SAEGEEMR+RA ELS+++K+ +  GG  R E++SF+AHI R
Sbjct  440   DSAEGEEMRQRAKELSKAVKDSVMEGGTSRLEMDSFIAHIGR  481



>emb|CDP14137.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   436 bits (1121),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 257/455 (56%), Positives = 335/455 (74%), Gaps = 6/455 (1%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ LHLSRLI+++ IPVHY G A+H RQA  RVHGWDPLA  N HFH  S
Sbjct  1     MVPLPAQGHLNQLLHLSRLISSYDIPVHYVGTASHNRQAKVRVHGWDPLATSNFHFHEFS  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
             +P +++PPPNP+A TK PTQL+P F A+  LR P  AL++ LS   +R+VVI D LM +V
Sbjct  61    IPSYETPPPNPNAPTKSPTQLIPAFNASIKLREPVYALLQQLSGTTRRLVVIYDDLMPYV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG-PEAAGVLNHMPSPEGCFIPEFE  592
             +QDV  + NAE Y F+ ISAFT Y+F WE+ GKP +  PE    L  +P+ E CF  E  
Sbjct  121   IQDVGLILNAEAYCFQSISAFTVYAFVWEQEGKPGISEPELLKPLEDLPTLESCFPQELM  180

Query  593   EFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSIN-  763
             +F+K+Q      +SG L N+CR IE  ++DL+ K   + +  QWAIGP NPV + +  N 
Sbjct  181   DFVKLQHDNKPITSGSLFNTCRAIEGPYLDLLAKSGITDSDKQWAIGPFNPVEMNEQKNL  240

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH  L+WLD+Q  +SV+F+SFGSTTS+S+E+  E+  GL++SGQKFIWV+RD D+GDV
Sbjct  241   KKRHYCLDWLDKQAPNSVIFISFGSTTSISDEEAEEIAIGLDKSGQKFIWVLRDADKGDV  300

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             F   +  RRA++PEG+ ER  GRG+VVR+WAPQLEILGH S GGFMSHCGWNSC+ESISM
Sbjct  301   FQGED--RRAQLPEGFAERTEGRGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCIESISM  358

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW+++NE V    +   V++L+ SAEGEE
Sbjct  359   GVPVAAWPMHSDQPRNAILLEKVLKIGLIIRDWSKQNELVTSITVENAVRRLMDSAEGEE  418

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+RA ELS+++K  +  GG  R E++SF+AHI R
Sbjct  419   MRQRARELSKAVKGSVMEGGVSRLEMDSFIAHIRR  453



>emb|CDP14138.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   437 bits (1123),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 263/470 (56%), Positives = 340/470 (72%), Gaps = 6/470 (1%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             +NG+       V VVM+PLPAQGHLNQ LHLS LI+++ IPVHY G A+H RQA  RVHG
Sbjct  18    QNGSSIQEIHEVTVVMVPLPAQGHLNQLLHLSCLISSYDIPVHYVGTASHNRQAKVRVHG  77

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             WDPLA+ N+HFH  S+P +++PPPNP+A TKFPTQL PVF  +  LR P   L++ LS  
Sbjct  78    WDPLAISNIHFHEFSIPSYETPPPNPNAPTKFPTQLFPVFNTSIKLREPVYTLLQQLSGT  137

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG-PEAAGVL  547
              +R+VVI DSLM +V+QDV  + NAE Y F   SAFT YS  WE+ GKP +  PE    L
Sbjct  138   TRRLVVIYDSLMAYVIQDVGLILNAESYCFPSTSAFTVYSIVWEQEGKPGLSEPELLETL  197

Query  548   NHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWA  721
               +P+ E CF  E  +F K+Q+ F   SSG L NSCR IE  ++DL    K + +  QWA
Sbjct  198   EDLPTWESCFPQELTDFAKLQQDFKPISSGYLFNSCRAIEGPYLDLHVKSKITDSDKQWA  257

Query  722   IGPLNPVSLTDSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             IGP NPV +    N+  RH  L+WLD+Q  +SV+F+SFGSTTS+S+E+  E+  GL++SG
Sbjct  258   IGPFNPVEMNGQKNSEKRHYCLDWLDKQAPNSVIFISFGSTTSVSDEEAKEIATGLDKSG  317

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
             QKFIWV+RD D+GDVF   +  RRA++PEG+EER+ GRG+VVR+WAPQLEILGH S GGF
Sbjct  318   QKFIWVLRDADKGDVFQGED--RRAQLPEGFEERIEGRGIVVRDWAPQLEILGHSSTGGF  375

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             MSHCGWNSC+ESISMGVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW+++NE V    +
Sbjct  376   MSHCGWNSCIESISMGVPVAAWPMHSDQPRNALLLEKVLKIGLKVRDWSKQNEPVTSITV  435

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                V++L+ SAEGEEM +RA  LS+++K+    GG  R E++SF+AHI R
Sbjct  436   ENAVRRLMDSAEGEEMWQRAKLLSKAVKDSGMEGGVSRLEMDSFIAHIRR  485



>ref|XP_009783803.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=464

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 247/462 (53%), Positives = 323/462 (70%), Gaps = 11/462 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V+VV++P PAQGHLNQ LHLSRLI ++ IPVHY     H  QA  R  G  P+A+ N+HF
Sbjct  7     VIVVVVPFPAQGHLNQLLHLSRLICSYKIPVHYVSTKNHTLQAKIRAQGLSPIAMNNIHF  66

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H  S+  FQSPPPNP+++ KFP+ L P F  ++SHLR P  +L+R LS + +R+VVI DS
Sbjct  67    HEFSISSFQSPPPNPNSTIKFPSHLQPSFESSSSHLREPVASLLRFLSSNARRIVVIHDS  126

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM +VVQD  SL NAE Y F  +SAFT + F WE  GKP   P  A +L ++PS  GCF 
Sbjct  127   LMAYVVQDFTSLPNAESYNFHSVSAFTIFLFLWESMGKP--FPIEAQILENLPSLTGCFT  184

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTD  754
              EF +F+  QR + ++ SG++ N+ R IE  F++L+ KE   +    WAIGP NPV  T 
Sbjct  185   SEFMDFMAAQRKYSNSDSGNIYNTTRVIEGKFMNLLEKEPIKRNKMHWAIGPFNPVMTTT  244

Query  755   SINTN----RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             S N +    RHK L WLD+Q   SV+F+SFG+TTSL++EQI EL  GLE S  KFIW +R
Sbjct  245   SSNNSSIGQRHKCLTWLDKQSPKSVIFISFGTTTSLTDEQIKELCIGLERSDTKFIWALR  304

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D D+GD+F      R+ E+P GYEER++ +G++VR+WAPQLEILGH S+GGFMS+CGWNS
Sbjct  305   DADKGDIFSG--EVRKFELPNGYEERIKNKGIIVRDWAPQLEILGHFSIGGFMSYCGWNS  362

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMES SMGVPI AWPMHSDQPRN+ L+T+ LK+GI + +W RRNE V    +   VK L+
Sbjct  363   CMESFSMGVPIIAWPMHSDQPRNSILVTKFLKVGILVNNWERRNEVVTSNTVERAVKTLV  422

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +S EG E+R+RAA+L  ++++    GG  R EL+SF+ HITR
Sbjct  423   SSNEGNEIRKRAADLGVTIRKSGVEGGVTRKELDSFIGHITR  464



>gb|EYU18710.1| hypothetical protein MIMGU_mgv1a005799mg [Erythranthe guttata]
Length=470

 Score =   435 bits (1119),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 321/472 (68%), Gaps = 15/472 (3%)
 Frame = +2

Query  17    GTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWD  196
             G K  A+  V VVM+P P QGHLNQ LHLSRLI+A  +PVHY G  TH RQA  R+HGWD
Sbjct  6     GVKQSAEDQVAVVMVPFPLQGHLNQLLHLSRLISAADVPVHYVGTTTHNRQARRRIHGWD  65

Query  197   PLAVP-NLHFHHLSMPHFQSPPPN---PDASTKFPTQLMPVFFATSHLRRPFNALIRNLS  364
             PL+ P N+ FH  S   F+SPPP+   P ++T FP+   P+F A S LRRP + L+R L 
Sbjct  66    PLSNPNNIIFHDFSPISFESPPPDTSAPPSTTPFPSHHQPLFDALSALRRPVSQLLRRLC  125

Query  365   VDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGV  544
                +RV+V+ DSLMG VVQD     N+E Y F  +SA+T + F WE  G+P       G+
Sbjct  126   AASRRVIVVYDSLMGSVVQDFIEFPNSEAYTFHSVSAYTIFFFLWENVGRPFA--VDGGI  183

Query  545   LNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQW  718
             L  +PS EGCF PEF +F++ Q  +   +SG + N+CR +E  F++++ K   +G   QW
Sbjct  184   LEDLPSMEGCFTPEFLKFVRRQHDYMKLNSGRIYNTCRVVEGQFMEMLEKPEISGNKKQW  243

Query  719   AIGPLNPVSLTDSINTN--RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             A+GP NPV L  S  +   RH+ L+WLD Q KDSV+ VSFG+TT+LS +QI EL AGLE 
Sbjct  244   ALGPFNPVVLEYSGESKKGRHRCLKWLDGQAKDSVILVSFGTTTTLSEKQIKELAAGLER  303

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             SG+KFIW V     G     GE  +R      +EERVR RG+VVREWAPQLEILGH S G
Sbjct  304   SGKKFIW-VLRDADGGGGGGGEVCKRV----EFEERVRERGIVVREWAPQLEILGHSSTG  358

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRN  LIT+VLK+G+ + DW RR+E V   
Sbjct  359   GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTVLITKVLKIGVVVKDWGRRDEIVTAD  418

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++ + V +L+ S EGEEMRRRAAEL  ++++    GG  R EL+SF++HITR
Sbjct  419   DVEKAVGRLMGSEEGEEMRRRAAELGGAVRKAAGEGGLSRVELDSFISHITR  470



>gb|EYU20759.1| hypothetical protein MIMGU_mgv1a017976mg [Erythranthe guttata]
Length=453

 Score =   434 bits (1115),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 248/458 (54%), Positives = 325/458 (71%), Gaps = 12/458 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLI-AAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHL  232
             M+PLPAQGHLNQ LHLSRL+ AA  IPV+Y G+ATHIRQA  RVHGW+P +  NL FH  
Sbjct  1     MVPLPAQGHLNQLLHLSRLVSAAANIPVYYVGSATHIRQAKLRVHGWNPSSAANLRFHEF  60

Query  233   SMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGW  412
               P FQ+P PNP++STKFP+Q++P   A+++LR P +A +  +S++  R ++I DSLM +
Sbjct  61    LTPSFQNPAPNPNSSTKFPSQILPSLSASTNLRHPLHAFVAGISIEYSRTIIIFDSLMSY  120

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFE  592
             VVQD+ S+ N ELY F  ISAFT YSF WE  GKPD+   AA  L  +P  +  F PEF 
Sbjct  121   VVQDMDSIPNTELYCFVSISAFTYYSFLWETAGKPDLPAGAAKFLKEIPGRDDFFTPEFS  180

Query  593   EFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDS-----  757
             +F  +QR      +G++ NS R IE  +++L+ +E K    WAIGP NP  +T +     
Sbjct  181   DFSTLQRSSRKKIAGNIYNSSRLIEGTYLNLLEQE-KGEKVWAIGPFNPTVITTTDQEKV  239

Query  758   -INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               + NRH+ L+WLD+QE +SV+FVSFGSTTSLS+EQI EL  GLE S QKFIWVVR+ D+
Sbjct  240   LDSRNRHECLDWLDKQEPNSVIFVSFGSTTSLSDEQIQELAIGLERSSQKFIWVVREADK  299

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F+    +R+AE+P G+EERV  RG+VVREWAPQLEILGH S GGFMSHCGWNSCMES
Sbjct  300   GDIFEG--ESRKAELPRGFEERVSKRGIVVREWAPQLEILGHSSTGGFMSHCGWNSCMES  357

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVP+  WPMHSDQPRN  L+T+VL++G+ + DW    ++V    + E   +++   E
Sbjct  358   ISMGVPMVTWPMHSDQPRNGFLVTKVLRVGVEVRDWGCFRDKVVSSVMVENAVRVL--ME  415

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EE+R+RA EL  +++     GG G NE++SF+AHITR
Sbjct  416   SEEIRKRAEELGAAVRNSFMEGGSGSNEMKSFIAHITR  453



>ref|XP_002284381.1| PREDICTED: zeatin O-glucosyltransferase-like [Vitis vinifera]
Length=473

 Score =   432 bits (1112),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 245/459 (53%), Positives = 315/459 (69%), Gaps = 6/459 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P PAQGHLNQ L LSRLI+++ + VHY G+ TH  QA  RV GWDPL  PN  F
Sbjct  17    VAVVMVPFPAQGHLNQLLQLSRLISSYNVSVHYVGSVTHTHQAKLRVQGWDPLLHPNFQF  76

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             HH   PHF SPPPNP++S +FP  L   F A+S LR+P  AL+R LS   +R++VI DSL
Sbjct  77    HHFPTPHFHSPPPNPNSSVQFPAHLESSFEASSQLRQPVAALLRELSPRARRIIVIHDSL  136

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+QDV S++NAE Y F  +SAF+ + F WE  GKP +  + A  L  +PS +GCF  
Sbjct  137   MGSVIQDVASIRNAESYTFHSVSAFSIFLFLWEAAGKPVL--KEAKFLEDVPSLDGCFPL  194

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLI-GKESKTGFQ--WAIGPLNPVSLTD  754
             EF  FI  Q  F   +SG++ N+C+ +E  ++DL+ G E   G +  WA+GP NP+++  
Sbjct  195   EFLNFIASQHQFKKLNSGNIYNTCKSMEGCYVDLLDGLEIYGGKKKHWALGPFNPLTICY  254

Query  755   SINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                +N  H+ L WLD+Q   SVL VSFG+TTSL++EQI EL  GLE+S QKFIWV+RD D
Sbjct  255   DKKSNPGHRCLGWLDKQAPKSVLLVSFGTTTSLTDEQIKELAIGLEQSKQKFIWVLRDAD  314

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +GDVF                   RG G+VVR+WAPQLEILGH S GGFMSHCGWNSC+E
Sbjct  315   KGDVFSGEVRRAELPEGYEERVGGRGMGLVVRDWAPQLEILGHSSTGGFMSHCGWNSCLE  374

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVPIAAWPMHSDQPRN  L+ +VLK+G+ + DWA+R + V    + + V+ L+AS 
Sbjct  375   SISMGVPIAAWPMHSDQPRNTVLVAQVLKVGLVVRDWAQREQLVAASTVEKKVRSLMASK  434

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG++MR+RAAEL  +++  +  GG  R EL+SFVAHITR
Sbjct  435   EGDDMRKRAAELGATIQRSMDEGGVSRKELDSFVAHITR  473



>ref|XP_009766032.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=453

 Score =   431 bits (1107),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 249/457 (54%), Positives = 321/457 (70%), Gaps = 12/457 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQFLHLSRLI+ + IPVHY G   HI+QA  RVHG+DPL + N+ FH   
Sbjct  1     MVPLPAQGHLNQFLHLSRLISMYNIPVHYVGTNAHIQQAKTRVHGFDPLTITNIQFHEFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL--SVDQKRVVVISDSLMG  409
              P +++P PNP+A  KFP+QL+P FFA SHLR P  +L R L  +++  +VVVI D+LM 
Sbjct  61    TPTYETPSPNPNAPHKFPSQLIPSFFAASHLREPICSLARKLASTMNVNKVVVIYDNLMS  120

Query  410   WVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDV-GPEAAGVLNHMPSPEGCFIPE  586
              VVQD+P + N E Y F  ISAF  +S+ WE  GKP + G E       +PS + CF   
Sbjct  121   GVVQDLPEMPNTECYCFNPISAFHRFSYFWEVKGKPLLPGTEH---YEDIPSVKDCFSAY  177

Query  587   FEEFIKMQ-RPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDS-  757
             F E++K Q  PF    S G+L NS R IE L++DL+ KE      WAIGP NPV LT+  
Sbjct  178   FWEYLKAQVVPFVGKISCGELFNSSRVIEGLYLDLMAKEFNNPKLWAIGPFNPVVLTEKH  237

Query  758   INTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              N+N RH+SL+WLD+QE +SV+FVSFG+TTSLSNE+I ++  GLE+S QKFIW     D 
Sbjct  238   KNSNKRHESLDWLDKQEHNSVIFVSFGTTTSLSNEEIKQIAIGLEKSEQKFIW--VLRDA  295

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
                       R+ ++PEGYEER++GRG++VR+WAPQLEIL H S GGFMSHCGWNSCMES
Sbjct  296   DKGDVFTSEVRKIQLPEGYEERIKGRGIIVRDWAPQLEILAHSSTGGFMSHCGWNSCMES  355

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             IS GVPIAAWPMHSDQPRN+ L+T+ LK+G+++  W RR+E V    +   VK L+ + E
Sbjct  356   ISFGVPIAAWPMHSDQPRNSQLVTKYLKIGLTVRPWMRRDEHVTPDMVENAVKTLMDTTE  415

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             G+EMR+RAA LS ++K+ +  GG  R E++SF+AHIT
Sbjct  416   GDEMRKRAALLSNTIKKSVMDGGMNRAEMDSFIAHIT  452



>ref|XP_006351251.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=450

 Score =   429 bits (1104),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 261/455 (57%), Positives = 334/455 (73%), Gaps = 9/455 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PL AQGHLNQ LHLSRLI ++ IPVHY GA THIRQA  RVHG+DP+   NL+FH   
Sbjct  1     MVPLSAQGHLNQLLHLSRLITSYNIPVHYVGATTHIRQAKFRVHGFDPVTAKNLYFHEFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL-SVDQKRVVVISDSLMGW  412
              P F++PPPNP+AS KFP QL+P F+AT HLR P  +L+R L  V+ +RV+VI DS+M W
Sbjct  61    TPPFENPPPNPNASNKFPNQLIPSFYATIHLREPVCSLVRQLLGVNHRRVIVIYDSMMSW  120

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCFIPEF  589
             VV+DVP++ NAE Y F  ISAF T+S  WE  GKP   G E   +   + S + C  PE 
Sbjct  121   VVEDVPAIPNAECYCFNSISAFHTFSCIWESRGKPLQAGTE---IFEGISSNKNCATPEL  177

Query  590   EEFIKMQRPFW-DASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINT  766
              E  + Q       SSG+L NS R IE L++DL+ KE+    QWA+GP NP+    + N+
Sbjct  178   WELWRKQEALMRKVSSGELYNSSRVIEGLYLDLVAKENDGLNQWALGPFNPLLSEQNKNS  237

Query  767   NRH-KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
             N+H ++L WLD+QE +SV++VSFG+TTSLSNE+I EL  GLE+S QKFIWV+RD D+GDV
Sbjct  238   NKHHQTLYWLDKQETNSVIYVSFGTTTSLSNEEIEELAVGLEKSMQKFIWVLRDADKGDV  297

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             F   E  RRA++P+GYEER++GRG++VR+WAPQLEIL HPS GGFMSHCGWNSCMESISM
Sbjct  298   FAGEE--RRAQLPDGYEERLKGRGIIVRDWAPQLEILAHPSTGGFMSHCGWNSCMESISM  355

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPIAAWPMHSDQPRN+ L+T+ LK+G+ +  WA R+E V    +   V+ L+AS EG+E
Sbjct  356   GVPIAAWPMHSDQPRNSQLVTKFLKIGLIVRHWACRDELVTSEIVENAVRTLMASPEGDE  415

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+RA+ELS  +K+ +  GG  R E++SF+ HITR
Sbjct  416   MRKRASELSNVVKQSVVDGGVNREEMDSFITHITR  450



>ref|XP_011075344.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=519

 Score =   431 bits (1109),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 253/468 (54%), Positives = 330/468 (71%), Gaps = 8/468 (2%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             +NG K      V VVM+PLPAQGHLNQ LHLSR+++A  IPV+Y GAATHIRQA  RV G
Sbjct  56    QNGYKRTQSSDVAVVMVPLPAQGHLNQLLHLSRMVSARNIPVYYIGAATHIRQARLRVQG  115

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             W+P  V N+ FH      F++P P+P+A TKFP Q++P   A+  LR P    +  +S  
Sbjct  116   WNPSGVSNIQFHEFPQTPFENPLPDPNAPTKFPGQILPSLMASMLLRGPVYRFVEGISRA  175

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              +R VVI DSLM +VVQD+ SLQNA  Y FR ISAF   S  WE    PD  P  A +L 
Sbjct  176   FRRAVVIYDSLMSYVVQDIDSLQNAVCYSFRSISAFAVSS--WEALDSPDDLPIEAEILK  233

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAI  724
              +PS +G + PEF EF+ +Q       SG++ NSCREIE L++DL+ K  + G +  WAI
Sbjct  234   DIPSLDGYYPPEFAEFLNLQSGSRKIFSGEIYNSCREIEGLYLDLLEKRKRNGAEKLWAI  293

Query  725   GPLNPVSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             GP N VS+ +  +  NRHKSL+WLDRQ  +SV+FVSFG+T+SLS+EQI E+  GLE SGQ
Sbjct  294   GPFNLVSVPEERDFRNRHKSLQWLDRQGLNSVIFVSFGTTSSLSDEQIKEIAFGLERSGQ  353

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             KFIWV+RD D+GD+F      R +E+P+G+E+RV+ RGVVVR+WAPQLEIL HPS GGFM
Sbjct  354   KFIWVLRDADKGDIFAG--EVRESELPDGFEKRVKERGVVVRDWAPQLEILCHPSTGGFM  411

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNSC+ESISMGVP+A WP+HSDQP NA L+T+VLK+G+ +  W+R++E V    + 
Sbjct  412   SHCGWNSCLESISMGVPMATWPLHSDQPGNAVLMTQVLKIGVQVKCWSRQDELVSSLTVE  471

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
               V+KL+ S EG+ +R+RAAEL  ++K+ +  GG  R E++SF+ HIT
Sbjct  472   TAVRKLMMSEEGDWVRKRAAELGDAVKKSVE-GGVIRKEIDSFIDHIT  518



>emb|CDP14139.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   429 bits (1103),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 254/455 (56%), Positives = 330/455 (73%), Gaps = 6/455 (1%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+P PAQGHLNQ LHLSRLI+++ IPVHY   ATH RQA  RV GWDPLA+ N+HF   S
Sbjct  1     MVPFPAQGHLNQLLHLSRLISSYNIPVHYVSTATHTRQAKFRVQGWDPLAISNIHFLEFS  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
             +P +++PPPNP+A TKFPTQL+P   A+  LR P  AL++ LS   +R+V+I DSL  +V
Sbjct  61    VPSYENPPPNPNAPTKFPTQLIPATHASFKLREPVYALLQQLSTTTRRLVLIHDSLFQYV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCFIPEFE  592
             +QDV  + NAE Y F  ISAFT Y+  WE  GKP    PE   +L  +PS E CF P   
Sbjct  121   IQDVGLIPNAESYCFESISAFTDYTIDWEDEGKPGLSEPELLELLEDIPSLESCFHPALI  180

Query  593   EFIKMQRPFWDASSGDLLNSCREIEALFIDLI--GKESKTGFQWAIGPLNPVSLTDSINT  766
             + + +Q+     SSGD+ N+CR IE  ++DL+   K + +  QWAIGP NPV   +  N+
Sbjct  181   DLVNLQKNTKPISSGDIYNTCRAIEGPYLDLLAKAKTADSNKQWAIGPFNPVETNEQKNS  240

Query  767   -NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH  L+WLD+Q  +SV+FVSFGSTTSLS+E+  E+ +GLE+SGQKFIWV+RD D+GDV
Sbjct  241   KKRHYCLDWLDKQATNSVIFVSFGSTTSLSDEEAEEIASGLEQSGQKFIWVLRDADKGDV  300

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             F      RRA++PEG+EER  GRG+VVR+WAPQLEILGH S GGFMSHCGWNSCMESISM
Sbjct  301   FQGE--VRRAQLPEGFEERTEGRGIVVRDWAPQLEILGHASTGGFMSHCGWNSCMESISM  358

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW++++E V    +   V++L+ SAEGE+
Sbjct  359   GVPVAAWPMHSDQPRNAVLLEKVLKIGLLVRDWSKKDELVTSMTVENAVRRLMDSAEGEK  418

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+ A ELS+++K  +  GG  R E++SF+AHI R
Sbjct  419   MRQTAKELSKAVKGSVMEGGASRLEMDSFIAHIRR  453



>ref|XP_006351250.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   429 bits (1103),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 268/470 (57%), Positives = 335/470 (71%), Gaps = 10/470 (2%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NG     D  V VVM+PL AQGHLNQ LHLSRLI ++ IPVHY GA THIRQA  RVHG+
Sbjct  10    NGQISVQDAQVAVVMVPLSAQGHLNQLLHLSRLITSYNIPVHYVGATTHIRQAKFRVHGF  69

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRN-LSVD  370
             DP    NL+FH    P F++PPPNP+AS KFP QL+P F+AT HLR P  +L+R  L V+
Sbjct  70    DPGTAKNLYFHEFPTPPFENPPPNPNASNKFPNQLIPSFYATIHLREPVCSLVRQLLGVN  129

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVL  547
              +RV+VI DS+M WVV+DVP++ NAE YRF  ISAF T+S  WE  GKP   G E   + 
Sbjct  130   HRRVIVIYDSMMSWVVEDVPAIPNAECYRFNSISAFHTFSCIWESRGKPLQAGTE---IF  186

Query  548   NHMPSPEGCFIPEFEEFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAI  724
               + S E C  PE  E    Q       SSG+L NS R IE L++DL+ KE       AI
Sbjct  187   EDISSNENCATPELWELWSKQNSLEGKISSGELYNSSRVIEGLYLDLVAKEINGLNLRAI  246

Query  725   GPLNPVSLT--DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             GP NP+ LT  D+ +  RHK+L+WLD+QE DSV++VSFG++TSLSNE+I +L  GLE+S 
Sbjct  247   GPFNPLLLTEQDNDSNKRHKTLDWLDKQEPDSVIYVSFGTSTSLSNEEIEQLAIGLEKSL  306

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
             QKFIWV+RD D+GDVF   E  RRA +PEGYEER++GRG++ R+WAPQLEIL HPS GGF
Sbjct  307   QKFIWVLRDADKGDVFAGEE--RRARLPEGYEERIKGRGIIARDWAPQLEILAHPSTGGF  364

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             MSHCGWNSCMESISMGVPIAAWPMHSDQPRN+ L+T+ LK+G++L   A ++E V    +
Sbjct  365   MSHCGWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKFLKIGLNLRHGACQDELVTSEMV  424

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                V+ L+AS EG EMR+RA+ELS ++K+ +  G G   E++SF+ HITR
Sbjct  425   ENAVRTLMASPEGGEMRKRASELSVAVKQSVMDGEGTGTEMDSFITHITR  474



>ref|XP_009625755.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=470

 Score =   429 bits (1102),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 257/470 (55%), Positives = 322/470 (69%), Gaps = 9/470 (2%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSR-LIAAHGIPVHYAGAATHIRQATHRVHG  190
             N         V+VVM+PLPAQGHL+QFL L+R L +AH IPV+Y     H+RQA  R  G
Sbjct  5     NHAANATQHSVIVVMVPLPAQGHLHQFLELARRLASAHNIPVYYVSTVAHVRQAQSRARG  64

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             WDPL  PNL+F   S+  F  PPPNPDAS KFP+QL+P F ++  LR P   L+ NLS  
Sbjct  65    WDPLNTPNLNFSEFSV-SFDVPPPNPDASIKFPSQLVPAFNSSLQLREPVAELVNNLSSK  123

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              ++VVV+ D L  W+VQDVP + N E Y F  +SAF  +S+ W+   +P V  EA  VL 
Sbjct  124   ARKVVVLHDFLTSWIVQDVPKIPNTECYCFHTVSAFLIFSYIWD-AARPPVPSEAEVVLK  182

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ-WAIG  727
              +PS EGC  PE EEF K Q        G++ ++ R IE L++DLI K     F+ WA+G
Sbjct  183   QIPSLEGCNSPELEEFAKKQLQARVFGVGNIFSTSRVIEQLYLDLIEKTYVKDFKHWALG  242

Query  728   PLNPVSL---TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             P NPV +   T      RH SLEWLD+Q ++SV+FVSFGSTTSLS E+I EL  GLE+S 
Sbjct  243   PFNPVEIPIPTPDAEKRRHYSLEWLDKQTENSVIFVSFGSTTSLSEEEIKELAKGLEQSE  302

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
             Q+FIWV+RD D+GD+F      R+ ++PEGYEERV  RG+V+R+WAPQLEIL H +  GF
Sbjct  303   QRFIWVLRDADKGDIFSGD--VRKRQLPEGYEERVAERGIVIRDWAPQLEILEHVATSGF  360

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             MSHCGWNSCMESISMGVPIAAWPMHSDQPRNA LIT+ LK+GIS+  W +RNE V    I
Sbjct  361   MSHCGWNSCMESISMGVPIAAWPMHSDQPRNALLITKGLKIGISVRVWEKRNEVVPAETI  420

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + VK L+AS+EGEEM++RA EL +++K  +  GG    E+ESFVAHITR
Sbjct  421   EKVVKTLMASSEGEEMKKRATELKEAVKLSVMDGGAAHKEMESFVAHITR  470



>ref|XP_002322723.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEF04484.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=476

 Score =   424 bits (1089),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 255/460 (55%), Positives = 331/460 (72%), Gaps = 9/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+PLPAQGHLNQ L LSRLI +H IPVHY GA TH RQA  RVHGWDP A  N+HF
Sbjct  21    VVVVMVPLPAQGHLNQLLQLSRLILSHNIPVHYVGATTHNRQAKQRVHGWDPNAAANIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +P F  PPP+P A  KFP+ L PVF A+S L  P + L+R LS   ++V+VI DSL
Sbjct  81    HDIEIPPFHCPPPDPKAKIKFPSHLQPVFNASSQLTEPVSMLLRALSCKARKVIVIHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+++   L NAE Y F  +SAF    + WE+ GK  +  E        PS EGCF  
Sbjct  141   MGSVIEEARFLSNAESYTFHSVSAFAISLYEWEQEGK--LIEENELFPRDTPSLEGCFTD  198

Query  584   EFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGKES-KTGFQ-WAIGPLNPVSLTD  754
             EF +F+      +   ++G + N+C+ +E+ ++D + KE+ K G + WA+GP NPV++ +
Sbjct  199   EFADFVDCHYSKYQKFNTGCVYNTCKLVESAYLDFLEKETIKEGIKHWALGPFNPVTIPE  258

Query  755   SINTNR--HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                +++  H  LEWLD+Q K++V++VSFG+TT+  +EQI EL  GL ES +KFIWV+RDG
Sbjct  259   RSESSKKQHFCLEWLDKQAKNTVIYVSFGTTTTFDDEQIKELAIGLRESKKKFIWVLRDG  318

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GDVF+  E  RRAE+P+GYE  V G G+VVR+WAPQLEIL HP+ GGFMSHCGWNSCM
Sbjct  319   DKGDVFNGEE--RRAELPKGYENSVDGIGLVVRDWAPQLEILAHPATGGFMSHCGWNSCM  376

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPIAAWPMHSDQPRN  LITEVLK+GI + DWA+R+E V  + +G  V +L+AS
Sbjct  377   ESISMGVPIAAWPMHSDQPRNTVLITEVLKIGIVVKDWAQRDEIVTSKIVGSAVNRLMAS  436

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+EMR+RAAE+ +S++  +A GG  R E+ESF+AHITR
Sbjct  437   TEGDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHITR  476



>emb|CDP14140.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   422 bits (1086),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 241/459 (53%), Positives = 314/459 (68%), Gaps = 12/459 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+P P QGHLNQ LHLSRLI+++ IPVH+   ATH RQA  RVHGW+PL+  N+HFH   
Sbjct  1     MVPFPLQGHLNQLLHLSRLISSYNIPVHFVSTATHNRQAKLRVHGWNPLSKANIHFHEFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
               +F +PPPNP+ S KFP  L P F A++ LR P +AL R LS   KRVV+I+DSLMG V
Sbjct  61    TANFPNPPPNPNTSLKFPAHLQPSFDASADLRGPISALFRALSARAKRVVIINDSLMGSV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD  ++ NAE Y F  +SAF+ + F WER   P   P    +L  +P  +GCF PEF  
Sbjct  121   VQDFVTVSNAESYTFHSVSAFSIFFFMWERMENP--FPVDKEILKILPPMDGCFTPEFSN  178

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLT------  751
             F+K Q  F   +SG + NSC+ IE  ++DL+ KE  S    QWA+GP NPV++       
Sbjct  179   FVKAQHNFVQFNSGRIYNSCKVIEGPYLDLLSKEEISLNKKQWALGPFNPVNIMHQKSGP  238

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                N  RHK L+WLD Q  +SV+FVSFG+TTS+S+EQI EL  GLE S QKF+W     D
Sbjct  239   KEQNNERHKCLQWLDSQSNNSVIFVSFGTTTSISDEQIRELAFGLERSAQKFLW--VLRD  296

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
                     +  R+ E+P+G+E RV GRG+VVR WAPQLEILGH + GGFMSHCGWNSCME
Sbjct  297   ADSGDVFVQETRKLELPKGFERRVEGRGLVVRNWAPQLEILGHSATGGFMSHCGWNSCME  356

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SI+MGVP+A WPMHSDQPRNA LIT++LK+G+ + DWA ++E V   ++ +  + L+A  
Sbjct  357   SITMGVPMATWPMHSDQPRNAVLITKILKVGLEVKDWAHKDELVTSSKVEKAARMLMAEE  416

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG++MR+R+AE+  +++  +A GG  R EL+SF+AHITR
Sbjct  417   EGQQMRKRSAEMGAAVRTSLAEGGVTRMELDSFIAHITR  455



>ref|XP_009796092.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=470

 Score =   423 bits (1087),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 252/460 (55%), Positives = 319/460 (69%), Gaps = 9/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSR-LIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V+VVM+PLPAQGHL+QFL L+R L +AH IPV+Y   A H+RQA  R  GWDPL  PNL+
Sbjct  15    VIVVMVPLPAQGHLHQFLELARRLSSAHNIPVYYVSTAAHVRQAQSRARGWDPLNTPNLN  74

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             F   S+  F  P PNPDAS KFP+QL+P F ++  LR P   L+  LS   ++VVV+ D 
Sbjct  75    FSEFSV-SFDVPSPNPDASIKFPSQLVPAFNSSLQLREPVAELVNTLSSKARKVVVMHDF  133

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  WVVQDVP + N E Y F  +SAF  +S+ W+   +P V   A  VL  +PS EGC  
Sbjct  134   LTSWVVQDVPKIPNTECYCFHTVSAFLIFSYIWD-AARPPVPSVAEVVLKQIPSLEGCNS  192

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ-WAIGPLNPVSL---  748
             PE EEF K Q        G++ ++ R +E ++++LI K     F+ WA+GP NPV +   
Sbjct  193   PELEEFAKKQLQVKVFGVGNIFSTSRVVEEMYLNLIEKTYVKDFKHWALGPFNPVEIPVP  252

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             T     NRH SLEWLD+Q ++SV+FVSFGSTTSLS ++I EL  GLE+S Q+F+WVVRD 
Sbjct  253   TPDTEKNRHYSLEWLDKQPENSVIFVSFGSTTSLSEDEIKELAKGLEQSEQRFVWVVRDA  312

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F      R+ ++PEGYEERV  RG+V+R+WAPQL+ILGH + GGFMSHCGWNSCM
Sbjct  313   DKGDIFSGD--VRKYQLPEGYEERVAERGIVIRDWAPQLDILGHVATGGFMSHCGWNSCM  370

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPIAAWPMHSDQPRNA LIT+ LK+GIS+ +W +RNE V    I   VK LI  
Sbjct  371   ESISMGVPIAAWPMHSDQPRNAVLITKGLKIGISVREWEKRNEVVPAETIENVVKTLIVW  430

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EGEEM++RA EL +++K  +  GG    E+ESFVAHITR
Sbjct  431   PEGEEMKKRATELKEAVKLSVMDGGVAHKEMESFVAHITR  470



>ref|XP_002278696.2| PREDICTED: zeatin O-glucosyltransferase [Vitis vinifera]
Length=496

 Score =   424 bits (1089),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 309/472 (65%), Gaps = 12/472 (3%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             ENG K    V VV  M+P PAQGHLNQ L LSR+I+++ IPVHY G+ATHI QA  R+ G
Sbjct  27    ENGVKEAPHVAVV--MVPFPAQGHLNQLLQLSRIISSYNIPVHYVGSATHINQAKLRLQG  84

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             WDPL  PN HFH    PHF SPPP+PDAS +FP  L P F A+S LR P  AL+R LS+ 
Sbjct  85    WDPLLEPNFHFHDFPTPHFHSPPPDPDASVQFPAHLQPCFEASSELREPVAALLRELSLT  144

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
               R++VI+DSLMG VVQD   + NAE Y F  +S F+ + F WE  G+P +  E   +  
Sbjct  145   VDRLIVINDSLMGSVVQDFVGIGNAESYTFHSVSVFSIFFFFWESLGRPAL--EGVKIPE  202

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ---WA  721
              +PS +GCF  EF +F+  Q  F   SSG+L  + + IE  ++D++ +E   G +   WA
Sbjct  203   DVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTSKLIEGPYVDILREEEIDGVKKKGWA  262

Query  722   IGPLNPV-SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             +GPLN V + +D  +    K LEWLD+Q   SVL VSFG++TSL++EQI EL  GLE SG
Sbjct  263   LGPLNLVTTYSDKTSNPGDKCLEWLDKQAPKSVLLVSFGTSTSLTDEQIKELAIGLERSG  322

Query  899   QKFIWvvrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
              KFIW     D        E  RR+E         +  G GVVVREWAPQLEILGH S G
Sbjct  323   HKFIW--LLRDADKGDIFSEEVRRSELPEGYEERMKETGMGVVVREWAPQLEILGHSSTG  380

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             G M HCGWNSC+ESISMGVPIAAWPMHSDQPRNA L+T+VL++G+++ +WA R + V   
Sbjct  381   GLMCHCGWNSCLESISMGVPIAAWPMHSDQPRNAALVTQVLQVGLAVKEWAEREQLVAAS  440

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              I + V++L+AS EG  MR++A +L  SL+  +  GG  R EL+ F+AHITR
Sbjct  441   AIEKAVRRLMASEEGNAMRKKAQQLGNSLQRSMEEGGVSRKELDGFIAHITR  492



>ref|XP_004249229.2| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=483

 Score =   423 bits (1087),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 329/460 (72%), Gaps = 9/460 (2%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  V VVM+PLPAQGHLNQ LHLSRLI ++ IPVHY GA THIRQA  RVHG+DP+ + N
Sbjct  31    DAQVAVVMVPLPAQGHLNQLLHLSRLITSYNIPVHYVGATTHIRQAKLRVHGFDPVTIRN  90

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQ-KRVVVI  391
             LHFH    P F++PPPNP+AS KFP  ++P+  AT H R P  +L+  L  D  +RV+VI
Sbjct  91    LHFHEFPTPPFENPPPNPNASHKFPDHMLPLLNATIHFREPVCSLVNQLLGDNHRRVIVI  150

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEG  571
              DS+M WVVQDVP++ NAE YRF   SAF   S +WE  GKP   PE   + + + S E 
Sbjct  151   YDSMMTWVVQDVPAIPNAEGYRFNSFSAFYMCSSYWETKGKPS-QPETE-IFDDIISSEN  208

Query  572   CFIPEFEEFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             C IPE  E    Q        SG+L NS R IE L++DL+ KE      WAIGP NP+  
Sbjct  209   CAIPELWELWNKQGALEGKICSGELYNSSRVIEGLYLDLVAKEINGLNLWAIGPFNPLL-  267

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
               S    +H++L WLD+QE +SV++VSFGSTT+LSNE+I EL  GLE+S QKFIWV+R+ 
Sbjct  268   --SQQNKQHQTLYWLDKQETNSVIYVSFGSTTTLSNEEIEELAIGLEKSMQKFIWVLREA  325

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F   E  RRA +PEGYEER++GRG++VR+WAPQLEIL HPS GGFMSHCGWNSCM
Sbjct  326   DKGDIFAGEE--RRARLPEGYEERIKGRGIIVRDWAPQLEILAHPSTGGFMSHCGWNSCM  383

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPIAAWPMHSDQPRN+ LIT+VLK G+++  WARR+E V    +   V+ L+ S
Sbjct  384   ESISMGVPIAAWPMHSDQPRNSQLITKVLKTGLTVRHWARRDELVASEIVENVVRTLMTS  443

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+EMR+RA+ELS ++K+ +  G G   E+ SF+AHITR
Sbjct  444   PEGDEMRKRASELSIAVKKSVMDGEGYGAEMNSFIAHITR  483



>ref|XP_010269695.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=525

 Score =   424 bits (1090),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 257/472 (54%), Positives = 332/472 (70%), Gaps = 11/472 (2%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             +NG K      V+VV +P PAQGHLNQ LHLSRLI+A+GIPVHY  +ATH RQA HRVHG
Sbjct  58    QNGFKQAP---VMVVTVPFPAQGHLNQLLHLSRLISAYGIPVHYVASATHNRQAKHRVHG  114

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             WDPL+ PNLHFH   +P F +PPPNP A  KFP  L P F A+ HLR P   L+ +LS  
Sbjct  115   WDPLSTPNLHFHDFPLPPFLNPPPNPHAPIKFPAHLQPTFDASLHLREPLAQLLDSLSAI  174

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
               RVVVI D+LM + VQDV +L NAE Y F  +SAF      WE  G+P    E   + N
Sbjct  175   AYRVVVIHDTLMAYAVQDVVALPNAEAYAFHPVSAFAIVFHLWESLGRP--TDEGILIPN  232

Query  551   HMP--SPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--W  718
              +P  S EGCF  EF +FI  Q    +   GDL N+CR +E  F+DL+ +E  +G +  W
Sbjct  233   DVPHHSLEGCFTGEFAKFIARQYDLMNFDVGDLYNTCRAMEGRFVDLLDQEKLSGNKRIW  292

Query  719   AIGPLNPVSLTDSINT--NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             A+GPLNPV L  +  +   RHK LEWLD+Q   SVL+VSFG+ TSLS++QI EL  GLE 
Sbjct  293   AVGPLNPVVLGAARESPWRRHKCLEWLDKQPLRSVLYVSFGTMTSLSDDQIFELAVGLER  352

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             S Q+FIWV+R+ DRGD++ + E AR  ++P+GYEERV G G++VR+WAPQLEIL H + G
Sbjct  353   SKQRFIWVLREADRGDIYAEEEEARVTQLPKGYEERVEGVGLIVRDWAPQLEILAHRATG  412

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             GF+SHCGWNSC+ESISMGVPIAAWPMHSDQPRN  L+T+VL++G+ + +WARR+E V   
Sbjct  413   GFLSHCGWNSCVESISMGVPIAAWPMHSDQPRNTMLVTQVLRVGLVVREWARRHELVSSD  472

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + +  +KL+AS EG++MR++A  L  ++++ ++ GG  R EL+SFVAHI+R
Sbjct  473   AVEDAARKLMASEEGDDMRKKAEMLGGAVRDSMSEGGISRAELDSFVAHISR  524



>ref|XP_011039446.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Populus 
euphratica]
 ref|XP_011039448.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Populus 
euphratica]
Length=473

 Score =   422 bits (1085),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 256/458 (56%), Positives = 326/458 (71%), Gaps = 8/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+PLPAQGHLNQ L LSRLI +H IPVHY GA TH RQA  RVHGWDP A  N+HF
Sbjct  21    VVVVMVPLPAQGHLNQLLQLSRLILSHNIPVHYVGATTHNRQAKQRVHGWDPNAAANIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +P F  PPPNP A  KFP+ L PVF A+S L  P + L+R  S   ++V+VI DSL
Sbjct  81    HDIEIPPFHCPPPNPKAKIKFPSHLQPVFNASSQLTEPVSMLLRAFSCKARKVIVIHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+++   L NAE Y F  +SAF T  + WER G   V  E        PS EGCF  
Sbjct  141   MGSVIEEARFLSNAESYTFHSVSAFATSLYEWEREGM--VIGENELFPRDTPSLEGCFSD  198

Query  584   EFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGKES-KTGFQ-WAIGPLNPVSLTD  754
             EF +F+      +   ++G + N+C+ +E  ++D + KE+ K G + WA+GP NPV++ +
Sbjct  199   EFADFVDCHYSKYQRFNTGCVYNTCKLVEPAYLDFLEKETIKEGIKHWALGPFNPVTIPE  258

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             S +  +H  LEWLD+Q K++V++VSFG+TT+  +EQI EL  GL ES +KFIWV+RDGD+
Sbjct  259   S-SKKQHFCLEWLDKQAKNTVIYVSFGTTTTFDDEQIKELAIGLRESKKKFIWVLRDGDK  317

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF       RAE+P+GYE  V G G+VVR+WAPQLEIL HP+ GGFMSHCGWNSCMES
Sbjct  318   GDVFTGE--GTRAELPKGYENSVDGIGLVVRDWAPQLEILAHPATGGFMSHCGWNSCMES  375

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPIAAWPMHSDQPRN  LITEVLK+GI++ DWARR+E V  + +G  V +L+AS E
Sbjct  376   ISMGVPIAAWPMHSDQPRNTVLITEVLKIGIAVKDWARRDEIVTSKIVGSAVNRLMASTE  435

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+RA E+ +S++  +A GG  R E+ESF+AHITR
Sbjct  436   GDEMRKRATEMGESVRGSVAEGGVSRMEMESFIAHITR  473



>ref|XP_004303646.1| PREDICTED: zeatin O-glucosyltransferase-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   422 bits (1085),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 248/465 (53%), Positives = 320/465 (69%), Gaps = 14/465 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPL---AVPN  214
             VVVVM+PLPAQGHLNQ LHLSRLI+ + +PVH+ G   H RQA  RVHGWD     A   
Sbjct  13    VVVVMVPLPAQGHLNQLLHLSRLISTYNMPVHFVGTPNHNRQAKLRVHGWDQTSSDAKNT  72

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HFH   +P F  P PNPDA +KFP+ L+P F AT+HLR P  AL+R L+   +RVVVI 
Sbjct  73    IHFHDFIVPPFVCPAPNPDAPSKFPSHLLPTFEATTHLRHPVAALLRKLASQTRRVVVIH  132

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL------NHM  556
             DSLM  V+QDV S+ N+E Y F  +SAF  + + WE  G P   PE  GV       +++
Sbjct  133   DSLMASVIQDVGSIANSESYTFHSVSAFAVFLYLWEGIGCP---PELQGVQVKSKIPDNV  189

Query  557   PSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLN  736
             PS E CF  EF  FI  Q  +   +SG++ N+ R IE  ++DL+ K       WA+GP N
Sbjct  190   PSLEDCFPDEFMNFIVAQYEYTGYNSGNIYNASRTIEGEYVDLLNKLGDDKKHWAVGPFN  249

Query  737   PVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             PVS+ +  N  RH  LEWLD QE +SV++VSFG+TT + +EQI EL  GLE+   KFIWV
Sbjct  250   PVSVPEK-NGKRHACLEWLDEQEPNSVIYVSFGTTTCMKDEQIRELAIGLEQCNHKFIWV  308

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
             +RD D+GD+F DG+  R+AE+P+GYEERV+ RGVVVR+WAPQL+IL H S   F+SHCGW
Sbjct  309   LRDADKGDLFMDGDQVRKAELPKGYEERVKERGVVVRDWAPQLDILSHKSTAWFLSHCGW  368

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NSCMES+++GVPIA WPMHSDQPRN  L+T+VLK+G+ + DW RRNE V    + +GV K
Sbjct  369   NSCMESLTLGVPIACWPMHSDQPRNTVLVTKVLKVGVVMRDWERRNELVTSSIVTDGVHK  428

Query  1277  LIasa-egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             L+AS+ E + +R++A EL  +++  +  GGG   EL SFVAHITR
Sbjct  429   LMASSGEVDVIRKKARELGAAVRGSMVEGGGSHMELSSFVAHITR  473



>gb|KHN07349.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=505

 Score =   423 bits (1087),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 231/455 (51%), Positives = 309/455 (68%), Gaps = 2/455 (0%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++P PAQGHLNQ LHLSRLI AH IPVH+ G+ TH RQ   R  GWDP ++ N+  
Sbjct  53    VEVVVVPFPAQGHLNQLLHLSRLILAHNIPVHFVGSQTHNRQVIVRAQGWDPNSIYNIQI  112

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  ++P F SP PNP A T+FP+ L+P F A++ LR P  AL+++LS   +RVVVI DSL
Sbjct  113   HDFNVPPFVSPAPNPHAETRFPSHLLPSFVASTSLREPVYALLQSLSTVARRVVVIYDSL  172

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQD   + N E Y F  +SAFT + + W+  G+P V  + + ++  +PS EGCF  
Sbjct  173   MASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPV-EKVSHIIPEVPSLEGCFTT  231

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             +F +FI  Q  F   S G + N+ R IE+ +++LI +   +   WA+GP NP+S+   + 
Sbjct  232   QFIDFITSQYEFHKFSKGTIYNTTRAIESPYLELIERIISSKTHWALGPFNPLSIEKGVY  291

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH S+EWLD+QE  SVL+VSFG+TT  S EQI E+  GLE+S QKFIW V        
Sbjct  292   NTRHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKFIW-VVRDADKGD  350

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
               D +  R AE+P+G+EERV+G G+VVR+WAPQLEIL H S GGFMSHCGWNSCMES++M
Sbjct  351   VFDEDGVRTAELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCMESMTM  410

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPI AWPMHSDQPRN  L+TEVL++G+ + DW  R+E V   ++   V++L+A+ EG+E
Sbjct  411   GVPIVAWPMHSDQPRNRVLVTEVLRVGVVVKDWDHRDELVTSSDVENAVRRLMATKEGDE  470

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+RA  L  +++     GG  R EL+ F+AH+TR
Sbjct  471   MRQRAMNLKNAIRRSKDEGGVSRAELDDFIAHVTR  505



>ref|XP_003521165.2| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=505

 Score =   422 bits (1086),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 230/455 (51%), Positives = 308/455 (68%), Gaps = 2/455 (0%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++P PAQGHLNQ LHLSRLI AH IPVH+ G+ TH RQ   R  GWDP ++ N+  
Sbjct  53    VEVVVVPFPAQGHLNQLLHLSRLILAHNIPVHFVGSQTHNRQVIVRAQGWDPNSIYNIQI  112

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  ++P F SP PNP A T+FP+ L+P F A++ LR P  AL+++LS   +RVVVI DSL
Sbjct  113   HDFNVPPFVSPAPNPHAETRFPSHLLPSFVASTSLREPVYALLQSLSTVARRVVVIYDSL  172

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQD   + N E Y F  +SAFT + + W+  G+P V  + + ++  +PS EGCF  
Sbjct  173   MASVVQDAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPV-EKVSHIIPEVPSLEGCFTT  231

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             +F +FI  Q  F   S G + N+ R IE+ +++LI +   +   WA+GP NP+S+   + 
Sbjct  232   QFIDFITSQYEFHKFSKGTIYNTTRAIESPYLELIERIISSKTHWALGPFNPLSIEKGVY  291

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH S+EWLD+QE  SVL+VSFG+TT  S EQI E+  GLE+S QKFIW V        
Sbjct  292   NTRHFSVEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKFIW-VVRDADKGD  350

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
                 +  R AE+P+G+EERV+G G+VVR+WAPQLEIL H S GGFMSHCGWNSCMES++M
Sbjct  351   VFHEDGVRTAELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCMESMTM  410

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPI AWPMHSDQPRN  L+TEVL++G+ + DW  R+E V   ++   V++L+A+ EG+E
Sbjct  411   GVPIVAWPMHSDQPRNRVLVTEVLRVGVVVKDWDHRDELVTSSDVENAVRRLMATKEGDE  470

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR+RA  L  +++     GG  R EL+ F+AH+TR
Sbjct  471   MRQRAMNLKNAIRRSKDEGGVSRAELDDFIAHVTR  505



>dbj|BAJ53203.1| JHL06B08.4 [Jatropha curcas]
Length=485

 Score =   421 bits (1082),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 334/473 (71%), Gaps = 15/473 (3%)
 Frame = +2

Query  26    GGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDP--  199
             G     V+VVM+PLPAQGHLNQ L LSRLI ++ IPVH+ G  TH RQA  RVHGWDP  
Sbjct  16    GFKQTKVIVVMVPLPAQGHLNQLLQLSRLILSYDIPVHFVGTTTHNRQAKLRVHGWDPQA  75

Query  200   --LAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVD  370
                A  ++HFH   +P F  P  NP+A  KFP+ L+P F+A+ S+LR P + L+R+LS  
Sbjct  76    AAAATSSIHFHDFEIPTFSCPSANPNAKNKFPSHLLPAFYASVSNLREPVSFLLRSLSCQ  135

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              ++++VI DSLMG VVQ++  + NAE Y F  +SAFT   F  E+ G+     +A  V  
Sbjct  136   ARKIIVIHDSLMGSVVQEIQFISNAESYTFHSVSAFTLCLFLSEKMGRNIKLNDA--VPK  193

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ-----  715
              +P  EGCF  EF +F+  +  +   +SG + N+ R IE +++DLI  + K   +     
Sbjct  194   QLPPFEGCFTNEFLDFVASEYQYHKFNSGCIYNTSRLIEGIYMDLIENQEKESVEKNIKK  253

Query  716   -WAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
              WA+GP NP+++ D    N +H  L+WLD+QE++SV+FVSFG+TT+LSNEQ+ +L  GL+
Sbjct  254   HWALGPFNPLTIPDKKGLNEKHFCLKWLDKQERNSVIFVSFGTTTALSNEQVKQLAIGLK  313

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
             +S QKFIWV+RD D+GDVF+  ++ ++AE+P+GYE+ ++G G+VVREW PQLEIL H ++
Sbjct  314   KSNQKFIWVLRDADKGDVFNK-DSEKKAELPKGYEDSIQGMGIVVREWVPQLEILAHQAI  372

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGFMSHCGWNSCMESI+MGVPIAAWPMHSDQPRNA LIT++LK+GI + DW RR+E V  
Sbjct  373   GGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDLLKIGIVIKDWCRRDEIVTA  432

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + +   VK+L+AS EGE +R+RAAEL +SL   +  GG  R E++SFVA+I+R
Sbjct  433   KMVETCVKRLMASDEGEGVRKRAAELGESLHRSMGRGGVSRLEIDSFVAYISR  485



>ref|XP_006351249.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=479

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 257/468 (55%), Positives = 332/468 (71%), Gaps = 7/468 (1%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NG     D  V VVM+PLPAQGHLNQ LHLSRLI ++ IPVHY GA  HIRQ   RVHG+
Sbjct  10    NGQISVQDAQVAVVMVPLPAQGHLNQLLHLSRLITSYNIPVHYVGATPHIRQVKLRVHGF  69

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL-SVD  370
             DP+   NLHFH    P F++PPPNP+AS KFP  ++P+ +AT H R P  +L+  L   +
Sbjct  70    DPVTTKNLHFHEFPTPPFENPPPNPNASHKFPNHILPLLYATIHFREPVCSLVNQLLGAN  129

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              +RV+VI DSLM WV++D+P++ NAE YRF   SAF  +S +WE  GKP   PE   +  
Sbjct  130   HRRVIVIYDSLMTWVLEDIPAIPNAECYRFNSFSAFYMFSSYWEAKGKP-FQPETE-IFE  187

Query  551   HMPSPEGCFIPEFEEFIKMQRPF-WDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIG  727
              + S E C  PE  E    Q        SG+L N+ R IE  ++DL+ KE+     WAIG
Sbjct  188   DIISRENCATPELWELWNKQGSLEGKICSGELYNTSRVIEGSYLDLVAKETNGLNLWAIG  247

Query  728   PLNPVSLTDSINTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQK  904
             P NP+    + ++N+ H++L WLD+QE +SV++VSFGSTT+LSN++I EL  GLE+S QK
Sbjct  248   PFNPLLSEQNKDSNKQHQTLYWLDKQETNSVIYVSFGSTTTLSNKEIKELAIGLEKSMQK  307

Query  905   FIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMS  1084
             FIWV+RD D+GDVF   E  RRA++PEGYEER++GRG++ R+WAPQLEIL HPS GGFMS
Sbjct  308   FIWVLRDADKGDVFAGEE--RRAQLPEGYEERIKGRGIIERDWAPQLEILAHPSTGGFMS  365

Query  1085  HCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGE  1264
             HCGWNSCMESISMGVPIAAWPMHSDQPRN+ L+T+VLK G+++  WARR+E V    +  
Sbjct  366   HCGWNSCMESISMGVPIAAWPMHSDQPRNSQLVTKVLKTGLTVRHWARRDELVASEIVEN  425

Query  1265  GVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              V+ L+AS EG+EMR+RA+ELS ++K+ +  G G   E+ SF+AHITR
Sbjct  426   AVRTLMASPEGDEMRKRASELSIAVKQSVMDGEGYGAEMNSFIAHITR  473



>ref|XP_006475704.1| PREDICTED: zeatin O-glucosyltransferase-like [Citrus sinensis]
 ref|XP_006492944.1| PREDICTED: zeatin O-glucosyltransferase-like [Citrus sinensis]
Length=475

 Score =   421 bits (1081),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 256/463 (55%), Positives = 332/463 (72%), Gaps = 11/463 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP----  211
             VVVVM+P PAQGHLNQ L LSRLI ++ IPVHY G+A H RQA  RVHGWDPL V     
Sbjct  16    VVVVMVPFPAQGHLNQLLQLSRLILSYNIPVHYVGSAVHNRQAQVRVHGWDPLDVSSNNN  75

Query  212   NLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVI  391
             N+HFH   +P +  PPPNP+A+ KFP+ ++P   A+ HLR P   L+  LS   +RVVVI
Sbjct  76    NIHFHDFEIPPYPCPPPNPNAACKFPSHIIPCCEASKHLRHPLATLLNTLSATARRVVVI  135

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPE  568
              DSLM  V+QDV  + NAE Y F  +SAFT Y + WER G P++  EA+G++   +PS E
Sbjct  136   HDSLMASVIQDVCLIPNAESYTFHSVSAFTLYLYIWERMGNPNLN-EASGLIPKDVPSLE  194

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF--QWAIGPLNPV  742
             GCF  EF + I  +      +SG++ N+ R IE+ ++DL+ K +  G    WA+GP NPV
Sbjct  195   GCFTSEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKATVAGTFNHWALGPFNPV  254

Query  743   SLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
             +L +   +N RH  LEWLD+QEK+SVL+VSFG+TT++S+EQI EL  GL++S QKFIWV+
Sbjct  255   TLPNKDGSNGRHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQKFIWVL  314

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             RD DRGDVF+     RRAE+P+GYE+ V+ +G+VVR+WAPQLEIL H S GGFMSHCGWN
Sbjct  315   RDADRGDVFNG--EVRRAELPKGYEDSVKDKGLVVRDWAPQLEILAHCSAGGFMSHCGWN  372

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESI+MGVPI AWPMHSDQPRN  LIT++LK+GI + D ARR+E V    I   VK+L
Sbjct  373   SCMESITMGVPIVAWPMHSDQPRNTVLITQLLKLGIVMADCARRDEIVTSNVIENAVKRL  432

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +AS EG+E+R++A EL  +++  +  GG  R E +SF+AHITR
Sbjct  433   MASKEGDEIRKKAVELGGNVRRSMDEGGVSRMEFDSFIAHITR  475



>ref|XP_006421301.1| hypothetical protein CICLE_v10004886mg [Citrus clementina]
 gb|ESR34541.1| hypothetical protein CICLE_v10004886mg [Citrus clementina]
Length=475

 Score =   420 bits (1080),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 253/463 (55%), Positives = 331/463 (71%), Gaps = 11/463 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP----  211
             VVVVM+P PAQGHLNQ L LSRL+ ++ IP+HY G+A H RQA  RVHGWDPL V     
Sbjct  16    VVVVMVPFPAQGHLNQLLQLSRLVLSYNIPIHYVGSAVHNRQAQVRVHGWDPLDVSSNNN  75

Query  212   NLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVI  391
             N+HFH   +P +  PPPNP+A+ KFP+ ++P   A+ HLR P   L+  LS   +RVVVI
Sbjct  76    NIHFHDFEIPPYPCPPPNPNAACKFPSHIIPCCEASKHLRHPLATLLNTLSATARRVVVI  135

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPE  568
              DSLM  V+QDV  + NAE Y F  +SAFT Y + WER G P +  EA+G++   +PS E
Sbjct  136   HDSLMASVIQDVCLIPNAESYTFHSVSAFTLYLYIWERMGNPTLN-EASGLIPKDVPSLE  194

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNPV  742
             GCF  EF + I  +      +SG++ N+ R IE+ ++DL+ K +  +T   WA+GP NPV
Sbjct  195   GCFTSEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKATVAETFNHWALGPFNPV  254

Query  743   SLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
             +L +   +N RH  LEWLD+QEK+SVL+VSFG+TT++S+EQI EL  GL++S QKFIWV+
Sbjct  255   TLPNKGGSNGRHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQKFIWVL  314

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             RD DRGDVF+     RRAE+P+ YE+ V+ +G+VVR+WAPQLEIL H S GGFMSHCGWN
Sbjct  315   RDADRGDVFNG--EVRRAELPKAYEDSVKDKGLVVRDWAPQLEILAHCSTGGFMSHCGWN  372

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESI+MGVPI AWPMHSDQPRN  LIT +LK+G+ + DWARR+E V    I   VK+L
Sbjct  373   SCMESITMGVPIVAWPMHSDQPRNTLLITHLLKLGLVMADWARRDEIVTSNAIENAVKRL  432

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +AS EG+E+R++A EL  +++  +  GG  R E +SF+AHITR
Sbjct  433   MASKEGDEIRKKAVELGGNVRRSMDEGGVSRMEFDSFIAHITR  475



>ref|XP_010279538.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=493

 Score =   419 bits (1077),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 259/473 (55%), Positives = 330/473 (70%), Gaps = 8/473 (2%)
 Frame = +2

Query  8     LENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVH  187
             LE    G   + V VVM+P PAQGHLNQ LHLSRLI+A+GIPVHY G ATH RQA  RVH
Sbjct  23    LEFQVNGLNQIPVRVVMVPFPAQGHLNQLLHLSRLISAYGIPVHYVGWATHNRQAKQRVH  82

Query  188   GWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSV  367
             GW+PL V N+ FH   MP   +PPPNPDA  KFP+ L P F A+ HLR P  AL+R LS 
Sbjct  83    GWNPLTVSNIRFHDFPMPPLLNPPPNPDAPIKFPSHLQPTFDASLHLREPMAALLRLLSP  142

Query  368   DQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL  547
               +R+VVI D+LM + VQDV ++ NAE Y F  +SAF    + WE  G+P   P+   ++
Sbjct  143   TTRRLVVIHDTLMAFSVQDVAAIANAEAYAFHSVSAFAIAFYLWESLGRPT--PDQGIII  200

Query  548   -NHMP--SPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ-  715
                +P  S EGCF  EF  FI       +   GDL N+CR +EA FIDL+ +E   G + 
Sbjct  201   PKDLPDLSLEGCFTQEFANFISHHYDVMNFDVGDLYNTCRPMEATFIDLLAQEQLNGNKK  260

Query  716   -WAIGPLNPVSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
              WA+GPLNP++L+ +    +RHK LEWLD+Q   SVL+VSFG+ TS+S++QI+EL  GLE
Sbjct  261   IWAVGPLNPLALSLAREFKHRHKCLEWLDKQPSQSVLYVSFGTMTSISDDQISELAVGLE  320

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
              S Q+FIWV+R+ DRGD++   E AR+ E+P+GYEER+ G G++VR+WAPQLEIL HPS 
Sbjct  321   RSKQRFIWVLREADRGDIYAQVEDARKVELPKGYEERMDGVGLIVRDWAPQLEILAHPST  380

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRN  L+T+VLK+GI + +W RR E V  
Sbjct  381   GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNTMLVTKVLKVGIVVGEWQRREELVSS  440

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               I   + KL+AS EG +M++RA  L +++ + +A GG    ELESF+A I+R
Sbjct  441   LTIENAITKLMASEEGNKMKKRAENLGRAVHQSVAEGGTSHAELESFIAFISR  493



>gb|EYU18711.1| hypothetical protein MIMGU_mgv1a023637mg [Erythranthe guttata]
Length=452

 Score =   415 bits (1067),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 263/457 (58%), Positives = 318/457 (70%), Gaps = 11/457 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG-WDPLAVPN--LHFH  226
             M+PLPAQGHLNQ L LSRLIAA+ +PVHY   +TH RQA  R HG WDP A  N  LHFH
Sbjct  1     MVPLPAQGHLNQLLQLSRLIAAYNVPVHYVSTSTHTRQAKLRDHGGWDPRAAANNNLHFH  60

Query  227   HLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNLSVDQKRVVVISDSL  403
                +P F SP PNP+A+ KFP+ L P+F A S HLR+P  AL+R+LS   +RVVVI DSL
Sbjct  61    GFPVPEFHSPNPNPNAANKFPSHLQPLFNAASRHLRQPLAALLRSLSGTARRVVVIHDSL  120

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEGCFI  580
             M  VVQDV S+ NAE Y F  ISAF  + + +E   K +  P     L N +PS E CF 
Sbjct  121   MASVVQDVGSVPNAETYVFHSISAFAIFWYFYETLEKIEPKPTIETELQNKVPSLEDCFT  180

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSI  760
              EF +FI  +      SSG L NSCR +E  F+DLI K S     W+IGP NPV  T+  
Sbjct  181   TEFMDFIVSEHGHVGLSSGSLYNSCRSVEGRFMDLIEKISGNKKHWSIGPFNPVGSTEK-  239

Query  761   NTNRHKSLEWLDRQE-KDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
              ++ H+ L+WLD QE + SV++VSFG+TTS S+EQI EL  GLEESG KFIWV+RD D+G
Sbjct  240   KSSEHRCLKWLDEQESRSSVIYVSFGTTTSFSDEQIEELANGLEESGAKFIWVLRDADKG  299

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D  ++G   R+AE+P G+EERVR RG+VVREWAPQLEIL H S GGFMSHCGWNSCMESI
Sbjct  300   DSIENG-GIRKAELPVGFEERVRERGIVVREWAPQLEILRHSSTGGFMSHCGWNSCMESI  358

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             SMGVPIAAWPMHSDQPRNA LITEVLK+G+ + DW RR+E V    +   VK+L+     
Sbjct  359   SMGVPIAAWPMHSDQPRNAVLITEVLKIGVVVKDWGRRDEIVTAEAVAVAVKELM---GS  415

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EEMRRRA EL   ++  +A GG   +E++SFVAHI R
Sbjct  416   EEMRRRAEELGGDVRSAVAEGGVTWSEMDSFVAHIGR  452



>ref|XP_010673139.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   415 bits (1067),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 242/458 (53%), Positives = 312/458 (68%), Gaps = 6/458 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+P PAQGHLNQ LHLS LI ++ IPVHYAG+ATH  QA  R+HGWD  ++ N+HF
Sbjct  20    VVVVMVPFPAQGHLNQLLHLSHLITSYRIPVHYAGSATHNHQAKLRLHGWDTESLDNIHF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P + SPPPNPDAST FPT L P+F A+ HLR+P + L++ LS   KR+VVI DSL
Sbjct  80    HDFQLPLYSSPPPNPDASTLFPTNLEPLFDASMHLRQPVSLLLQELSTKFKRIVVIFDSL  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEA-AGVLNHMPSPEGCFI  580
             M +VVQDV  +QNAE + F  +SAFT +   WE  G P+   +    +   +PS EGC  
Sbjct  140   MAYVVQDVKIIQNAESFSFFTVSAFTMFLNIWE--GIPEKPFQLDLEIPRCIPSNEGCLT  197

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKT--GFQWAIGPLNPVSLTD  754
             P    FI          +G L N+ R IE  +++L+ K SK      +A+GPLNPV    
Sbjct  198   PLVFSFIANLHKLLGFQAGMLYNTSRLIEGRYVELLQKLSKNAEAKHFAVGPLNPVETKS  257

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                 +RH  L WLD+QE  SV+++SFGSTTS+++EQITEL  GLE S QKFIWV+R  D 
Sbjct  258   KSEKDRHTCLLWLDKQEVGSVIYISFGSTTSMTDEQITELALGLERSRQKFIWVLRRADT  317

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
              D     E  R  ++PE YEERV+ RG+V+R+WAPQL+IL HPS GGFMSHCGWNSCMES
Sbjct  318   ADALRGTE-VRNPQLPEVYEERVKDRGIVIRDWAPQLQILAHPSTGGFMSHCGWNSCMES  376

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVP+AAWPMHSDQPRNA L+TEVL++G  + DW  R + V    I   V++L+AS E
Sbjct  377   ISMGVPMAAWPMHSDQPRNAVLVTEVLRIGTLVRDWTDRAKLVMSTTIENVVRRLLASEE  436

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             GE M++RA  L ++++  +A  G    E++SF++HITR
Sbjct  437   GEAMQKRAIGLGEAVRASVAEDGVSHLEMDSFMSHITR  474



>emb|CDP14132.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   413 bits (1062),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 326/454 (72%), Gaps = 6/454 (1%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ LHLSRLI+++ IPVH+ G+ATH RQA  RVHGWDPLA+ ++ FH   
Sbjct  1     MVPLPAQGHLNQLLHLSRLISSYNIPVHFVGSATHNRQAKDRVHGWDPLAISDIRFHEFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
             +P F +PPP+P A TK PTQL+P FFAT HLR P   L+  LS   +RVVVI DSLM +V
Sbjct  61    LPSFPTPPPDPKAPTKLPTQLVPAFFATLHLREPACELVTKLSSTARRVVVIHDSLMCYV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD+PS+ NAE Y F+ +SAF  YS+ WE  GKP V  +   V + + +PE  F  E  E
Sbjct  121   VQDMPSIPNAESYCFQSVSAFALYSYVWEAMGKP-VLADGEPVNDLLSTPESVFPEELAE  179

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIG--KESKTGFQWAIGPLNPVSLT-DSINT  766
             F K+Q+     + G+L NS R I+  +++L+   K  +T   WAIGP NP  +T D  + 
Sbjct  180   FFKVQQEARKCNWGNLFNSSRLIDGEYLNLLAEIKFDETENNWAIGPFNPPVITEDQKSK  239

Query  767   NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvf  946
               HK LEWLD+Q   SV+FVSFGSTTSLS+E++ ++  GLE SGQKF+WV+RD D GDV 
Sbjct  240   KSHKCLEWLDKQAPKSVIFVSFGSTTSLSDEEVEQIAIGLERSGQKFMWVLRDADTGDVS  299

Query  947   ddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMG  1126
                   R+A++PEGYEERV GRG ++REWAPQLE+LGHPS GGFMSHCGWNSC+ESISMG
Sbjct  300   IGE--GRKAQLPEGYEERVDGRGFILREWAPQLEVLGHPSTGGFMSHCGWNSCVESISMG  357

Query  1127  VPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeem  1306
             VP+AAWPMHSDQPRNA L+T++LK G+ + D A ++E      + + VK+L+ S EG+EM
Sbjct  358   VPMAAWPMHSDQPRNAILVTKILKTGLMVGDLAHQDESFKAEVVEDAVKRLMNSTEGQEM  417

Query  1307  rrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             R+RA ELS +LK+ +  G     E+++F+AHITR
Sbjct  418   RKRAEELSDALKQSVIKGSDNSTEMDTFIAHITR  451



>ref|XP_010319172.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=572

 Score =   417 bits (1073),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 260/492 (53%), Positives = 342/492 (70%), Gaps = 32/492 (7%)
 Frame = +2

Query  8     LENGTKGGADVG------------------VVVVMLPLPAQGHLNQFLHLSRLIAAHGIP  133
             +++  KGG  VG                  + VVM+PLPAQGHLNQ LHLSRLI+ + I 
Sbjct  88    MQDDIKGGGSVGHPLPENQFLTPPLHDDGRLAVVMVPLPAQGHLNQLLHLSRLISMYNIQ  147

Query  134   VHYAGAATHIRQATHRVHGWDPLAVPNLHFHHL-SMPHFQSPPPNPDASTKFPTQLMPVF  310
             VHY G  +HI+QA  R HG+DPL V N++FH     P F++P PNP+AS K+P QL+P F
Sbjct  148   VHYIGITSHIQQAKIRAHGFDPLTVTNINFHEFHQTPSFETPLPNPNASFKYPHQLIPSF  207

Query  311   FATSHLRRPFNALIRNL-SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTY  487
             +AT HLR P  +L++ L S +  +VVVI DSLM +VVQD+P + N E Y F   SAF  Y
Sbjct  208   YATFHLRGPVCSLVQELLSANHCKVVVIYDSLMKFVVQDLPLIPNIECYCFNSSSAFMLY  267

Query  488   SFHWERTGKPDVGPEAAGVLNH--MPSPEGCFIPEFEEFIKMQRPFWDAS-SGDLLNSCR  658
             S+HWE  GKP       G  N+  +P+    F PEF EF+K+Q      + SG+L NS R
Sbjct  268   SYHWELKGKP----FHPGTENYEDIPTVGDSFPPEFWEFMKIQEQCDGRNHSGELYNSSR  323

Query  659   EIEALFIDLIGKESKTGFQWAIGPLNPVSLTD-SINTN-RHKSLEWLDRQEKDSVLFVSF  832
              +E+L++DL+ KE     QWAIGP NP+   + S ++N RH+SL WLD+QE++SV+FVSF
Sbjct  324   VVESLYLDLMAKEYDGMKQWAIGPFNPMEPQEKSKDSNKRHESLHWLDKQERNSVIFVSF  383

Query  833   GSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgr  1012
             G+TTSL +E+I  L  GLE+S QKF+WV+RD D+GDVF      R+A++PEGYEER + R
Sbjct  384   GTTTSLCDEEIKVLAIGLEKSRQKFVWVLRDADKGDVFTS--EVRKAQLPEGYEERTKER  441

Query  1013  gvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEV  1192
             G++VR+WAPQLEIL H S GGFMSHCGWNSC+ES+S GVPIAAWPMHSDQPRN+ L+T+ 
Sbjct  442   GIIVRDWAPQLEILAHSSTGGFMSHCGWNSCIESMSFGVPIAAWPMHSDQPRNSQLVTKY  501

Query  1193  LKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGR  1372
             LK+G+ +  WARRNE V    +   V+ L+AS+EG+EMRRRAA LS ++K+ +  GG  R
Sbjct  502   LKIGLIVRPWARRNEVVTSEIVENAVRTLMASSEGDEMRRRAAVLSNAIKKSMD-GGMNR  560

Query  1373  NELESFVAHITR  1408
              E++SF+AHITR
Sbjct  561   AEMDSFIAHITR  572



>gb|KDP26082.1| hypothetical protein JCGZ_21115 [Jatropha curcas]
Length=460

 Score =   413 bits (1062),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 240/463 (52%), Positives = 329/463 (71%), Gaps = 15/463 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDP----LAVPNLHF  223
             M+PLPAQGHLNQ L LSRLI ++ IPVH+ G  TH RQA  RVHGWDP     A  ++HF
Sbjct  1     MVPLPAQGHLNQLLQLSRLILSYDIPVHFVGTTTHNRQAKLRVHGWDPQAAAAATSSIHF  60

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F  P  NP+A  KFP+ L+P F+A+ S+LR P + L+R+LS   ++++VI DS
Sbjct  61    HDFEIPTFSCPSANPNAKNKFPSHLLPAFYASVSNLREPVSFLLRSLSCQARKIIVIHDS  120

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LMG VVQ++  + NAE Y F  +SAFT   F  E+ G+     +A  V   +P  EGCF 
Sbjct  121   LMGSVVQEIQFISNAESYTFHSVSAFTLCLFLSEKMGRNIKLNDA--VPKQLPPFEGCFT  178

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ------WAIGPLNPV  742
              EF +F+  +  +   +SG + N+ R IE +++DLI  + K   +      WA+GP NP+
Sbjct  179   NEFLDFVASEYQYHKFNSGCIYNTSRLIEGIYMDLIENQEKESVEKNIKKHWALGPFNPL  238

Query  743   SLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
             ++ D    N +H  L+WLD+QE++SV+FVSFG+TT+LSNEQ+ +L  GL++S QKFIWV+
Sbjct  239   TIPDKKGLNEKHFCLKWLDKQERNSVIFVSFGTTTALSNEQVKQLAIGLKKSNQKFIWVL  298

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             RD D+GDVF+  ++ ++AE+P+GYE+ ++G G+VVREW PQLEIL H ++GGFMSHCGWN
Sbjct  299   RDADKGDVFNK-DSEKKAELPKGYEDSIQGMGIVVREWVPQLEILAHQAIGGFMSHCGWN  357

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESI+MGVPIAAWPMHSDQPRNA LIT++LK+GI + DW RR+E V  + +   VK+L
Sbjct  358   SCMESITMGVPIAAWPMHSDQPRNAVLITDLLKIGIVIKDWCRRDEIVTAKMVETCVKRL  417

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +AS EGE +R+RAAEL +SL   +  GG  R E++SFVA+I+R
Sbjct  418   MASDEGEGVRKRAAELGESLHRSMGRGGVSRLEIDSFVAYISR  460



>ref|XP_002532135.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30255.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=487

 Score =   414 bits (1064),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 250/475 (53%), Positives = 332/475 (70%), Gaps = 13/475 (3%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NG  G     VVVVM+PLPAQGHLNQ LHLSRLI ++ IPVH+    TH RQA HRVHGW
Sbjct  14    NGENGLKRSQVVVVMVPLPAQGHLNQLLHLSRLILSYNIPVHFVSTTTHNRQAKHRVHGW  73

Query  194   DPL--AVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFF-ATSHLRRPFNALIRNLS  364
             DP   A  N+HFH   +P F  PPPNP++  KFP+ L+P FF A+SHL+ P +AL+R+LS
Sbjct  74    DPQSDATSNIHFHDFEIPPFPCPPPNPNSKNKFPSHLLPSFFHASSHLQGPVSALLRSLS  133

Query  365   VDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGV  544
                ++V+ I DSLM  VVQ+V  + NAE Y F  +SAFT   F+WER G+P +     G+
Sbjct  134   CGARKVIAIHDSLMASVVQEVALISNAESYTFHSVSAFTICLFYWERMGRP-IHQRGGGI  192

Query  545   LNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK-------ESK  703
                +P  +GCF  EF + +  Q  +   ++G L N+ R IE  F++LI K       E+ 
Sbjct  193   PEELPPLDGCFTDEFMDLVASQYQYHRYNTGCLYNTSRLIEGTFMELIEKQEQESTMEAN  252

Query  704   TGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGA  880
                 WA+GP NPV+L +   +N +H  L+WLD+QE +SV++VSFG+TT+++ EQI +L  
Sbjct  253   LRKHWALGPFNPVTLAEQKGSNGKHVCLDWLDKQETNSVIYVSFGTTTAMNTEQIKQLAI  312

Query  881   GLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGH  1060
             GL++S QKFIWV+RD D+GDVF+ G   RR E+P+GYE  V G G+VVR+W PQLEILGH
Sbjct  313   GLKQSNQKFIWVLRDADKGDVFNGGHE-RRDELPKGYENSVDGMGLVVRDWVPQLEILGH  371

Query  1061  PSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNER  1240
             P+ GGFMSHCGWNSCMESI+MGVPIAAWPMHSDQPRNA LITE LK+G+ + DWARR+E 
Sbjct  372   PATGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNAVLITECLKIGVLVKDWARRDEI  431

Query  1241  VGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
                + +   VK+L+AS EG+ MR++AAE+  S++  +  GG  R E++SF++ I+
Sbjct  432   ATSKMVETCVKRLMASDEGDGMRKKAAEMGHSIRRSLGEGGVSRMEMDSFISCIS  486



>ref|XP_002308926.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92449.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=473

 Score =   414 bits (1063),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 247/456 (54%), Positives = 324/456 (71%), Gaps = 6/456 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+P PAQGHLNQ L LSRL+ ++ IPVHY GA TH RQA  RVHGWDP A  ++HF
Sbjct  21    VVVVMVPFPAQGHLNQLLQLSRLVLSYNIPVHYVGATTHNRQAKQRVHGWDPDAAASIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +P F  PPPNP+A  KFP+ L P F A+SHL  P + L+R LS   ++++VI DSL
Sbjct  81    HDIEIPPFHCPPPNPNAKIKFPSHLQPAFNASSHLTEPVSMLVRALSCKARKIIVIHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+Q+   L N E Y F  +SAFT  S+ WE+ GK ++  +       +PS EGCF  
Sbjct  141   MGSVIQEARLLPNVESYIFHSVSAFTVSSYAWEQQGK-NIIEDNELFPQDIPSLEGCFTA  199

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES-KTGFQ-WAIGPLNPVSLTDS  757
             EF +F   Q  +   ++G + N+C+ +E  + DL+ KE+ K G + WA+GP NPV++ + 
Sbjct  200   EFADFFARQSNYQKFNTGCVYNTCKLVEGAYTDLLEKETAKEGIKHWALGPFNPVTIPER  259

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                 R   L+WLD+  ++SV++VSFG+TT+L +EQI EL  GL ES QKFIW +RD D+G
Sbjct  260   SEKKRF-CLDWLDKHARNSVIYVSFGTTTTLDDEQIKELAIGLRESKQKFIWALRDADKG  318

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             DVF+  E  RRAE+PEGYE+ V G G+V+R+WAPQLEIL HP+ GG MSHCGWNSCMESI
Sbjct  319   DVFNGEE--RRAELPEGYEDSVDGIGLVLRDWAPQLEILAHPATGGIMSHCGWNSCMESI  376

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWPMHSDQPRNA LIT++LK+G+ + +W  R+E V  + +   VKKL+AS EG
Sbjct  377   TMGVPIAAWPMHSDQPRNAVLITKILKIGVVVKEWELRDEIVTSKIVESAVKKLMASTEG  436

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             +EMRRRA E+ +S++   A GG  R E+ESFVAHIT
Sbjct  437   DEMRRRAEEMGESVRVSAAEGGVSRMEMESFVAHIT  472



>ref|XP_009363193.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009363194.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Pyrus 
x bretschneideri]
Length=473

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 253/461 (55%), Positives = 329/461 (71%), Gaps = 7/461 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN-LH  220
             VVVVM+PLPAQGHLNQ LHLSRLI+A+ IPVHY GAATH RQA  R HGWD  +V N + 
Sbjct  14    VVVVMVPLPAQGHLNQLLHLSRLISAYNIPVHYVGAATHNRQAKLRAHGWDQTSVSNKIQ  73

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P F SPPPNP+A+ KFP+ L P F AT+HLR+P   L+R LS+  +RV+VI DS
Sbjct  74    FHDFPTPPFLSPPPNPNATNKFPSHLQPSFEATAHLRQPLAKLLRELSLKGRRVIVIHDS  133

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEGCF  577
             LM  ++QDV S+ N E Y F  +SAFT + + WE  GKP    E    L + +PS EGCF
Sbjct  134   LMASIIQDVASIPNGESYTFHSVSAFTIFLYLWEVIGKPKKLEELDVKLPDGIPSLEGCF  193

Query  578   IPEFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--  748
               EF  FI  Q  +    ++G L N+ R IE  ++DL+ +       WAIGP NP ++  
Sbjct  194   TVEFRNFIDEQHKYQKLNNAGYLHNTSRTIEGPYMDLLNRIGDQKKHWAIGPFNPTTVAY  253

Query  749   -TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrd  925
               ++ N++RH  LEWLD+QE+ SV++VSFG+TT++ +EQI EL  GLEES Q+FIWV+RD
Sbjct  254   PNNNSNSSRHMCLEWLDKQEQRSVMYVSFGTTTAMKDEQIQELAIGLEESKQRFIWVLRD  313

Query  926   gdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSC  1105
              D+GD+F+ GE  RRAE+P+G+EER++GRG+VVR+W PQLEIL H S GGF+SHCGWNSC
Sbjct  314   ADKGDLFNGGEV-RRAELPQGFEERIKGRGLVVRDWVPQLEILSHKSTGGFLSHCGWNSC  372

Query  1106  MESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIa  1285
             MESI+MGVPIAAWPMHSDQPRN  LIT++L++G  + DW +R+E V  + +  GV+K + 
Sbjct  373   MESITMGVPIAAWPMHSDQPRNTVLITKLLRVGFVMRDWDKRDELVTSQNVKNGVQKFMG  432

Query  1286  saegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             S EGEE+R+RAAEL  ++++    G     E  SF+AHITR
Sbjct  433   SKEGEEIRKRAAELGAAVRQSRVEGEASHMEFSSFIAHITR  473



>ref|XP_010672878.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=483

 Score =   413 bits (1062),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 303/458 (66%), Gaps = 6/458 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V  VM+P P QGHLN+ LHLS LIA++ IPVH+AG+ TH  Q   R+HGW+P     +HF
Sbjct  20    VAAVMVPFPMQGHLNEALHLSNLIASYSIPVHFAGSTTHNSQVKLRLHGWNPENTSKIHF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F S PP  +A T FP  L P+F A  H R P   L++ LS   ++VVVI D+L
Sbjct  80    HDLKLPSFSSIPPKFNAHTTFPGHLQPLFDAFQHFREPVYQLLQELSGKFRKVVVIHDTL  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWER-TGKPDVGPEAAGVLNHMPSPEGCFI  580
                VVQDV  + NA  Y    +SAFT + + W+  T KP        + + +PS EGCF 
Sbjct  140   TASVVQDVKLISNAVTYALHSVSAFTIFFYTWDSITEKP--FQLDFDIPDDIPSKEGCFT  197

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTD  754
             PEFE+FI  Q    +  SG L N+ REIE  ++DL+ K      +  +AIGPLNPV L  
Sbjct  198   PEFEDFIAKQYKVLNFESGRLYNTSREIEGRYMDLLEKLPTNANKKLFAIGPLNPVELKS  257

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             + + +RHK +EWLD+QEKDSV++VSFG+ TS++ EQI+EL  GLE+SG KF+W V     
Sbjct  258   NCSKSRHKCIEWLDKQEKDSVIYVSFGTATSMTEEQISELAVGLEKSGHKFLW-VLRSAD  316

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
                    ++ +R ++PEG+ +R++ RG+VV +WAPQLE+L HPS GGFMSHCGWNSCMES
Sbjct  317   RIDPFTEDSVQRPQLPEGFRDRLQSRGMVVTDWAPQLEVLAHPSTGGFMSHCGWNSCMES  376

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPIAAWPMHSDQPRN  L+T+VL+ GI + DW +R E V    I   V+ L+ S E
Sbjct  377   ISMGVPIAAWPMHSDQPRNTILVTQVLRTGIHVRDWTKRTELVTSTTIESAVRSLMESEE  436

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMRRRAAEL   ++     GG  R E++SF+AHITR
Sbjct  437   GKEMRRRAAELGDIVRGSTVEGGTSRLEMDSFIAHITR  474



>gb|AAL92461.1| putative glucosyltransferase [Solanum lycopersicum]
Length=451

 Score =   412 bits (1059),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 253/458 (55%), Positives = 331/458 (72%), Gaps = 14/458 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHL-  232
             M+PLPAQGHLNQ LHLSRLI+ + I VHY G  +HI+QA  R HG+DPL V N++FH   
Sbjct  1     MVPLPAQGHLNQLLHLSRLISMYNIQVHYIGITSHIQQAKIRAHGFDPLTVTNINFHEFH  60

Query  233   SMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL-SVDQKRVVVISDSLMG  409
               P F++P PNP+AS K+P QL+P F+AT HLR P  +L++ L S +  +VVVI DSLM 
Sbjct  61    QTPSFETPLPNPNASFKYPHQLIPSFYATFHLRGPVCSLVQELLSANHCKVVVIYDSLMK  120

Query  410   WVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH--MPSPEGCFIP  583
             +VVQD+P + N E Y F   SAF  YS+HWE  GKP       G  N+  +P+    F P
Sbjct  121   FVVQDLPLIPNIECYCFNSSSAFMLYSYHWELKGKPF----HPGTENYEDIPTVGDSFPP  176

Query  584   EFEEFIKMQRPFWDAS-SGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTD-S  757
             EF EF+K+Q      + SG+L NS R +E+L++DL+ KE     QWAIGP NP+   + S
Sbjct  177   EFWEFMKIQEQCDGRNHSGELYNSSRVVESLYLDLMAKEYDGMKQWAIGPFNPMEPQEKS  236

Query  758   INTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              ++N RH+SL WLD+QE++SV+FVSFG+TTSL +E+I  L  GLE+S QKF+WV+RD D+
Sbjct  237   KDSNKRHESLHWLDKQERNSVIFVSFGTTTSLCDEEIKVLAIGLEKSRQKFVWVLRDADK  296

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF      R+A++PEGYEER + RG++VR+WAPQLEIL H S GGFMSHCGWNSC+ES
Sbjct  297   GDVFTS--EVRKAQLPEGYEERTKERGIIVRDWAPQLEILAHSSTGGFMSHCGWNSCIES  354

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             +S GVPIAAWPMHSDQPRN+ L+T+ LK+G+ +  WARRNE V    +   V+ L+AS+E
Sbjct  355   MSFGVPIAAWPMHSDQPRNSQLVTKYLKIGLIVRPWARRNEVVTSEIVENAVRTLMASSE  414

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMRRRAA LS ++K+ +  GG  R E++SF+AHITR
Sbjct  415   GDEMRRRAAVLSNAIKKSMD-GGMNRAEMDSFIAHITR  451



>ref|XP_004498042.1| PREDICTED: zeatin O-glucosyltransferase-like [Cicer arietinum]
 gb|AGU14112.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   412 bits (1060),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 234/455 (51%), Positives = 323/455 (71%), Gaps = 4/455 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVV+M+P PAQGHLNQ LH+S LI +H IPVHY G +TH RQAT RV GWD   +  +HF
Sbjct  15    VVVIMVPFPAQGHLNQLLHMSCLILSHNIPVHYVGTSTHNRQATIRVQGWDQNFISKIHF  74

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             HH ++P F SPPPNP++ +KFP+ L+P F A+SHLR     L+++LS   KRVVVI DSL
Sbjct  75    HHFNVPPFDSPPPNPNSESKFPSHLIPSFEASSHLREHVKELMQSLSPVFKRVVVIHDSL  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQD  +++N E Y F    AFT +SF WE+ GKP   P     +   PS EGCFIP
Sbjct  135   MASVVQDAANIENVENYTFHSTCAFTVFSFFWEKMGKP---PLQTSHILQFPSLEGCFIP  191

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             +  +FI  Q+ F   + G++ N+ R IE+ +++LI K + +   WA+GP NP+++    +
Sbjct  192   QIIDFIAAQKEFLKLNDGNIYNTSRAIESTYMELIEKITCSKKHWAVGPFNPLTIEKKDS  251

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH  +EWLD++E +SV++VSFG+TT+L  EQI ++  GLE+S + FIWV+RD D+GD+
Sbjct  252   KGRHSCIEWLDKKEPNSVIYVSFGTTTTLVEEQIQQIAIGLEQSKKNFIWVLRDADKGDI  311

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             F+  E  +R E+P+G+EE V+  G++VR+WAPQLEIL HPS GGF SHCGWNSC+ESISM
Sbjct  312   FEGNE-VKRHELPKGFEESVKEMGLIVRDWAPQLEILNHPSTGGFTSHCGWNSCLESISM  370

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPIAAWPMHSDQPRN+ LI +VLK+G+ + +W +R+E V   +I   V++L+ + EG+E
Sbjct  371   GVPIAAWPMHSDQPRNSVLIAQVLKVGLVVKEWDKRHELVTALDIENVVRRLLETKEGDE  430

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR++A  L   + + +  GG  R E++SF+ HITR
Sbjct  431   MRQKALNLKNDIHKSMDEGGVSRKEMDSFIDHITR  465



>ref|XP_011075346.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=462

 Score =   412 bits (1058),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 238/464 (51%), Positives = 315/464 (68%), Gaps = 21/464 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVV+M+P P  GHLNQ LHLSRLI+AH + VHY G A H RQA  R+HGW+PL++ N+ F
Sbjct  11    VVVLMVPFPLHGHLNQLLHLSRLISAHDVAVHYVGTAAHNRQARRRIHGWNPLSISNIFF  70

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H           P+    + FP++  P+F A+S LR+P   L+R L    +RVVVI DSL
Sbjct  71    H--------DQFPSLSFQSSFPSRPQPLFDASSALRQPVAELLRYLCAINRRVVVIYDSL  122

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG VVQD     NAE Y F  +SA+T + F WE+TG+P    +   +L ++PS EGCF P
Sbjct  123   MGSVVQDFVKFPNAESYTFHSVSAYTIFFFLWEKTGRPFAIDKE--ILENLPSLEGCFSP  180

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPVSLT--  751
             EF +F+  Q  +   +SG + N+CR +E+ F++L+ K   +G   QWA+GP NPV     
Sbjct  181   EFVKFVGNQHQYMKLNSGRIYNTCRVVESPFLELLAKPEISGNKKQWALGPFNPVGAESV  240

Query  752   -----DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
                   S + +RH+ L+WLDRQ  +SV+ VSFG+TT+LS++Q+ EL  GLE+S QKF+W 
Sbjct  241   ERKKPSSNSDSRHRCLKWLDRQGPNSVILVSFGTTTTLSDKQLQELATGLEKSQQKFVW-  299

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
                 D       G   +R E+P+G+EERV+ RG+VVR+WAPQLEILGH + GGFMSHCGW
Sbjct  300   -VLRDADGANFFGREIKRVELPKGFEERVKKRGMVVRDWAPQLEILGHSATGGFMSHCGW  358

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NSCMESISMGVPIAAWPMHSDQPRN  LIT+VLK+G+++ DWARR+E V    +   V +
Sbjct  359   NSCMESISMGVPIAAWPMHSDQPRNTILITKVLKIGLAVKDWARRDELVKSSAVESAVAR  418

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             L+ S EG EMR+RAAELS S+++ +A GG    EL+SF+ HITR
Sbjct  419   LMTSEEGAEMRKRAAELSGSVRKAVAKGGVTHLELDSFITHITR  462



>ref|XP_010672879.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=474

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 303/458 (66%), Gaps = 6/458 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V  VM+P P QGHLN+ LHLS LIA++ IPVH+AG+ TH  Q   R+HGW+P     +HF
Sbjct  20    VAAVMVPFPMQGHLNEALHLSNLIASYSIPVHFAGSTTHNSQVKLRLHGWNPENTSKIHF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F S PP  +A T FP  L P+F A  H R P   L++ LS   ++VVVI D+L
Sbjct  80    HDLKLPSFSSIPPKFNAHTTFPGHLQPLFDAFQHFREPVYQLLQELSGKFRKVVVIHDTL  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWER-TGKPDVGPEAAGVLNHMPSPEGCFI  580
                VVQDV  + NA  Y    +SAFT + + W+  T KP        + + +PS EGCF 
Sbjct  140   TASVVQDVKLISNAVTYALHSVSAFTIFFYTWDSITEKP--FQLDFDIPDDIPSKEGCFT  197

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTD  754
             PEFE+FI  Q    +  SG L N+ REIE  ++DL+ K      +  +AIGPLNPV L  
Sbjct  198   PEFEDFIAKQYKVLNFESGRLYNTSREIEGRYMDLLEKLPTNANKKLFAIGPLNPVELKS  257

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             + + +RHK +EWLD+QEKDSV++VSFG+ TS++ EQI+EL  GLE+SG KF+W V     
Sbjct  258   NCSKSRHKCIEWLDKQEKDSVIYVSFGTATSMTEEQISELAVGLEKSGHKFLW-VLRSAD  316

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
                    ++ +R ++PEG+ +R++ RG+VV +WAPQLE+L HPS GGFMSHCGWNSCMES
Sbjct  317   RIDPFTEDSVQRPQLPEGFRDRLQSRGMVVTDWAPQLEVLAHPSTGGFMSHCGWNSCMES  376

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPIAAWPMHSDQPRN  L+T+VL+ GI + DW +R E V    I   V+ L+ S E
Sbjct  377   ISMGVPIAAWPMHSDQPRNTILVTQVLRTGIHVRDWTKRTELVTSTTIESAVRSLMESEE  436

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMRRRAAEL   ++     GG  R E++SF+AHI+R
Sbjct  437   GKEMRRRAAELGDIVRGSTVEGGTSRLEMDSFIAHISR  474



>ref|XP_006350170.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   411 bits (1056),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 254/465 (55%), Positives = 326/465 (70%), Gaps = 16/465 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAV---PN  214
             ++VV++P PAQGHLNQ L L +LIA+H I VHY    TH  QA  RVH  DP +     N
Sbjct  16    IIVVVVPFPAQGHLNQLLQLCKLIASHNIQVHYVTTMTHTNQAKSRVH--DPYSFINNNN  73

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HFH LS P F SPPPNP+++ KFP+ L P F ++SHLR+P + L+  LS   KR+V+I 
Sbjct  74    IHFHELSTPFFNSPPPNPNSTIKFPSHLQPSFESSSHLRKPLSKLLTVLSSKAKRIVIIH  133

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEG  571
             DSLMG+VVQD   L NAE Y F  +SAFT + F WE  G+P D+    A  L  +PS E 
Sbjct  134   DSLMGYVVQDFVYLPNAEAYAFHSVSAFTLFLFIWENMGRPFDID---ANFLKDVPSLED  190

Query  572   CFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVS  745
             CF PEFE+FIK+Q  +   +SG + N+CR IE  F+DL+ KE  S    QWA+GP NPV 
Sbjct  191   CFSPEFEKFIKLQHDYMKFNSGRIYNTCRVIEGPFLDLLSKEQISNNKKQWALGPFNPV-  249

Query  746   LTDSINTN----RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             L     T     +H+ L WLD  E +SV+FVSFG+TTS S+EQI E+  GLE S  KF+W
Sbjct  250   LVQQYGTKSCHKQHECLIWLDEHEPNSVVFVSFGTTTSFSDEQIKEIAIGLERSEVKFVW  309

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD D+G+VF     +R+ E+P+G+EERV+ +G+V+R+WAPQLEIL H SVGGFMSHCG
Sbjct  310   VLRDADKGNVFAKDHQSRKIELPKGFEERVKDKGIVLRDWAPQLEILAHSSVGGFMSHCG  369

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESISMGVPIAAWPMHSDQPRN  L+T++LK+G+ + +W RR+E V R  +   V+
Sbjct  370   WNSCMESISMGVPIAAWPMHSDQPRNTVLVTKILKVGLVVKEWTRRHEVVTRGMVQAAVE  429

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             KL+AS EGEEMR RA +LS +LK  +A  G    EL+SF++HITR
Sbjct  430   KLMASKEGEEMRNRAMDLSGALKNSVAESGIKNMELDSFISHITR  474



>dbj|BAJ53204.1| JHL06B08.5 [Jatropha curcas]
Length=483

 Score =   411 bits (1056),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 241/466 (52%), Positives = 326/466 (70%), Gaps = 15/466 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDP----LAVP  211
             VVVVM+PLPAQGHLNQ L LSRLI+++ IPVH+ G  TH RQA  R HG DP     A  
Sbjct  20    VVVVMVPLPAQGHLNQLLQLSRLISSYNIPVHFVGTTTHNRQAKLRAHGCDPQAAAAATS  79

Query  212   NLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVV  388
             ++HFH   +P F  P  NP+A  KFP+ L+P F+A+ S+LR P + L+R+LS + ++++V
Sbjct  80    SIHFHDFEIPTFSCPSANPNAKNKFPSHLLPAFYASVSNLREPVSFLLRSLSCEARKIIV  139

Query  389   ISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPE  568
             I DSLMG VVQ+V  + NAE Y F  +SAFT   F  E+ G+     E   +   +PS E
Sbjct  140   IHDSLMGSVVQEVRFISNAESYTFHSVSAFTLCLFLSEKMGRNIKLNET--IPEELPSLE  197

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ------WAIGP  730
             GCF  EF +F   Q  +   +SG + N+ R IE  +IDLI  E K   Q      WA+GP
Sbjct  198   GCFTNEFLDFTASQYDYHKFNSGCIYNTSRLIEGAYIDLIENEVKESMQKNIKKHWALGP  257

Query  731   LNPVSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKF  907
              NP+++ D      +H  L+WLD+ E++SV++VSFG+TT+L+NEQI +L  GL+ S +KF
Sbjct  258   FNPLTIPDKERLQEQHFCLKWLDKHERNSVIYVSFGTTTTLNNEQIKQLAIGLKRSNEKF  317

Query  908   IWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             IWV+RD D+GDVF+  ++ R+AE+P+GYE+ ++G G+VVR+W PQLEIL H ++GGFMSH
Sbjct  318   IWVLRDADKGDVFNK-DSERKAELPKGYEDSIQGMGIVVRDWVPQLEILAHQAIGGFMSH  376

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMESI+MGVPIAAWPMHSDQPRNA LIT+VLK+G+ + DW+RR+E V  + +   
Sbjct  377   CGWNSCMESITMGVPIAAWPMHSDQPRNAVLITDVLKIGVIVRDWSRRDEIVTSKMVETC  436

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             VK L+AS EG+ MR+RAAE   SLK  +  GG  R E++SF+A+I+
Sbjct  437   VKSLMASDEGDGMRKRAAEFGDSLKRSMGEGGVSRMEIDSFIAYIS  482



>ref|XP_004237101.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   410 bits (1053),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 256/465 (55%), Positives = 328/465 (71%), Gaps = 16/465 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAV---PN  214
             ++VV++P PAQGHLNQ L L +LIA+H I VHY    TH  QA  RVH  DP +     N
Sbjct  7     IIVVVVPFPAQGHLNQLLQLCKLIASHNIQVHYVTTMTHTNQAKTRVH--DPYSFINNNN  64

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HFH LS P F SPPPNP+++ KFP+ L P F ++SHLR+P + L+  LS   KR+V+I 
Sbjct  65    IHFHELSTPFFNSPPPNPNSTIKFPSHLQPSFESSSHLRKPLSKLLSVLSSKAKRIVIIH  124

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEG  571
             DSLMG+VVQD   L NAE Y F  +SAFT + F WE  G+P D+    A  L  +PS E 
Sbjct  125   DSLMGYVVQDFVYLPNAEAYAFHSVSAFTLFLFIWENMGRPFDID---ANFLKDVPSLED  181

Query  572   CFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVS  745
             CF PEFE+FIK+Q  +   +SG + N+CR IE  F+DL+ KE  S    QWA+GP NPV 
Sbjct  182   CFSPEFEKFIKLQHDYMKFNSGRIYNTCRVIEGPFLDLLSKEQISNNKMQWALGPFNPV-  240

Query  746   LTDSINTN----RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             L     T     +HKSL WLD  E +SV+FVSFG+TTS S+EQI E+  GLEES  KF+W
Sbjct  241   LVQQYGTKSCHKQHKSLIWLDEHEPNSVVFVSFGTTTSFSDEQIKEIAIGLEESEVKFVW  300

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD D+G+VF     +R+ E+P+G+EERV+ +G+V+R+WAPQLEIL H SVGGFMSHCG
Sbjct  301   VLRDADKGNVFAKDHQSRKIELPKGFEERVKDKGIVLRDWAPQLEILAHSSVGGFMSHCG  360

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESISMGVPIAAWPMHSDQPRN  L+T++LK+G+ + +W RR+E V R  +   V+
Sbjct  361   WNSCMESISMGVPIAAWPMHSDQPRNTVLVTKILKVGLVVKEWTRRHEVVTRGMVQAAVE  420

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             KL+ S EGEEMR RA +LS +LK+ +A  G    EL+SF++HITR
Sbjct  421   KLMVSKEGEEMRNRAMDLSGALKKSVAESGIKNMELDSFISHITR  465



>gb|KHN14960.1| Zeatin O-glucosyltransferase [Glycine soja]
Length=505

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 303/449 (67%), Gaps = 2/449 (0%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ L+LSRLI AH IPVH+ G+ TH RQ   R  GWDP  + N+  H  ++ 
Sbjct  59    PFPAQGHLNQLLNLSRLILAHNIPVHFVGSPTHNRQVIVRAQGWDPNFIYNIQIHDFNVS  118

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F SP PNP+A T+FP+ L+P F A++ LR P  AL+++LS   +RVVVI DSLM  VVQ
Sbjct  119   PFVSPAPNPNAETRFPSHLLPSFEASTSLRVPVYALLQSLSSVARRVVVIYDSLMASVVQ  178

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             D   + N E Y F  +SAFT + + W+  G+P V  + + V+  +PS EGCF  +F +FI
Sbjct  179   DAIHVPNCESYTFHSVSAFTMFLYFWDAMGRPPV-EKVSHVIPEVPSLEGCFTTQFIDFI  237

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTNRHKS  781
               Q  F   S G + N+ R IE+ +++LI +   +   WA+GP NP+S+   +   +H S
Sbjct  238   TSQYEFHKFSKGTIYNTTRVIESPYLELIKRIISSKTHWALGPFNPLSIEKGVYNTKHFS  297

Query  782   LEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEA  961
             +EWLD+QE  SVL+VSFG+TT  S EQI E+  GLE+S QKFIW V            + 
Sbjct  298   VEWLDKQEAGSVLYVSFGTTTCFSEEQIKEVANGLEKSKQKFIW-VVRDADKGDVFIEDG  356

Query  962   ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAA  1141
              R +E+P+G+EERV+G G+VVR+WAPQLEIL H S GGFMSHCGWNSCMESI+MGVPIAA
Sbjct  357   VRTSELPKGFEERVKGTGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCMESITMGVPIAA  416

Query  1142  WPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraa  1321
             WPMHSDQPRN  L+TEVLK+G+ + DW  R+E V   ++   V++L+A+ EG+EMR+RA 
Sbjct  417   WPMHSDQPRNRVLVTEVLKIGVVVKDWDHRDELVTASDVENAVRRLMATKEGDEMRQRAM  476

Query  1322  eLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              L  +++     GG  R EL+ F+AHITR
Sbjct  477   NLKNAIRRSRDEGGVSRVELDDFIAHITR  505



>ref|XP_004251001.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   409 bits (1052),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 242/451 (54%), Positives = 308/451 (68%), Gaps = 6/451 (1%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHL+  + LS  I++  IPV+Y   A H+RQA  R  GWDPL   NL+F    + 
Sbjct  21    PLPAQGHLHAAIELSHRISSANIPVYYVSTAAHVRQAQSRAVGWDPLNTTNLNFIDFPV-  79

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F+ PPPNPDAS KFP+QL+P F ++  LR P   L+  L+   +RVVVI D L  WVVQ
Sbjct  80    TFEVPPPNPDASIKFPSQLVPAFNSSLQLREPVTDLVNKLASTSRRVVVIHDFLTSWVVQ  139

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             DVP + NAE Y    +SAF  +S+ W+   +P V PEA  VL  +PS +GC  PE EEF 
Sbjct  140   DVPKIPNAECYCLHTVSAFLVFSYIWD-AARPPVPPEAEAVLKQLPSLDGCNSPELEEFA  198

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGK-ESKTGFQ-WAIGPLNPVSLTDSINTNRH  775
             K Q        G++ ++ R IE L+IDL+ +    +GF+ WA+GP NPV+L      NRH
Sbjct  199   KKQIAARVPGVGNIFSTSRVIEGLYIDLMDRMMGASGFKHWALGPFNPVNLEFEKKENRH  258

Query  776   KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddg  955
              SLEWLD+Q   SV+FVSFGSTTSLS ++I EL  GLE S Q+FIWV+RD D+GD+F   
Sbjct  259   YSLEWLDKQPASSVIFVSFGSTTSLSEDEIRELAIGLEASQQRFIWVLRDADKGDIFSGE  318

Query  956   EAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPI  1135
                R+ ++PEGYE+RV  RG+V+R+WAPQLEILGHPS GGFMSHCGWNSCMESI+MGVPI
Sbjct  319   --VRKCQLPEGYEKRVSERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCMESITMGVPI  376

Query  1136  AAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrr  1315
             AAWPMHSDQPRNA  ITE LK GI +  W +RNE +    + + V+ LIAS EG EM+R 
Sbjct  377   AAWPMHSDQPRNALFITEGLKTGIWVRKWEQRNEVIPAETVEKVVRTLIASPEGAEMKRN  436

Query  1316  aaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             A  + +++K  +  GG  + E++SFVAHITR
Sbjct  437   ATAIKEAVKLSVMEGGVTQQEMKSFVAHITR  467



>gb|AIE12482.1| UGT11 [Panax ginseng]
Length=466

 Score =   408 bits (1048),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 245/472 (52%), Positives = 327/472 (69%), Gaps = 13/472 (3%)
 Frame = +2

Query  2     SILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHR  181
             ++ E+ T G     VVVVM+P PAQGHLNQ LHLSRLI+A+ IPVHY G  TH RQA  R
Sbjct  4     NLYEHQTNGRKKSQVVVVMVPFPAQGHLNQLLHLSRLISAYNIPVHYVGTTTHSRQAKSR  63

Query  182   VHGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL  361
             + G    ++ N+HFH    P F +P PNP+ STKFP  L P F A+SHLR P  +L+  L
Sbjct  64    IQG----SITNIHFHEFPTPPFFTPSPNPNTSTKFPAHLQPSFEASSHLREPVASLVHAL  119

Query  362   SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAG  541
             +    ++VVI D+ M  +VQDV ++ NAE Y F+  SAF   +F WE  G+P        
Sbjct  120   APTAHKIVVIHDAFMSSIVQDVVTISNAESYSFQSGSAFNFLAFKWESIGRP--SSLKLE  177

Query  542   VLNHMPSPEGCFIPEFEEFIKMQRPFWDA-SSGDLLNSCREIEALFIDLIGKESKTG--F  712
              L ++PS +GCF  EF EF   Q P  D  SSG + +  + IE  + DL+ KE  +G   
Sbjct  178   TLKNLPSMDGCFTQEFMEFATCQIPLMDKFSSGTIHDVSKVIEGEYFDLLTKEEFSGNIK  237

Query  713   QWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             QWA+GP NPVS++D     RH  L WLD+Q+ +SV++VSFG+TTSL++EQI EL  GLE+
Sbjct  238   QWALGPFNPVSISDH---KRHNCLNWLDKQDPNSVIYVSFGTTTSLTDEQIHELAIGLED  294

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             S QKFIWV+R+ D+GD+F+    ARRAE+P+GYE+R++G+G+++R+W PQLEIL H S G
Sbjct  295   SEQKFIWVLREADKGDIFEG-NYARRAELPKGYEQRIQGKGIILRDWVPQLEILEHASTG  353

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             GFMSHCGWNSCMES+SMGV +AAWPMHS+QPRNA LIT+VLK+G  + DW RR+E V   
Sbjct  354   GFMSHCGWNSCMESMSMGVAMAAWPMHSEQPRNAMLITDVLKIGTLVRDWERRDELVTSL  413

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + + V++L+ S EG EMR+RAAE+  +++  +A GG  R E +SF++HITR
Sbjct  414   SVEKAVRRLMVSKEGGEMRKRAAEMGGTVRRSVAEGGVTRAEFDSFISHITR  465



>gb|KEH28644.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=464

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 237/456 (52%), Positives = 322/456 (71%), Gaps = 5/456 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VV+V++P PAQGHLNQ LH SRLI +H IPVHY G + H RQAT RV GWDP ++ N+HF
Sbjct  13    VVIVVVPFPAQGHLNQLLHFSRLILSHNIPVHYVGTSIHNRQATTRVQGWDPNSISNIHF  72

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             HH   P F SPPPNP+   KFP+ ++P F A+SHLR P   L+ +LS   ++VVVI DSL
Sbjct  73    HHFKAPPFVSPPPNPNTENKFPSHMVPSFVASSHLREPVAELMHSLSSVFEKVVVIHDSL  132

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQD  ++ N E Y F    AF+ ++  WE+ GKP   P  +  +  +PS EGCF  
Sbjct  133   MASVVQDAKNIANVENYSFLSTCAFSIFTSIWEKVGKP---PFESSHIIDVPSMEGCFTT  189

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             E  +FI  Q  F++ S G + N+ R IE+ +++LI + + +   WA+GP NP+++    +
Sbjct  190   EIYDFINAQSEFYEFSDGSIYNTSRVIESPYLELIERITCSKKHWAVGPFNPLTIEKKKD  249

Query  764   TN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             +  RH  +EWLD+QE +SV++VSFG+TT+L++E+I ++  GLE+S  KFIWV+RD D+GD
Sbjct  250   SKGRHLCMEWLDKQEPNSVIYVSFGTTTTLTDEEIEQIATGLEQSKIKFIWVLRDADKGD  309

Query  941   vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESIS  1120
             +FD  E  +R E+ +G+EERV G G VVR+WAPQLEIL HPS GGFMSHCGWNS +ESIS
Sbjct  310   IFDGNE-GKRGELAKGFEERVEGMGFVVRDWAPQLEILSHPSTGGFMSHCGWNSTLESIS  368

Query  1121  MGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaege  1300
             MGVPIAAWPMHSDQPRN   IT+VLK+G+ ++DWA+R+E V   +I   V+ L+ + EG+
Sbjct  369   MGVPIAAWPMHSDQPRNCVFITQVLKIGLVVMDWAKRHELVTASDIENVVRTLMDTMEGD  428

Query  1301  emrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EMR RA +L  ++   +  GG  R E++SF+AHITR
Sbjct  429   EMRERAMKLKNAIGMSMDEGGVSRMEMDSFIAHITR  464



>ref|XP_002532137.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30257.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=456

 Score =   405 bits (1042),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 312/461 (68%), Gaps = 35/461 (8%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V+VVM+PLPAQGHLNQ L LSRLI ++ IPVH+ GAATH RQ   R HGWD         
Sbjct  23    VIVVMVPLPAQGHLNQLLQLSRLILSYNIPVHFVGAATHNRQVKLRDHGWD---------  73

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
                                KFP+ L P F A+S+LR P + L+R+L+   ++VVVI DSL
Sbjct  74    ----------------TQNKFPSHLQPAFLASSNLRDPVSLLLRSLASKARKVVVIHDSL  117

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+Q+V  + NAE Y F  +SAFT + FHWER GK  + P    +   +PS EGCF  
Sbjct  118   MGSVIQEVRYISNAESYTFHSVSAFTIFLFHWERMGK-HIRPNGL-IPKDVPSLEGCFTS  175

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESK------TGFQWAIGPLNPVS  745
             EF  FI  Q    D  SG + N+CR IE  ++DL+ K+ K          WA+GP NPVS
Sbjct  176   EFLSFIYSQYKHQDFCSGYVYNTCRLIEGSYMDLLEKQHKETTVKEKKTHWALGPFNPVS  235

Query  746   LTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             +T+  +++ RH  L+WLD+Q ++SV++VSFG+TT+++NEQI +L  GL++S QKFIWV+R
Sbjct  236   ITERTDSDQRHSCLDWLDKQARNSVIYVSFGTTTTMNNEQIKQLATGLKQSQQKFIWVLR  295

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D D+GDVF+  E  +R E+P GYE+ + G G++ R+W PQLEILGHP+ GGFMSHCGWNS
Sbjct  296   DADKGDVFNG-EHGQRVELPTGYEDSLSGMGLIARDWVPQLEILGHPATGGFMSHCGWNS  354

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESI+MGVPIAAWPMHSDQPRNA LITE LK+GI + DW  R+E V  + I   VKKL+
Sbjct  355   CMESITMGVPIAAWPMHSDQPRNAVLITEFLKIGIYVKDWTCRDEIVTSKMIETCVKKLM  414

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             AS EG+ +R+R AEL  S++  +  GG  R E++SF+AHI+
Sbjct  415   ASDEGDAVRKRVAELGGSVQRSMGEGGVSRMEMDSFIAHIS  455



>ref|XP_010279537.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=507

 Score =   407 bits (1046),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 254/461 (55%), Positives = 317/461 (69%), Gaps = 17/461 (4%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQ  250
             AQGHLNQ LHLSRLI+A+GIPVHY G+ATH RQA  RVHGW+PLA+PNLHFH   MP F 
Sbjct  49    AQGHLNQLLHLSRLISAYGIPVHYVGSATHNRQAKDRVHGWNPLAIPNLHFHDFPMPPFH  108

Query  251   SPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVP  430
             +PPP+P A  KFP  L P F A+ HLR P  AL+ +LS    RVVVI D+LM + VQDV 
Sbjct  109   NPPPDPHAPIKFPAHLQPTFDASLHLRGPIAALLSSLSTLTNRVVVIHDTLMAFAVQDVT  168

Query  431   SLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAA--GVLNHMPSPEGCFIPEFEEFIK  604
             SL NAE Y F  +SAF      WE  GKP  G      GV +H  S EGCF  EF  F+ 
Sbjct  169   SLSNAEAYAFHSVSAFAIVFHLWEILGKPTDGGIVIPNGVPHH--SLEGCFTAEFVNFMA  226

Query  605   MQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPV---SLTDSINTN  769
              Q        GDL N+CR IE  F+DL+ +E   G +  WA+GPLNPV   S  +S    
Sbjct  227   RQYHLMKFDVGDLYNTCRPIEGRFMDLLTQEKLNGRKKIWAVGPLNPVILHSAKESPRRR  286

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
             RHK LEWLD+Q   SVL+VSFG+ TSL ++QI EL  GLE S Q+FIWV+R+ DRGD++D
Sbjct  287   RHKCLEWLDKQPAQSVLYVSFGTLTSLPDDQINELAVGLERSKQRFIWVLREADRGDIYD  346

Query  950   d---gEAAR----RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             +    EA R    +       E RV GRG+++R+WAPQLEIL HPS GGF+SHCGWNSCM
Sbjct  347   EGLGVEARRTPLPKGYDYYEGEGRVEGRGLILRDWAPQLEILAHPSTGGFLSHCGWNSCM  406

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ES+SMGVP+AAWPMHSDQPRN  L+T+VLK+G+ + DW+RR+E V    I + +KKL+AS
Sbjct  407   ESLSMGVPMAAWPMHSDQPRNTMLVTQVLKVGLVVRDWSRRHELVSSSTIEDAIKKLMAS  466

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGR-NELESFVAHITR  1408
              EG++MR+RA +L  ++++ ++  GG    ELESF+AHI+R
Sbjct  467   EEGDDMRKRAEKLGGTVRQSMSEQGGTSCAELESFIAHISR  507



>emb|CDP14136.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   407 bits (1046),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 252/458 (55%), Positives = 325/458 (71%), Gaps = 32/458 (7%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++PLPAQGHLNQ LHLSRLI+++ IPVHY G A+HIRQA  RVHGWDPLA+ N+HF
Sbjct  79    VTVVIVPLPAQGHLNQLLHLSRLISSYDIPVHYVGTASHIRQAKVRVHGWDPLAISNIHF  138

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H  S+P +++PPPNP+A TKFPTQL+PVF  +  LR P  AL++ LS   +R+VVI DSL
Sbjct  139   HEFSIPSYETPPPNPNAPTKFPTQLIPVFNTSIKLREPVYALLQQLSGTSRRLVVIYDSL  198

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M +V+QDV  + NAE Y     SAFT YS                           CF  
Sbjct  199   MAYVIQDVGLIPNAESYCSPGTSAFTIYS---------------------------CFPQ  231

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWAIGPLNPVSLTDS  757
             E  +F K+Q+     SSG L N+CR IE  ++DL    K + +  QWAIGP NPV +   
Sbjct  232   EMTDFAKLQQDVKPISSGYLFNTCRAIEGPYLDLHVKSKITDSDKQWAIGPFNPVEVNGQ  291

Query  758   INT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              N+  RH  L+WLD+Q  +SV+F+SFGSTTS+S+E+  E+  GL++SGQKFIWV+RD D+
Sbjct  292   KNSETRHCCLDWLDKQAPNSVIFISFGSTTSVSDEEAKEIATGLDKSGQKFIWVLRDADK  351

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF   +  RRA++P+G+EERV GRG+VVR+WAPQLEILGH S GGFMSHCGWNSC+ES
Sbjct  352   GDVFQGED--RRAQLPKGFEERVEGRGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCIES  409

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW++ NE V    +   V++L+ SAE
Sbjct  410   ISMGVPVAAWPMHSDQPRNAILLEKVLKIGLKVRDWSKLNELVTSITVENAVRRLMDSAE  469

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             GEEMR+RA ELS+++K  +  GG  R E++SF+AHI R
Sbjct  470   GEEMRQRARELSKAVKGSVMEGGLSRLEMDSFIAHIRR  507



>ref|XP_011048089.1| PREDICTED: zeatin O-glucosyltransferase-like [Populus euphratica]
Length=473

 Score =   405 bits (1041),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 235/457 (51%), Positives = 319/457 (70%), Gaps = 8/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+P PAQGHLNQ L LSRLI ++ IPV Y GA TH RQA  RVHGWDP    N+HF
Sbjct  21    VVVVMVPFPAQGHLNQLLQLSRLILSYNIPVRYVGATTHNRQAKQRVHGWDPDTAANIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +  F+ PPPNP+A  KFP+Q+ P F A+SHL  P + L+R LS   ++V+VI DSL
Sbjct  81    HDVEIRPFRCPPPNPNAKIKFPSQVQPAFNASSHLTEPVSMLLRALSCKARKVIVIHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  V+Q+   L N E Y F  +SAF    + WE+ GK  +  +       +PS EGCF  
Sbjct  141   MESVIQEARLLPNVESYIFHSVSAFAVSLYAWEQQGK--IIEDNELFPRDIPSLEGCFTA  198

Query  584   EFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGKES-KTGFQ-WAIGPLNPVSLTD  754
             EF +F+  Q   +   +SG + N+C+ +E  ++D + KE+ K G + WA+GP NPV++ +
Sbjct  199   EFADFLSYQYNNYRKFNSGCVYNTCKLVEGAYMDFLEKETLKEGNKHWALGPFNPVTIPE  258

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               +  +   L+WLD + ++SV++VSFG+TT+L +EQ+ EL  GL ES Q F+WV+RD D+
Sbjct  259   R-SKKKKFCLDWLDMKARNSVIYVSFGTTTALDDEQVKELAIGLRESKQNFVWVLRDADK  317

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF   E  R AE+PEGYE+ V G G+VVR+WAPQLEIL HP+ GGF+SHCGWNSC+ES
Sbjct  318   GDVFSGEE--RSAELPEGYEDSVDGIGLVVRDWAPQLEILAHPATGGFLSHCGWNSCLES  375

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQPRN  LIT++LK+G+ + +W +R+  V    +   VK+L+ S E
Sbjct  376   ITMGVPIAAWPMHSDQPRNTVLITKILKIGVVVREWEQRDAVVTSNIVESAVKRLMGSTE  435

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             G+EMR+RAAE+ +S++  +A GG  R E+ESF+AHIT
Sbjct  436   GDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHIT  472



>ref|XP_006349063.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=467

 Score =   405 bits (1040),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 241/451 (53%), Positives = 307/451 (68%), Gaps = 6/451 (1%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHL+  + LS  I++  IPV+Y   A H+RQA  R   WDPL   NL+F    + 
Sbjct  21    PLPAQGHLHAAIELSHRISSANIPVYYVSTAAHVRQAQSRAVCWDPLKTTNLNFIDFPV-  79

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F++PPPNPDAS KFP+QL+P F ++  LR P   L+  L+   +RVVV+ D L  WVVQ
Sbjct  80    TFEAPPPNPDASIKFPSQLVPAFNSSLQLREPVTDLVNKLASTSRRVVVVHDFLTSWVVQ  139

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             DVP + NAE Y    +SAF  +S+ W+   +P V PEA  VL  +PS +GC  PE EEF 
Sbjct  140   DVPKITNAECYCLHTVSAFLVFSYIWD-AARPPVPPEAEAVLKQLPSLDGCNSPELEEFA  198

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGK-ESKTGFQ-WAIGPLNPVSLTDSINTNRH  775
             K Q        G++ ++ R IE L+IDL+ K    +GF+ WA+GP NPV+L       RH
Sbjct  199   KKQIAARVPGVGNIFSTSRVIEGLYIDLMDKMMGPSGFKHWALGPFNPVNLEFDKKETRH  258

Query  776   KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddg  955
              SLEWLD+Q   SV+FVSFGSTTSLS ++I EL  GLE S Q+FIWV+RD D+GD+F   
Sbjct  259   YSLEWLDKQPASSVIFVSFGSTTSLSEDEIRELAIGLEVSQQRFIWVLRDADKGDIFSGE  318

Query  956   EAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPI  1135
                R+ ++PEGYE+RV  RG+V+R+WAPQLEILGHPS GGFMSHCGWNSC+ESISMGVPI
Sbjct  319   --VRKYQLPEGYEKRVSERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCIESISMGVPI  376

Query  1136  AAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrr  1315
             A WPMHSDQPRNA  I E LK+GI + +W RR E V    + + V+ L+AS EGEEM+R+
Sbjct  377   AVWPMHSDQPRNALFIAEGLKIGIPVREWKRRKEVVPAETVEKVVRTLMASPEGEEMKRK  436

Query  1316  aaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             A  L +++K  +  GG    E+ESFVAHITR
Sbjct  437   ATALKEAVKLAVMEGGVTHKEMESFVAHITR  467



>ref|XP_010671477.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=477

 Score =   405 bits (1041),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 233/460 (51%), Positives = 311/460 (68%), Gaps = 5/460 (1%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWD-PLAVPNL  217
              +  +M+P P QGHLN+ LHLS +IA++GIPVH+AG+  H RQA  R+HGWD   +   +
Sbjct  19    SIAAMMVPFPMQGHLNETLHLSNIIASYGIPVHFAGSTAHNRQAKLRLHGWDDEESTSKM  78

Query  218   HFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             HFH L +P F S P   +  T FP  L P+F AT  LR+P   L++ LS   +R+++I D
Sbjct  79    HFHDLQLPPFTSIPAKFNPQTNFPGHLQPLFDATLDLRQPVFRLLQELSAKYRRIIIIHD  138

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             +LM  VVQDV    NAE Y    +SAFT +   W          ++   ++ +PS EGCF
Sbjct  139   TLMASVVQDVKLFPNAESYALHGVSAFTIFYHFWNSMTDTPFELDSDIKISGIPSSEGCF  198

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK---ESKTGFQWAIGPLNPVSL  748
              PEFE +I  Q    D  SG + N+CREIE  +++L+ K    +K  F +A+GPL+PV  
Sbjct  199   TPEFEAYIAKQYKVLDFESGRIFNTCREIEGRYMELLSKLPENAKKKF-FALGPLHPVET  257

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
              +  N  RH+ LEWLD QE +SV++VSFG+ TSL+ EQI+EL  GLE S +KF+WV+R  
Sbjct  258   KNRFNKIRHRCLEWLDEQEINSVIYVSFGTATSLTEEQISELAIGLERSEKKFLWVLRSA  317

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             DR D+  + +   R ++P+GYE RV+ +G+VVR+WAPQL+IL HPSVGGFMSHCGWNSCM
Sbjct  318   DRVDISTEDDVIIRPQLPKGYEYRVKSKGMVVRDWAPQLDILAHPSVGGFMSHCGWNSCM  377

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPIAAWPMHSDQPRN+ LITEVLK+G+ + DW  R E V    +   V +L+ S
Sbjct  378   ESISMGVPIAAWPMHSDQPRNSILITEVLKIGLLIRDWEHRAEVVTSTTVENVVIRLMTS  437

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EGEEMR+RAAELS +++  +  GG  R E++SFVAHI+R
Sbjct  438   KEGEEMRKRAAELSVAVRGSVEDGGSSRLEVDSFVAHISR  477



>gb|KDP26081.1| hypothetical protein JCGZ_21114 [Jatropha curcas]
Length=460

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 322/462 (70%), Gaps = 15/462 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDP----LAVPNLHF  223
             M+PLPAQGHLNQ L LSRLI+++ IPVH+ G  TH RQA  R HG DP     A  ++HF
Sbjct  1     MVPLPAQGHLNQLLQLSRLISSYNIPVHFVGTTTHNRQAKLRAHGCDPQAAAAATSSIHF  60

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F  P  NP+A  KFP+ L+P F+A+ S+LR P + L+R+LS + ++++VI DS
Sbjct  61    HDFEIPTFSCPSANPNAKNKFPSHLLPAFYASVSNLREPVSFLLRSLSCEARKIIVIHDS  120

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LMG VVQ+V  + NAE Y F  +SAFT   F  E+ G+     E   +   +PS EGCF 
Sbjct  121   LMGSVVQEVRFISNAESYTFHSVSAFTLCLFLSEKMGRNIKLNET--IPEELPSLEGCFT  178

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ------WAIGPLNPV  742
              EF +F   Q  +   +SG + N+ R IE  +IDLI  E K   Q      WA+GP NP+
Sbjct  179   NEFLDFTASQYDYHKFNSGCIYNTSRLIEGAYIDLIENEVKESMQKNIKKHWALGPFNPL  238

Query  743   SLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
             ++ D      +H  L+WLD+ E++SV++VSFG+TT+L+NEQI +L  GL+ S +KFIWV+
Sbjct  239   TIPDKERLQEQHFCLKWLDKHERNSVIYVSFGTTTTLNNEQIKQLAIGLKRSNEKFIWVL  298

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             RD D+GDVF+  ++ R+AE+P+GYE+ ++G G+VVR+W PQLEIL H ++GGFMSHCGWN
Sbjct  299   RDADKGDVFNK-DSERKAELPKGYEDSIQGMGIVVRDWVPQLEILAHQAIGGFMSHCGWN  357

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESI+MGVPIAAWPMHSDQPRNA LIT+VLK+G+ + DW+RR+E V  + +   VK L
Sbjct  358   SCMESITMGVPIAAWPMHSDQPRNAVLITDVLKIGVIVRDWSRRDEIVTSKMVETCVKSL  417

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             +AS EG+ MR+RAAE   SLK  +  GG  R E++SF+A+I+
Sbjct  418   MASDEGDGMRKRAAEFGDSLKRSMGEGGVSRMEIDSFIAYIS  459



>ref|XP_003519074.1| PREDICTED: zeatin O-glucosyltransferase [Glycine max]
 gb|AAM09513.2|AF489873_1 putative glucosyltransferase [Glycine max]
Length=461

 Score =   404 bits (1038),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/456 (50%), Positives = 304/456 (67%), Gaps = 9/456 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V+ V++P PAQGHLNQ LHLSRLI +H IPVHY G  THIRQ T R H     ++ N+HF
Sbjct  14    VMAVLIPFPAQGHLNQLLHLSRLILSHNIPVHYVGTVTHIRQVTLRDHN----SISNIHF  69

Query  224   HHLSMPHFQSPPPNPD-ASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F SPPPNP+   T FP  L+P F A+SHLR P   L+ +LS   KRV+VI DS
Sbjct  70    HAFEVPSFVSPPPNPNNEETDFPAHLLPSFEASSHLREPVRKLLHSLSSQAKRVIVIHDS  129

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             +M  V QD  ++ N E Y F     F T  F+W++ G+P V      ++  +PS EGCF 
Sbjct  130   VMASVAQDATNMPNVENYTFHSTCTFGTAVFYWDKMGRPLVD---GMLVPEIPSMEGCFT  186

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSI  760
              +F  F+  QR F   + G++ N+ R IE  +I+ + + +     WA+GP NP++     
Sbjct  187   TDFMNFMIAQRDFRKVNDGNIYNTSRAIEGAYIEWMERFTGGKKLWALGPFNPLAFEKKD  246

Query  761   NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             +  RH  LEWLD+Q+ +SVL+VSFG+TT+   EQI ++  GLE+S QKFIWV+RD D+GD
Sbjct  247   SKERHFCLEWLDKQDPNSVLYVSFGTTTTFKEEQIKKIATGLEQSKQKFIWVLRDADKGD  306

Query  941   vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESIS  1120
             +FD  E A+  E    +EERV G G+VVR+WAPQLEIL H S GGFMSHCGWNSC+ESIS
Sbjct  307   IFDGSE-AKWNEFSNEFEERVEGMGLVVRDWAPQLEILSHTSTGGFMSHCGWNSCLESIS  365

Query  1121  MGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaege  1300
             MGVPIAAWPMHSDQPRN+ LITEVLK+G+ + +WA+RN  V    +   V++L+ + EG+
Sbjct  366   MGVPIAAWPMHSDQPRNSVLITEVLKIGLVVKNWAQRNALVSASNVENAVRRLMETKEGD  425

Query  1301  emrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +MR RA  L   +   +  GG  R E++SF+AHIT+
Sbjct  426   DMRERAVRLKNVIHRSMDEGGVSRMEIDSFIAHITK  461



>gb|KEH20810.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=481

 Score =   405 bits (1040),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 229/473 (48%), Positives = 303/473 (64%), Gaps = 7/473 (1%)
 Frame = +2

Query  5     ILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRV  184
             +L  GTK      VVVV++P PAQGHLNQ LHLSRLI+ + IP+H+ G   H RQA  RV
Sbjct  11    VLSKGTKVIHQSQVVVVVVPFPAQGHLNQLLHLSRLISLYNIPIHFVGTTQHNRQAIVRV  70

Query  185   HGWDPLAV-PNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNL  361
              GWDP +   N + H+  +P F SPPPNP+A +KFP+ L P F A+S+LR     L+++L
Sbjct  71    QGWDPKSFSKNFNIHNFKVPTFVSPPPNPNAKSKFPSHLFPSFQASSNLREHVATLLQSL  130

Query  362   SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAG  541
             S   KRVVVI DSLM   +QD   ++N E Y F  +SAFT + F W   GKP V   +  
Sbjct  131   SSVAKRVVVIYDSLMASCIQDAIHIKNCESYTFHSVSAFTMFLFFWGVMGKPLV-KNSTN  189

Query  542   VLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWA  721
             ++  +PS EGCF  +F  FI  Q  F   S+G + N+ R IE  +I+LI         WA
Sbjct  190   IIPEVPSLEGCFTTQFINFITSQYEFHKFSNGTIYNTSRVIEKPYIELIEGMISHKTHWA  249

Query  722   IGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             +GP NP+ +    N   RH SLEWLD+Q+ +SV+++SFG+TT+L  EQI EL  GLE+S 
Sbjct  250   LGPFNPLCVEKRNNNKARHFSLEWLDKQKDNSVIYISFGTTTALKEEQIIELANGLEQSK  309

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevp---egyeervrgrgvvvreWAPQLEILGHPSV  1069
             QKFIW V          + +  RR             + G G++VR+WAPQLEIL H S+
Sbjct  310   QKFIW-VLRDADRSDVFNEDGVRRMIELPKGFEERVEIEGVGLIVRDWAPQLEILSHSSI  368

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGFMSHCGWNSCMESI+MGVPIAAWPMHSDQPRN  L+TEVLK+G+ + DW++R+E V  
Sbjct  369   GGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNRVLVTEVLKIGLVVKDWSQRDELVMA  428

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +   V++L+A+ EG+EMR+ A  L   + + +  GG  R EL+SF+AH+TR
Sbjct  429   SIVENVVRRLMATKEGDEMRQNAMNLKNEILKSMDEGGVSRMELDSFIAHVTR  481



>ref|XP_010279539.1| PREDICTED: zeatin O-glucosyltransferase-like [Nelumbo nucifera]
Length=479

 Score =   404 bits (1039),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 313/465 (67%), Gaps = 14/465 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++P PAQGHLNQ LH SRLI+ +GIPVHYAG+ATH RQA  R+HGW+PL + NLHF
Sbjct  19    VTVVIVPFPAQGHLNQLLHFSRLISGYGIPVHYAGSATHNRQARQRIHGWNPLTISNLHF  78

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   MP F +PPPNPDA  KFP+ L P F A+ HLR P  AL+R+LS    R+VV+ D+L
Sbjct  79    HDFPMPPFPTPPPNPDAPIKFPSHLQPSFNASLHLREPVAALLRSLSRTTHRLVVVHDTL  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL--NHMP--SPEG  571
               + VQDV +L N E Y F   SAF    + WE  G+P  G    G++  N +P  S EG
Sbjct  139   TAFAVQDVATLPNGEAYAFHSASAFALVYYLWESRGRPSNG----GIVLPNELPYISLEG  194

Query  572   CFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVS  745
             CF  EF  FI  Q    +  +GD+ N+CR +E  F+DL+ KE  ++    WA+GPLNP++
Sbjct  195   CFTTEFANFITRQYDIMNFDAGDIYNTCRPVEGRFLDLLIKEQLNRDKRLWAVGPLNPMA  254

Query  746   --LTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
               LT      +HK L+WLD+Q   SVL+VSFG+ TSL ++QI EL  GLE S Q+F+WV+
Sbjct  255   LRLTRESPHRQHKCLQWLDKQPLQSVLYVSFGTMTSLPDDQILELAVGLERSKQRFVWVL  314

Query  920   rdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             R+ D GD++   ++ R  +            G G++VR+WAPQLEIL HPS  GF+SHCG
Sbjct  315   READIGDIYAGEKSGREIQLPKGYEERIEGVGVGLIVRDWAPQLEILAHPSTAGFLSHCG  374

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESIS+GVP+AAWPMHSDQPRN  L+T+VLK+G+ + +W RR E V    +   VK
Sbjct  375   WNSCMESISLGVPVAAWPMHSDQPRNTMLVTQVLKVGLVVQEWDRRQELVPSVTVENAVK  434

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +L+AS EG  MR+RA ELS S++  +A GG    EL+SFVAHI+R
Sbjct  435   RLMASEEGNNMRKRAKELSGSIRRSVAQGGISCTELDSFVAHISR  479



>gb|KEH40483.1| zeatin O-glucosyltransferase-like protein [Medicago truncatula]
Length=461

 Score =   403 bits (1035),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 314/451 (70%), Gaps = 10/451 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LH SRLI +H IPVHY G + H RQAT R  GWDP    N+HFHH  +P
Sbjct  19    PFPAQGHLNQLLHFSRLILSHNIPVHYVGTSIHNRQATIRGQGWDP----NIHFHHFKVP  74

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
             HF SPPP  ++ TKFP+ ++P F A+ HLR P   L+++LS   KRVVVI D+ M  VVQ
Sbjct  75    HFVSPPPILNSETKFPSHMLPSFEASLHLREPVAELMQSLSSVFKRVVVIHDTYMASVVQ  134

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             D  ++ N E Y F    AFT ++  WER GK  +  E++ +++ +PS EGCF  +F +F+
Sbjct  135   DAKNIANVENYMFVSTCAFTAFTSIWERMGKTPI--ESSHIID-VPSMEGCFTNQFVDFM  191

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTN--RH  775
               Q  F + S+G + N+ R IE  +++LI K +     WA+GP NP+++      +  RH
Sbjct  192   IAQMEFCEFSNGSIYNTNRVIEGPYLELIEKITCNKKHWAVGPFNPLTIDQEKKDSKGRH  251

Query  776   KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddg  955
               +EWLD+QE +SV++VSFG+TT+L++E+I ++  GL++S  KFIWV+RD D+GD+FD  
Sbjct  252   SCMEWLDKQETNSVIYVSFGTTTTLTDEEIEQIATGLKQSKIKFIWVLRDADKGDIFDKN  311

Query  956   EAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPI  1135
             E  +R E+ +G+EERV G G VVR+WAPQLEIL HPS GGFMSHCGWNS +E+ISMGVPI
Sbjct  312   EG-KRGELSKGFEERVEGMGFVVRDWAPQLEILSHPSTGGFMSHCGWNSTLETISMGVPI  370

Query  1136  AAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrr  1315
             AAWPMHSDQPRN  LIT+VLK+G+ + DWA+R++ V    I   V++L+ + EG+EMR R
Sbjct  371   AAWPMHSDQPRNCVLITQVLKIGLVVKDWAKRHKLVTASNIENVVRRLMETTEGDEMRER  430

Query  1316  aaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             A +L   +   +  GG  R E++SF+AHITR
Sbjct  431   AIKLKNVVGTSMDEGGVSRIEMDSFIAHITR  461



>ref|XP_006351402.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=471

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 326/473 (69%), Gaps = 13/473 (3%)
 Frame = +2

Query  5     ILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHG-IPVHYAGAATHIRQATHR  181
             I +N  K      +VVV++P  AQGHLNQ L LS LIA++  I VHY    TH  QA  R
Sbjct  7     ICKNNQKSQK---IVVVIVPFLAQGHLNQLLQLSCLIASYNNIKVHYVSTKTHNLQAKLR  63

Query  182   V-HGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRN  358
             V + +D  +   +HFH    P F SP PNP++  KFP+ L   F ++S+LR P   LI+ 
Sbjct  64    VINSFDSFS--KIHFHEFPTPSFISPNPNPNSRIKFPSHLQSSFESSSYLRNPVKRLIQT  121

Query  359   LSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAA  538
             LS   +RVV+I+DSLMG VVQD  S+ NAE Y F  +SAFT   F WER  +P +    +
Sbjct  122   LSSKYQRVVIINDSLMGSVVQDFVSVPNAEAYTFHSVSAFTLLLFIWERKKRPFLID--S  179

Query  539   GVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGF  712
              +L  +PS EGCF PEFE+ +K +      +SG + N+CR +E+ F+DL+ KE  +    
Sbjct  180   EMLIDLPSLEGCFSPEFEKLMKREYECMKFNSGKIYNTCRVMESPFLDLLLKEVTNNNEK  239

Query  713   QWAIGPLNPVSL-TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
             QWA+GP NPV+   +  NT  H  L WLD+QE +SV+ VSFG+TTS S+EQI E+  GLE
Sbjct  240   QWALGPFNPVTFPKNGPNTKSHTCLLWLDKQEPNSVILVSFGTTTSFSDEQIKEIAIGLE  299

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
             +S QKFIWV+RD D+G+VF   +++R+ E+P+G+EERV+ +G++VR+WAPQLEIL H S 
Sbjct  300   QSEQKFIWVLRDADKGNVFTK-DSSRKIELPKGFEERVKEKGILVRDWAPQLEILSHCST  358

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGF+SHCGWNSCMES+SMGVPIAAWPMHSDQPRNA LIT++LK+GI + +WA RNE V  
Sbjct  359   GGFLSHCGWNSCMESVSMGVPIAAWPMHSDQPRNAVLITKILKIGIVVREWANRNELVKS  418

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               + + V+KL+AS  G+EMR +A  LS  +++ +A GG  R EL+SF++HITR
Sbjct  419   NVVKKCVEKLMASKGGDEMRNKAKYLSVEIRKSVAEGGIKRIELDSFISHITR  471



>ref|XP_004251002.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=464

 Score =   402 bits (1034),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 243/458 (53%), Positives = 313/458 (68%), Gaps = 10/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVV++PLPAQGHL+  L LSR +++  IPV+Y     H+RQA  R  GWDPL  PNL+F
Sbjct  14    VVVVIVPLPAQGHLHAALELSRRLSSANIPVYYVSTTAHVRQAHSRAAGWDPLNTPNLNF  73

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
                 +  F +PP NPDAS KFP+QL+P F ++  LR P   L+  L    +RV+VI D L
Sbjct  74    IDFPVT-FNAPPTNPDASIKFPSQLVPAFNSSMQLRTPITDLVNKLGSISRRVIVIHDFL  132

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
               WVVQDVP + N E Y    +SA+  +++ WE   +P V PEA  VL  +PS +GC  P
Sbjct  133   TSWVVQDVPKISNTECYCLHTVSAYLMFTYTWE-AARPPVPPEAEVVLKQLPSQDGCTSP  191

Query  584   EFEEF-IKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNPVSLTD  754
             E  EF +K      DA  G++ ++ R I+ +++DL  K S  K    WA+GP NPV L  
Sbjct  192   EVIEFAMKQINVLQDA--GNIYSTSRAIDGMYLDLTEKMSVPKDFKNWALGPFNPVDLNI  249

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                 +RH S+EWLD+Q   SV+FVSFGSTTSL+ ++I EL  GLE S Q+FIWV+RD D+
Sbjct  250   D-KKDRHYSVEWLDKQPASSVIFVSFGSTTSLTEDEIRELAIGLEASQQRFIWVLRDADK  308

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F      R+ ++PEGYE+RV  RG+V+R+WAPQLEILGHPS GGFMSHCGWNSC+ES
Sbjct  309   GDIFSGE--VRKYQLPEGYEKRVSERGLVMRDWAPQLEILGHPSTGGFMSHCGWNSCIES  366

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPIAAWPMHSDQPRNA  ITE LK+GIS+ +W RR E V    + + V+ L+AS E
Sbjct  367   ISMGVPIAAWPMHSDQPRNALFITEGLKIGISVREWERRKEVVPAETVEKVVRTLMASPE  426

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             GEEM+R+A EL +++K  +  GG    E+ESFVAHITR
Sbjct  427   GEEMKRKAMELKEAVKLAVMEGGVTHKEMESFVAHITR  464



>ref|XP_009777653.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=484

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 231/451 (51%), Positives = 314/451 (70%), Gaps = 11/451 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LHLSRLI+++ IP HY     H  Q   R HG++PL+  N+HFH  S P
Sbjct  43    PFPAQGHLNQLLHLSRLISSYNIPTHYITTKIHSHQVNLRAHGFNPLSTNNIHFHEFSTP  102

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F SP    ++S KFP+ L P    +S+LR+P   ++ +LS   +R+++I DSLMG VVQ
Sbjct  103   VFNSPS---NSSIKFPSHLTPSSQISSNLRKPVAKILHSLSHKNRRIIIIHDSLMGSVVQ  159

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             D  ++ NAE Y F  +SAFT + + WE  G+P        ++  +PS EGCF PEFE+F+
Sbjct  160   DFRTIPNAEAYTFHSVSAFTLFLYVWESIGRPF----GIDMIKELPSNEGCFSPEFEKFM  215

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINTNRH  775
             K +  +   +SG + N+ + IE  F+DL+ KE  SK   QWA+GP NPV + ++ +  RH
Sbjct  216   KSEHEYSKFNSGKIYNTSQAIEHTFLDLLSKEQISKGKKQWALGPFNPVVIQET-HQQRH  274

Query  776   KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddg  955
             KSL WLD+Q   SV+FVSFG+T+S S+EQI E+  GLE+S QKFIWV+RD D+ +VF   
Sbjct  275   KSLVWLDKQVPKSVIFVSFGTTSSFSDEQIKEIAIGLEKSQQKFIWVLRDADKENVFSK-  333

Query  956   EAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPI  1135
             +  ++ E+P+G+EER + +G++VR+WAPQLEIL H S GGF+SHCGWNSC+ESISMGVPI
Sbjct  334   DFIKKIELPKGFEERAKEKGIIVRDWAPQLEILAHSSTGGFLSHCGWNSCIESISMGVPI  393

Query  1136  AAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrr  1315
              AWPMHSDQPRN  LIT++LK+GI + DWARR++ +   +I   V+ L+AS EGEEMR+R
Sbjct  394   VAWPMHSDQPRNTVLITKILKVGIVVKDWARRDDLIVSTKIEMAVRILMASEEGEEMRKR  453

Query  1316  aaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             A EL   +K+ +  GG  R E +SF+AHITR
Sbjct  454   AEELGFGVKKAVGEGGVTRKEFDSFIAHITR  484



>ref|XP_007028692.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOY09194.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=499

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 240/456 (53%), Positives = 324/456 (71%), Gaps = 4/456 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P PAQGHLNQ LHLSR++ ++GIPVHY    TH RQA  R HGWDP+A  N HF
Sbjct  46    VAVVMVPFPAQGHLNQLLHLSRIVLSYGIPVHYVATPTHNRQAKIRAHGWDPVATANFHF  105

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P F SPPP+P ++ KFP+ L P F A  HL +P   L+R LS   ++V+VI DS+
Sbjct  106   HDCQVPPFLSPPPDPSSAIKFPSHLQPCFDACWHLCQPVTELLRMLSSQARKVIVIHDSM  165

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG VVQ+V S+ NAE Y F  +SAF+ + + WE  GKP+V  E       +PS EGCF  
Sbjct  166   MGSVVQEVGSIANAESYTFHTVSAFSLFFYVWESIGKPEVNAEMPDE-GDVPSLEGCFTK  224

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL-TDSI  760
             +F EFI +Q  +   ++G + N+ + IE  +++L+G   +    WA+GP NPV +   + 
Sbjct  225   DFLEFIALQFQYLRDNAGIIYNTSKVIEGPYLELLGGIMRGKQHWALGPFNPVRIPGKNS  284

Query  761   NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             + +RH  LEWLD+Q  +SVL+VSFG+TT++ +EQI EL  GL +S QKFIWV+RD D+GD
Sbjct  285   SASRHFCLEWLDKQATNSVLYVSFGTTTAMDDEQIKELAIGLRKSNQKFIWVLRDADKGD  344

Query  941   vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESIS  1120
             VF+     RR E+P+GYE+ V+  G+VVR+WAPQLEIL HP+ GGF+SHCGWNSCMESI+
Sbjct  345   VFNGE--VRRPELPQGYEDSVKDTGLVVRDWAPQLEILAHPATGGFVSHCGWNSCMESIT  402

Query  1121  MGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaege  1300
             MGVPI AWPMHSDQPRNA LIT++LK+GI++ DW RR+  V    + + VK+L+AS EG+
Sbjct  403   MGVPIGAWPMHSDQPRNAVLITKLLKVGIAVKDWERRDGTVTAPIVEDAVKRLMASKEGD  462

Query  1301  emrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EMR+RAAE+  ++++ +A G   + E +SF+AHITR
Sbjct  463   EMRKRAAEVGGAVRQSVAEGEVSQKERDSFIAHITR  498



>ref|XP_004249252.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=471

 Score =   400 bits (1028),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 241/473 (51%), Positives = 325/473 (69%), Gaps = 13/473 (3%)
 Frame = +2

Query  5     ILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHG-IPVHYAGAATHIRQATHR  181
             I +N  KG     +VVV++P  AQGHLNQ L LS LIA++  I VHY    TH  QA  R
Sbjct  7     ICKNNQKGQK---IVVVIVPFLAQGHLNQLLQLSCLIASYNNIKVHYVSTKTHNLQAKVR  63

Query  182   V-HGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRN  358
             V + +D  +   +HFH   +P+F SP PNP++  KFP+ L   F ++S+LR P   LI+ 
Sbjct  64    VVNSFDSFS--KIHFHEFPIPNFISPNPNPNSRMKFPSHLQSSFESSSYLRNPVKRLIQT  121

Query  359   LSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAA  538
             LS   +RVV+I+DSLMG VVQD  S+ NAE Y F  +SAF    F WER  +P +    +
Sbjct  122   LSSKYQRVVIINDSLMGSVVQDYVSVPNAEAYTFHSVSAFALLLFIWERKKRPFLID--S  179

Query  539   GVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGF  712
              +L  +PS + CF PEFE  ++ +    + +SG + N+C+ IE+ F+DL+ KE  +    
Sbjct  180   EILIDLPSLKDCFSPEFENLMRKEYECMNFNSGKIYNTCKVIESPFLDLLSKEVTNNNEK  239

Query  713   QWAIGPLNPVSL-TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
             QWA+GP NPV+   +   T  H  L WLD+QE++SV+ VSFG+TTS S+EQI E+  GLE
Sbjct  240   QWALGPFNPVTFPKNGPYTKSHTCLLWLDKQEQNSVILVSFGTTTSFSDEQIKEMAIGLE  299

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
             +S QKFIWV+RD D+G+VF   ++ R+ E+P+G+EERV+ RG++VR+WAPQLEIL H S 
Sbjct  300   QSEQKFIWVLRDADKGNVFTK-DSTRKIELPKGFEERVKERGILVRDWAPQLEILSHCST  358

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGF+SHCGWNSCMES+SMGVPIAAWPMHSDQPRN  LIT++LK+GI + DWA RNE V  
Sbjct  359   GGFLSHCGWNSCMESVSMGVPIAAWPMHSDQPRNTVLITKILKIGIVVRDWADRNELVKS  418

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +   V+KL+AS EG+EMR +A  LS  +++ +A GG  R EL+SF++HITR
Sbjct  419   NVVKNCVEKLMASKEGDEMRNKAKILSVEIRKSVAEGGIKRIELDSFISHITR  471



>ref|XP_010672884.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   399 bits (1026),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 236/462 (51%), Positives = 318/462 (69%), Gaps = 8/462 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++PLPAQGHLNQ LHLS LIA++GIPVHYAG+ TH RQA  R+H  +  ++  +HF
Sbjct  14    VAVVIVPLPAQGHLNQLLHLSHLIASYGIPVHYAGSTTHNRQAKLRLHCRESQSLAKIHF  73

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P + SPPP+ D S  FP    P+F A++ LR P + L+  LS    RVVVI D  
Sbjct  74    HDFQLPPYHSPPPSIDISVPFPDHFTPLFEASTQLREPISQLLHQLSQKFSRVVVIHDHT  133

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWE---RTGKPDVGPEAAGVLNHMPSPEGC  574
             M +VVQDV  + NA+ + F  ISAFT +S  WE      KP    ++  +  +MP+ EGC
Sbjct  134   MTYVVQDVKLIPNAKAFTFIPISAFTMFSNTWESIPEEAKP-FQLDSNDIPENMPTNEGC  192

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG----FQWAIGPLNPV  742
                E  EF + Q       SG + N+CR IE  ++ L+ K S T       +AIGP +PV
Sbjct  193   ATKEVLEFARKQIECLGFESGWIFNTCRAIEGKYVTLLDKLSSTNKSQIKHFAIGPFHPV  252

Query  743   SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
              + +  + NRH+ L+WLD QEK SV++VSFGSTTSL+++QI EL  GLE+S  KF+WV+R
Sbjct  253   HIENKNSENRHQCLKWLDEQEKCSVIYVSFGSTTSLTDDQIEELANGLEQSEVKFLWVLR  312

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
               D  DVF++ +  ++A++P+GYE+RV+ RG++V++WAPQLEIL HPS GGFMSHCGWNS
Sbjct  313   RADPNDVFEEADRVKKAQLPKGYEDRVKDRGMIVKDWAPQLEILAHPSTGGFMSHCGWNS  372

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMES+SMGVP+AAWPMHSDQPRNA L++EVL++GI + DWA R E V    I   VK L+
Sbjct  373   CMESMSMGVPVAAWPMHSDQPRNAVLLSEVLRIGILVRDWAHRGEVVKSSTIENVVKTLM  432

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             AS EG+EM++RAAEL +S++  +A GG    E +SF+AHI++
Sbjct  433   ASEEGKEMKKRAAELGESVRGSVAEGGVSCLERDSFIAHISK  474



>emb|CAN74373.1| hypothetical protein VITISV_010199 [Vitis vinifera]
Length=1843

 Score =   427 bits (1099),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 309/472 (65%), Gaps = 12/472 (3%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             ENG K    V VV  M+P PAQGHLNQ L LSR+I+++ IPVHY G+ATHI QA  R+ G
Sbjct  1374  ENGVKEAPHVAVV--MVPFPAQGHLNQLLQLSRIISSYNIPVHYVGSATHINQAKLRLQG  1431

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
             WDPL  PN HFH    PHF SPPP+PDAS +FP  L P F A+S LR P  AL+R LS+ 
Sbjct  1432  WDPLLEPNFHFHDFPTPHFHSPPPDPDASVQFPAHLQPCFEASSELREPVAALLRELSLT  1491

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
               R++VI+DSLMG VVQD   + NAE Y F  +S F+ + F WE  G+P +  E   +  
Sbjct  1492  VDRLIVINDSLMGSVVQDFVGIGNAESYTFHSVSVFSIFFFFWESLGRPAL--EGVKIPE  1549

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ---WA  721
              +PS +GCF  EF +F+  Q  F   SSG+L  + + IE  ++D++ +E   G +   WA
Sbjct  1550  DVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTSKLIEGPYVDILREEEIDGVKKKGWA  1609

Query  722   IGPLNPV-SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             +GPLN V + +D  +    K LEWLD+Q   SVL VSFG++TSL++EQI EL  GLE SG
Sbjct  1610  LGPLNLVTTYSDKTSNPGDKCLEWLDKQAPKSVLLVSFGTSTSLTDEQIKELAIGLERSG  1669

Query  899   QKFIWvvrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
              KFIW     D        E  RR+E         +  G GVVVREWAPQLEILGH S G
Sbjct  1670  HKFIW--LLRDADKGDIFSEEVRRSELPEGYEERMKETGMGVVVREWAPQLEILGHSSTG  1727

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             G M HCGWNSC+ESISMGVPIAAWPMHSDQPRNA L+T+VL++G+++ +WA R + V   
Sbjct  1728  GLMCHCGWNSCLESISMGVPIAAWPMHSDQPRNAALVTQVLQVGLAVKEWAEREQLVAAS  1787

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              I + V++L+AS EG  MR++A +L  SL+  +  GG  R EL+ F+AHITR
Sbjct  1788  AIEKAVRRLMASEEGNAMRKKAQQLGNSLQRSMEEGGVSRKELDGFIAHITR  1839



>ref|XP_009363195.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X3 [Pyrus 
x bretschneideri]
Length=472

 Score =   399 bits (1024),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 233/419 (56%), Positives = 302/419 (72%), Gaps = 7/419 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN-LH  220
             VVVVM+PLPAQGHLNQ LHLSRLI+A+ IPVHY GAATH RQA  R HGWD  +V N + 
Sbjct  14    VVVVMVPLPAQGHLNQLLHLSRLISAYNIPVHYVGAATHNRQAKLRAHGWDQTSVSNKIQ  73

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P F SPPPNP+A+ KFP+ L P F AT+HLR+P   L+R LS+  +RV+VI DS
Sbjct  74    FHDFPTPPFLSPPPNPNATNKFPSHLQPSFEATAHLRQPLAKLLRELSLKGRRVIVIHDS  133

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEGCF  577
             LM  ++QDV S+ N E Y F  +SAFT + + WE  GKP    E    L + +PS EGCF
Sbjct  134   LMASIIQDVASIPNGESYTFHSVSAFTIFLYLWEVIGKPKKLEELDVKLPDGIPSLEGCF  193

Query  578   IPEFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--  748
               EF  FI  Q  +    ++G L N+ R IE  ++DL+ +       WAIGP NP ++  
Sbjct  194   TVEFRNFIDEQHKYQKLNNAGYLHNTSRTIEGPYMDLLNRIGDQKKHWAIGPFNPTTVAY  253

Query  749   -TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrd  925
               ++ N++RH  LEWLD+QE+ SV++VSFG+TT++ +EQI EL  GLEES Q+FIWV+RD
Sbjct  254   PNNNSNSSRHMCLEWLDKQEQRSVMYVSFGTTTAMKDEQIQELAIGLEESKQRFIWVLRD  313

Query  926   gdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSC  1105
              D+GD+F+ GE  RRAE+P+G+EER++GRG+VVR+W PQLEIL H S GGF+SHCGWNSC
Sbjct  314   ADKGDLFNGGEV-RRAELPQGFEERIKGRGLVVRDWVPQLEILSHKSTGGFLSHCGWNSC  372

Query  1106  MESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             MESI+MGVPIAAWPMHSDQPRN  LIT++L++G  + DW +R+E V  + +  GV+K +
Sbjct  373   MESITMGVPIAAWPMHSDQPRNTVLITKLLRVGFVMRDWDKRDELVTSQNVKNGVQKFM  431



>ref|XP_010092094.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB50176.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=483

 Score =   399 bits (1025),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 317/461 (69%), Gaps = 4/461 (1%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  VVVVM+PLPAQGH+NQ LHLSRLIAA+ IPV+Y GAA H RQAT RV GW+P ++ N
Sbjct  24    DHEVVVVMVPLPAQGHINQLLHLSRLIAAYNIPVYYVGAAAHNRQATLRVQGWNPNSIKN  83

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HF    +P F SPPPNP++  KFP+ L+P F A  HLR P  AL+R LS   +R+++I 
Sbjct  84    IHFLDFLVPPFNSPPPNPNSQDKFPSHLLPSFRAARHLRHPVTALLRRLSEKARRIIIIH  143

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEG  571
             DSLM  VVQD   + N E + F  ISAF  + F+W+   K  +  +A  ++   +PS EG
Sbjct  144   DSLMASVVQDAALIPNTESFTFHSISAFAIFLFYWDGMKKVQLEVDAKNIIPKDVPSLEG  203

Query  572   CFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLT  751
             C   E  +FI  Q  F   +SG+L N+ R +E  ++DL+ +       WA+GP NPV L 
Sbjct  204   CLTSEMMDFIAAQYEFNKYNSGNLYNTSRVMERPYMDLLVRILPNKKHWALGPFNPVELV  263

Query  752   D-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             +  ++ ++H  LEWLD+Q  +SV++VSFG+TT+ + EQI EL  GLE+SGQKF+W V   
Sbjct  264   EKKVSNDKHMCLEWLDKQAPNSVIYVSFGTTTTFTEEQIQELALGLEQSGQKFMW-VLRY  322

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
                 V  D E  R+ E+P+GYEE VR +G+VVR+WAPQLEILGHPS GGF+SHCGWNSC+
Sbjct  323   ADKGVVFDDEVIRKVELPKGYEESVRNKGIVVRDWAPQLEILGHPSTGGFLSHCGWNSCI  382

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESI+MGVPI AWPMHSDQPRN  L+TE+L +G  + DW RRNE      + EGV+KL+ S
Sbjct  383   ESITMGVPIGAWPMHSDQPRNTVLVTELLGVGTVVRDWNRRNEVATAAAVVEGVRKLMES  442

Query  1289  aegeemrrraaeLSQSLKEPIAV-GGGGRNELESFVAHITR  1408
              EGE MR+RAAEL  ++++  A   G  R EL++F+AHI+R
Sbjct  443   KEGEHMRKRAAELGSAVRQSAAAEDGASRKELDAFIAHISR  483



>gb|KDO36524.1| hypothetical protein CISIN_1g039436mg, partial [Citrus sinensis]
Length=422

 Score =   394 bits (1012),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 230/417 (55%), Positives = 298/417 (71%), Gaps = 11/417 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP----NLHF  223
             M+P PAQGHLNQ L LSRL+ ++ IPVHY G+A H RQA  RVHGWDPL V     N+HF
Sbjct  1     MVPFPAQGHLNQLLQLSRLVLSYNIPVHYVGSAVHNRQAQVRVHGWDPLDVSSNNNNIHF  60

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P +  PPPNP+A+ KFP+ ++P   A+ HLR P   L+  LS   +RVVVI DSL
Sbjct  61    HDFEIPPYPCPPPNPNAACKFPSHIIPCCEASKHLRHPLATLLNTLSATARRVVVIHDSL  120

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEGCFI  580
             M  V+QDV  + NAE Y F  +SAFT Y + WER G P++  EA+G++   +PS EGCF 
Sbjct  121   MASVIQDVCLIPNAESYTFHSVSAFTLYLYIWERMGNPNLN-EASGLIPKDVPSLEGCFT  179

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNPVSLTD  754
              EF + I  +      +SG++ N+ R IE+ ++DL+ K +  +T   WA+GP NPV+L +
Sbjct  180   SEFLDSIASEYDHMKFNSGNVYNTSRVIESAYMDLLEKATVAETFNHWALGPFNPVTLPN  239

Query  755   SINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                +N RH  LEWLD+QEK+SVL+VSFG+TT++S+EQI EL  GL++S QKFIWV+RD D
Sbjct  240   KGGSNGRHFCLEWLDKQEKNSVLYVSFGTTTAMSDEQIKELAVGLKQSNQKFIWVLRDAD  299

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             RGDVF+     RRAE+P+ YE+ V+ +G+VVR+WAPQLEIL H S GGFMSHCGWNSCME
Sbjct  300   RGDVFNG--EVRRAELPKAYEDSVKDKGLVVRDWAPQLEILAHCSTGGFMSHCGWNSCME  357

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             SI+MGVPI AWPMHSDQPRN  LIT +LK+G+ + DWARR+E V    I   VK+L+
Sbjct  358   SITMGVPIVAWPMHSDQPRNTLLITHLLKLGLVMADWARRDEIVTSNVIENAVKRLM  414



>ref|XP_002308931.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92454.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=473

 Score =   394 bits (1011),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 240/457 (53%), Positives = 322/457 (70%), Gaps = 8/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+P PAQGHLNQ L LSRLI ++ IPV Y GA TH RQA  RVHGWDP A  N+HF
Sbjct  21    VVVVMVPFPAQGHLNQLLQLSRLILSYNIPVRYVGATTHNRQAKQRVHGWDPDAAANIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +P F+ PPPNP+A  KFP+QL P F  +SHL  P + L+R LS   ++V+VI DSL
Sbjct  81    HDIEIPPFRCPPPNPNAKIKFPSQLQPAFNTSSHLTEPVSMLLRALSCKARKVIVIHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  V+Q+   L N E Y F  +SAF    + WE+ GK  +  ++      +PS EGCF  
Sbjct  141   MESVIQEARLLPNVESYIFHSVSAFAVSLYAWEQQGK--IIEDSDMFPRDIPSLEGCFTA  198

Query  584   EFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGKES-KTGFQ-WAIGPLNPVSLTD  754
             EF +F+  Q   +   +SG + N+C+ +E  ++D + KE+ K G + WA+GP NPV++ +
Sbjct  199   EFADFVACQYNNYQKFNSGCVYNTCKLVEGAYMDFLEKETLKEGNKHWALGPFNPVTIPE  258

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               +  +   L+WLD++ ++SV++VSFG+TT+L +EQI EL  GL ES Q F+WV+RD D+
Sbjct  259   R-SKKKKFCLDWLDKKARNSVIYVSFGTTTALDDEQIKELAIGLRESKQNFVWVLRDADK  317

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GDVF   E  R AE+PEGYE+ V G G+VVR+WAPQLEIL HP+ GGFMSHCGWNSC+ES
Sbjct  318   GDVFGGEE--RSAELPEGYEDSVDGVGLVVRDWAPQLEILAHPATGGFMSHCGWNSCLES  375

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQPRN  LIT++LK+G+ + +W  R+  V    +   VK+L+AS E
Sbjct  376   ITMGVPIAAWPMHSDQPRNTVLITKILKIGVVVKEWELRDAVVTSNIVESAVKRLMASTE  435

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             G+EMR+RAAE+ +S++  +A GG  R E+ESF+AHIT
Sbjct  436   GDEMRKRAAEMGESVRGSVAEGGVSRMEMESFIAHIT  472



>ref|XP_008346617.1| PREDICTED: zeatin O-glucosyltransferase-like [Malus domestica]
Length=468

 Score =   392 bits (1007),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 251/460 (55%), Positives = 320/460 (70%), Gaps = 10/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+PLPAQGHLNQ LHLSRLI+A+ IPVHY GAATH RQ   R H WD      L F
Sbjct  14    VVVVMVPLPAQGHLNQLLHLSRLISAYNIPVHYVGAATHNRQVKLRAHCWDQ---AKLQF  70

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H    P F SPPPNP A+ KFP+ L P F AT+HLR+P   L+R LS   +RV+VI DS+
Sbjct  71    HDFXTPPFLSPPPNPKATNKFPSHLQPSFKATAHLRQPVAKLLRELSPKARRVIVIHDSM  130

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL-NHMPSPEGCFI  580
             M  V+QDV S+ N E Y F  +SAFT + + WE  G P    +    L + +PS EGCF 
Sbjct  131   MASVIQDVASIPNGESYTFHSVSAFTIFLYLWEVIGMPKKLEKLXVKLPDGIPSLEGCFT  190

Query  581   PEFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL---  748
              EF  F+  Q       ++G+L N+ R IE  +IDL+ +  +    WAIGP NP ++   
Sbjct  191   IEFMNFLGEQHEHQKLMNAGNLHNTSRTIEGPYIDLLNRIGQQK-HWAIGPFNPTTVANP  249

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
              ++ N +RHK LEWLD+QE+ SV++VSFG+TT++ +EQI EL  GLEES QKFIWV+RD 
Sbjct  250   NNNSNGSRHKCLEWLDKQEQSSVMYVSFGTTTAMKDEQIQELAIGLEESKQKFIWVLRDA  309

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F DGE  RRAE+P GYEE+V+GRG+VVR+WAPQL+IL H S GGF+SHCGWNSC+
Sbjct  310   DKGDLFSDGEV-RRAELPRGYEEKVKGRGLVVRDWAPQLDILSHKSTGGFLSHCGWNSCI  368

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESI+MGVPIAAWPMHSDQPRN  LIT++L +G  +  W +R+E V  + I  GV+K + S
Sbjct  369   ESITMGVPIAAWPMHSDQPRNTVLITKLLGVGFVMRHWDKRDELVTSQSIKNGVQKFMWS  428

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+E+R+RAAEL   +++    GG    E  SF+AHITR
Sbjct  429   EEGDEIRKRAAELGADVRQSRVEGGASHMEFSSFIAHITR  468



>ref|XP_010672888.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 239/462 (52%), Positives = 312/462 (68%), Gaps = 8/462 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLPAQGHLNQ LHLS+LI ++GIPVH+AG+ATH  QA  R+HGWD  ++  +HF
Sbjct  14    VAVVMVPLPAQGHLNQLLHLSQLITSYGIPVHFAGSATHNNQAKLRLHGWDAESMTRIHF  73

Query  224   HHLSMP-----HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVV  388
             H   +P     +  SPPPNP     FP    P+F A +HLR+P + L+  LS   KR++V
Sbjct  74    HDFPLPPLAPHNSTSPPPNPGHCIPFPAHFYPLFEAATHLRQPVSELLHQLSSMFKRIIV  133

Query  389   ISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPE  568
             I D ++  VVQDV  + NAE Y    ISAFT +   WE   +      +  +   +PS E
Sbjct  134   IHDIIITSVVQDVKFIPNAESYTLMPISAFTLFLSSWENIAEKPFQLGSEDIPKCIPSNE  193

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPV  742
             GC  PE + F+  Q  F    SG + N+ R IE  ++ L+ K S       + +GP NPV
Sbjct  194   GCTPPEIDNFVANQFKFLGLESGRIYNTSRPIEGRYVQLLEKLSTNADMKHFVLGPFNPV  253

Query  743   SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
              +       RH+ LEWLD+QE+ SV++VSFGS+TSLS+EQI EL  GLE SGQKF+WV+R
Sbjct  254   DIKSKSGRQRHQCLEWLDQQEQGSVIYVSFGSSTSLSDEQIRELAIGLERSGQKFVWVLR  313

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             + D GD+F +GEA R+ +VP+GYEER++ RG+V R+WAPQLEIL HP+ GGFMSHCGWNS
Sbjct  314   NSDTGDIFAEGEA-RKPQVPQGYEERLKDRGIVERDWAPQLEILAHPATGGFMSHCGWNS  372

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             C+ESISMGVPIAAWPMHSDQPRNA L+TEVL++G  + DWA R + V    I   VK L+
Sbjct  373   CIESISMGVPIAAWPMHSDQPRNAILVTEVLRIGTLVRDWAHRAQLVTSTTIENTVKTLM  432

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + EG EMR+RAAEL  +++  +A GG  R E++ F+AHITR
Sbjct  433   DTKEGNEMRKRAAELGDAVQGSVAKGGTARLEMDDFIAHITR  474



>ref|XP_009628740.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=476

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 230/453 (51%), Positives = 305/453 (67%), Gaps = 8/453 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LHLSRLI+++ IPVHY     H  Q   R HG++PL+  N+HFH  S P
Sbjct  28    PFPAQGHLNQLLHLSRLISSYNIPVHYITTKIHSHQVNLRAHGFNPLSTNNIHFHEFSTP  87

Query  242   HF--QSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              F   SP  N ++S KFP+ L P    +S+LR+P   ++ +LS   +R+++I DSLMG V
Sbjct  88    VFNSPSPNYNSNSSNKFPSHLTPSSQFSSNLRKPVAKILHSLSHKNRRIIIIHDSLMGSV  147

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD  ++ NAE Y F  +SAFT + + WE  GKP        ++  +PS EGCF PEF++
Sbjct  148   VQDFLTIPNAEAYTFHSVSAFTLFLYVWESIGKPFAID--TDMIKELPSNEGCFSPEFDK  205

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINTN  769
             F+K +  +   SSG + N+ + IE  F+DL+ KE  SK   QWA+GP NP ++    +  
Sbjct  206   FVKSEHAYSTFSSGKIYNTSKAIEDTFLDLLSKEQISKGKKQWALGPFNP-AVIQGTHQQ  264

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
             RHKSL WLD+Q   SV+FVSFG+T S S+EQI E+  GLE S QKFIW V      +   
Sbjct  265   RHKSLIWLDKQVPKSVIFVSFGTTCSFSDEQIKEIAIGLERSQQKFIW-VLRDADKENVF  323

Query  950   dgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGV  1129
               +  ++ E+P+G+EERV+ +G++VR+WAPQLEIL H S GGF+SHCGWNSC+ESISMGV
Sbjct  324   SKDFIKKIELPKGFEERVKEKGIIVRDWAPQLEILAHSSTGGFLSHCGWNSCVESISMGV  383

Query  1130  PIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemr  1309
             PI AWPMHSDQPRN  LIT++LK+GI + DWARR++ V    I + V  L+AS EGEEMR
Sbjct  384   PIVAWPMHSDQPRNTVLITKILKLGIVVKDWARRDDLVVSSTIEKAVTILMASEEGEEMR  443

Query  1310  rraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +RA ELS  + + +  GG  R E +SF+AHITR
Sbjct  444   KRAQELSFGVNKAVGEGGVTRKEFDSFIAHITR  476



>ref|XP_004168290.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=464

 Score =   390 bits (1001),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 228/460 (50%), Positives = 309/460 (67%), Gaps = 3/460 (1%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  VVVVM+PL AQGHLNQ LHLSRLI+A  IPVHY GA TH RQA  R+HGWDP A+ N
Sbjct  4     DGQVVVVMVPLAAQGHLNQLLHLSRLISARNIPVHYIGATTHNRQAKLRIHGWDPSALAN  63

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVI  391
             LHFH  S+P    PPP+P A TKFP  L+P F  A  HLR P   L+ +LS   +R+VVI
Sbjct  64    LHFHDFSIPPIPCPPPDPAAETKFPAHLIPSFQTAAIHLRGPLENLLHSLSPHARRIVVI  123

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN-HMPSPE  568
              DSLM   V+D+ S+ NAE Y F  +SAF    +  E+  +   G E + + +  +PS +
Sbjct  124   HDSLMASTVEDIDSIPNAESYNFHSVSAFAMAIYELEQEDQQTKGMETSIIKDLDIPSLD  183

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GCF  EF EF+++Q       SG+L N+C+ IE  +++++ + +     WAIGP NP+ L
Sbjct  184   GCFTQEFWEFVELQFGVPRKFSGNLYNTCKTIEEPYLEILQRINHETKHWAIGPFNPLEL  243

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             + S + N H  LEWLD+QE +SV++VSFG+TT+L +EQI E+  GLE S QKFIWV+RD 
Sbjct  244   SSS-SHNIHPCLEWLDQQEANSVVYVSFGTTTALEDEQIAEIARGLERSEQKFIWVLRDA  302

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F+                +  G+G+VVR+WAPQL IL H S GGF+SHCGWNSCM
Sbjct  303   DKGDIFNGEVRKSELPEGFEKRVKTEGKGLVVRDWAPQLAILSHGSTGGFVSHCGWNSCM  362

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             E+I+MGVP+ AWPMHSDQPRN+ L+TEVL++G+ + +W++R++ V    I   V+KL+AS
Sbjct  363   EAITMGVPMVAWPMHSDQPRNSVLMTEVLRVGLLIREWSQRDKLVMATTIENAVRKLMAS  422

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG  MR+   EL+  +++ +   G  R E +SF++HITR
Sbjct  423   EEGHGMRKTVEELAVVMRQSVEENGVSREEFDSFISHITR  462



>ref|XP_008244258.1| PREDICTED: zeatin O-glucosyltransferase-like [Prunus mume]
Length=480

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 244/473 (52%), Positives = 326/473 (69%), Gaps = 8/473 (2%)
 Frame = +2

Query  11    ENGTKGGADVG-VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVH  187
             +N T  G +   VVVVM+PLPAQGHLNQ LH S L++AH IPVH+ G+ TH RQA  RVH
Sbjct  8     QNNTPNGFNQSQVVVVMVPLPAQGHLNQLLHFSLLVSAHDIPVHFVGSTTHNRQAKLRVH  67

Query  188   GWDPLAVPN-LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLS  364
             GWD  +V N + FH   +P F SPPPNP+A  KFP+ L P F AT+HLR+P   L+R LS
Sbjct  68    GWDQASVSNNVQFHDFQIPPFPSPPPNPNAKNKFPSHLQPSFEATTHLRQPVADLLRQLS  127

Query  365   VDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEA-AG  541
                +RV+VI DS+M  V+QDV S+ N E Y F  +SAF  + +  E  G+P +  E    
Sbjct  128   PKARRVIVIHDSMMASVIQDVASIPNGESYTFHTVSAFALFLYLCEAIGRPAMLEELHVE  187

Query  542   VLNHMPSPEGCFIPEFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGFQW  718
             + +  PS EGCF  EF +FI  Q       ++G++ N+ R IE  ++D + +       W
Sbjct  188   IPDDTPSLEGCFTNEFLDFIAAQYKCQKLNNAGNIYNTSRTIEGPYMDFLNRIGDHQKHW  247

Query  719   AIGPLNPVSLTDSINTN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
             A+GP NP ++  S N+N   RH  L+WLD+Q  +SV++VSFG+TT++ +EQI EL  GLE
Sbjct  248   ALGPFNPSTILKSGNSNGGRRHMCLDWLDKQAPNSVIYVSFGTTTAMKDEQIAELAIGLE  307

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
             +S QKFIWV+RD D+GDVF + E  RRAE+P+GYEERV+GRG+VVR+WAPQLEIL H S 
Sbjct  308   QSNQKFIWVLRDADKGDVFSNEEE-RRAELPQGYEERVKGRGLVVRDWAPQLEILAHKST  366

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGF+SHCGWNSC+ESI+MGVP+AAWPMHSDQPRN  LIT +L++G+ + DWA R+E +  
Sbjct  367   GGFVSHCGWNSCIESITMGVPVAAWPMHSDQPRNTVLITRLLRVGVVMRDWAHRDEILTS  426

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +  GV+K + S EG+E+R+RAA+L  +++  +  GG    E  SF+ HITR
Sbjct  427   LSVKNGVEKFMGSKEGDEIRKRAADLGAAVRRSMVEGGASHMEFSSFMDHITR  479



>ref|XP_009363212.1| PREDICTED: zeatin O-glucosyltransferase-like [Pyrus x bretschneideri]
Length=464

 Score =   389 bits (1000),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 249/459 (54%), Positives = 317/459 (69%), Gaps = 13/459 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVVM+PLPAQGHLNQ LHLSRLI+A+ IPVHY GAATH RQ   R H W+      L F
Sbjct  14    VVVVMVPLPAQGHLNQLLHLSRLISAYNIPVHYVGAATHNRQVKLRAHRWEA----KLQF  69

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H    P   SPPPNP+A+ KFP+ L P F AT+HLR+P   L+R LS   +RV+VI DS+
Sbjct  70    HDFPTPPSISPPPNPNATNKFPSHLQPSFKATAHLRQPVAKLLRELSPKARRVIVIHDSM  129

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  V+QDV S+ N E Y F  +SAFT + + WE  G P            +   EGCF  
Sbjct  130   MASVIQDVASIPNGESYTFHSVSAFTIFLYLWEVIGMPXXXXXXXXXXXXL---EGCFTI  186

Query  584   EFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL---T  751
             EF  FI  Q       ++G+L N+ R IE  +IDL+ +  +    WAIGP NP ++    
Sbjct  187   EFMNFIGEQHEHQKLINAGNLHNTSRTIEGPYIDLLNRIGQQK-HWAIGPFNPTTVANPN  245

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             ++ N +RHK LEWLD+QE+ SV++VSFG+TT++ +EQI EL  GLEES Q+FIWV+RD D
Sbjct  246   NNSNGSRHKCLEWLDKQEQSSVIYVSFGTTTTMKDEQIQELAIGLEESKQQFIWVLRDAD  305

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +GD+F DGE  RRAE+P+GYEERV+GRG+VVR+WAPQLEIL H S GGF+SHCGWNSC+E
Sbjct  306   KGDLFSDGEV-RRAELPQGYEERVKGRGLVVRDWAPQLEILSHKSTGGFLSHCGWNSCIE  364

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SI+MGVPIAAWPMHSDQPRN  LIT++L +G  + DW +R+E V  + I  GV+K + S 
Sbjct  365   SITMGVPIAAWPMHSDQPRNTVLITKLLGVGFVMRDWDKRDELVTSQSIKNGVQKFMWSE  424

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+E+R+RAAEL   +++    GG    E  SF+AHITR
Sbjct  425   EGDEIRKRAAELGADVRQSRVEGGASYMEFSSFIAHITR  463



>ref|XP_004150614.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
 gb|KGN54639.1| hypothetical protein Csa_4G414390 [Cucumis sativus]
Length=464

 Score =   388 bits (997),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 227/460 (49%), Positives = 308/460 (67%), Gaps = 3/460 (1%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  VVVVM+PL AQGHLNQ LHLSRLI+A  IPVHY GA  H RQA  R+HGWDP A+ N
Sbjct  4     DGQVVVVMVPLAAQGHLNQLLHLSRLISARNIPVHYIGATNHNRQAKLRIHGWDPSALAN  63

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVI  391
             LHFH  S+P    PPP+P A TKFP  L+P F  A  HLR P   L+ +LS   +R+VVI
Sbjct  64    LHFHDFSIPPIPCPPPDPAAETKFPAHLIPSFQTAAIHLRGPLENLLHSLSPHARRIVVI  123

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN-HMPSPE  568
              DSLM   V+D+ S+ NAE Y F  +SAF    +  E+  +   G E + + +  +PS +
Sbjct  124   HDSLMASTVEDIDSIPNAESYNFHSVSAFAMAIYELEQEDQQTKGMETSIIKDLDIPSLD  183

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GCF  EF EF+++Q       SG+L N+C+ IE  +++++ + +     WAIGP NP+ L
Sbjct  184   GCFTQEFWEFVELQFGVPRKFSGNLYNTCKTIEEPYLEILQRINHETKHWAIGPFNPLEL  243

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             + S + N H  LEWLD+QE +SV++VSFG+TT+L +EQI E+  GLE S QKFIWV+RD 
Sbjct  244   SSS-SHNIHPCLEWLDQQEANSVVYVSFGTTTALEDEQIAEIARGLERSEQKFIWVLRDA  302

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F+                +  G+G+VVR+WAPQL IL H S GGF+SHCGWNSCM
Sbjct  303   DKGDIFNGEVRKSELPEGFEKRVKTEGKGLVVRDWAPQLAILSHGSTGGFVSHCGWNSCM  362

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             E+I+MGVP+ AWPMHSDQPRN+ L+TEVL++G+ + +W++R++ V    I   V+KL+AS
Sbjct  363   EAITMGVPMVAWPMHSDQPRNSVLMTEVLRVGLLIREWSQRDKLVMATTIENAVRKLMAS  422

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG  MR+   EL+  +++ +   G  R E +SF++HITR
Sbjct  423   EEGHGMRKTVEELAVVMRQSVEENGVSREEFDSFISHITR  462



>ref|XP_010672887.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=496

 Score =   389 bits (998),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 228/466 (49%), Positives = 317/466 (68%), Gaps = 17/466 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV++PLPAQGHLNQ LHLS LI ++ IPVHYAG+ TH RQA  R+ GWD  ++  +HF
Sbjct  37    VAVVIVPLPAQGHLNQLLHLSHLITSYNIPVHYAGSTTHNRQAKLRLQGWDSQSLTKIHF  96

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P + SPPP+ D S   P     +F A++HLR P + L+  L+    +VVVI D+L
Sbjct  97    HDFQLPPYHSPPPSVDISAPSPEHFTALFEASTHLREPISQLLHQLAQKFNQVVVIHDNL  156

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL--------NHMP  559
             M +VVQDV  + NA+ + F  ISAF+ +S+ WE        PE   +L        +++P
Sbjct  157   MAYVVQDVKLIPNAKAFTFIPISAFSMFSYSWESI------PEEVKLLQLDSEEIPDNIP  210

Query  560   SPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQ-WAIGP  730
             + EGC   E  EF   Q       SG + N+ R IE  ++ L+ K   SK+  + +AIGP
Sbjct  211   THEGCATKEMLEFATKQIECLGFESGWIYNTSRAIEGRYVTLLDKLYSSKSQIKHFAIGP  270

Query  731   LNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
              +PV++ +  + NRH+ L+WLD QEK SV++VSFGSTTS +++QI EL  GL+ S  KF+
Sbjct  271   FHPVNIENKNSENRHQCLKWLDEQEKCSVIYVSFGSTTSFTDDQIEELANGLDRSEVKFL  330

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+R  D  +VF++ +  ++A++PEGYE+RV+ RG++V++WAPQLEIL HPS GGFMSHC
Sbjct  331   WVLRRADPNNVFEEADRVKKAQLPEGYEDRVKDRGMIVKDWAPQLEILAHPSTGGFMSHC  390

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVP+AAWPMHSDQPRNA L+T+VL++GI + DWA R E V    I   V
Sbjct  391   GWNSCMESISMGVPVAAWPMHSDQPRNAVLLTKVLRIGILVRDWAHRGEVVKSSTIENVV  450

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K L+ + EG+EM++RAAEL +S++  +A GG    E +SF+A+I++
Sbjct  451   KTLMVTEEGKEMKKRAAELGESVRGSVAEGGVSCLERDSFIAYISK  496



>ref|XP_006351401.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=409

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 306/458 (67%), Gaps = 60/458 (13%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+PLPAQGHLNQ LHLSRLI+A+ +P+H+AG   H+RQA +R+HGW+PL+   + F
Sbjct  9     VAIVMVPLPAQGHLNQLLHLSRLISAYHLPLHFAGTTVHLRQAKNRIHGWNPLSTSTVKF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H    P++++P PNP+++TKFP+QLMP F ATSHLR P  +L++ LS +           
Sbjct  69    HEFPTPNYETPAPNPNSTTKFPSQLMPSFHATSHLRHPITSLLQELSRN-----------  117

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
                             YR R  S F +YS  W+++                        P
Sbjct  118   ----------------YR-RHFSFFDSYS--WDKSS---------------------VTP  137

Query  584   EFEEFIKMQRPFWD-ASSGDLLNSCREIEALFIDLIGKE-SKTGFQWAIGPLNPVSLTDS  757
             EF E+ ++Q    +  +SG+L NSC EIE L++D + KE S    QWAIGPLNPV L + 
Sbjct  138   EFTEYTRVQFEVREIVNSGNLYNSCYEIEGLYLDWLAKEKSSRDKQWAIGPLNPVKLYEK  197

Query  758   INT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              N+   HK + WLD QE +SV+FVSFG+TT+ S+EQI E+  GLE+S Q+FIWV+R+ D+
Sbjct  198   NNSLISHKCMNWLDEQEPNSVIFVSFGTTTTFSDEQIKEIAIGLEKSEQRFIWVLREADK  257

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             G++F     +R  E+PE YEERV  RG++VR+WAPQLEILGH S GGFMSHCGWNSCMES
Sbjct  258   GNIFTG--ESREVELPERYEERVGKRGLIVRDWAPQLEILGHESTGGFMSHCGWNSCMES  315

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPI AWPMHSDQPRNA L+TEVLK+G+ L DWA+R+E V    + E VK+L+ SAE
Sbjct  316   ISMGVPILAWPMHSDQPRNAVLVTEVLKIGVELRDWAKRDELVSSVAVAECVKRLMDSAE  375

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+R  ELS+S    +  GGG   E+ SF+AHITR
Sbjct  376   GDEMRKRVMELSKS----VVDGGGSGREMASFIAHITR  409



>ref|XP_010056886.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   385 bits (989),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 234/460 (51%), Positives = 295/460 (64%), Gaps = 11/460 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHLNQ L L+ L+A++GI VHY G+A+H  QA  R H     +  ++ FH    P
Sbjct  14    PLPAQGHLNQLLELAYLVASYGISVHYVGSASHNHQAKLRSHILPSSSPSDICFHDFPTP  73

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F SP PNPD++ KFP+QL P F A S LR P   LIR+LS + +RVVV+ DSLMG VVQ
Sbjct  74    AFPSPAPNPDSTYKFPSQLQPAFDAASLLRGPVANLIRSLSSESRRVVVVHDSLMGSVVQ  133

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEG------CFIP  583
             D  S+ NAE Y F  +SAF  Y F WE TG      E    +  + S EG      CF  
Sbjct  134   DAASVPNAENYVFHSVSAFALYWFTWEATGMVLPQEEEEVDIAELVSAEGFPSIRVCFTD  193

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLTD  754
             EF +FI  Q  F   SSG + N+CR +E  ++DL    +        WAIGP N V   +
Sbjct  194   EFLKFIASQHEFKKLSSGCIFNTCRVVEGRYVDLYASATANSIATKHWAIGPFNMVKTPE  253

Query  755   -SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
              S   + H   EWLD+Q   SV++VSFG+TT+LSNEQI E+  GLE SGQKFIWV+R+ D
Sbjct  254   KSSRRSAHACTEWLDKQASSSVIYVSFGTTTALSNEQIREIAIGLESSGQKFIWVLREAD  313

Query  932   rgdvfddgEAARRAe-vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             +GD+F  GEA +             R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNSCM
Sbjct  314   KGDIFRGGEARKMELPQGFEEMVGTRDIGVVVRDWAPQLEILGHPATGGFLSHCGWNSCM  373

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + D   +N+ V    I + VK L+AS
Sbjct  374   ESISMGVPILAWPMHSDQPRNAILITGVLKIGLIVTDCMSQNKVVKSPAIQDAVKALMAS  433

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              +G+EMR++AAEL  +++  +  GG  R EL+SF+ HI+R
Sbjct  434   EQGDEMRKKAAELGIAVRGSMDKGGVSRAELDSFITHISR  473



>ref|XP_006351384.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   385 bits (989),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 307/453 (68%), Gaps = 10/453 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LH SRLI+++ IPVHY    TH RQ   R HG+   +  N+HFH    P
Sbjct  28    PFPAQGHLNQLLHFSRLISSYNIPVHYITTTTHTRQVNFRAHGFK--STNNIHFHEFPTP  85

Query  242   HFQSPPP--NPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              F SP P  NP  S KFP+ L P    +++LR P   ++ +LS   +R+V+I DSLMG V
Sbjct  86    IFNSPTPTNNPYPSLKFPSHLQPSSQISTNLRNPIAKILHSLSHKTRRIVIIHDSLMGSV  145

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD   + NAE Y F  +SAFT + + WE  G+         ++  +PS +GCF PEF +
Sbjct  146   VQDYRDIPNAEAYTFHSVSAFTIFLYVWESMGRS--SSIDVDMIKDLPSNDGCFTPEFTK  203

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINTN  769
             F++ +  F   +SG + N+ R IE  F+DL+ KE  +K   QWA+GP NP+++       
Sbjct  204   FVRSEHEFSKFNSGKIYNTSRVIEGPFLDLLSKEQINKGKKQWALGPFNPITILGPTQ-Q  262

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
             RH SL WLD+Q   SV+FVSFG+TTS S EQI E+  GLE+S QKFIWV+RD D+ +VF 
Sbjct  263   RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAIGLEQSQQKFIWVLRDADKENVFS  322

Query  950   dgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGV  1129
             + +  ++ E+P+G+EERV+ RG+VVR+WAPQLEIL H S GGF+SHCGWNSCMESISMGV
Sbjct  323   E-DFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHCGWNSCMESISMGV  381

Query  1130  PIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemr  1309
             P+ AWPMHSDQPRN  LIT++L++G+ + DWA+R++ V    I + V+ L+AS EGEEMR
Sbjct  382   PLVAWPMHSDQPRNTVLITKILEVGLVVKDWAQRDKLVMFDRIEKVVRILMASKEGEEMR  441

Query  1310  rraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +RA ELS  +K  +   G  +NE ++F+AHITR
Sbjct  442   KRAKELSFGVKNAVGENGVTKNEFDAFIAHITR  474



>ref|XP_008455786.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Cucumis 
melo]
Length=463

 Score =   383 bits (983),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 226/460 (49%), Positives = 313/460 (68%), Gaps = 4/460 (1%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  VVVVM+PL AQGHLNQ LHLSR I+A  IPVHY GA TH RQA  R+HGWDP  + N
Sbjct  4     DGQVVVVMVPLAAQGHLNQLLHLSRFISARNIPVHYIGATTHNRQAKLRIHGWDPSELAN  63

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVI  391
             LHFH  S+P    PPP+P A T+FP  L+P F  A +HLR P   L+ +LS   +R++VI
Sbjct  64    LHFHSFSIPPIPCPPPDPTAETRFPAHLIPSFRTAATHLRGPLKNLLHSLSPHSRRIIVI  123

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN-HMPSPE  568
              DSLM   V+D+ S+ NAE Y F  +SAF    +  E+  +   G E++ V +  +PS +
Sbjct  124   HDSLMASTVEDIDSIPNAESYNFHSVSAFAMAIYDLEQDQQTK-GMESSIVKDLDIPSLD  182

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GCF  EF EF+++Q       SG+L N+C+ +E  +++++ + +     WAIGP NP+ L
Sbjct  183   GCFTQEFWEFVELQFGGPRKFSGNLYNTCKTMEEPYLEILQRINHETKHWAIGPFNPLEL  242

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             + S + N H  LEWLD+Q+ +SV++VSFG+TT+L +EQI E+ +GLE S QKFIWV+RD 
Sbjct  243   SSS-SHNIHPCLEWLDQQKANSVVYVSFGTTTALEDEQIAEIASGLERSEQKFIWVLRDA  301

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+F+                ++ G+G+VVR+WAPQL IL H S GGF+SHCGWNSCM
Sbjct  302   DKGDIFNGEVRKCELPDGFEKRVKMEGKGLVVRDWAPQLAILSHDSTGGFVSHCGWNSCM  361

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             E+I+MGVP+ AWPMHSDQPRNA L+T+VL++G+ + +WA+R+E V    I + V+KL+AS
Sbjct  362   ETITMGVPMVAWPMHSDQPRNAVLMTKVLRVGLLIREWAQRDELVMATTIEKAVRKLMAS  421

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG EMR+   EL+  +++ +   G  R E +SF++HITR
Sbjct  422   EEGHEMRKTVEELAVVMRQAVEENGVSRVEFDSFISHITR  461



>gb|EYU20761.1| hypothetical protein MIMGU_mgv1a022179mg [Erythranthe guttata]
Length=462

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 233/459 (51%), Positives = 314/459 (68%), Gaps = 10/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+P PAQGHLNQ + LS LI+++GIPVHY G+A H RQA  RV+G +   V  +HF
Sbjct  6     VAVIMVPFPAQGHLNQLMQLSCLISSYGIPVHYVGSAIHNRQAKVRVNGLNHEDVEKIHF  65

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H +  P F SPPP+P++  KFPTQL P++ A+  LR P  + +R+++   +RVVV+ DSL
Sbjct  66    HDIPTPSFASPPPDPNSPDKFPTQLQPMWDASLSLREPVASYLRDMANKFERVVVVHDSL  125

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQDV S+ NAE Y F C+SAF+   F W+  GKP            +PS EGC   
Sbjct  126   MAVVVQDVSSILNAESYVFNCVSAFSKAVFTWDLLGKPLPIEHP----KELPSLEGCITD  181

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSL--T  751
             E  +F  +Q       +GDL N+CR IE  F++L+ +E   G +  WAIGP+ P  L  +
Sbjct  182   EIRDFWALQFEPLSYRAGDLYNTCRLIEPAFMELLEREEIAGSRKSWAIGPILPAKLSSS  241

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
              S + +R++ LEWLD+QE +SV++VSFG+TTSLS+EQI EL  GLE+S  KF+W     D
Sbjct  242   ASQSESRYRCLEWLDKQEPNSVIYVSFGTTTSLSDEQIKELAFGLEQSKVKFLW--VLRD  299

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
                     E  RRAE+PEG+EE+V+G G+VVREWAPQ +IL HPS GGF+SHCGWNSC+E
Sbjct  300   ADKGDIFDEQVRRAELPEGFEEKVKGVGMVVREWAPQPQILAHPSTGGFVSHCGWNSCIE  359

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SI+MGVPIAAWPMHSDQP N+ LITE+LKMG+ + +W +R E V    I   +K L+AS 
Sbjct  360   SITMGVPIAAWPMHSDQPSNSVLITEILKMGLFVREWKQRTELVKASTIENVLKILMASK  419

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+E+R+RA EL+ ++++    GG  + EL+SF++HITR
Sbjct  420   EGDEIRKRAEELAATVQQATQQGGASKLELDSFISHITR  458



>ref|XP_009400942.1| PREDICTED: zeatin O-xylosyltransferase-like [Musa acuminata subsp. 
malaccensis]
Length=475

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 303/465 (65%), Gaps = 14/465 (3%)
 Frame = +2

Query  38    VGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQA---THRVHGWDPLAV  208
             + V VVM+PLPAQGHLNQFLHLS L++A G+P+HY G+ATH RQ      R+H       
Sbjct  13    LDVAVVMVPLPAQGHLNQFLHLSSLLSARGLPIHYVGSATHNRQVLDRASRLHNGGTACR  72

Query  209   PNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVV  388
             P +HFH  ++P + SP P PDA+ KFP  L P F A  HL  P   L+R+L+   +RVV+
Sbjct  73    P-IHFHDFTLPDYSSPAPEPDAAIKFPGHLQPAFDAARHLLSPLADLVRSLASRSRRVVL  131

Query  389   ISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMP--S  562
             I DS M +      SL N E + F  +SA   + F WE  GKP    E A  +  +P  S
Sbjct  132   IHDSSMTFAAGAAASLPNVEAFCFHTVSAIAGFFFRWELRGKPR---EPAVEILELPHVS  188

Query  563   PEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLN  736
              E C   +F +F+  Q+    A SG L+NSCR IE +FIDL+ +E   +    +AIGPLN
Sbjct  189   NEDCISQQFCDFVLSQQQTTVADSGRLINSCRAIEGMFIDLVAREPEWQDKKTFAIGPLN  248

Query  737   PVSLTD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             P++    S N  RH S+EWLD+Q   SV++VSFG+T++ S+EQ+ EL AGLE SGQ+F+W
Sbjct  249   PITFNQASGNGARHPSIEWLDQQPPSSVIYVSFGTTSTFSDEQVAELAAGLEASGQRFLW  308

Query  914   vvrdgdrgdvfddg--EAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             V+RD DR D++ +   +A  + ++P  Y  RV  RG VVR WAPQ EIL HPS GGFMSH
Sbjct  309   VLRDADRADIYAETGGDAVEKEKLPLDYYTRVERRGKVVRGWAPQPEILAHPSTGGFMSH  368

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMES S GVPI AWPMHSDQPRNA L+T+VL++G  ++DW +R E V    I + 
Sbjct  369   CGWNSCMESFSAGVPIVAWPMHSDQPRNAVLVTDVLRVGFHVLDWDKRAELVASATISDV  428

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHI  1402
             +++L+AS EGEE+RRRA EL   ++  +  GG  + +L++FV HI
Sbjct  429   IERLMASKEGEEVRRRARELGGEVRRAMEEGGSSKTDLDAFVTHI  473



>ref|XP_007145587.1| hypothetical protein PHAVU_007G251100g [Phaseolus vulgaris]
 gb|ESW17581.1| hypothetical protein PHAVU_007G251100g [Phaseolus vulgaris]
Length=462

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 315/458 (69%), Gaps = 12/458 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVV++P PAQGHLNQ +HLS LI++H IPVHY    THIRQAT R H     +   +HF
Sbjct  14    VVVVLIPFPAQGHLNQLMHLSHLISSHNIPVHYVSTVTHIRQATLRHHK----SSSTIHF  69

Query  224   HHLSMPHFQSPPPNPDA-STKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F SPPPNP+   T FP+ L+P F A++HL+ P   L+++LS   KRV+VI DS
Sbjct  70    HSFQVPPFVSPPPNPNNPETDFPSHLIPSFEASTHLQEPVGKLLQSLSSQAKRVIVIHDS  129

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM  V QD  ++ N E Y F C  AFTT++F WE  GKP   P  A  +   PS EGCF 
Sbjct  130   LMASVAQDATNMPNVENYTFHCTCAFTTFAFFWEEMGKP---PLEAFRVPEFPSLEGCFP  186

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--TD  754
              +F +FI  Q      + G++ N+ R IE  +++L+   S     WA+GP NP+++   D
Sbjct  187   TQFIDFIVAQYELQKFNDGNIYNTSRAIEDPYLELLNLFSAGKKVWALGPFNPLTVEKKD  246

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             SI   RH  +EWLD+QE  SV+++SFG+TT+L +EQI E+  GLE+S QKFIWV+RD D+
Sbjct  247   SIGL-RHSCVEWLDKQEPSSVIYISFGTTTALRDEQIQEIATGLEQSKQKFIWVLRDADK  305

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+FD  EA +R E+PEG+EERV G G+VVR+WAPQ+EIL H S GGFMSHCGWNSC+ES
Sbjct  306   GDIFDGSEA-KRYELPEGFEERVEGMGLVVRDWAPQMEILSHGSTGGFMSHCGWNSCLES  364

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIA W MHSDQPRNA L+T+VLK+G+ + DW +RN  V   ++ + V++L+ + E
Sbjct  365   ITMGVPIATWAMHSDQPRNAVLVTDVLKVGLVVKDWDQRNALVSASDVEKAVRRLMETEE  424

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+E+R RA +L  ++   +  GGG   E+ SF+AHIT+
Sbjct  425   GDEIRERAVKLKNAIHRSMDEGGGSHMEMASFIAHITK  462



>gb|AAM09517.1|AF489877_1 putative glucosyltransferase [Phaseolus lunatus]
Length=462

 Score =   380 bits (976),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 237/466 (51%), Positives = 312/466 (67%), Gaps = 8/466 (2%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NG        VVVV++P PAQGHLNQ +HLS LI++H IPVHY    THIRQAT R H  
Sbjct  4     NGDNLADKNQVVVVLIPFPAQGHLNQLMHLSHLISSHNIPVHYVSTVTHIRQATLRHH--  61

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNPDA-STKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
                 + N+HFH   +P F SPPPNP+   T FPT L+P   A+ HLR P   L+++LS  
Sbjct  62    -KSIISNIHFHGFEVPPFVSPPPNPNNPETDFPTHLIPSLEASMHLREPVRKLLQSLSFQ  120

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              KRV+VI DS M  V QD  ++ N E Y F C  AF+ Y   W++ G+P V  EA   L 
Sbjct  121   AKRVIVIHDSPMASVAQDATNMPNVENYTFHCTCAFSVYVSFWDKMGRPSV--EAMHALK  178

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGP  730
              +PS EGCF  +F +F+  +R F   S G + N+ R I+A +IDL+         WA+GP
Sbjct  179   -IPSLEGCFPTQFLDFLIAKRDFLKLSDGIVYNTSRVIDADYIDLMEVIPGGKKVWALGP  237

Query  731   LNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
              NP+++    +  RH  +EWLD+QE +SV++VSFG+TT L  EQI ++  GLE+S QKFI
Sbjct  238   FNPLAVEKKGSKERHSCMEWLDKQEPNSVIYVSFGTTTPLKVEQIEQVATGLEQSKQKFI  297

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+RD D+GD+FD+ EA +R E+P G+EERV+  G+VVR+WAPQLEIL H S GGFMSHC
Sbjct  298   WVLRDADKGDIFDENEA-KRLELPNGFEERVKDMGLVVRDWAPQLEILSHSSTGGFMSHC  356

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSC+ESISMGVPIA WP HSDQPRNA LITEVLK+G+ + DW++RN  V    + + V
Sbjct  357   GWNSCLESISMGVPIATWPFHSDQPRNAALITEVLKVGLVVKDWSQRNSLVSGSVVEDAV  416

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++L+ + EG+EMR RA  L  ++ +    GG    E++SF+AHIT+
Sbjct  417   RRLMQTEEGDEMRERAGRLKNAIHKSTEEGGVSHTEMDSFIAHITK  462



>ref|XP_010672886.1| PREDICTED: zeatin O-xylosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   380 bits (976),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 315/452 (70%), Gaps = 6/452 (1%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LHLS LI ++G+PVHYAG+A+H RQA  R+HGWD  +   +HFH   +P
Sbjct  25    PFPAQGHLNQLLHLSNLITSYGLPVHYAGSASHNRQAKLRLHGWDSQSSSKVHFHDFQLP  84

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              + SPPPNPD S +FP  L P+F  + HLR+P N L+  LS + +R++VI D LM  VVQ
Sbjct  85    PYSSPPPNPDPSIQFPAHLQPLFDTSLHLRQPVNQLLHQLSTNFRRIIVIHDCLMASVVQ  144

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPE-AAGVLNHMPSPEGCFIPEFEEF  598
             DV  + NAE Y F  ISAFT++   W+R   PD   +  + +   +PS +GC   E   F
Sbjct  145   DVKLIPNAEAYAFIPISAFTSFFNSWDRI--PDKPFQLDSDIPKCIPSTDGCSTQEIANF  202

Query  599   IKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPVSLTDSINTNR  772
             I  QR      SG L N+   IE  +I+L+ K SK      +A+GPLNPV + +     +
Sbjct  203   IANQRKCLGFESGRLYNTSMVIEGRYIELLKKLSKKSEIKHFAVGPLNPVEIENKSEKQQ  262

Query  773   HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfdd  952
             H  L+WLD+Q KDSV++VSFGSTT++++EQI EL  GLE+S QKFIWV+R  D GDVF  
Sbjct  263   HMCLKWLDKQMKDSVIYVSFGSTTTMTDEQIMELATGLEKSEQKFIWVLRRADIGDVFKG  322

Query  953   gEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVP  1132
             GE  R+ ++PEGYEER+  RG+VVREWAPQLEIL HPS+GG+MSHCGWNSCMESIS+GVP
Sbjct  323   GE-DRKPQLPEGYEERMEDRGMVVREWAPQLEILAHPSIGGYMSHCGWNSCMESISIGVP  381

Query  1133  IAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrr  1312
             +AAWPMHSDQP+NA L+TEVL++G  + DW +  E V    I   +++L+AS EGEEMR+
Sbjct  382   MAAWPMHSDQPKNAILVTEVLRIGTLVRDWTQHAELVMSTTIENALRRLMASKEGEEMRK  441

Query  1313  raaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             RAAEL   ++  +A GG  R E++SF+++ITR
Sbjct  442   RAAELGDVVRASVAKGGASRLEIDSFISYITR  473



>ref|XP_010673138.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=466

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 229/460 (50%), Positives = 309/460 (67%), Gaps = 6/460 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLPAQ HLNQ LHLS +I ++G+PVH+AG+A+H RQ   R+HGWD  ++  + F
Sbjct  8     VAVVMVPLPAQSHLNQLLHLSHVITSYGLPVHFAGSASHNRQTKLRLHGWDAQSLAKIQF  67

Query  224   HHLSMPHFQSPPPNPDAS---TKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             H   +P + + P     S     FP    P+F A +HLR+P   L++ LS   KR+VVI 
Sbjct  68    HDFQLPPYDASPTPTSTSGHCIPFPAHFYPLFEAATHLRKPVFELLQQLSTKFKRIVVIH  127

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGC  574
             D ++  VVQDV  + NAE Y    ISAFT +   WE   +     ++  +   +PS EGC
Sbjct  128   DIVLASVVQDVKYIPNAESYSLIPISAFTLFLDFWESMPEKPFQLDSDVLPKCIPSHEGC  187

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESK-TGFQ-WAIGPLNPVSL  748
               PE + F+  Q  +    SG L N+ R IE  +++L+ K S   G + + +GP NPV +
Sbjct  188   TPPEIDNFVADQFQYLGLESGRLYNTSRPIEGKYVELLEKISTYDGIKHFVLGPFNPVEI  247

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                    RH+ LEWLD QE+ SV++VSFGS+TSLS EQI EL  GLE S QKF+WV+R+ 
Sbjct  248   KSISGKERHQCLEWLDEQEQKSVIYVSFGSSTSLSYEQIEELAVGLERSEQKFVWVLRNS  307

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D G++F +G+  R  ++PEGYEERV+ RG+VV++WAPQL+IL HPS+GGFMSHCGWNSC+
Sbjct  308   DTGNIFAEGQ-GRNPQLPEGYEERVKNRGIVVKDWAPQLDILAHPSIGGFMSHCGWNSCI  366

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGV IAAWPMHSDQPRNA L+T+VLK+GI + DWA R + V    I + VK L+ +
Sbjct  367   ESISMGVAIAAWPMHSDQPRNAVLVTDVLKIGILVRDWADRAQLVTSTTIEKTVKTLMDT  426

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EGE+MR+RAAEL ++++  +A GG    E+ SF+AHITR
Sbjct  427   EEGEKMRKRAAELGEAVQGSVAKGGAAHFEMNSFIAHITR  466



>ref|XP_007204339.1| hypothetical protein PRUPE_ppa005515mg [Prunus persica]
 gb|EMJ05538.1| hypothetical protein PRUPE_ppa005515mg [Prunus persica]
Length=457

 Score =   379 bits (972),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 316/458 (69%), Gaps = 9/458 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN-LHFHHL  232
             M+PLPAQGHLNQ LH SRL++A  IPVH+ G+ TH RQA  RVHGWD  +V N + FH  
Sbjct  1     MVPLPAQGHLNQLLHFSRLVSAQDIPVHFVGSPTHNRQAKLRVHGWDRASVSNNVQFHDF  60

Query  233   SMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGW  412
              +P F SPPPNP+A+ KFP+ L P F AT+HLR+P   L+R LS   +RV+VI DS+M  
Sbjct  61    QIPPFPSPPPNPNATNKFPSHLQPSFEATTHLRQPVADLLRQLSPKARRVIVIHDSMMAS  120

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVL--NHMPSPEGCFIPE  586
             V+QDV S+ N E Y F  +SAF  + +  E  G+P +  EA  V   +  PS E CF  E
Sbjct  121   VIQDVASIPNGESYTFHTVSAFALFLYLCEAIGRPAM-LEALHVEIPDDTPSLEDCFTNE  179

Query  587   FEEFIKMQRPFWDAS-SGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             F +FI  Q      + +G++ N+ R IE  ++D +         WA+GP NP ++  S N
Sbjct  180   FLDFIAAQYKCQKLNNAGNIYNTSRTIEGPYMDFLNMIGDHQKHWALGPFNPSTILKSGN  239

Query  764   TN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             +N   RH+ L+WLD+Q  +SV++VSFG+TT++ +EQI EL  GLE+S QKFIWV+RD D+
Sbjct  240   SNGGRRHRCLDWLDKQAPNSVIYVSFGTTTAMKDEQIAELAIGLEQSNQKFIWVLRDADK  299

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F + E  RRAE+P+GYEERV+GRG+VVR+WAPQLEIL H S G F+SHCGWNSCMES
Sbjct  300   GDLFSNEEE-RRAELPQGYEERVKGRGLVVRDWAPQLEILAHKSTGMFVSHCGWNSCMES  358

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQPRN  LIT +L++G+ + DWA R+E +    +  GV+K + S E
Sbjct  359   ITMGVPIAAWPMHSDQPRNTVLITRLLRVGVVMRDWAHRDEILTSLSVKNGVEKFMGSKE  418

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G E+R+RAA+L  +++  +  GG    E  SF+ HITR
Sbjct  419   GNEIRKRAADLGAAVRRSMVAGGASHMEFSSFIDHITR  456



>ref|XP_010024031.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   379 bits (974),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 226/466 (48%), Positives = 303/466 (65%), Gaps = 11/466 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+ ++G PVHY G+A+H  QA  R H     A  ++ F
Sbjct  19    VAVIMVPLPAQGHLNQLLELAHLVTSYGFPVHYVGSASHNHQAKLRFHVPALKAPGDIRF  78

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H    P F SP PNPD+S KFP+ L+P F ATS LR P  +LIR+LS + +RVVV+ DS+
Sbjct  79    HDFPTPPFLSPAPNPDSSHKFPSHLLPAFHATSSLRGPIASLIRSLSSELRRVVVVHDSM  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPE  568
             M  VVQD  S+ NAE Y F  +SAF  Y +  E TG    P+   +   +++   +P+  
Sbjct  139   MASVVQDAASVPNAETYIFHSVSAFALYWYTLEATGMGLPPEEDVDVTDLISSKGLPTLL  198

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
               F  EF +F+  Q  F + S G + N+CR +E  ++DL    + +G     WAIGP NP
Sbjct  199   DIFTDEFLKFMASQHEFMNLSLGSIYNTCRVVEGRYVDLFASATASGTPTKHWAIGPFNP  258

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + +  +  + H  L WLD+Q  +SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV
Sbjct  259   VKVPEKKSRKSAHVCLGWLDKQAPNSVIYVSFGTTTVLSDEQIREIAMGLERSGQKFIWV  318

Query  917   vrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  319   LREADKADIFSGGVEARKIELPQGFKETVEARDSGVVVRDWAPQLEILGHPATGGFLSHC  378

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ + D   +++ V    I   V
Sbjct  379   GWNSCMESISMGVPILAWPMHSDQPSNAVLITQVLKIGLMVQDCMSQDKVVKSSAIQGAV  438

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + L+AS +G+EMR+ AAEL  +++  +  GG  R EL+SF+ HI+R
Sbjct  439   EALMASEQGDEMRKSAAELGAAVRGSMDEGGVSRVELDSFITHISR  484



>ref|XP_007028693.1| UDP-glucosyltransferase, putative [Theobroma cacao]
 gb|EOY09195.1| UDP-glucosyltransferase, putative [Theobroma cacao]
Length=476

 Score =   379 bits (973),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 235/460 (51%), Positives = 314/460 (68%), Gaps = 8/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+++P P Q HLNQ L L  L+++H IPVHY  +  H RQ   R HG +   +  L F
Sbjct  20    VAVIVVPFPGQSHLNQLLQLCCLLSSHKIPVHYVCSNIHNRQVKLRAHGLNSSQISLLTF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L++P F SPPPNP A+TKFPT L P F A  HLR P  AL+  LS   +R+++I DS+
Sbjct  80    HDLAIPPFISPPPNPRATTKFPTHLQPSFEAYLHLRHPVGALVSELSQSAERIIIIHDSV  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCFI  580
             +  ++QD  S+ NAE+Y F+ IS FT +   WE  GKP  +  E A + N +PS +GCF 
Sbjct  140   IASIIQDAASIPNAEIYAFQSISPFTLFYNIWEARGKPFQLEAEVAEIQNKLPSLDGCFS  199

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTD  754
              EF  F+  Q  F +  +G+L N+CR I+  +I+L+ K   +    QWAIGPLNP+ + +
Sbjct  200   SEFVNFVTYQYQFMNFQAGELYNTCRLIDGTYINLLAKLQTNVNRKQWAIGPLNPLKIHE  259

Query  755   SIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
               N T RHK LEWLD+Q   SVL++ FGS+TS+ ++QI EL  GLE+S  KFIWV+RD D
Sbjct  260   QSNPTRRHKCLEWLDKQTPKSVLYICFGSSTSMPDDQINELAIGLEQSKTKFIWVLRDAD  319

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +GD+  +    R+ ++PE +E R    G+V+R+WAPQLEILGHPS GGFMSHCGWNSCME
Sbjct  320   KGDISTE---VRQLKLPEAFEARTERSGMVLRDWAPQLEILGHPSTGGFMSHCGWNSCME  376

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVPIAAWPMHSDQPRN  L+T+VL++G+ + D  R  ++V   +I E V++L+AS 
Sbjct  377   SISMGVPIAAWPMHSDQPRNTVLVTQVLQIGLVVKDRQRMEDKVTSSDIKEAVRRLMASK  436

Query  1292  egeemrrraaeLSQSLKEPIAVGGG-GRNELESFVAHITR  1408
             EGE MR+RA EL ++++E  A  GG  R ELESF+AHITR
Sbjct  437   EGETMRKRAEELGEAVREQSAAQGGVSRVELESFIAHITR  476



>gb|KCW90138.1| hypothetical protein EUGRSUZ_A02330, partial [Eucalyptus grandis]
Length=457

 Score =   378 bits (970),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 231/459 (50%), Positives = 291/459 (63%), Gaps = 19/459 (4%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHLNQ L L+ L+A++GI VHY G+A+H  QA  R H     +  ++ FH    P
Sbjct  8     PLPAQGHLNQLLELAYLVASYGISVHYVGSASHNHQAKLRSHILPSSSPSDICFHDFPTP  67

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
              F SP PNPD++ KFP+QL P F A S LR P   LIR+LS + +RVVV+ DSLMG VVQ
Sbjct  68    AFPSPAPNPDSTYKFPSQLQPAFDAASLLRGPVANLIRSLSSESRRVVVVHDSLMGSVVQ  127

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEG------CFIP  583
             D  S+ NAE Y F  +SAF  Y F WE TG      E    +  + S EG      CF  
Sbjct  128   DAASVPNAENYVFHSVSAFALYWFTWEATGMVLPQEEEEVDIAELVSAEGFPSIRVCFTD  187

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLTD  754
             EF +FI  Q  F   SSG + N+CR +E  ++DL    +        WAIGP        
Sbjct  188   EFLKFIASQHEFKKLSSGCIFNTCRVVEGRYVDLYASATANSIATKHWAIGPS-------  240

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                 + H   EWLD+Q   SV++VSFG+TT+LSNEQI E+  GLE SGQKFIWV+R+ D+
Sbjct  241   --RRSAHACTEWLDKQASSSVIYVSFGTTTALSNEQIREIAIGLESSGQKFIWVLREADK  298

Query  935   gdvfddgEAARRAe-vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             GD+F  GEA +             R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNSCME
Sbjct  299   GDIFRGGEARKMELPQGFEEMVGTRDIGVVVRDWAPQLEILGHPATGGFLSHCGWNSCME  358

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVPI AWPMHSDQPRNA LIT VLK+G+ + D   +N+ V    I + VK L+AS 
Sbjct  359   SISMGVPILAWPMHSDQPRNAILITGVLKIGLIVTDCMSQNKVVKSPAIQDAVKALMASE  418

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +G+EMR++AAEL  +++  +  GG  R EL+SF+ HI+R
Sbjct  419   QGDEMRKKAAELGIAVRGSMDKGGVSRAELDSFITHISR  457



>sp|Q9ZSK5.1|ZOG_PHALU RecName: Full=Zeatin O-glucosyltransferase; AltName: Full=Trans-zeatin 
O-beta-D-glucosyltransferase [Phaseolus lunatus]
 gb|AAD04166.1| zeatin O-glucosyltransferase [Phaseolus lunatus]
Length=459

 Score =   377 bits (969),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 316/464 (68%), Gaps = 21/464 (5%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             +  VVV+++P PAQGHLNQFLHLSRLI A  IPVHY G  THIRQAT R +  +P +  N
Sbjct  11    ETKVVVLLIPFPAQGHLNQFLHLSRLIVAQNIPVHYVGTVTHIRQATLRYN--NPTS--N  66

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HFH   +P F SPPPNP+    FP+ L+P F A++HLR P   L+++LS   KRVVVI+
Sbjct  67    IHFHAFQVPPFVSPPPNPE--DDFPSHLIPSFEASAHLREPVGKLLQSLSSQAKRVVVIN  124

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG----PEAAGVLNHMPS  562
             DSLM  V QD  ++ N E Y F   SAF T    WE  GKP VG    PE        PS
Sbjct  125   DSLMASVAQDAANISNVENYTFHSFSAFNTSGDFWEEMGKPPVGDFHFPE-------FPS  177

Query  563   PEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPV  742
              EGC   +F+ F   Q  F   ++GD+ N+ R IE  +++L+   +     WA+GP NP+
Sbjct  178   LEGCIAAQFKGFRTAQYEFRKFNNGDIYNTSRVIEGPYVELLELFNGGKKVWALGPFNPL  237

Query  743   SL--TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             ++   DSI   RH  +EWLD+QE  SV+++SFG+TT+L +EQI ++  GLE+S QKFIWV
Sbjct  238   AVEKKDSIGF-RHPCMEWLDKQEPSSVIYISFGTTTALRDEQIQQIATGLEQSKQKFIWV  296

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
             +R+ D+GD+F   EA +R E+P+G+EERV G G+VVR+WAPQLEIL H S GGFMSHCGW
Sbjct  297   LREADKGDIFAGSEA-KRYELPKGFEERVEGMGLVVRDWAPQLEILSHSSTGGFMSHCGW  355

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NSC+ESI+MGVPIA WPMHSDQPRNA L+TEVLK+G+ + DWA+RN  V    +  GV++
Sbjct  356   NSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGVRR  415

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             L+ + EG+EMR+RA  L  ++   +  GG    E+ SF+AHI++
Sbjct  416   LMETKEGDEMRQRAVRLKNAIHRSMDEGGVSHMEMGSFIAHISK  459



>ref|XP_006355036.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=511

 Score =   379 bits (973),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 294/457 (64%), Gaps = 7/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+P PAQGHLNQ L LS LI+++G+PV+Y  +ATH RQA  R +  +P  +  +HF
Sbjct  60    VTIVMVPFPAQGHLNQLLQLSCLISSYGLPVYYVCSATHNRQARIRANALNPSDIAKVHF  119

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P F SP P+ +A +KFP+ L P + A+  LR P  + +RN+S   KRV+V+ D L
Sbjct  120   HDLPTPEFDSPSPDFNALSKFPSHLQPSWDASMLLREPIASFLRNISSKAKRVIVVHDLL  179

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + VQDV SL N E Y F CIS FT++       G      E   +L  +PS EG    
Sbjct  180   MSYNVQDVSSLPNVESYVFNCISVFTSFCLQRLSCGMSVQHKEE--LLKKLPSLEGIATD  237

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTDS  757
             E  +F   QR + D  SGD+ N+ + IE  F+DL+ +    +    WAIGP+ P  L D 
Sbjct  238   EARDFSASQRRYMDIRSGDIYNTSKVIEGKFLDLLAQVASDQNKKNWAIGPVLPTKL-DR  296

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
             I+   +  L+WL++Q   SVL+VSFG+TTS SN +I EL  GLE+S Q+FIW     D  
Sbjct  297   ISNRENICLDWLNKQPPRSVLYVSFGTTTSFSNREIKELAMGLEQSKQRFIW--VLRDAD  354

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
                   E AR+ E+PEG+EERV+G G+VVREWAPQ EIL H S GGFMSHCGWNSCMESI
Sbjct  355   RGDIFTEEARKVELPEGFEERVKGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCMESI  414

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWPMHSDQP N  L+TEVLK+G+ + +W +R E V    I   V+KL+AS EG
Sbjct  415   TMGVPIAAWPMHSDQPMNGFLVTEVLKIGLIVREWEKREELVNASTIENVVRKLMASEEG  474

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +R+RA E  +++++    GG  R E +SF+AHITR
Sbjct  475   NVIRKRAEEFGEAVRQSTEKGGSSRMEFDSFIAHITR  511



>gb|AAM09516.1|AF489876_1 putative glucosyltransferase [Phaseolus lunatus]
Length=462

 Score =   377 bits (968),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 312/458 (68%), Gaps = 12/458 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVV+ P PAQGHLNQF+HLS LI++H IPVHY    THIRQAT R H     ++  +HF
Sbjct  14    VVVVLTPFPAQGHLNQFMHLSLLISSHDIPVHYVSTVTHIRQATLRHHK----SISTIHF  69

Query  224   HHLSMPHFQSPPPNPDA-STKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F SPPPNP+   T FP+ L+P F A++HLR P   L+++LS   KRV+VI DS
Sbjct  70    HAFEVPPFVSPPPNPNNPETDFPSHLIPSFEASTHLREPVGKLLQSLSSQAKRVIVIHDS  129

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM  V QD  ++ N E Y F C  AFTT++F WE  GKP   P  A  +   P  EGCF 
Sbjct  130   LMASVAQDATNMPNVENYTFHCTCAFTTFAFFWEEMGKP---PLEAFRVPEFPLLEGCFP  186

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--TD  754
              +F +FI  Q      + G++ N+ R IE  +++L+   S     WA+GP NP+++   D
Sbjct  187   TQFIDFIVAQYELQKFNDGNIYNTSRVIEDPYLELLDLFSAGKKVWALGPFNPLTVEKKD  246

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             SI   RH  +EWLD+QE  SV+++SFG+TT+L +EQI ++  GLE+S QKFIWV+RD D+
Sbjct  247   SIGF-RHSCMEWLDKQEPSSVIYISFGTTTALRDEQIQQIATGLEQSKQKFIWVLRDADK  305

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+FD  EA +R E+P+G+EERV G G+V+R+WAPQLEIL H S GGFMSHCGWNSC+ES
Sbjct  306   GDIFDGSEA-KRYELPKGFEERVEGMGLVLRDWAPQLEILSHSSTGGFMSHCGWNSCLES  364

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             ISMGVPIA WPMHSDQPRNA L+TEVLK+G+ + DW +RN  V   ++ + V++L+ + E
Sbjct  365   ISMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWDQRNALVTASDVEKAVRRLMETKE  424

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+E+R RA  L   +   +   G    E+ SF+AHIT+
Sbjct  425   GDEIRERAVGLKNVIHRSMDESGVSHMEMGSFIAHITK  462



>ref|XP_007140338.1| hypothetical protein PHAVU_008G103900g [Phaseolus vulgaris]
 gb|ABS29019.1| family 1 glycosyltransferase [Phaseolus vulgaris]
 gb|ESW12332.1| hypothetical protein PHAVU_008G103900g [Phaseolus vulgaris]
Length=464

 Score =   377 bits (967),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 232/472 (49%), Positives = 310/472 (66%), Gaps = 18/472 (4%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NGT   A+  V+V+++P  AQGHLN  LH +RLIA+H IPVHY G  THIRQAT R H  
Sbjct  4     NGTLENAETEVLVILIPFLAQGHLNPLLHFARLIASHNIPVHYVGTITHIRQATLRYH--  61

Query  194   DPLAVPNLHFHHLSMPHFQSPPPN----PDASTKFPTQLMPVFFATSHLRRPFNALIRNL  361
             + ++  N+HFH   +P F SPPPN      ++T FP+ L+P F AT HLR PF  L+++L
Sbjct  62    NSISNSNIHFHRFEVPPFVSPPPNPNNNAQSNTFFPSHLLPSFEATYHLRDPFRQLLQSL  121

Query  362   SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAG  541
             S   KRV+VI DSLM +V QD  ++ N E Y F   SAF T    WE+  +P        
Sbjct  122   SSQAKRVLVIHDSLMAYVAQDATNMPNVENYTFLSSSAFYTSLLFWEKMERPQCL-----  176

Query  542   VLNHMPSP--EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ  715
                H+P P  EGCF  +F +F+  QR F   S G + N+ R IE   I+ +         
Sbjct  177   ---HVPVPSLEGCFPSQFMDFVSAQREFHKFSDGSIYNTSRAIEGASIEFLEGVGGGKKV  233

Query  716   WAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             WA+GP NP+++    +   RH  LEWLD+QE +SV++VSFG+TT+L+ EQI E+ +GLE+
Sbjct  234   WALGPFNPLAVEKKDSDGIRHSCLEWLDKQEANSVIYVSFGTTTTLTEEQIQEIASGLEQ  293

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             S QKFIWV+RD D+GD+FD   AA+R E+P G+EERV G G+VVR+WAPQLEIL H S G
Sbjct  294   SKQKFIWVLRDADKGDIFDC-SAAKRHELPTGFEERVEGMGLVVRDWAPQLEILNHSSTG  352

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             GFMSHCGWNSC+E+++MGVPIAAWP HSDQPRN  L+T+VLK+G+ + DWA+RN  V   
Sbjct  353   GFMSHCGWNSCLEALTMGVPIAAWPFHSDQPRNTILMTQVLKVGLVVKDWAQRNVVVSAS  412

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              +   V++L+ + EG+EMR RA      +   +  GG    E++ F+AHIT+
Sbjct  413   VVENAVRRLMETKEGDEMRDRAMRFKNVIHSSMGEGGVTSTEIDFFIAHITK  464



>ref|XP_003537252.1| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=461

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 232/459 (51%), Positives = 312/459 (68%), Gaps = 17/459 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VV V++P  AQGHLNQ LHLSRLI +H I VHY   ATHIRQAT R    D  ++ N+HF
Sbjct  14    VVAVLIPFAAQGHLNQLLHLSRLILSHNIAVHYVCTATHIRQATLR----DKNSISNIHF  69

Query  224   HHLSMPHFQSPPPNPDAS-TKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F SPPPNP+   T FP+ L+P F A+SHLR P   L+++LS   KRV+VI D+
Sbjct  70    HGFEVPPFASPPPNPNNEETDFPSHLIPSFEASSHLREPVRNLLQSLSSQAKRVIVIHDA  129

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG----PEAAGVLNHMPSPE  568
              M  V QD  ++ N E Y F+   AFTT+ + W++ G+P V     PE       +PS E
Sbjct  130   AMASVAQDATNMPNVENYTFQITCAFTTFVYLWDKMGRPSVEGLHVPE-------IPSME  182

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GCF P+F +FI  QR F   S G + N+ R IE  +I+ + + S     WA+GP NP+++
Sbjct  183   GCFTPQFMDFIIAQRDFDKFSDGYIYNTSRAIEGAYIESMERISGGKKIWALGPFNPLAI  242

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
                 +  RH  +EWLD+Q+ +SV++VSFG+TTS   +QI ++  GLE+S QKFIWV+RD 
Sbjct  243   EKKESKGRHLCMEWLDKQDPNSVIYVSFGTTTSFKEDQIEQIATGLEQSKQKFIWVLRDA  302

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+FD  E  +R E+P G+EER++G G++VR+WAPQLEIL H S GGFMSHCGWNSC+
Sbjct  303   DKGDIFDGNET-KRYELPNGFEERIKGIGLIVRDWAPQLEILSHTSTGGFMSHCGWNSCL  361

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESI+MGVPIA+WPMHSDQPRN  LIT+VLK+G+ + DWA+RN  V    + + V++LI +
Sbjct  362   ESITMGVPIASWPMHSDQPRNTVLITQVLKVGLVVKDWAQRNALVTASVVEKVVRRLIET  421

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
              EG+E+R+RA  L  ++      GG    E+ESF+AHIT
Sbjct  422   EEGDEIRQRAVRLKNAIHRSKDEGGVSHLEMESFIAHIT  460



>ref|XP_003519079.1| PREDICTED: zeatin O-glucosyltransferase-like [Glycine max]
Length=458

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 226/452 (50%), Positives = 299/452 (66%), Gaps = 9/452 (2%)
 Frame = +2

Query  50    VVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHH  229
             VV++P PAQGHLNQ LHLSR I +H IPVHY G ATHIRQAT R H     ++ N+HFHH
Sbjct  13    VVLIPFPAQGHLNQLLHLSRHILSHNIPVHYVGTATHIRQATVRDHN----SISNIHFHH  68

Query  230   LSMPHFQSPPPNPDA-STKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLM  406
               +P F SPPPNP+   T FP  L+P F A+SHLR P   L+++LS   KRV+VI DSLM
Sbjct  69    FEVPPFVSPPPNPNNPETDFPCHLLPSFEASSHLREPVRNLLQSLSSQAKRVIVIHDSLM  128

Query  407   GWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPE  586
               V QD  ++ N E Y F    AFTT+ ++WE  G+P V       ++ +PS EGCF P+
Sbjct  129   ASVAQDATNMPNVENYTFHSTCAFTTFVYYWEVMGRPSV---EGFQVSEIPSLEGCFPPQ  185

Query  587   FEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINT  766
             F +FI  Q  F   + G++ N+ R IE  +I+ + +   +    A+GP NP+++    + 
Sbjct  186   FIDFITAQYEFHQFNDGNIYNTSRAIEGPYIEFLERIGGSKKICALGPFNPLAIEKKDSK  245

Query  767   NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvf  946
              RH  LEWL +QE +SV++VSFG+TTSL+ EQI E+  GLE+S QKFIW V         
Sbjct  246   TRHTCLEWLHKQEPNSVMYVSFGTTTSLTVEQIEEIATGLEQSKQKFIW-VLRDADKGDI  304

Query  947   ddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMG  1126
              DG   +  E+P G+EERV+G G++VR+WAPQLEIL H S GGFMSHCGWNSC+ESI+MG
Sbjct  305   FDGNGTKWYELPNGFEERVKGIGLIVRDWAPQLEILSHTSTGGFMSHCGWNSCLESITMG  364

Query  1127  VPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeem  1306
             VPI AWP+HSDQPRN+ LITEVLK+G+ + DWA+RN  V    +   V++L+ + EG++M
Sbjct  365   VPILAWPVHSDQPRNSVLITEVLKVGLVVKDWAQRNVLVSASVVENAVRRLMKTKEGDDM  424

Query  1307  rrraaeLSQSLKEPIAVGGGGRNELESFVAHI  1402
             R RA  L  ++      GG  R E+ SF+ HI
Sbjct  425   RDRAVRLKNAIHRSKDEGGVSRMEMSSFIDHI  456



>ref|XP_010673140.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   375 bits (964),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 235/470 (50%), Positives = 309/470 (66%), Gaps = 7/470 (1%)
 Frame = +2

Query  11    ENGTKGGAD-VGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVH  187
             +NG + G +   V VVM+P PAQGHLNQ LHLS LI ++ IPV+Y G+AT   QA  R+H
Sbjct  8     KNGNQNGLEHPQVAVVMVPFPAQGHLNQLLHLSHLIISYNIPVYYPGSATDNHQAKLRLH  67

Query  188   GWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSV  367
             GWD   +  +HFH   +P + SPPPNPD S  FP +L P+F A+ HLR+P + L++ LS 
Sbjct  68    GWDTEILDKIHFHDFQLPIYSSPPPNPDPSILFPRELEPLFDASKHLRQPVSLLLQGLST  127

Query  368   DQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEA-AGV  544
               KR+VVI DSLM +V+QDV  +QNAE Y FR  SA + +   WE  G P+   +    +
Sbjct  128   KFKRIVVIFDSLMAYVIQDVKLIQNAESYAFRPFSALSIFLNIWE--GIPEKPFQLDLEI  185

Query  545   LNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKT--GFQW  718
                +PS EGC  P    FI          +G L N+ R IE  +++L+ K SK      +
Sbjct  186   PRCIPSNEGCLTPLVFSFIANLHKLLGFQAGMLYNTSRLIEGRYVELLQKLSKNAEAKHF  245

Query  719   AIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             A+GPLNPV        +RH  L WLD+QE  SV+++SFGSTTS+++EQITEL  GLE S 
Sbjct  246   AVGPLNPVETKSKSEKDRHTCLLWLDKQEVGSVIYISFGSTTSMTDEQITELALGLERSR  305

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
             QKFIWV+R  D  D     E  R  ++PE YEERV+ RG+V+R+WAPQL+IL HPS GGF
Sbjct  306   QKFIWVLRRADTADALRGTE-VRNPQLPEVYEERVKDRGIVIRDWAPQLQILAHPSTGGF  364

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             MSHCGWNSCMESISMGVP+AAWPMHSDQPRNA L+TEVL++G  + DW  R + V    I
Sbjct  365   MSHCGWNSCMESISMGVPMAAWPMHSDQPRNAVLVTEVLRIGTLVRDWTDRAKLVMSTTI  424

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                +++L+AS EG+ M+ RA EL  +++  +   G  R E++SF++HITR
Sbjct  425   ENVLRRLLASEEGKAMQERAIELGDAVRASVGKDGVSRLEMDSFMSHITR  474



>ref|XP_007162168.1| hypothetical protein PHAVU_001G129900g [Phaseolus vulgaris]
 gb|ESW34162.1| hypothetical protein PHAVU_001G129900g [Phaseolus vulgaris]
Length=484

 Score =   375 bits (963),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 296/446 (66%), Gaps = 3/446 (1%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQ  250
             AQGHLNQ LHLSRLI AH IP+H+ G+ TH RQ   R  GWDP +  ++H H L++  F 
Sbjct  42    AQGHLNQLLHLSRLILAHNIPLHFVGSPTHNRQVIGRAQGWDPKSFSHIHIHDLNVSPFV  101

Query  251   SPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVP  430
             SPPPNP+A +KFP+ L+P F A++ LR P  AL+++LS+  KRVVVI DSLM  VVQD  
Sbjct  102   SPPPNPNAPSKFPSHLIPSFEASASLRGPVFALLQSLSLVAKRVVVIYDSLMASVVQDAT  161

Query  431   SLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQ  610
              L N E Y F  +SAFT + + W+  G+P V    + ++  +PS EGCF  +F +FI  Q
Sbjct  162   HLSNCETYTFHSVSAFTMFLYFWDVMGRPPVN-RMSLLVPEVPSLEGCFTTQFLDFIASQ  220

Query  611   RPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTNRHKSLEW  790
               F   S G + N+ R IE  +++LI +       WA+GP NP+S+ +     +H  +EW
Sbjct  221   YVFHKFSKGIIYNTTRAIEGPYMELIERIMSRKTHWALGPFNPLSI-EKDEKGKHFCIEW  279

Query  791   LDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARR  970
             LDRQE  SV++VSFG+TT  S EQI E+  GLE+S QKF+W V          + +   +
Sbjct  280   LDRQEARSVMYVSFGTTTCFSEEQIKEVANGLEKSKQKFVW-VVRDADKGDVFNHDGGSQ  338

Query  971   AevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPM  1150
               +P+G+EERV+G G+VVREWAPQLEIL H S GGFMSHCGWNSCMESIS GVPIAAWPM
Sbjct  339   LVLPKGFEERVKGIGLVVREWAPQLEILSHSSTGGFMSHCGWNSCMESISTGVPIAAWPM  398

Query  1151  HSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLS  1330
             HSDQPRN  L+TEVLK+G+ + +W  R+E V   ++   V+KL+A+ EG EMR RA EL 
Sbjct  399   HSDQPRNRVLVTEVLKVGVVVKEWEHRDELVTASDVENAVRKLMATKEGNEMRERAMELK  458

Query  1331  QSLKEPIAVGGGGRNELESFVAHITR  1408
               + +    GG  R E + F+AH+TR
Sbjct  459   NVILKSRDEGGASRMEFDDFIAHVTR  484



>gb|EPS57763.1| hypothetical protein M569_17054, partial [Genlisea aurea]
Length=460

 Score =   374 bits (961),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 299/456 (66%), Gaps = 5/456 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAH-GIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V VVM+PL AQGHLNQ LHL+RLI+   GI VH+   +TH RQAT R+  W+P     +H
Sbjct  8     VAVVMVPLAAQGHLNQLLHLARLISGRRGISVHFIATSTHCRQATSRIQDWNPANSAAVH  67

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISD  397
             FH + +P  ++PPPNPD+  KFP+Q++P+   AT +LR+P + L  +LS   KRVV++ D
Sbjct  68    FHEVDVPLAENPPPNPDSVYKFPSQVIPIIKSATVNLRKPIHDLALSLSSAHKRVVIVYD  127

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             S   + VQD  S+ N E Y F+  +AFT ++F+WE  G+P++ PEA  V   +PS EGCF
Sbjct  128   SATAYSVQDAESVPNTEFYCFQSTAAFTMFAFNWEFAGRPELPPEAE-VFKEVPSAEGCF  186

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDS  757
             +PEFEE I          SG + NS R IE  ++DL   +      WA GP +       
Sbjct  187   VPEFEELIAFGNETKILKSGYIYNSSRIIEGFYLDLRLGDGIDKI-WAFGPFHRTPENPP  245

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                  +  L+WLD Q  +SV+F+SFG+T SLS+EQI E+  GLE S QKFIWV+RD DR 
Sbjct  246   ETGRENDCLKWLDEQSPNSVIFISFGTTVSLSDEQIQEIATGLERSHQKFIWVLRDADRA  305

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+F  GE  RR E+P  +EERV GRG V+R+WAPQ  IL HPS GGFM+HCGWNS +ESI
Sbjct  306   DIFSGGEV-RRPELPPNFEERVGGRGRVIRDWAPQPAILDHPSTGGFMTHCGWNSFLESI  364

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             S GVP+A WPMHSDQP+NA LIT+VLK+G+ + DW R  E V    +   V+ L+ S EG
Sbjct  365   SAGVPMATWPMHSDQPKNAALITKVLKVGVEVKDWRRWKEIVTAETVENSVRVLMGSEEG  424

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             + MR+RAA + ++L+E +   G    EL+SF+ HIT
Sbjct  425   DAMRKRAAVMGKALRESVKENGSSAMELDSFLEHIT  460



>gb|EYU20762.1| hypothetical protein MIMGU_mgv1a027163mg, partial [Erythranthe 
guttata]
Length=465

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 316/458 (69%), Gaps = 9/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+P PAQGHLNQ + LS LI+++ IPV+Y G+A H RQA  R++G     V  + F
Sbjct  6     VAVIMVPFPAQGHLNQLMQLSCLISSYSIPVYYVGSAIHNRQAKVRINGLSNDDVEKIQF  65

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H +  P F SPPP+P++  KFP QL P++ A+  LR P  A ++N++   +RV+++ DSL
Sbjct  66    HDIPTPSFASPPPDPNSPNKFPAQLQPMWDASLSLREPVAAYLQNMAKKFQRVIIVHDSL  125

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQDV  + NAE Y F C+SAF+   F W+  GK    P        +PS EGC   
Sbjct  126   MAVVVQDVSWIPNAESYVFNCVSAFSIAGFTWDHLGK----PLPTEFPKELPSLEGCVTD  181

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             E + F  +Q       +GDL N+CR IE  F++L+ +E   G +  WAIGP+ P  L+ +
Sbjct  182   EIQYFWALQSEPLSYRAGDLYNTCRLIEPAFMELLEREEIAGSRKSWAIGPILPAKLSSA  241

Query  758   INT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               + +R++ LEWLD+QE +SV++VSFG+TTSLS+EQI EL  GLE+S  KF+WV+RD D+
Sbjct  242   NQSESRNRCLEWLDKQEPNSVIYVSFGTTTSLSDEQIKELAFGLEQSKVKFLWVLRDADK  301

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+FD     RRAE+P+G+EERV G G+VVREWAPQ +IL HPS GGF+SHCGWNSC+ES
Sbjct  302   GDIFDGQ--VRRAELPDGFEERVEGLGMVVREWAPQPQILAHPSTGGFVSHCGWNSCIES  359

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQP N+ LITE+LKMG+ + +WA+R E V    I   +K L+ S E
Sbjct  360   ITMGVPIAAWPMHSDQPSNSVLITEILKMGLIVREWAQRFEIVKASTIENVLKTLMTSKE  419

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+E+R++A EL+ +++     GG  R EL+SF+AHITR
Sbjct  420   GDEIRKKAEELAATVQHATQQGGASRLELDSFIAHITR  457



>ref|XP_009624070.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=479

 Score =   374 bits (959),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 229/480 (48%), Positives = 302/480 (63%), Gaps = 28/480 (6%)
 Frame = +2

Query  11    ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
             +N TK   D  V++VM+P PAQGHLNQ LHLSRL++++ +PVHY   +T IRQA  RVHG
Sbjct  13    QNCTK---DQDVLIVMVPFPAQGHLNQLLHLSRLVSSYHLPVHYVSFSTSIRQAKFRVHG  69

Query  191   WDPL--AVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLS  364
             WDP+    PN+HF    +P      PN    +KF    + +      LR P +A +  LS
Sbjct  70    WDPITNTTPNIHFKEFPIPSTHVQSPNCSNMSKFIASTLDLSLT---LREPISAFLNELS  126

Query  365   VDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAG-  541
                +R+V+I DSLM WVVQDV S+ N E Y FR +SAFTT S  WE   K    P+  G 
Sbjct  127   STTRRMVIIYDSLMAWVVQDVVSIPNVEAYCFRAVSAFTTSSILWEGIEKFFHLPKFLGK  186

Query  542   --------VLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE  697
                     +   +PS E  F  E   FI MQ    +  SG+L ++C+ IE  F++ + K 
Sbjct  187   FIATKLLKIPQQLPSLESSFTQELLHFIFMQDRHHNICSGNLFDTCKVIEGSFLESLEKL  246

Query  698   SKT---GFQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQIT  868
              +    G QWAIGP NP+ +    + N HK L+WLD+QE +SV+ VSFG+T+SLS+EQI 
Sbjct  247   HRLLRRGNQWAIGPFNPIKIQKD-SKNCHKCLKWLDKQEPNSVILVSFGTTSSLSSEQIK  305

Query  869   ELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLE  1048
             EL  GLE+S QKFIWVVRD   G             +P GYEER+ GRG+V+++WAPQ E
Sbjct  306   ELAIGLEKSNQKFIWVVRDVLLG-------EGEEVNIPNGYEERIEGRGIVIKDWAPQFE  358

Query  1049  ILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWAR  1228
             IL H S GGF+SHCGWNSCMESI+MGVPIA WPM  DQPRNA L+T VLK+GI + DW  
Sbjct  359   ILAHSSTGGFLSHCGWNSCMESITMGVPIATWPMSFDQPRNAVLVTNVLKIGIVVKDWEH  418

Query  1229  RNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               + V   +I   V+KL+AS EG+EMR+RA E  + ++E +  GG  R E++SF++++TR
Sbjct  419   CEDLVTSTKIENAVRKLMASQEGDEMRKRAMEFGKKVRESMMDGGVSRMEMDSFISYVTR  478



>ref|XP_007145588.1| hypothetical protein PHAVU_007G251200g [Phaseolus vulgaris]
 gb|ESW17582.1| hypothetical protein PHAVU_007G251200g [Phaseolus vulgaris]
Length=461

 Score =   373 bits (957),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 235/456 (52%), Positives = 311/456 (68%), Gaps = 9/456 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             VVVV++P PAQGHLNQ LHLS LI+ H IPVHY    THIRQAT R H        N+HF
Sbjct  14    VVVVLIPFPAQGHLNQLLHLSHLISPHNIPVHYVSTVTHIRQATLRHH---KSIHSNIHF  70

Query  224   HHLSMPHFQSPPPNPDA-STKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H   +P F SPPPNP+   T FP  L+P   A+ HLR P   L+++LS + KRV+VI DS
Sbjct  71    HGFEVPPFVSPPPNPNNPETDFPCHLIPSLKASMHLRDPVRELLQSLSSEAKRVIVIHDS  130

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
              M  V QD  ++ N E Y F C  AF+ Y  +W+R G+P V  EA   L  +PS EGCF 
Sbjct  131   PMASVAQDATNMANVENYTFHCTCAFSVYLAYWDRMGRPSV--EAMHALK-IPSLEGCFP  187

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSI  760
              +F +F + Q      S G + N+ R IE  +I+L+   +     WA+GP NP+++    
Sbjct  188   TQFLDF-RAQSELLKLSDGIVYNTSRVIEGDYIELMKAITGGKKIWALGPFNPLAVEKKG  246

Query  761   NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             +  RH  +EWLD+QE +SV+++SFG+TT+L +EQI E+  GLE+S QKFIWV+RD D+GD
Sbjct  247   SKERHSCVEWLDKQEPNSVIYISFGTTTALRDEQIQEIATGLEQSKQKFIWVLRDADKGD  306

Query  941   vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESIS  1120
             +FD GEA +R E+P G+EERV+  G+VVR+WAPQLEIL H S GGF+SHCGWNSC+ESI+
Sbjct  307   IFDGGEA-KRYELPNGFEERVKEMGLVVRDWAPQLEILSHSSTGGFLSHCGWNSCLESIT  365

Query  1121  MGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaege  1300
             MGVPIA WP HSDQPRNATLITEVLK+G+ + DW++RN  V    + +GV++L+ + EG+
Sbjct  366   MGVPIATWPFHSDQPRNATLITEVLKVGLVVKDWSQRNSLVSGSVVEDGVRRLMQTEEGD  425

Query  1301  emrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EMR RA  L + + +    GG    E++SF+AHIT+
Sbjct  426   EMRERAERLKRVIHKSTEEGGVSHMEMDSFIAHITK  461



>ref|XP_009766031.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=472

 Score =   373 bits (958),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 299/458 (65%), Gaps = 9/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V ++M+P PAQGHLNQ L LS LI+++G+PV+Y G+ATH RQA  R +  +P  +  +HF
Sbjct  21    VAIIMVPFPAQGHLNQLLQLSCLISSYGLPVYYVGSATHNRQARIRANALNPSDIAQIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P F SP P+ ++S+KFP  L P + A   LR P  +  RN+S   +RVVV+ DSL
Sbjct  81    HDLPTPEFASPKPDFNSSSKFPAHLQPSWDACMLLREPIASFFRNISSISRRVVVVHDSL  140

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + VQDV    N E Y F CIS FT Y       G      +   +L  +PS EG    
Sbjct  141   MSYNVQDVSCFPNVESYVFNCISVFTLYCLICITRGMSIQLEDE--LLKKLPSLEGIMTD  198

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFID---LIGKESKTGFQWAIGPLNPVSLTD  754
             E  EF   Q+P+ +  SGD+ N+ + IE  F+D   L+  E K   QWAIGP+ P  L D
Sbjct  199   EVREFGASQKPYMEIRSGDIHNTSKVIEGKFLDLLTLVTSEQKKK-QWAIGPILPTKL-D  256

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              I+   +  L+WL +Q   SVL+VSFG+TTS S  +I EL  GLE+S QKFIWV+RD DR
Sbjct  257   HISNRNNICLDWLKKQPPRSVLYVSFGTTTSFSYREIKELAMGLEQSKQKFIWVLRDADR  316

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F     AR+ E+PEG+EERV+  G+VVR WAPQ EIL H S GGFMSHCGWNSC+ES
Sbjct  317   GDIFTG--EARKVELPEGFEERVKEVGLVVRYWAPQPEILAHSSTGGFMSHCGWNSCIES  374

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQP+N  L+TE+LK G+ + +W +R E V    I   V+KL+AS E
Sbjct  375   ITMGVPIAAWPMHSDQPKNGFLVTEILKTGMLVREWGKRGELVTASTIQNVVRKLMASEE  434

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+ +R+RA EL ++++     GG  R EL++F+AHITR
Sbjct  435   GDVIRKRAEELGEAVRRSTEKGGASRKELDAFIAHITR  472



>ref|XP_011078914.1| PREDICTED: zeatin O-xylosyltransferase-like [Sesamum indicum]
Length=468

 Score =   372 bits (956),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 242/457 (53%), Positives = 316/457 (69%), Gaps = 10/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PL AQGHLNQ + LS LI+++G+PV Y  +A HIRQA  RV+G +PL V  +HF
Sbjct  20    VAVIMVPLAAQGHLNQMMQLSCLISSYGLPVFYISSAIHIRQARVRVNGLNPLDVAKIHF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H + +P F SPPP+P++S+KFP QL P + A+  LR+PF A ++ +S   KRVVV+ D L
Sbjct  80    HEIPVPPFASPPPDPNSSSKFPEQLQPAWNASLSLRQPFAAYLQEMSEKFKRVVVVHDFL  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQDV S+ NAE Y F CI AF+   F  E      V   +A  L  + S +GC   
Sbjct  140   MAAVVQDVISIHNAESYAFNCIPAFSQAFFIGE-----GVLDSSAERLKELHSLQGCIPE  194

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             +  EF+ +        +GDL N+CR IEA ++DL+ KE   G +  WAIGP+ P  L+ S
Sbjct  195   KMLEFVAIHAEPLRYRAGDLFNTCRLIEAPYLDLLEKEESGGNRKTWAIGPIVPTKLS-S  253

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                  +K LEWLD+QE  SV++VSFG+T SLS+EQI EL  GLE+S  KF+WV+RD D+G
Sbjct  254   AAKPANKCLEWLDQQEPKSVIYVSFGTTVSLSDEQIKELALGLEQSKVKFLWVLRDADKG  313

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+FD     RRAE+PEG+EERV+  G VVR+WAPQ EIL H S GGFMSHCGWNSC+ESI
Sbjct  314   DIFDGQ--VRRAELPEGFEERVKEVGKVVRDWAPQPEILAHKSTGGFMSHCGWNSCIESI  371

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWPMHSDQPRN   +T+VLKMGI +++W +R E V    I   V++L+AS EG
Sbjct  372   TMGVPIAAWPMHSDQPRNTLFVTQVLKMGIVVMEWEQRTELVKASAIENAVRRLMASEEG  431

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              E+R+RA +L+ +L++ I  GG  R EL+SFVAHI R
Sbjct  432   NEVRKRAEDLAATLRQAIEPGGASRLELDSFVAHIIR  468



>ref|XP_010056748.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   371 bits (952),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 229/466 (49%), Positives = 300/466 (64%), Gaps = 11/466 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L++++G+PVHY G+ATH RQA  R H     A  ++ F
Sbjct  19    VAVIMVPLPAQGHLNQLLQLAHLVSSYGVPVHYVGSATHNRQAKLRSHVPPSSAPGDIRF  78

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H    P   SP P+  +  KFP+ L P F A   LR P  + +++LS   +RVVV+ DSL
Sbjct  79    HDFPTPPIPSPAPSLSSPHKFPSHLQPAFDAALSLRSPVASFVQSLSSGSRRVVVVHDSL  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPE  568
             M  VVQD  S+ NAE+Y F+ ISAFT  SF WER G    P+V  + A +++    PS +
Sbjct  139   MASVVQDAASVPNAEIYEFKTISAFTLCSFKWERIGMAPPPEVELDIAELISSKGFPSIQ  198

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F   Q+     +SG + N+CR +E  F+DL    +  G     WAIGP NP
Sbjct  199   DSSTDEFLKFRASQKECKKLNSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNP  258

Query  740   VSLTDSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + +  +T + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIWV
Sbjct  259   VKVPEKTSTRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIWV  318

Query  917   vrdgdrgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR              R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  319   LREADKADIFGGGGEARIIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHC  378

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + DW  +++ V    I   V
Sbjct  379   GWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDVVKSSIIEGAV  438

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K L+ + EGEE R+RAAEL  +++  +  GG  R EL+SF+AHI R
Sbjct  439   KALMVTEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  484



>ref|XP_004249738.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=477

 Score =   370 bits (949),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 226/454 (50%), Positives = 308/454 (68%), Gaps = 11/454 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LH SRLI+++ IPVHY    TH RQ   R HG+   +  N+HFH    P
Sbjct  28    PFPAQGHLNQLLHFSRLISSYNIPVHYITTTTHTRQVNFRAHGFK--STNNIHFHEFPTP  85

Query  242   HFQSPPPNPDAST--KFPTQLMPVFFATSHLRRPFNALIRNLSVDQ-KRVVVISDSLMGW  412
              F SP PN +++   KFP+ L P    +++LR P   ++ +LS ++ +R+V+I DSLMG 
Sbjct  86    IFNSPTPNNNSNPSIKFPSHLQPSSQISTNLRNPVAKILHSLSHNKTRRIVIIHDSLMGS  145

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFE  592
             VVQD   + NAE Y F  +SAFT + + WE  G+         ++  +PS +GCF PEF 
Sbjct  146   VVQDYRDIPNAEAYTFHSVSAFTIFLYVWESMGRS--SSIDVDMIKDLPSNDGCFTPEFT  203

Query  593   EFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINT  766
              F++ +  +   +SG + N+ R IE  F+DL+ KE  +K   QWA+GP NP++++     
Sbjct  204   TFVRREHEYSKFNSGKIYNTSRVIEGPFLDLLSKEQINKGKKQWALGPFNPITISGPTQ-  262

Query  767   NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvf  946
              RH SL WLD+Q   SV+FVSFG+TTS S EQI E+  GLE+S QKFIWV+RD D+ +VF
Sbjct  263   QRHYSLTWLDKQVPKSVIFVSFGTTTSFSYEQINEIAIGLEQSQQKFIWVLRDADKENVF  322

Query  947   ddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMG  1126
                +  ++ E P+G+EERV+ RG+VVR+WAPQLEIL H S GGF+SHCGWNSCMESISMG
Sbjct  323   SQ-DFTKKIEPPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHCGWNSCMESISMG  381

Query  1127  VPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeem  1306
             VP+AAWPMHSDQPRN  LIT++L++G+ + DWA+R+E V    I + V+ L+AS EGEEM
Sbjct  382   VPLAAWPMHSDQPRNTVLITKILQVGLVVKDWAQRDELVTLNRIEKVVRILMASKEGEEM  441

Query  1307  rrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             R+RA +LS  +K  +   G  +NE ++F+AHI R
Sbjct  442   RKRAKKLSFDVKNAVGENGVTKNEFDAFIAHIAR  475



>ref|XP_009586605.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=471

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 301/457 (66%), Gaps = 8/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V ++M+P PAQGHLNQ L LS LI+++G+PV+Y G+ATH RQ   R +  +PL +  +HF
Sbjct  21    VAIIMVPFPAQGHLNQLLQLSCLISSYGLPVYYVGSATHNRQVRIRANALNPLDIAKIHF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P F SP P+ ++ +KFP  L P + A   LR P  +  R++S   +RVVV  DSL
Sbjct  81    HDLPTPEFDSPEPDFNSLSKFPVHLQPSWDACMLLREPIASFFRDISSKSRRVVV-HDSL  139

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + VQDV S  N E Y F CIS FT Y       G      E   +L  +PS +G    
Sbjct  140   MSYNVQDVSSFPNVESYVFNCISVFTLYCLICITKGMSIQLEEE--LLKKLPSLQGIVTD  197

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTDS  757
             E  EF   Q+P+ +  SGD+ N+ + IE  F+DL+ +    +   QWAIGP+ P  L D 
Sbjct  198   EIREFGASQKPYMEIRSGDIHNTSKVIEGKFLDLLAQVTSEQKKKQWAIGPILPTKL-DH  256

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
             I+   +  L+WL++Q   SVL++SFG+TTS S  +I EL  GLE+S QKFIWV+RD DRG
Sbjct  257   ISKKNNICLDWLNKQPPRSVLYISFGTTTSFSYREIKELAMGLEQSKQKFIWVLRDADRG  316

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+F     AR+ E+PEG+EERV+  G+VVR+WAPQ EIL H S GGFMSHCGWNSC+ESI
Sbjct  317   DIFTG--EARKVELPEGFEERVKEIGLVVRDWAPQPEILAHSSRGGFMSHCGWNSCIESI  374

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWPMHSDQP+N  L+TE+LK+G+ + +W +R E V    I   V+KL+AS EG
Sbjct  375   TMGVPIAAWPMHSDQPKNGFLVTEILKIGMLVREWRKREELVTASTIENVVRKLMASEEG  434

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + +R+RA EL ++++     GG  R EL+SF+AHITR
Sbjct  435   DVIRKRAEELGEAVRRSTEKGGASRKELDSFIAHITR  471



>ref|XP_007145589.1| hypothetical protein PHAVU_007G251300g [Phaseolus vulgaris]
 gb|ESW17583.1| hypothetical protein PHAVU_007G251300g [Phaseolus vulgaris]
Length=467

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 234/467 (50%), Positives = 309/467 (66%), Gaps = 12/467 (3%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             NG        VVVV++P PAQGHLNQ +HLS LI+ H IPVHY    THIRQAT R H  
Sbjct  4     NGDNVLHQTQVVVVLVPFPAQGHLNQLMHLSHLISPHNIPVHYVSTVTHIRQATLRHHK-  62

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNP-DASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
                +   +HFH   +P F SPPPNP +A T FP+ L+P F A+SHLR P   L+++LS  
Sbjct  63    ---STSTIHFHAFQVPPFVSPPPNPHNAETDFPSHLIPSFEASSHLREPVGKLLQSLSSQ  119

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              KRVVVI DSLMG VVQD  ++ N E Y F+  SAF T+ + WE+ GKP +       + 
Sbjct  120   AKRVVVIHDSLMGPVVQDAANMPNVERYTFQSTSAFFTFVYFWEQMGKPSL---QGFRVP  176

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGP  730
               PS E     EF E+I     F   + G + N+ R  E  +++L+     T   WA+GP
Sbjct  177   EFPSLEESLPAEFIEYISENFEFNKFNDGHIYNTSRAFEGPYLELLENMKGTKKVWALGP  236

Query  731   LNPVSL--TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQK  904
              NP++    DS+   RH  +EWLD+QE  SV+++SFG+TT+L +EQI E+  GLE+S QK
Sbjct  237   FNPLAFEKKDSVGF-RHSCMEWLDKQEASSVIYISFGTTTALRDEQIQEIATGLEQSKQK  295

Query  905   FIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMS  1084
             FIWV+RD D+GD+FD  E  +R E+P+G+E+RV G G+VVR+WAPQLEIL H + GGFMS
Sbjct  296   FIWVLRDADKGDIFDGSET-KRYELPKGFEKRVDGMGLVVRDWAPQLEILSHSATGGFMS  354

Query  1085  HCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGE  1264
             HCGWNSC+ESI+MGVP+A WPMHSDQPRNA L+TE+LK+G+ + DW +RN  V    I  
Sbjct  355   HCGWNSCLESITMGVPMATWPMHSDQPRNAVLVTEILKVGLVVKDWEQRNSLVSASVIEN  414

Query  1265  GVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             GV++L+ S EG+EMR+R+  L   +   +  GG    E++SF+AHIT
Sbjct  415   GVRRLMESKEGDEMRKRSMRLKNGIHRSMDEGGISPKEMDSFIAHIT  461



>ref|XP_010056875.1| PREDICTED: zeatin O-xylosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 234/466 (50%), Positives = 295/466 (63%), Gaps = 11/466 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A +GIPVHY G+A+H RQA  R H     A  ++ F
Sbjct  8     VTVIMVPLPAQGHLNQLLELAHLVACYGIPVHYVGSASHNRQARFRSHVPPSSAASDIRF  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   SP P+  +  KFP+QL P F ATS LR P  +LIR+LS   +RVVV+ DSL
Sbjct  68    HDLPTPPIPSPAPSLSSPYKFPSQLQPAFDATSSLRGPVASLIRSLSSGSRRVVVVHDSL  127

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVL--NHMPSPE  568
             M  VVQD  S+ N E+Y F  ISAFT   F WE  G    P+V  + A ++    +PS  
Sbjct  128   MASVVQDAASVPNTEIYEFNPISAFTLCWFTWESIGMAPPPEVEVDIAELIASKGLPSLL  187

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F   Q       SG + N+CR +E  F+DL    +  G     WAIGP NP
Sbjct  188   DSSTDEFLKFYASQNECKKFHSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNP  247

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + +  +  + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV
Sbjct  248   VKVPEKRSRRSAHGCMEWLDKQAPSSVMYVSFGTTTVLSDEQIREIAMGLEYSGQKFIWV  307

Query  917   vrdgdrgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR  +           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  308   LREADKADIFGGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHPATGGFLSHC  367

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + DW  +++ V    I   V
Sbjct  368   GWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDLVKSSTIEGAV  427

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K L+ S EGEE R+RAAEL   ++  +  GG  R EL+SF+AHI R
Sbjct  428   KALMVSEEGEEARKRAAELGAVVRGSMDEGGVSRAELDSFIAHICR  473



>ref|XP_010056814.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=484

 Score =   368 bits (945),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 305/466 (65%), Gaps = 11/466 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L++++G+PVHY G+A+H RQA  R H     A  ++ F
Sbjct  19    VAVIMVPLPAQGHLNQLLQLAHLVSSYGVPVHYVGSASHNRQAKLRSHVPPSSAPSDIRF  78

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H   +P   SP P+P +  KFP+ L P F A   LR P  +L+++LS   +RVVV+ DSL
Sbjct  79    HDFPIPPIPSPAPSPSSPHKFPSHLQPAFDAALSLRSPVASLVQSLSSGSRRVVVVYDSL  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPE  568
             M  VVQD  S+ NAE+Y F+ ISAFT   F WER G    P+V  + A +++    PS +
Sbjct  139   MATVVQDAASVPNAEIYEFKAISAFTLCGFAWERIGMAPPPEVEVDIAELISSKGFPSIQ  198

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
               F  EF +F   Q+    ++SG + N+CR +E  F+DL       G     WA+GP NP
Sbjct  199   DSFTDEFSKFRASQKECKKSNSGFIHNTCRVVEGRFVDLYASAMANGTATKHWALGPFNP  258

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             + + +  +  + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIWV
Sbjct  259   IKVPEKRSRRSAHWCMEWLDKQTPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIWV  318

Query  917   vrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  319   LREADKTDIFGGGGEARKIELPQGFEETAAARDLGVVVRDWAPQLEILGHPATGGFLSHC  378

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + +W  +++ V    I   V
Sbjct  379   GWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVRNWMSQDDVVKSSIIEGAV  438

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K L+A+ EGEE R+RAA+L  +++  +  GG  R EL+SF+AHI R
Sbjct  439   KALMATEEGEEARKRAAKLGAAVRGSMDEGGVSRAELDSFIAHIAR  484



>ref|XP_006367370.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=492

 Score =   368 bits (945),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 308/453 (68%), Gaps = 10/453 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ LH SRLI+++ IPVHY    TH RQ   R HG+   +  N+HFH    P
Sbjct  44    PFPAQGHLNQLLHFSRLISSYNIPVHYITTTTHTRQVNFRAHGFK--STNNIHFHEFPTP  101

Query  242   HFQSPPPNPDAST--KFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              F SP PN + +   KFP+ L P    +++L  P   ++ +LS   +R+V+I+DSLMG V
Sbjct  102   IFNSPTPNNNPNPSIKFPSHLQPSSQISTNLIYPVAKILHSLSHKTQRIVIINDSLMGSV  161

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD   + NAE Y F  +SAFT + + WE  G+         ++  +PS +GCF PEF +
Sbjct  162   VQDYRDIPNAEAYTFHSVSAFTIFLYVWETMGRS--SSIDVDMIKDLPSNDGCFTPEFTK  219

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINTN  769
             F++ +  +   +SG + N+ R IE  F+DL+ KE  +K   QWA+GP NP++++      
Sbjct  220   FVRSEHEYSKFNSGKIYNTSRVIEGPFLDLLSKEQINKGKKQWALGPFNPITISGPTQ-Q  278

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
             RH SL WLD+Q   SV+FVSFG+TTS S EQI E+  GLE+S QKFIWV+RD D+ +VF 
Sbjct  279   RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAIGLEQSQQKFIWVLRDADKENVFL  338

Query  950   dgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGV  1129
             D +  ++ E+P+G+EERV+ RG+VVR+WAPQLEIL H S GGF+SHCGWNSCMES+SMGV
Sbjct  339   D-DFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHCGWNSCMESMSMGV  397

Query  1130  PIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemr  1309
             P+A WPMHSDQPRN  LIT++L++G+ + DWA+RNE V    I + V+ L+AS EGEEMR
Sbjct  398   PLATWPMHSDQPRNTVLITKILEVGLVVKDWAQRNELVTFDRIEKVVRILMASKEGEEMR  457

Query  1310  rraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +RA +LS  +K  +   G  +NE ++F+AHIT+
Sbjct  458   KRAKDLSLGVKNAVEENGVTKNEFDAFIAHITK  490



>gb|AAM09514.2|AF489874_1 zeatin O-glucosyltransferase [Glycine max]
Length=464

 Score =   367 bits (942),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 233/457 (51%), Positives = 305/457 (67%), Gaps = 10/457 (2%)
 Frame = +2

Query  50    VVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHH  229
             VV++P PAQGHLNQ LHL+R I +H IPVHY G ATHIRQAT R H  + ++   +HFH 
Sbjct  14    VVLIPFPAQGHLNQLLHLARHIFSHNIPVHYVGTATHIRQATLRDHNSN-ISNIIIHFHA  72

Query  230   LSMPHFQSPPPNPDAS-TKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLM  406
               +P F SPPPNP+   T FP+ L+P F A+SHLR P   L+++LS   KRV+VI DSLM
Sbjct  73    FEVPPFVSPPPNPNNEETDFPSHLLPSFKASSHLREPVRNLLQSLSSQAKRVIVIHDSLM  132

Query  407   GWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPE  586
               V QD  ++ N E Y F    AFTT+ ++WE  G+P V  E       +PS  GCF P+
Sbjct  133   ASVAQDATNMPNVENYTFHSTCAFTTFLYYWEVMGRPPV--EGFFQATEIPSMGGCFPPQ  190

Query  587   FEEFIKMQRPFWDASSGDLLNSCREIEALFIDL---IGKESKTGFQWAIGPLNPVSLTDS  757
             F  FI  +  F   + G++ N+ R IE  +I+    IG   K    WA+GP NP+++   
Sbjct  191   FIHFITEEYEFHQFNDGNIYNTSRAIEGPYIEFLERIGGSKKR--LWALGPFNPLTIEKK  248

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                 RH  +EWLD+QE +SV++VSFG+TTS +  Q  ++  GLE+S QKFIWV+RD D+G
Sbjct  249   DPKTRHICIEWLDKQEANSVMYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKG  308

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             ++FD  EA  R E+P G+EERV G G+++R+WAPQLEIL H S GGFMSHCGWNSC+ESI
Sbjct  309   NIFDGSEA-ERYELPNGFEERVEGIGLLIRDWAPQLEILSHTSTGGFMSHCGWNSCLESI  367

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWPMHSDQPRN+ LITEVLK+G  + DWA+RN  V    +   V++L+ + EG
Sbjct  368   TMGVPIAAWPMHSDQPRNSVLITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEG  427

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +EMR RA  L   +      GG  R E+ SF+AHIT+
Sbjct  428   DEMRDRAVRLKNCIHRSKYGGGVSRMEMGSFIAHITK  464



>ref|XP_003535886.2| PREDICTED: zeatin O-glucosyltransferase [Glycine max]
Length=481

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 230/455 (51%), Positives = 306/455 (67%), Gaps = 6/455 (1%)
 Frame = +2

Query  50    VVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHH  229
             VV++P PAQGHLNQ LHL+R I +H IPVHY G ATHIRQAT R H  + ++   +HFH 
Sbjct  31    VVLIPFPAQGHLNQLLHLARHIFSHNIPVHYVGTATHIRQATLRDHNSN-ISNIIIHFHA  89

Query  230   LSMPHFQSPPPNPDAS-TKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLM  406
               +P F SPPPNP+   T FP+ L+P F A+SHLR P   L+++LS   KRV+VI DSLM
Sbjct  90    FEVPPFVSPPPNPNNEETDFPSHLLPSFKASSHLREPVRNLLQSLSSQAKRVIVIHDSLM  149

Query  407   GWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPE  586
               V QD  ++ N E Y F    AFTT+ ++WE  G+P V  E       +PS  GCF P+
Sbjct  150   ASVAQDATNMPNVENYTFHSTCAFTTFLYYWEVMGRPPV--EGFFQATEIPSMGGCFPPQ  207

Query  587   FEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ-WAIGPLNPVSLTDSIN  763
             F  FI  +  F   + G++ N+ R IE  +I+ + +   +  + WA+GP NP+++     
Sbjct  208   FIHFITEEYEFHQFNDGNIYNTSRAIEGPYIEFLERIGGSKKRLWALGPFNPLTIEKKDP  267

Query  764   TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdv  943
               RH  +EWLD+QE +SV++VSFG+TTS +  Q  ++  GLE+S QKFIWV+RD D+G++
Sbjct  268   KTRHICIEWLDKQEANSVMYVSFGTTTSFTVAQFEQIAIGLEQSKQKFIWVLRDADKGNI  327

Query  944   fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
             FD  EA  R E+P G+EERV G G+++R+WAPQLEIL H S GGFMSHCGWNSC+ESI+M
Sbjct  328   FDGSEA-ERYELPNGFEERVEGIGLLIRDWAPQLEILSHTSTGGFMSHCGWNSCLESITM  386

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPIAAWPMHSDQPRN+ LITEVLK+G  + DWA+RN  V    +   V++L+ + EG+E
Sbjct  387   GVPIAAWPMHSDQPRNSVLITEVLKVGFVVKDWAQRNALVSASVVENAVRRLMETKEGDE  446

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             MR RA  L   +      GG  R E+ SF+AHIT+
Sbjct  447   MRDRAVRLKNCIHRSKYGGGVSRMEMGSFIAHITK  481



>ref|XP_009390153.1| PREDICTED: cis-zeatin O-glucosyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   364 bits (935),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 300/461 (65%), Gaps = 9/461 (2%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             GV VV+LPLPA GHLNQ LHL+RL++  G+ VHYAG+ATH RQ   R  GW P A   +H
Sbjct  13    GVSVVVLPLPAFGHLNQLLHLARLLSTRGVAVHYAGSATHNRQVRDRASGWRPDA--TIH  70

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH   +P F SP P+P A+ KFP  L P F A  HLR P  AL+R+L+   +RVV+I DS
Sbjct  71    FHDFPLPPFASPEPDPRAAVKFPAHLQPAFDAAVHLRHPLAALLRSLAAPSRRVVLIHDS  130

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN-HMPSPEGCF  577
              M +      SL   E + F  +SAF    + WE  GK  +     G LN  + + +GCF
Sbjct  131   AMSFAAALAASLPGVEAFSFHSVSAFAVLLYLWESCGK-QLEDLVVGKLNLAVVTNDGCF  189

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLT  751
               EF  F++ Q     A SG LLN+CR IE  FIDL+ +E +   Q  +A+GPLN   + 
Sbjct  190   TDEFLGFLQSQHQMTGADSGRLLNTCRSIEGPFIDLLKEEPRWREQKTFAVGPLNQTVVA  249

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             D   + RH+ LEWLD+Q   SV++VSFG+T+SLS+EQ+ EL AGL+ SGQ+FIWV+RD D
Sbjct  250   DDGTSCRHECLEWLDQQPPSSVVYVSFGTTSSLSDEQVAELAAGLQASGQRFIWVLRDAD  309

Query  932   rgdvfddgEAARRAevpeg---yeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             R D++ D   +  A   +    Y++ V   G VVR WAPQL+IL H S GGFMSHCGWNS
Sbjct  310   RADIYADEGISDHASGDKQLPNYDKAVHRTGRVVRGWAPQLDILAHRSTGGFMSHCGWNS  369

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMES+SMGVPI AWPMHSDQPRN  L+T +L  G+ + DWA+RNE      I + + +L+
Sbjct  370   CMESLSMGVPILAWPMHSDQPRNTLLVTHILGTGVLVRDWAKRNELTPAMAIRDSILRLM  429

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
              S EG++++RRA  + Q++++ +A GG  + +L++F+A+IT
Sbjct  430   ISEEGKDVQRRANAVGQAVRKAMAEGGSSKADLDAFIAYIT  470



>gb|KCW90127.1| hypothetical protein EUGRSUZ_A02318 [Eucalyptus grandis]
Length=462

 Score =   364 bits (934),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 225/462 (49%), Positives = 302/462 (65%), Gaps = 11/462 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ L L+ L++++G+PVHY G+A+H RQA  R H     A  ++ FH   
Sbjct  1     MVPLPAQGHLNQLLQLAHLVSSYGVPVHYVGSASHNRQAKLRSHVPPSSAPSDIRFHDFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
             +P   SP P+P +  KFP+ L P F A   LR P  +L+++LS   +RVVV+ DSLM  V
Sbjct  61    IPPIPSPAPSPSSPHKFPSHLQPAFDAALSLRSPVASLVQSLSSGSRRVVVVYDSLMATV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCFI  580
             VQD  S+ NAE+Y F+ ISAFT   F WER G    P+V  + A +++    PS +  F 
Sbjct  121   VQDAASVPNAEIYEFKAISAFTLCGFAWERIGMAPPPEVEVDIAELISSKGFPSIQDSFT  180

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLT  751
              EF +F   Q+    ++SG + N+CR +E  F+DL       G     WA+GP NP+ + 
Sbjct  181   DEFSKFRASQKECKKSNSGFIHNTCRVVEGRFVDLYASAMANGTATKHWALGPFNPIKVP  240

Query  752   DSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             +  +  + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIWV+R+ 
Sbjct  241   EKRSRRSAHWCMEWLDKQTPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIWVLREA  300

Query  929   drgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNS
Sbjct  301   DKTDIFGGGGEARKIELPQGFEETAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWNS  360

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + +W  +++ V    I   VK L+
Sbjct  361   CMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVRNWMSQDDVVKSSIIEGAVKALM  420

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             A+ EGEE R+RAA+L  +++  +  GG  R EL+SF+AHI R
Sbjct  421   ATEEGEEARKRAAKLGAAVRGSMDEGGVSRAELDSFIAHIAR  462



>ref|XP_009796346.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=463

 Score =   363 bits (931),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 300/458 (66%), Gaps = 8/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V +VM+P P QGHLNQ L L+ LI++ + +PV+Y G+ATH RQA  R +  +PL +  + 
Sbjct  11    VAIVMVPFPGQGHLNQLLQLACLISSSYNLPVYYVGSATHNRQARVRANALNPLDIAKIQ  70

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH +  P F SPPP+ ++  KFP  L P + A   +R P  +   ++S   +RVVV+ DS
Sbjct  71    FHDIPTPEFASPPPDFNSLNKFPAHLEPSWAACMLMREPIASFFHDISSKTRRVVVVHDS  130

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM + VQDV SL NAE Y F CIS FT Y       G      E   +L  +PS EG   
Sbjct  131   LMSYNVQDVSSLSNAESYIFNCISVFTLYCLICLSCGMSIQLEEE--LLKTLPSLEGIMT  188

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKT--GFQWAIGPLNPVSLTD  754
              E  E    Q P+ D  SGD+ N+ R IE  F+DL+ + + T    QWAIGP+ P  L  
Sbjct  189   DEIRERGASQSPYMDIRSGDIHNTSRVIEGKFLDLLVEVTSTQNKKQWAIGPVLPAKLDH  248

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               NTN +  LEWL++Q   SVL++SFG+TTS S+ +I EL  GLE+S Q+FIWV+RD DR
Sbjct  249   VSNTN-NICLEWLNKQPPRSVLYISFGTTTSFSDREIKELAMGLEQSKQRFIWVLRDADR  307

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F     AR+ E+PEG+EERV+  G+VVREWAPQLEIL H S GGFMSHCGWNSC+ES
Sbjct  308   GDIFTG--EARKVELPEGFEERVKEVGLVVREWAPQLEILAHSSTGGFMSHCGWNSCIES  365

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMHSDQP N  L+ E+LK+G+ + +W +R E V    I   V+KL+AS E
Sbjct  366   ITMGVPIAAWPMHSDQPINGFLVMEILKIGLIVREWEKREELVSASTIENVVRKLMASEE  425

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+E+R+RA EL ++++      G  R EL+SF+AHITR
Sbjct  426   GDEIRKRADELGEAVRLSTEKRGASRMELDSFIAHITR  463



>gb|EYU37237.1| hypothetical protein MIMGU_mgv1a026906mg, partial [Erythranthe 
guttata]
Length=471

 Score =   362 bits (930),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 316/459 (69%), Gaps = 11/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+P PAQGHLNQ + LS LI+++GIPVHY G+A H RQA  R++G +   V  +HF
Sbjct  16    VAVIMVPFPAQGHLNQLMQLSCLISSYGIPVHYVGSAIHNRQAKVRINGLNHEDVEKIHF  75

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
               +  P   SPPP+P++  K PTQL P++ + S LR P  + +R+++   +RVVV+ DSL
Sbjct  76    RDIPTPSSVSPPPDPNSPDKPPTQLQPLWDSLS-LREPVASYLRDMANKFERVVVVHDSL  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VVQDV S+ NAE Y F CISAFT   F  +  GKP            +PS EGC   
Sbjct  135   MAVVVQDVSSILNAESYVFNCISAFTKAVFTLDLLGKPLPIEHP----KELPSFEGCITD  190

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             E  +F+ +Q       +GDL N+CR IE  +++LI KE   G +  WAIGP+ P  L+ S
Sbjct  191   EIRDFLALQFEPLSYRAGDLYNTCRLIEQDYMELIEKEEIVGSRKSWAIGPILPAKLSSS  250

Query  758   INTNR--HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
              N +   ++ LEWLD+QE +SV++VSFG+TTSLS+EQI EL  GLE+S  KF+WV+RD D
Sbjct  251   ANQSEIHNRCLEWLDKQEINSVIYVSFGTTTSLSDEQIKELAYGLEQSKVKFLWVLRDAD  310

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             + D+FD     RRAE+P+G+EERV G G+VVREWAPQ +IL HPS GGF+SHCGWNSC+E
Sbjct  311   KRDIFDGQ--VRRAELPDGFEERVEGVGMVVREWAPQPQILAHPSTGGFVSHCGWNSCIE  368

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SI+MGVPIAAWPMHSDQP N+ LITE+LKMG+ + DW +R E V    I   +K L+AS 
Sbjct  369   SITMGVPIAAWPMHSDQPNNSVLITEILKMGLLVRDWKQRTELVKASIIKNILKILMASK  428

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+E+R+RA EL+ ++ +    GG  + EL+SF++HITR
Sbjct  429   EGDELRKRAEELAATVYQATQQGGASKLELDSFISHITR  467



>ref|XP_006355035.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=494

 Score =   363 bits (932),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 302/457 (66%), Gaps = 7/457 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+P PAQGHLNQ L LS LI+++G+PV+Y G+ATH RQA  R +  +P  +  +HF
Sbjct  43    VAIVMVPFPAQGHLNQLLQLSCLISSYGLPVYYVGSATHNRQARIRANSLNPSDIAKVHF  102

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H +  P F SP P+ +A +KFP+ L P + A+  LR P  + +R++S   +RV+V+ D L
Sbjct  103   HDIPTPEFASPSPDFNALSKFPSHLQPSWNASMLLREPIASFLRDISSKSRRVIVVHDPL  162

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + V DV SL NAE Y F CISA T+YS      G  D   E   +L  +PS EG    
Sbjct  163   MSYNVHDVSSLPNAESYMFNCISALTSYSLISLFFGMSDQHEEE--LLKKLPSLEGIMTD  220

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDS  757
             E  +    Q+ + D  SGDL N+ R IE  ++DL+ +   +    QWAIGP+ P    D 
Sbjct  221   EIRDLSASQQHYLDIRSGDLNNTSRVIEGKYLDLLEQAELNLNKKQWAIGPILPTKF-DH  279

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
             I+   +  L+WL++Q   SVL++SFG+TTS S+ +I EL  GLE+S QKFIWV+RD DRG
Sbjct  280   ISNRENICLDWLNKQPPRSVLYISFGTTTSFSDREIKELAMGLEQSKQKFIWVLRDADRG  339

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+F   +  RR E+PEG+EER++  G+VVREWAPQ EIL H S  GFMSHC WNSC+ESI
Sbjct  340   DIFKGED--RRVELPEGFEERLKDVGLVVREWAPQPEILAHSSTSGFMSHCDWNSCLESI  397

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGV IAAWPMHSDQP N  L+T++LK+G+ + DW +R + V    I   V+KL+AS EG
Sbjct  398   TMGVSIAAWPMHSDQPINGFLVTDILKIGLLVRDWGKREDVVSAFTIENVVRKLMASEEG  457

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               +R+RA EL +++++    GG  + EL+SF+AHITR
Sbjct  458   NLIRKRAEELGEAVRQSTEKGGASQIELDSFIAHITR  494



>ref|XP_006351248.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=479

 Score =   363 bits (931),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 310/471 (66%), Gaps = 26/471 (6%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAH-GIPVHYAGAATHIRQATHRVHGW----DPLAVPNLHFH  226
             P PAQGHLNQ LH S LI+++  I VHY     H RQA  R HG            +HFH
Sbjct  13    PFPAQGHLNQLLHFSSLISSYKNIQVHYVSTKIHTRQAKIRAHGLLNPSSSSNNNIIHFH  72

Query  227   HLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLM  406
               S P F SPPPNP+++ KFP+ L P F ++ HLR P  +L+R+LS   +RVVV+ DSLM
Sbjct  73    EFSTPSFPSPPPNPNSNIKFPSHLQPSFESSYHLRSPVASLLRSLSSIARRVVVVHDSLM  132

Query  407   GWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPE  586
              +VVQD  SL N E Y F  +SAFT + F WE  GKP   P  A +L+++PS EGCF  E
Sbjct  133   AYVVQDFTSLPNVESYNFHSVSAFTIFLFLWESMGKP--FPIEAEILDNLPSLEGCFTSE  190

Query  587   FEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSI  760
             F +F+  QR +  + SG++ N+ R IE  F++L+ KE   +   QWAIGP NP+ +    
Sbjct  191   FMDFMASQRKYSKSDSGNIYNTSRVIEGKFMNLLEKEPIKRNKTQWAIGPFNPMKIISKT  250

Query  761   NTNRH------------KSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQK  904
             +TN +            K L WLD+Q   S +F+SFG+TTSL +EQI EL  GLE+SG K
Sbjct  251   STNNNLSIDHHHHHHRHKCLLWLDKQSPKSAIFISFGTTTSLKDEQIEELCIGLEKSGIK  310

Query  905   FIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMS  1084
             F+W +RD D+GD+F      R+ E+P+GYEER++ +G++VR+WAPQLEILGH S+G FMS
Sbjct  311   FVWALRDADKGDIFSG--EMRKIELPKGYEERIKNKGIIVRDWAPQLEILGHLSIGAFMS  368

Query  1085  HCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLV-DWARRNERVGRREIG  1261
             HCGWNSCMES+SMGVPI AWPMHSDQPRN+ LIT+ LK+GI++  +W R    V +  I 
Sbjct  369   HCGWNSCMESLSMGVPIIAWPMHSDQPRNSILITKFLKVGINIFNNWERSRNEVVKSNII  428

Query  1262  EG--VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             E   V  ++ + EG E+RRRAAEL  +++  +  GG  R EL+SF+AHITR
Sbjct  429   EHVIVTIMLNNIEGNEIRRRAAELGVAVRRSVVEGGVTRKELDSFIAHITR  479



>ref|XP_006356483.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=476

 Score =   362 bits (930),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 224/453 (49%), Positives = 303/453 (67%), Gaps = 10/453 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P PAQGHLNQ  H S LI+++ IPVHY    TH RQ   R HG+   +  N+HFH    P
Sbjct  28    PFPAQGHLNQLFHFSHLISSYNIPVHYITTTTHTRQVNFRAHGFK--STNNIHFHEFPTP  85

Query  242   HFQSPPPNPDAST--KFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              F SP PN + +   KFP+ L P    +++LR P   ++ +LS   +R+V+I DSLMG V
Sbjct  86    IFNSPTPNNNPNPSIKFPSHLQPSSQISTNLRNPVAKILHSLSHKTRRIVIIHDSLMGSV  145

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEE  595
             VQD   + NAE Y F  +SAFT + +  E  G+         ++  +PS +GCF PEF +
Sbjct  146   VQDYRDIPNAEAYTFHSVSAFTIFLYVRESMGRS--SSINVDMIKDLPSNDGCFTPEFTK  203

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDSINTN  769
             F++ +  +   +SG + N+ R IE  F+DL+ KE  +K   QWA+GP NP++++      
Sbjct  204   FVRSEHEYSKFNSGKIYNTLRVIEGPFLDLLSKEQINKDKKQWALGPFNPITISGPTQ-Q  262

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
             RH SL WLD+Q   SV+FVSFG+TTS S EQI E+  GLE+S Q FIWV+RD D+ +VF 
Sbjct  263   RHYSLIWLDKQVPKSVIFVSFGTTTSFSYEQIKEIAIGLEQSQQNFIWVLRDADKENVFL  322

Query  950   dgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGV  1129
             D +  ++ E+P+G+EERV+ RG+VVR+WAPQLEIL H S GGF+SHCGWNSCMESISMGV
Sbjct  323   D-DFTKKIELPKGFEERVKERGIVVRDWAPQLEILAHNSTGGFLSHCGWNSCMESISMGV  381

Query  1130  PIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemr  1309
             P+AAWPMHSDQPRN  LIT++L++G+   DW +R+E V    I + V+ L+AS EGEEMR
Sbjct  382   PLAAWPMHSDQPRNTVLITKILEVGLVAKDWTQRDELVTFDRIEKAVRILMASKEGEEMR  441

Query  1310  rraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +RA ELS  +K  +   G  +NE ++F+AHITR
Sbjct  442   KRAKELSLGVKNAVEENGVTKNEFDAFIAHITR  474



>ref|XP_009777022.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana sylvestris]
Length=479

 Score =   362 bits (930),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 221/469 (47%), Positives = 295/469 (63%), Gaps = 25/469 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPL--AVPNL  217
             VV+VM+P PAQGHLNQ LHLSRL++++ +PVHY   +T I+QA  RVHGWDP+     N+
Sbjct  21    VVMVMVPFPAQGHLNQLLHLSRLVSSYHLPVHYVSFSTSIQQAKLRVHGWDPVTDTTHNI  80

Query  218   HFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             HF    +P      PN    +KF    + +      LR+P ++ +  LS   +R+V+I D
Sbjct  81    HFKEFPLPSTHVQSPNCSNMSKFIASTLDLSLT---LRKPISSYLNELSSKTRRLVIIYD  137

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAG---------VLN  550
             SLM WVVQD+ S+ N E Y FR +SAFTT S  WE   K    P+  G         +  
Sbjct  138   SLMAWVVQDIVSIPNVEAYCFRAVSAFTTSSILWEGIEKFFHLPKFLGKFIATKFLKIPQ  197

Query  551   HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKT---GFQWA  721
              +P  E  F  E  +FI MQ    +  SG+L ++C+ IE  F++ + K  +    G QWA
Sbjct  198   QLPLLESSFTQELLDFIFMQDRHNNICSGNLFDTCKVIEGPFLESLEKLHRLLRRGNQWA  257

Query  722   IGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             IGP NP+ +    + N HK L WLD+QE +SV+ VSFG+T+SLS+EQI EL  GLE+S Q
Sbjct  258   IGPFNPIKIQKD-SKNCHKCLRWLDKQEPNSVILVSFGTTSSLSSEQIKELAIGLEKSNQ  316

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             KFIWVVRD   G             +P GYEER+ GRG++V++WAPQ EILGH S GGF+
Sbjct  317   KFIWVVRDVLLG-------EDEEVNIPNGYEERIEGRGIIVKDWAPQFEILGHSSTGGFL  369

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNSCMESI+MGVPIA WPM  DQPRNA L+T VLK+GI + DW    + V    I 
Sbjct  370   SHCGWNSCMESITMGVPIATWPMSFDQPRNAVLVTNVLKIGIVVKDWEHCEDLVSSTTIE  429

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               V+KL+ S+EG EMR+RA E  + ++E +  GG  + E++SF++H+TR
Sbjct  430   NVVRKLMVSSEGNEMRKRAMEFGKKVRESMMDGGISKMEMDSFISHVTR  478



>ref|XP_004243014.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=453

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 221/449 (49%), Positives = 295/449 (66%), Gaps = 17/449 (4%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQ  250
             AQGHLNQ L  S LI+++G+ VH+ G  THI+QA  R    +   +  +HFH    PHF 
Sbjct  19    AQGHLNQLLQFSCLISSYGVSVHFVGYRTHIQQAKSR----NLQDMQQIHFHEFPTPHFD  74

Query  251   SPPPN-PDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDV  427
             SPPP  P++  KFPT L P F A+  L  PF +L+   S   KR VVI D LM  VVQD 
Sbjct  75    SPPPIIPNSIMKFPTHLQPSFEASKQLHEPFTSLLHEFSSKVKRTVVIHDPLMSSVVQDF  134

Query  428   PSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKM  607
              S+ NAE Y F CISAFT +   W+  G+P       G+  ++PS EGCF  E   F+  
Sbjct  135   SSIPNAESYAFHCISAFTQFFSFWDAIGRPF---PVEGMPKNIPSMEGCFSFEIMNFMAY  191

Query  608   QRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTDSINTNRHKS  781
             Q  F    +GD+ NSCR IE  +IDL+ K   +    QW+IGP+         +++RHKS
Sbjct  192   QYEFMQYRTGDIFNSCRLIEGTYIDLLSKLEMNANKKQWSIGPI-----LQKGSSSRHKS  246

Query  782   LEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEA  961
             LEWLD+Q   SVL++SFGS+T+++++QI EL  GLE S QKF+WV+RD D+G++FD  + 
Sbjct  247   LEWLDKQGPKSVLYISFGSSTTMTDKQIQELAMGLENSKQKFLWVLRDADKGNIFD--DE  304

Query  962   ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAA  1141
              R+A +PEGY+ER  G G+VV +WAPQLEILGH S+GGFMSHCGWNSCMESI+MGVPI A
Sbjct  305   TRKARLPEGYQERTEGTGIVVTDWAPQLEILGHTSIGGFMSHCGWNSCMESITMGVPILA  364

Query  1142  WPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraa  1321
             WPMHS+QP NATLITE+L++GI + + A + E V    I + V +L+ S EGEE+R +A 
Sbjct  365   WPMHSEQPWNATLITEILEVGIQVTEQAHQKELVNSSTIEKVVNRLMVSKEGEELRSKAE  424

Query  1322  eLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +L + + +    GG  + EL SF+A++ R
Sbjct  425   KLGRQVWQSRDGGGVSQLELSSFIAYLNR  453



>ref|XP_004236911.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=470

 Score =   362 bits (928),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 225/459 (49%), Positives = 300/459 (65%), Gaps = 9/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAA--HGIPVHYAGAATHIRQATHRVHGWDPLAVPNL  217
             V +VM+P P QGHLNQ L L+ LI +    +PV+Y G+ATH  QA  R +  +P  +  +
Sbjct  17    VAIVMVPFPGQGHLNQLLQLACLITSSYDDLPVYYVGSATHNLQARVRANALNPSDIAKI  76

Query  218   HFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             HFH +  P F SP P+P+A +KFP+ L P + A   LR P  + +R++S   +RVVV+ D
Sbjct  77    HFHDIPTPDFTSPAPDPNALSKFPSHLEPSWDACMLLREPIASFLRDISSISRRVVVVHD  136

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             SLM + +QDV SL NAE Y F CIS FT Y       G      E   +L  +PS +G  
Sbjct  137   SLMSYNIQDVSSLHNAESYIFNCISVFTFYCIICLSVGMSVQLEEE--LLKKLPSLDGIM  194

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLT  751
               +  +    Q P+ D  SGD+ N+ + IE  F+DL+ +    +    WAIGPL P  + 
Sbjct  195   TDKIRDRGASQSPYLDIRSGDIHNTSKVIEGKFLDLLAQVASDQKKKNWAIGPLLPTKM-  253

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             D I+      L+WLD+Q   SVL+VSFG+TTS S+ +I EL  GLE+S Q+FIWV+RD D
Sbjct  254   DRISNREDVCLDWLDKQPPRSVLYVSFGTTTSFSDREIKELAMGLEQSKQRFIWVLRDAD  313

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             RGD+F   E ARR E+PEG+EERV+G G+VVREWAPQ EIL H S GGFMSHCGWNSC+E
Sbjct  314   RGDIFT--EEARRVELPEGFEERVKGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCIE  371

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SI+MGVPIAAWPMHSDQP    L+T+VLK+G+ + +W +R E V    I + V+KL+AS 
Sbjct  372   SITMGVPIAAWPMHSDQPMTGFLVTDVLKIGLIVREWEKREEMVNASTIEDVVRKLMASE  431

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+ +R+RA EL ++++     GG  R EL+SF+AHITR
Sbjct  432   EGDVIRKRAEELGEAVRLSTEKGGASRMELDSFIAHITR  470



>ref|XP_006366184.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=461

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 296/449 (66%), Gaps = 17/449 (4%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQ  250
             AQGHLNQ L  S LI++ G+PVH+ G  THI+QA  R    +   +  +HFH    PHF 
Sbjct  27    AQGHLNQLLQFSCLISSFGVPVHFIGYKTHIQQAKSR----NLQDMQQIHFHEFPTPHFD  82

Query  251   SPPPN-PDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDV  427
             SPPP  P++  KFPT L P F A+  L  PF  L+   S   KR+VVI D LM  VVQD 
Sbjct  83    SPPPIIPNSIMKFPTHLQPSFEASKQLHEPFTNLLHEFSNKVKRIVVIHDPLMSSVVQDF  142

Query  428   PSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKM  607
              S+ NAE Y F CISAFT +   W+  G+P       G+  ++PS EGCF  E   F+  
Sbjct  143   SSIPNAESYAFHCISAFTQFFSFWDAIGRPF---PVEGMPKNIPSMEGCFSFEIMNFMAY  199

Query  608   QRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLTDSINTNRHKS  781
             Q  F    +GD+ NSCR IE  ++DL+ K   +    QW+IGP+         ++ RHKS
Sbjct  200   QYEFMHYRTGDIFNSCRLIEGTYVDLLSKLEMNANKKQWSIGPI-----LQKGSSTRHKS  254

Query  782   LEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEA  961
             LEWLD+Q ++SVL++SFGS+T+++++QI EL  GLE S QKF+WV+RD D+G+VFD  + 
Sbjct  255   LEWLDKQGQNSVLYISFGSSTTMTDKQIQELAMGLENSKQKFLWVLRDADKGNVFD--DE  312

Query  962   ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAA  1141
              R+A +PEGY+ER  G G+VV +WAPQLEILGH S+GGFMSHCGWNSCMES++MGVPI A
Sbjct  313   TRKARLPEGYQERTEGTGIVVTDWAPQLEILGHTSIGGFMSHCGWNSCMESMTMGVPILA  372

Query  1142  WPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraa  1321
             WPMHS+QP NATLI+E+L++GI + + A + E V    I   V +L+ S EGEE+R RA 
Sbjct  373   WPMHSEQPWNATLISEILEVGIQVTEQAHQMEFVNSSTIENVVNRLMVSKEGEELRSRAE  432

Query  1322  eLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +L + + +    GG  + EL SF+AH++R
Sbjct  433   KLGRQVWQSRDEGGVSQLELSSFMAHLSR  461



>ref|XP_004236593.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=470

 Score =   361 bits (926),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 225/462 (49%), Positives = 309/462 (67%), Gaps = 10/462 (2%)
 Frame = +2

Query  29    GADVGVVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRVHGWDPLA  205
              +D  VV+VM+P P QGHLNQFL  S LI++ + +PV+Y G+ T  RQA  R +  +P  
Sbjct  17    NSDHEVVIVMVPFPIQGHLNQFLQFSCLISSSYDLPVYYLGSPTLNRQARLRANALNPSD  76

Query  206   VPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVV  385
             +  +HFH + +P F SPPP  DA +KFP    P++ A+  LR P  + +R++S   +R+V
Sbjct  77    IAKIHFHDIPIPEFASPPPVFDALSKFPLHHKPLWDASLLLREPIASFLRDISSKSRRIV  136

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPS  562
             V+ D  M + VQDV SL NAE Y F  ISA   Y F     GKP  +G E   +L  +P 
Sbjct  137   VVHDPFMSYNVQDVSSLPNAESYIFNGISALNMYCFVCRFRGKPVQLGEE---LLKKLPD  193

Query  563   PEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPV  742
              EG    E  +F  +Q P     SGD+LN+ + IE  F++L+ +ESK   QWAIGP+ P 
Sbjct  194   LEGGIPDEMRDFTAIQSPHMGIRSGDILNTSKVIEGDFLELLVEESKQ--QWAIGPILPT  251

Query  743   SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
              L D I+   +  LEWL++Q   SVL+VSFG+T+  S+ ++ EL  GLE+S  KFIWV+R
Sbjct  252   KL-DHISNRNNICLEWLNKQPPRSVLYVSFGTTSIFSDREVIELAMGLEQSRHKFIWVLR  310

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             + DRGD+F     AR+ E+PEG+EERV+G G+V+REWAPQ EIL H S GGFMSHCGWNS
Sbjct  311   EADRGDIFTG--EARKLELPEGFEERVKGVGLVMREWAPQPEILAHSSTGGFMSHCGWNS  368

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             C+ESI+MGVPIAAWPMH+DQP+N  L+TE+LK+G+++ +W +R E V    +   V+KL+
Sbjct  369   CIESITMGVPIAAWPMHADQPKNGFLVTEILKIGLTVREWDKRAELVSASTVENVVRKLM  428

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             AS EG+ +R+RA EL++S++     GG  R EL+SF+AHITR
Sbjct  429   ASEEGDAIRKRAEELAESVRRSTEKGGSSRIELDSFIAHITR  470



>ref|XP_010024020.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 232/466 (50%), Positives = 293/466 (63%), Gaps = 11/466 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A +GIPVHY G+A+H RQA  R H     A  ++ F
Sbjct  8     VTVIMVPLPAQGHLNQLLELAHLVACYGIPVHYVGSASHNRQAKFRSHVPPSSAASDIRF  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   SP P+  +  KFP+ L P F ATS LR P  +LIR+LS   +RVVV+ DSL
Sbjct  68    HDLPTPPIPSPAPSLSSPHKFPSHLQPAFDATSSLRGPVASLIRSLSSGSRRVVVVYDSL  127

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVL--NHMPSPE  568
             M  VVQD  S+ NAE+Y F  ISAFT   F WE  G    P+V  +   ++     PSP 
Sbjct  128   MASVVQDAASVPNAEIYEFNPISAFTLCWFTWESIGMAPPPEVEIDIVELIASKGFPSPL  187

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F   Q       SG + N+CR +E  F+DL    +  G     WAIGP NP
Sbjct  188   DSSTDEFLKFAASQNECKKFHSGCIHNTCRVVEGRFVDLYASATANGTATKHWAIGPFNP  247

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + +  +  + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV
Sbjct  248   VKVPEKRSRRSAHGCMEWLDKQATSSVMYVSFGTTTVLSDEQIREIAMGLEYSGQKFIWV  307

Query  917   vrdgdrgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR  +           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  308   LREADKVDIFSGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHPATGGFLSHC  367

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQP NA LIT VLK+G+ + D   +++ V    I   V
Sbjct  368   GWNSCMESISMGVPILAWPMHSDQPWNAVLITRVLKIGLIVKDLMSQDDLVKSSSIEGAV  427

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K L+ S EGEE R+RAAEL  +++  +  GG  R EL+SF+AHI R
Sbjct  428   KALMVSEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFMAHICR  473



>gb|KCW90137.1| hypothetical protein EUGRSUZ_A02329, partial [Eucalyptus grandis]
Length=450

 Score =   359 bits (922),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 217/450 (48%), Positives = 290/450 (64%), Gaps = 11/450 (2%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ L L+ L+ ++G PVHY G+A+H  QA  R H     A  ++ FH   
Sbjct  1     MVPLPAQGHLNQLLELAHLVTSYGFPVHYVGSASHNHQAKLRFHVPALKAPGDIRFHDFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              P F SP PNPD+S KFP+ L+P F ATS LR P  +LIR+LS + +RVVV+ DS+M  V
Sbjct  61    TPPFLSPAPNPDSSHKFPSHLLPAFHATSSLRGPIASLIRSLSSELRRVVVVHDSMMASV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCFI  580
             VQD  S+ NAE Y F  +SAF  Y +  E TG    P+   +   +++   +P+    F 
Sbjct  121   VQDAASVPNAETYIFHSVSAFALYWYTLEATGMGLPPEEDVDVTDLISSKGLPTLLDIFT  180

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLT  751
              EF +F+  Q  F + S G + N+CR +E  ++DL    + +G     WAIGP NPV + 
Sbjct  181   DEFLKFMASQHEFMNLSLGSIYNTCRVVEGRYVDLFASATASGTPTKHWAIGPFNPVKVP  240

Query  752   DSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             +  +  + H  L WLD+Q  +SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV+R+ 
Sbjct  241   EKKSRKSAHVCLGWLDKQAPNSVIYVSFGTTTVLSDEQIREIAMGLERSGQKFIWVLREA  300

Query  929   drgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNS
Sbjct  301   DKADIFSGGVEARKIELPQGFKETVEARDSGVVVRDWAPQLEILGHPATGGFLSHCGWNS  360

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ + D   +++ V    I   V+ L+
Sbjct  361   CMESISMGVPILAWPMHSDQPSNAVLITQVLKIGLMVQDCMSQDKVVKSSAIQGAVEALM  420

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGR  1372
             AS +G+EMR+ AAEL  +++  +  GG  R
Sbjct  421   ASEQGDEMRKSAAELGAAVRGSMDEGGVSR  450



>ref|XP_009614885.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=492

 Score =   360 bits (925),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 220/487 (45%), Positives = 305/487 (63%), Gaps = 29/487 (6%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGW  193
             +G  G  +  + +VM+P PAQGH NQFLHLSRL++++ IP+HY G +T I Q   R+HGW
Sbjct  12    HGQIGMEEDQITMVMVPFPAQGHFNQFLHLSRLVSSYHIPIHYVGFSTEISQVKARMHGW  71

Query  194   DPLAVPN-LHFHHLSMP-HFQSPPP---NPDASTKFPTQLMPVFFATSHLRRPFNALIRN  358
             D     N +HF     P  + +P P   + ++S      +  V  A+  LR P +A I+ 
Sbjct  72    DLATATNYIHFQEFPTPSSYMAPGPCNFSNNSSETISKLIASVLDASLTLREPVSAFIKK  131

Query  359   LSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWE------------  502
             LS   +RVVVI DS+M   VQDV S++NAE Y F  ISAF   S  W+            
Sbjct  132   LSSTTRRVVVIYDSMMASTVQDVVSIKNAEAYCFHAISAFANSSLLWDIIKYYLHLPSFL  191

Query  503   -RTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFI  679
              +  K    P  A + + +P+    F PEF EF+++Q      SSG+L ++C+ +E  ++
Sbjct  192   SKLAKKLFLPSGAHIPDGLPTLRSTFTPEFIEFMRLQHSCNKFSSGNLYDTCKVLEGPYL  251

Query  680   DLIGKESK---TGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTS  847
             + + K S+      QWA+GP NPV+++   ++  RHK LEWLD+Q ++SV+ VSFG+T  
Sbjct  252   ETLAKFSRLLGIRKQWAVGPFNPVTISGEKDSKVRHKCLEWLDKQAQNSVILVSFGTTGY  311

Query  848   LSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvr  1027
             LS EQI EL  GLE+S QKFIWVVRD   G             +PEGYEERV+ RG++V+
Sbjct  312   LSMEQIKELAIGLEKSQQKFIWVVRDLLSG-------GEGEVRIPEGYEERVKERGIIVK  364

Query  1028  eWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGI  1207
             +WAPQLEIL H S GGF+SHCGWNSCMESI+MGVPIA WPM+ DQPRNA  +T+VLK+G+
Sbjct  365   DWAPQLEILAHSSTGGFISHCGWNSCMESITMGVPIATWPMNFDQPRNAVFVTDVLKIGV  424

Query  1208  SLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELES  1387
              + +W RR++ +    I   V+ L+AS EG EMR RA EL + +KE +  GG  + E++S
Sbjct  425   VVKNWDRRDDMIDSSTIKNVVENLMASTEGHEMRMRAMELGKQVKESVKDGGDHQKEMDS  484

Query  1388  FVAHITR  1408
             F+AH+TR
Sbjct  485   FIAHVTR  491



>ref|XP_008455780.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis melo]
Length=487

 Score =   360 bits (924),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 295/483 (61%), Gaps = 18/483 (4%)
 Frame = +2

Query  5     ILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRV  184
             I EN  K    + V+VVM+PLPAQGHLNQ LHLSRL++A  IPVH+ G ATH RQA HRV
Sbjct  8     ISENAGKNTHHLPVMVVMVPLPAQGHLNQLLHLSRLLSAFNIPVHFVGTATHNRQAQHRV  67

Query  185   HGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNL  361
                  ++   + FH   +P F SP PNP+ + KFP+ L+P+  A + HLRRP  A + +L
Sbjct  68    GA--EISNHLIQFHDFDIPIFPSPSPNPNTTHKFPSHLIPLMTAAAVHLRRPLAAFLSSL  125

Query  362   SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERT--GKPDVGPEA  535
             S   KR++VI DSLM  VVQ V ++ N E Y F  +SAF       ER   G  D   E+
Sbjct  126   SSKAKRLIVIHDSLMSSVVQVVDTIVNVESYNFHSVSAFAATLHCLERKGIGGGDDNCES  185

Query  536   AGVL---------NHMPSPEGCFIPEFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDL  685
                          N + S E CF  EF +FIK Q       + G + N+CR IE   + L
Sbjct  186   TKFYKEHVILKESNSVRSCENCFPTEFLDFIKSQFDQLPKKTCGKIYNTCRVIEGSSLKL  245

Query  686   IGKESKTGFQWAIGPLNPVSLTDS--INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNE  859
             I +       WA+GP NPV    +   ++++H  + WLD+QE  SV+++SFG+TT++ ++
Sbjct  246   IERIENEFNHWALGPFNPVKKLKNGERSSSKHSCMSWLDQQEPRSVMYISFGTTTTVEDK  305

Query  860   QITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAP  1039
             QI E+  GL  S QKFIW V            +  ++ ++PEGY + +  RG+V+REWAP
Sbjct  306   QIKEIAIGLARSHQKFIW-VIRDADKGDIFHDDNDKKPKLPEGYNDLIGDRGLVIREWAP  364

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             QLEIL H + GGFM+HCGWNSCMES++MGVP+AAWPMHSDQPRN  L+T +L++G+ + D
Sbjct  365   QLEILSHWATGGFMTHCGWNSCMESMTMGVPMAAWPMHSDQPRNTVLVTAILRVGVVVKD  424

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             W +  E V    + E VK+LI S EG E+R  A  + ++++  I  GG  R ELE+FV H
Sbjct  425   WDQGEEVVSALTVEEAVKRLIVSEEGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNH  484

Query  1400  ITR  1408
             ITR
Sbjct  485   ITR  487



>gb|AIE12481.1| UGT12 [Panax ginseng]
Length=467

 Score =   359 bits (921),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 294/465 (63%), Gaps = 16/465 (3%)
 Frame = +2

Query  26    GGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLA  205
             G     VVVVM+P  AQGH+NQ LHLSRLI+ + I +HY     + ++A  R+HGWD ++
Sbjct  15    GQNKAQVVVVMVPFAAQGHINQLLHLSRLISPYNITIHYVSTTAYTQKAKSRLHGWDSIS  74

Query  206   VPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVV  385
               N+HFH   +P+ +S      +ST F     P   A ++LR+P   L++ L    +R+V
Sbjct  75    AANIHFHEFHVPYVKS------SSTLFG----PSIEAAAYLRKPVAELLQALGPTAERLV  124

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSP  565
             VI D L+   VQD+  + NAE Y F  +SAF  +S+ WE  GKP       G ++ +P  
Sbjct  125   VIHDFLVSITVQDLVLVPNAEAYTFHGVSAFHVFSYFWEILGKPSSVFVDDGTIDELPLI  184

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIG-KESKTGF-QWAIGPLNP  739
             E  F PEF + I       +  SG + + CR +E  +IDL   K+   G  QWA+GP NP
Sbjct  185   ESAFSPEFVQHIDRNLAHANFMSGIIYDGCRSLEGKYIDLTATKDMMPGLKQWALGPFNP  244

Query  740   VSLT-DSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             V+LT +++  N RH  L+WLD+Q  +SV++VSFG+T  L  +Q+ EL  GLE+SGQKFIW
Sbjct  245   VTLTQNTVGPNQRHPCLKWLDQQAPNSVIYVSFGTTVCLVEQQVKELAIGLEQSGQKFIW  304

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
                  D             AE+P+GYEERV+G+G+VV++W PQ+EILGHPS GGF+SHCG
Sbjct  305   --LLRDADTQVLSQRELNSAELPKGYEERVKGQGMVVKDWVPQMEILGHPSTGGFLSHCG  362

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNS MES++MGVP+ AWPMHSDQPRN  LIT+ LK G+ + DWA RNE V    + +GV+
Sbjct  363   WNSLMESLTMGVPVGAWPMHSDQPRNTLLITKGLKTGLVVRDWADRNELVTSTTVEKGVR  422

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             KL+ S +GEEMR+ AAEL   L+  +  GG  R EL+SF+AHI R
Sbjct  423   KLMTSKQGEEMRKMAAELGSVLRGSMVKGGVTRMELDSFIAHINR  467



>ref|XP_008455787.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Cucumis 
melo]
Length=446

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 214/462 (46%), Positives = 297/462 (64%), Gaps = 25/462 (5%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             D  VVVVM+PL AQGHLNQ LHLSR I+A  IPVHY GA TH RQA  R+HGWDP  + N
Sbjct  4     DGQVVVVMVPLAAQGHLNQLLHLSRFISARNIPVHYIGATTHNRQAKLRIHGWDPSELAN  63

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVI  391
             LHFH  S+P    PPP+P A T+FP  L+P F  A +HLR P   L+ +LS   +R++VI
Sbjct  64    LHFHSFSIPPIPCPPPDPTAETRFPAHLIPSFRTAATHLRGPLKNLLHSLSPHSRRIIVI  123

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN-HMPSPE  568
              DSLM   V+D+ S+ NAE Y F  +SAF    +  E+  +   G E++ V +  +PS +
Sbjct  124   HDSLMASTVEDIDSIPNAESYNFHSVSAFAMAIYDLEQDQQTK-GMESSIVKDLDIPSLD  182

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GCF  EF EF+++Q       SG+L N+C+ +E  +++++ + +     WAIGP NP+ L
Sbjct  183   GCFTQEFWEFVELQFGGPRKFSGNLYNTCKTMEEPYLEILQRINHETKHWAIGPFNPLEL  242

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             + S + N H  LEWLD+Q+ +SV++VSFG+TT+L +EQI E+       G  F       
Sbjct  243   SSS-SHNIHPCLEWLDQQKANSVVYVSFGTTTALEDEQIAEIA----NKGDIF-------  290

Query  929   drgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
                         R+ E         ++ G+G+VVR+WAPQL IL H S GGF+SHCGWNS
Sbjct  291   --------NGEVRKCELPDGFEKRVKMEGKGLVVRDWAPQLAILSHDSTGGFVSHCGWNS  342

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CME+I+MGVP+ AWPMHSDQPRNA L+T+VL++G+ + +WA+R+E V    I + V+KL+
Sbjct  343   CMETITMGVPMVAWPMHSDQPRNAVLMTKVLRVGLLIREWAQRDELVMATTIEKAVRKLM  402

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             AS EG EMR+   EL+  +++ +   G  R E +SF++HITR
Sbjct  403   ASEEGHEMRKTVEELAVVMRQAVEENGVSRVEFDSFISHITR  444



>gb|KCW90135.1| hypothetical protein EUGRSUZ_A02326 [Eucalyptus grandis]
Length=463

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 231/465 (50%), Positives = 289/465 (62%), Gaps = 19/465 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A +GIPVHY G+A+H RQA  R H     A  ++ F
Sbjct  8     VTVIMVPLPAQGHLNQLLELAHLVACYGIPVHYVGSASHNRQARFRSHVPPSSAASDIRF  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   SP P+  +  KFP+QL P F ATS LR P  +LIR+LS   +RVVV+ DSL
Sbjct  68    HDLPTPPIPSPAPSLSSPYKFPSQLQPAFDATSSLRGPVASLIRSLSSGSRRVVVVHDSL  127

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVL--NHMPSPE  568
             M  VVQD  S+ N E+Y F  ISAFT   F WE  G    P+V  + A ++    +PS  
Sbjct  128   MASVVQDAASVPNTEIYEFNPISAFTLCWFTWESIGMAPPPEVEVDIAELIASKGLPSLL  187

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F   Q       SG + N+CR +E  F+DL    +  G     WAIGP   
Sbjct  188   DSSTDEFLKFYASQNECKKFHSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPS--  245

Query  740   VSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
                      + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV+
Sbjct  246   -------RRSAHGCMEWLDKQAPSSVMYVSFGTTTVLSDEQIREIAMGLEYSGQKFIWVL  298

Query  920   rdgdrgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             R+ D+ D+F  G  AR  +           R  GVVVR+WAPQLEILGHP+ GGF+SHCG
Sbjct  299   READKADIFGGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHPATGGFLSHCG  358

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + DW  +++ V    I   VK
Sbjct  359   WNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDLVKSSTIEGAVK  418

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              L+ S EGEE R+RAAEL   ++  +  GG  R EL+SF+AHI R
Sbjct  419   ALMVSEEGEEARKRAAELGAVVRGSMDEGGVSRAELDSFIAHICR  463



>ref|XP_010090213.1| Zeatin O-xylosyltransferase [Morus notabilis]
 gb|EXB39082.1| Zeatin O-xylosyltransferase [Morus notabilis]
Length=482

 Score =   357 bits (917),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 305/462 (66%), Gaps = 18/462 (4%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             P P+Q HLNQ  +LS +I++H IPVHY G+  H  Q   R +         + FH   +P
Sbjct  25    PFPSQSHLNQLFNLSHIISSHDIPVHYVGSTLHNAQVKSRANQALNDTKKMIQFHDFPIP  84

Query  242   HFQSPPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVVISDSLMGWVV  418
             HFQSP PN     KFP+ LMP F AT  HL++PF  ++  LS    RVVVI D LM  VV
Sbjct  85    HFQSPLPN---DIKFPSHLMPSFEATIKHLQQPFYDILTMLSKTATRVVVIHDPLMNSVV  141

Query  419   QDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEF  598
             QD  +  N E Y+F C+S    +++  +  G   +G +A     ++PS E     EFE F
Sbjct  142   QDSSTFPNTESYQFHCVSPLYHFTYVRDILG-VQIGHDADNKYANIPSLEKSITSEFEAF  200

Query  599   IKMQRPFWD----ASSGDLLNSCREIEALFIDLI---GKESKTGFQ-WAIGPLNPVSLTD  754
             +  Q  F +     +SG L N+CR +E+ F+D +    +ES    + WAIGPL  V+   
Sbjct  201   VAYQDQFVNQHIIKTSGHLYNTCRLLESTFLDFMLEMNRESDENVKMWAIGPLKTVTSFK  260

Query  755   SINTNR----HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             + + NR    HK LEWLD+QE +SVL++SFG+TT + +EQI EL  GLE+SG KF+WV+R
Sbjct  261   NRSPNRVNGEHKCLEWLDKQESNSVLYISFGTTTFMKDEQIRELAVGLEKSGVKFLWVLR  320

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D D+G+VFD+GE  RR ++P+G+E+RV+ +G+VVR+WAPQLEILGH S GGFMSHCGWNS
Sbjct  321   DADKGNVFDEGEV-RRPQLPQGFEDRVKEKGIVVRDWAPQLEILGHSSTGGFMSHCGWNS  379

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             C+ESIS+GVPIAAW MHSDQP NA L+T++LK+G+ + +WA+++E V    + E VK+L+
Sbjct  380   CLESISLGVPIAAWSMHSDQPINAVLMTDLLKIGVVIREWAKKDELVSSSVVEEFVKRLM  439

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              S EG E+R+RA EL   L++  A GG  R EL+SF+AHITR
Sbjct  440   KSEEGNEVRKRAEELGYELRKATAQGGVSRLELDSFIAHITR  481



>ref|XP_007145586.1| hypothetical protein PHAVU_007G251000g [Phaseolus vulgaris]
 sp|P56725.1|ZOX_PHAVU RecName: Full=Zeatin O-xylosyltransferase; AltName: Full=Zeatin 
O-beta-D-xylosyltransferase [Phaseolus vulgaris]
 gb|AAD51778.1|AF116858_1 zeatin O-xylosyltransferase [Phaseolus vulgaris]
 gb|ESW17580.1| hypothetical protein PHAVU_007G251000g [Phaseolus vulgaris]
Length=454

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 227/460 (49%), Positives = 306/460 (67%), Gaps = 13/460 (3%)
 Frame = +2

Query  35    DVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN  214
             +  VVV++LP P QGHLN FL LS LIAA  I VHY G  THIRQA  R H     A  N
Sbjct  6     ETKVVVLLLPFPVQGHLNPFLQLSHLIAAQNIAVHYVGTVTHIRQAKLRYHN----ATSN  61

Query  215   LHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVIS  394
             +HFH   +P + SPPPNP+    FP+ L+P F A++HLR P   L+++LS   KRVV+I+
Sbjct  62    IHFHAFEVPPYVSPPPNPE--DDFPSHLIPSFEASAHLREPVGKLLQSLSSQAKRVVLIN  119

Query  395   DSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGC  574
             DSLM  V QD  +  N E Y F+  SA  T    WE+ GKP   P A      +PS +GC
Sbjct  120   DSLMASVAQDAANFSNVERYCFQVFSALNTAGDFWEQMGKP---PLADFHFPDIPSLQGC  176

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--  748
                +F +F+  Q  F   ++GD+ N+ R IE  +++L+ + +     WA+GP  P+++  
Sbjct  177   ISAQFTDFLTAQNEFRKFNNGDIYNTSRVIEGPYVELLERFNGGKEVWALGPFTPLAVEK  236

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
              DSI  + H  +EWLD+QE  SV++VSFG+TT+L +EQI EL  GLE+S QKFIWV+RD 
Sbjct  237   KDSIGFS-HPCMEWLDKQEPSSVIYVSFGTTTALRDEQIQELATGLEQSKQKFIWVLRDA  295

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+GD+FD  EA +R E+PEG+EERV G G+VVR+WAPQ+EIL H S GGFMSHCGWNSC+
Sbjct  296   DKGDIFDGSEA-KRYELPEGFEERVEGMGLVVRDWAPQMEILSHSSTGGFMSHCGWNSCL  354

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ES++ GVP+A W MHSDQPRNA L+T+VLK+G+ + DW +R   V    I   V++L+ +
Sbjct  355   ESLTRGVPMATWAMHSDQPRNAVLVTDVLKVGLIVKDWEQRKSLVSASVIENAVRRLMET  414

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+E+R+RA +L   +   +  GG  R E+ SF+AHI+R
Sbjct  415   KEGDEIRKRAVKLKDEIHRSMDEGGVSRMEMASFIAHISR  454



>ref|XP_006357999.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=470

 Score =   355 bits (912),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 305/459 (66%), Gaps = 8/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V ++M+P PAQ HLNQ L L+ + ++ + +PVH+ G+ATH  QA  R +G  P  +  +H
Sbjct  16    VAIIMVPFPAQSHLNQQLQLACIFSSSYDLPVHFIGSATHNHQARVRANGLKPSDIAKIH  75

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH +  P F SP P+P+A TKFP+QL+P + A + LR P + L+R++S   +RVVV+ D 
Sbjct  76    FHDIPTPDFASPAPDPNAFTKFPSQLLPSYNACTLLRDPISLLLRDISSKSRRVVVVHDV  135

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYS-FHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             LM + VQDV SL NAE Y F C+S F  YS F     G P   P    +L  +P  E   
Sbjct  136   LMSYNVQDVTSLHNAESYIFNCVSVFFMYSSFICVPNGMP--IPLDEDLLKKLPILEPDA  193

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLT  751
               E  + ++ Q  F D   GDL NS + +E   +DL+ K   ++   QWAIGP+   +  
Sbjct  194   PEEINKLVEFQLQFRDIRVGDLYNSNKLLEGTSLDLMEKFASTQNKKQWAIGPIFLAAKV  253

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             D ++  R+K L+WLD Q   SVL+VSFGS+T+ S++++ EL  GLE S QKF+WV+RDGD
Sbjct  254   DHVSDKRNKCLDWLDNQPPRSVLYVSFGSSTTFSDKEVMELAMGLERSKQKFVWVLRDGD  313

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             RG++F   E ARR E+P+G+EERV G G+VVREWAPQLEIL H S GGFMSHCGWNSC+E
Sbjct  314   RGNIFS--EEARRFELPDGFEERVEGVGLVVREWAPQLEILAHSSTGGFMSHCGWNSCIE  371

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
              I+ GVP+AAW MHS+QP NA  +TE+LK G+ + +W +  E V    I + V+KL+AS 
Sbjct  372   CITAGVPMAAWAMHSEQPLNAFFVTEILKTGLLVREWKKHEELVTASAIEDVVRKLMASE  431

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+E+RRRA EL  +++E I  GG  + EL+SF+AHITR
Sbjct  432   EGDEIRRRAEELGAAVRESIEKGGASQLELDSFIAHITR  470



>ref|XP_009600299.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=467

 Score =   354 bits (909),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 223/472 (47%), Positives = 309/472 (65%), Gaps = 10/472 (2%)
 Frame = +2

Query  8     LENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRV  184
             +++  +  A+  + +V++P PAQ HLNQ L L+ + A+ + +PV+Y G+ATH  QA  R 
Sbjct  1     MDSSNENLANHEIAIVLVPFPAQSHLNQLLQLACIFASSYKLPVYYVGSATHNLQARVRA  60

Query  185   HGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHL-RRPFNALIRNL  361
             +  +P  +  +HFH L  P F SP P+P+A +KFP+QL P + A S L R+P  + +R++
Sbjct  61    NALNPSDIAKIHFHDLPTPDFASPTPDPNALSKFPSQLFPSYDANSKLLRKPIASFLRDV  120

Query  362   SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTY-SFHWERTGKPDVGPEAA  538
             S   +RV+V+ D LM + VQDV SL N E Y F C+S F  Y SF     G P   P   
Sbjct  121   SSKSRRVIVVHDVLMSYNVQDVSSLHNVESYIFNCVSVFFMYCSFICIPKGMP--IPLED  178

Query  539   GVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGF  712
              +L  +PS E     E  + +  Q  + D  SGDL NS + +E  F+DL+ K   ++   
Sbjct  179   ELLEKLPSLEADAPEEINKLVAFQLEYRDIRSGDLYNSNKVLEGTFLDLMAKFASTQNKK  238

Query  713   QWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             QWAIGP+ P  L D ++  R+  L+WLD Q   SVL+VSFGS+T+ S+++I EL  GLE 
Sbjct  239   QWAIGPILPTKL-DLVSNKRNVCLDWLDNQLPRSVLYVSFGSSTTFSDKEIMELAMGLER  297

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             S QKFIWV+RD DRGD+F   +  RR E+PEG+EERV+G G+VVREWAPQLEIL H S G
Sbjct  298   SEQKFIWVLRDADRGDIFKGED--RRFELPEGFEERVKGVGLVVREWAPQLEILAHSSTG  355

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
             GFMSHCGWNSC+ESI+MGVPI AWP+HS+QP NA  +TE+LK+G+ + +W +R E V   
Sbjct  356   GFMSHCGWNSCIESITMGVPIVAWPIHSEQPINAFFVTEILKIGVLVREWEKREELVCAS  415

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              I   V K +AS EG++ R+RA EL  ++++    GG  + EL+SF+AHITR
Sbjct  416   TIENVVSKFMASEEGDDFRKRAEELGAAVRQSREKGGSSQLELDSFIAHITR  467



>ref|XP_009796343.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=465

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 304/460 (66%), Gaps = 10/460 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLI-AAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             + +VM+P PAQ HLNQ L L+ +  +++  PV+Y G+ATH  QA  R +  +P  +  +H
Sbjct  11    IAIVMVPFPAQSHLNQLLQLACIFTSSYKFPVYYVGSATHNLQARVRANALNPSDIAKIH  70

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHL-RRPFNALIRNLSVDQKRVVVISD  397
             FH L  P F SP P+P+A +KFP+QL P + A S L R P  + +R++S   +RVVV+ D
Sbjct  71    FHDLPTPDFASPTPDPNALSKFPSQLFPSYDANSKLLREPIASFLRDISSKSRRVVVVHD  130

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTY-SFHWERTGKPDVGPEAAGVLNHMPSPEGC  574
              LM + VQDV SL N E Y F C+S F  Y SF     G     P    +L  +PS E  
Sbjct  131   VLMSYNVQDVSSLHNIESYIFNCVSVFFMYCSFICIPKGMS--IPLEDELLEKLPSLESD  188

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSL  748
                E  + +  Q  + D  SGDL NS + +E  F+DL+ K   ++   QWAIGP+ P  L
Sbjct  189   SPEEINKLVTFQLQYRDIRSGDLYNSNKVLEGNFLDLMAKFASTQNKKQWAIGPILPTKL  248

Query  749   TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
              D ++  R+  L+WLD Q   SVL+VSFGS+T+ S++++ EL  GLE S QKFIWV+RD 
Sbjct  249   -DHVSNKRNICLDWLDNQFPRSVLYVSFGSSTTFSDKEVKELAMGLERSEQKFIWVLRDA  307

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             DRGD+F   +  RR E+PEG+EERV+G G+VVREWAPQLEIL H S GGFMSHCGWNSC+
Sbjct  308   DRGDIFKGED--RRFELPEGFEERVKGVGLVVREWAPQLEILAHSSTGGFMSHCGWNSCI  365

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESI+MGVPIAAWPMHS+QP N+  +TE+LK+G+ + +W +R E V    I   V+KL+AS
Sbjct  366   ESITMGVPIAAWPMHSEQPINSFFVTEILKIGLIVREWEKREELVSASTIENVVRKLMAS  425

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+E+R+RA EL  ++++    GG  + EL+SF+AHITR
Sbjct  426   EEGDEIRKRAEELGAAVRQSTEKGGSSQLELDSFIAHITR  465



>ref|XP_010056810.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   353 bits (905),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 237/467 (51%), Positives = 307/467 (66%), Gaps = 13/467 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLH  220
             V V+M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ 
Sbjct  8     VAVIMVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VPPSSVPSDIR  66

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P   SP P+P++  KFP+ L P F ATS LR PF +L+R+LS   +RVVV+ DS
Sbjct  67    FHDFPTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLRGPFASLVRSLSSVSRRVVVVYDS  126

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSP  565
             LM  VVQD  S+ NAE+Y F  +SAFT   F WE  G    P+V  E A +++    PS 
Sbjct  127   LMASVVQDTGSVPNAEIYEFNSVSAFTLCWFTWESKGMAPPPEVEAEIAELISSKGFPSI  186

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLN  736
                F  EF +F   Q+     +SG + N+CR IE  F+DL    +  G     WAIGP N
Sbjct  187   LDSFTDEFMKFRASQKECKKFNSGCIYNTCRVIEGRFVDLFASATANGTATKHWAIGPFN  246

Query  737   PVSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             PV + +  +  + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIW
Sbjct  247   PVKVPEKRSRRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIW  306

Query  914   vvrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             V+R+ D+ D+F  G  AR  E           R  GV VR+WAPQLEILGHP+ GGF+SH
Sbjct  307   VLREADKTDIFGGGGEAREIELPQGFEEMAAARDLGVAVRDWAPQLEILGHPATGGFLSH  366

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMESISMGVPI AWPMHSDQPRNA LIT VLKMG+++ DW  +++ V    I   
Sbjct  367   CGWNSCMESISMGVPILAWPMHSDQPRNAVLITRVLKMGLTVKDWTSQHDVVKSTIIEGA  426

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             VK L+A+ EGEE+R+RAAEL  +++  +  GG  R EL+SF+AHI R
Sbjct  427   VKALMATEEGEEVRKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  473



>ref|XP_010668171.1| PREDICTED: zeatin O-glucosyltransferase-like [Beta vulgaris subsp. 
vulgaris]
Length=479

 Score =   353 bits (905),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 307/469 (65%), Gaps = 19/469 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPL--AVPNL  217
             V VV +PLP QGHLN FL LS LIAA+GIPVH+   A+H +QA  R HG D +   +  +
Sbjct  16    VAVVAIPLPIQGHLNPFLRLSHLIAAYGIPVHFVSFASHNQQAKVRAHGLDQINSTITMI  75

Query  218   HFHHLSMPHFQSPP-----PNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRV  382
             +FH    PHF   P        +  TKFPT +  +      L  P + LI +LS   KR+
Sbjct  76    NFHD---PHFIPLPSLTNTKQNNCITKFPTHVTRICDVCHLLEHPISELIGSLSAKFKRI  132

Query  383   VVISDSLMGWVV-QD-VPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHM  556
             +VI DSLM  +V QD V  + N E Y F   SAFT + F W    +      ++ + +++
Sbjct  133   IVIHDSLMASLVHQDAVKIISNVESYTFHTSSAFTIFFFMWHSMVEKPFNL-SSDIPHYV  191

Query  557   PSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGP  730
             PS +GC  PEFE+F   Q    + SSG L N+CR +E  ++DL+ +   +K    +AIGP
Sbjct  192   PSSKGCSSPEFEKFAADQYKLANLSSGRLYNTCRSLENKYMDLLTQLPANKNKKLFAIGP  251

Query  731   LNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
             +N +  T S NT++HK LEWLD QE DSV++VSFG+TTS+++EQI EL  GL+ S QKFI
Sbjct  252   VNRLINTSS-NTSKHKCLEWLDEQESDSVIYVSFGTTTSMTDEQIKELADGLDRSNQKFI  310

Query  911   WvvrdgdrgdvfddgEAA---RRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             WV+R+ D  ++F     A      ++ +GYEE VRGRG++V+ WAPQLEILGH ++GGF+
Sbjct  311   WVLREADEVNIFKKDGTAVGEHYDQLLKGYEEAVRGRGLMVKGWAPQLEILGHEAIGGFI  370

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNSC+ES+SMGVPIAAWP+HSDQP+N+ L+TEVLK+G+ + DWA R+E +    + 
Sbjct  371   SHCGWNSCLESLSMGVPIAAWPIHSDQPKNSMLVTEVLKVGVVVKDWANRDELITSSVVE  430

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               V++L+AS EGEE+R+RA EL  S++  +A GG    EL+SFVAHI R
Sbjct  431   SAVRRLMASKEGEELRKRARELGASVRGSVAKGGTSCLELDSFVAHIIR  479



>ref|XP_006351294.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X1 [Solanum 
tuberosum]
Length=474

 Score =   352 bits (903),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 215/466 (46%), Positives = 290/466 (62%), Gaps = 23/466 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +V++P   QGHLN  L+LSR+++++ +PV + G +T  RQA  R+ GWD L  P + F
Sbjct  21    VAIVIVPYLEQGHLNPLLNLSRILSSYKLPVFFLGTSTSNRQAKFRLSGWDILDFPTIRF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLM----PVFFATSHLRRPFNALIRNLSVDQKRVVVI  391
             H L        P  PD+ +     +M      F +   LR P    ++ +S   +R VVI
Sbjct  81    HDLV-------PVPPDSCSSVSAAVMEKIGSFFTSILLLREPIREFLQEVSSTYRRTVVI  133

Query  392   SDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEG  571
             +DS M WVVQD  S+ N E Y F  IS FT  SF  E T K    P  A ++  +P  E 
Sbjct  134   NDSGMSWVVQDAVSIPNTECYCFHTISVFTALSFACETTKKLLPSP-VAEIIAELPPREN  192

Query  572   CFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWAIGPLNPVS  745
              F  E  E+IKMQR   +  S  L NSC+EIE +FIDL  + +E+K   QWAIGPLNPV 
Sbjct  193   TFDSETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLLEVQRENK---QWAIGPLNPVK  249

Query  746   LTDSINTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             ++   ++ + H+   WL++Q+ +SV++VSFGSTT+LS EQI EL  GLE+S QKFIWV+R
Sbjct  250   ISKKKSSEQTHECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKFIWVLR  309

Query  923   dgdrgdvfddgEAARRAevpe----gyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
               D+    +     R +            R +G G + + W+PQLEIL H S+GGFMSHC
Sbjct  310   GADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGGFMSHC  369

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSC+ESISMGVP+AAWP+HSDQPRN  LIT+VLK+GI + DW  R+E V   +I   V
Sbjct  370   GWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAKIENVV  429

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + L+ SAEGEE+RRR  ELS ++K+ + + G  R E++SFVAHITR
Sbjct  430   RNLMGSAEGEELRRRVTELSSAVKKSV-MNGASRKEMDSFVAHITR  474



>ref|XP_004236592.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=471

 Score =   352 bits (902),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 303/459 (66%), Gaps = 8/459 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V ++M+P PAQ HLNQ L L+ + ++ + +PVH+  +A H  QA  R +G     +  +H
Sbjct  17    VSIIMVPFPAQSHLNQQLQLACIFSSSYHLPVHFISSAAHNHQARVRANGLKQSDIDKIH  76

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH +  P F SP P+P+A  KFP+QL+P + A + LR+P + L+ ++S   +RVVV+ D 
Sbjct  77    FHDIPTPDFASPAPDPNAFNKFPSQLVPSYNACTLLRQPISTLLHDISSKSRRVVVVHDV  136

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYS-FHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             LM + VQDV SL NAE Y F C+S F  YS F     G P   P    +L  +P  E   
Sbjct  137   LMSYTVQDVASLHNAESYIFNCVSVFCMYSSFICLPNGMP--IPLDEHLLQKLPILEPDA  194

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNPVSLT  751
               E  + ++ Q  + D  +GDL NS + +E   IDL+ +    +   QWAIGP+   +  
Sbjct  195   PEEINKLVEFQLKYTDIRAGDLYNSNKILEGTCIDLMERFASKQNKKQWAIGPIFLAAKV  254

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             D ++  R+K L+WLD+Q   SVL+VSFGS+T+ S++++ EL  GLE S QKF+WV+RDGD
Sbjct  255   DHVSDKRNKCLDWLDKQAPRSVLYVSFGSSTTFSDKEVMELAMGLERSKQKFVWVLRDGD  314

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             RG++F   E ARR E+P+G+EERV G G+VVREWAPQLEILGH S GGFMSHCGWNSC+E
Sbjct  315   RGNIFS--EEARRFELPDGFEERVEGVGLVVREWAPQLEILGHSSTGGFMSHCGWNSCIE  372

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
              ++MGVP+AAW MHS+QP NA  +TE+LK G+ + DW +  E V    I   V+KL+AS 
Sbjct  373   CVTMGVPMAAWAMHSEQPLNAFFVTEILKTGLVVRDWKKHEEIVTASAIENVVRKLMASE  432

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+E+R+RA EL  +++E I  GG  + EL+SF+AHITR
Sbjct  433   EGDEIRKRAEELGAAVRESIEKGGASQVELDSFIAHITR  471



>ref|XP_009785030.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=481

 Score =   352 bits (902),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 218/483 (45%), Positives = 298/483 (62%), Gaps = 29/483 (6%)
 Frame = +2

Query  26    GGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLA  205
             G  D  + +VM+P PAQGHLNQFLHLSRL++++ IP++Y G +T I Q   R+HGWD   
Sbjct  5     GVEDDQITMVMVPFPAQGHLNQFLHLSRLVSSYHIPIYYVGFSTEISQVKARIHGWDLAT  64

Query  206   VPN-LHFHHLSMP-HFQSPPP---NPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
               N +HF     P  F +P P   + ++S      +  V  A+  LR P +A I+ LS  
Sbjct  65    ATNYIHFQEFPTPSSFMAPAPSNCSNNSSETISKLIASVLDASLTLREPVSAFIKKLSSI  124

Query  371   QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWE-------------RTG  511
              +RVVVI DS+M   VQDV S++NAE Y F  ISAF   S  W+             +  
Sbjct  125   SRRVVVIYDSMMASTVQDVVSIKNAEAYCFHAISAFANSSLLWDIIKYYLHLPSFLAKLA  184

Query  512   KPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIG  691
             K    P    + + +P+    F PEF EF+++Q      SSG+L ++C+ +E  +++ + 
Sbjct  185   KKLFLPSGVHLPDGLPTLRSTFTPEFIEFMRLQFSCNKFSSGNLYDTCKVLEGPYLETLA  244

Query  692   KESK---TGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNE  859
             K S+      QWA+GP NPV+++   ++  RHK LEWLD+Q ++SV+ VSFG+T  LS E
Sbjct  245   KFSRLLGIRKQWAVGPFNPVTISTGKDSKVRHKCLEWLDKQSQNSVILVSFGTTGYLSME  304

Query  860   QITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAP  1039
             QI EL  GLE+S QKFIWVVRD   G             +PEGYEERV+ RG++V++WAP
Sbjct  305   QIKELAIGLEKSQQKFIWVVRDVLSG-------GEGEVRIPEGYEERVKERGIIVKDWAP  357

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             QLEIL H S GGFMSHCGWNSCMESI+MGVPIA W M  DQPRNA  +T VLK+G+ +  
Sbjct  358   QLEILAHSSTGGFMSHCGWNSCMESITMGVPIATWSMRFDQPRNAVFVTNVLKIGVVVKH  417

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             W R ++ +    I   V+ L+AS EG EMR RA EL + +KE +  GG  + E++SF++H
Sbjct  418   WDRSDDIIDSCTIKNAVENLMASTEGHEMRMRAMELGKQVKESVKDGGDHQLEMDSFISH  477

Query  1400  ITR  1408
             +TR
Sbjct  478   VTR  480



>gb|EPS60351.1| hypothetical protein M569_14451, partial [Genlisea aurea]
Length=445

 Score =   350 bits (899),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 282/459 (61%), Gaps = 20/459 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLS-RLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V V+M P P  GH NQ LHLS RL A  G+ VH+A  A   R+   R+ GWDP +    H
Sbjct  3     VAVLMAPFPLNGHHNQLLHLSGRLSAVPGLAVHFASTADLNRRTRDRIPGWDPRSAVVFH  62

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
                   P    P    +++  F  QL  +  ++S LRR F  +IR L  + +RV+V+ DS
Sbjct  63    ----DFP----PTMETNSAADFSEQLPALISSSSSLRRHFADVIRRLCAEYRRVIVVYDS  114

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCF  577
             LMG  VQD  S +NAE Y F  +SAFT + F WE  GKP DV  +   VL  +PS +GCF
Sbjct  115   LMGVCVQDFASFENAEAYVFHSVSAFTMFFFMWENAGKPFDVDRD---VLTDLPSLDGCF  171

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTG--FQWAIGPLNPVSLT  751
               EF    + Q  F +  SG + N+CR IE  F+ ++ K    G   QWA+GP N V   
Sbjct  172   ATEFFRLAEEQYRFTEYCSGRIYNTCRIIEDEFLKMLEKPEIAGDKKQWALGPFNQVYYG  231

Query  752   DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
             +   + RHKSL+WLD Q + SV+ V FG+TTS S+ QI EL  GLE SG KFIWV+R+ D
Sbjct  232   NDCESWRHKSLKWLDEQSEKSVILVCFGTTTSFSSVQIWELAVGLEMSGHKFIWVLREHD  291

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
                            +P+ YEER+ GRGV+V +WAPQL+IL H S GGFMSHCGWNSC+E
Sbjct  292   AKGKLFIY-----LFIPKNYEERIGGRGVMVTDWAPQLDILSHSSTGGFMSHCGWNSCIE  346

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SIS GVPIAAWP+HSDQPRNA LIT +LK+G ++ DW RR E V   EI   VK+L+   
Sbjct  347   SISAGVPIAAWPIHSDQPRNAVLITGILKIGFAVRDWDRRKETVTSSEIANSVKRLMEEG  406

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EG+EMRRRA +L   +   +A GG  R E++SF+AH+TR
Sbjct  407   EGKEMRRRAEKLGGDVAAAVAEGGMTRREIDSFIAHVTR  445



>ref|XP_004249250.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X1 [Solanum 
lycopersicum]
Length=471

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 211/460 (46%), Positives = 283/460 (62%), Gaps = 14/460 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             + +V++P   QGHLN  L+LSR+I+++ +PV + G +T  RQA  R+ GW+ L  P + F
Sbjct  21    IAIVIVPYLEQGHLNPLLNLSRIISSYKLPVFFLGTSTSNRQAKFRLSGWNILDFPTIRF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L       P      S     +L   F +   LR P    ++ +S   +R VVI+D+ 
Sbjct  81    HDLV------PGSCSSVSASVMEKLGSFFTSILLLREPIREFLQEVSSTYRRTVVINDTG  134

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M WVVQD  S+ N E Y F  ISAFT  SF  E T KP   P  A ++  +P  E  F  
Sbjct  135   MSWVVQDAVSIPNTECYCFHTISAFTALSFACEATKKPLPSP-VAEIIAELPPKENTFDS  193

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             E  E+I MQ    D  S  L NSC+EIE +FI+L+ +E +   QWAIGP+ PV ++   +
Sbjct  194   ETIEYIMMQHESRDFYSVGLHNSCKEIEGVFIELL-EEQRENKQWAIGPVYPVEISKRKS  252

Query  764   TN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgd  940
             +   H+   WLD+Q+ +SV++VSFGSTT+LS EQI EL  GLE+S QKFIWV+R  D+  
Sbjct  253   SELTHECFSWLDKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADKKG  312

Query  941   vfddgEAARRAevpe----gyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
               +     R +            + +G G + + WAPQLEIL H S+GGFMSHCGWNSC+
Sbjct  313   GDNIENVERGSNSDLPDGFEERIKEKGVGFIEKNWAPQLEILAHGSIGGFMSHCGWNSCI  372

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVP+AAWP+HSDQPRN  LIT+VLK+GI + DW  R E V   +I   V+ L+ S
Sbjct  373   ESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRYELVSAAKIKNAVRFLMDS  432

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             AEGEE+RRR  ELS S+K+ + + G  R E++SFVAHITR
Sbjct  433   AEGEELRRRVTELSSSVKKSV-MNGASRKEMDSFVAHITR  471



>ref|XP_010112354.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXC60340.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=572

 Score =   354 bits (908),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 216/455 (47%), Positives = 293/455 (64%), Gaps = 14/455 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG-WDPLAVPNLH  220
             VVVVM+PLP QGHL+QF+ LS LI A  IPVH+ GAAT   Q   R+HG  +      +H
Sbjct  20    VVVVMVPLPWQGHLHQFISLSHLITARAIPVHFVGAATENNQGKLRIHGGINTTNEKMIH  79

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH   +P   + PP+P ++  FP  L+P F AT HL  P  AL+R LS + +RVVV+ D 
Sbjct  80    FHDFVVPPCITTPPSPTSAHNFPIHLIPTFHATRHLGEPVAALLRQLSSEFRRVVVVHDF  139

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFH-WERTGKPDVGPEAAGVL---NHMPSPE  568
             L   +V  +  + N E Y  + +SAF     H  +R  K ++       L     +PS E
Sbjct  140   LTSSLVHGIGPIPNVESYALQGVSAFAISLLHSRDRDEKSELDQLDIADLIIPEDVPSME  199

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL  748
             GC  PE  E    +  F   SSG+L N+   IE  +++L+ +       WAIGPLN V+L
Sbjct  200   GCVPPEIMELSFRECTFVKLSSGNLYNTSMAIERPYVNLMARILPNKKHWAIGPLNMVTL  259

Query  749   TDS-INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrd  925
             ++  ++  RH  LEWLD+Q   SV++VSFG+TT+ ++EQI EL  GLE+SGQKFIWV+RD
Sbjct  260   SEKKVSNGRHMCLEWLDKQAPRSVIYVSFGTTTTFTDEQIGELALGLEQSGQKFIWVLRD  319

Query  926   gdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSC  1105
              +        +A R+ E+P+G+EER +  G+V+R+ APQLEILGHPS GGF+SHCGWNSC
Sbjct  320   AE--------KATRKVELPKGFEERAKDVGIVMRDLAPQLEILGHPSTGGFLSHCGWNSC  371

Query  1106  MESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIa  1285
             +ESI+MGVPI AWPMHSDQPRN +LIT+VLK+G ++ DW+RR E      I +GV+KL+A
Sbjct  372   IESIAMGVPIGAWPMHSDQPRNTSLITQVLKVGTAVRDWSRRFELATASTIADGVRKLMA  431

Query  1286  saegeemrrraaeLSQSLKEPIAVGGGGRNELESF  1390
             S EG  MR++AAEL  +L++ +A GG    E +SF
Sbjct  432   STEGNAMRKKAAELGAALRDSLAEGGDSHKEFDSF  466



>ref|XP_010910133.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Elaeis 
guineensis]
Length=471

 Score =   349 bits (896),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 224/463 (48%), Positives = 307/463 (66%), Gaps = 11/463 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P PAQGHLNQ LHLS L++  G+ VHYA + +HIRQA  R+ GW P ++  +HF
Sbjct  12    VAVVMVPFPAQGHLNQLLHLSLLLSTRGLTVHYAASPSHIRQAKSRLQGWQPASLHAIHF  71

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F +PPP+P+A+T FP+ L P++ +T HLR P  +L+R+LS   +R+VVI D L
Sbjct  72    HDLPIPPFSTPPPDPNAATTFPSHLQPLWVSTLHLRSPLVSLLRSLSAVSRRLVVIYDPL  131

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHW---ERTGKPDVGPEAAGVLNHMPSPEGC  574
             + +  Q+  +L NAE+Y F  +SAF   SF W   + +  P        +LN   S + C
Sbjct  132   VSFAAQETATLPNAEVYAFNSVSAFFHLSFRWSFQDESALPK-PKHLETILNQ--SFDDC  188

Query  575   FIPEFEEFIKMQRPFWDA--SSGDLLNSCREIEALFIDLIGKESKTGFQ---WAIGPLNP  739
             F  EF EF  M R   D+  + G L+N+CR IE   +DL+ ++S    +   +AIGP NP
Sbjct  189   FTNEFLEFATMNRVLQDSVVAEGSLINTCRPIEGELVDLLAEDSFYSGKKKLFAIGPFNP  248

Query  740   VSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
             V+     +  RH  LEWLD+Q   SV++VSFG+ +++ +EQI EL  GL  SGQ+FIWV+
Sbjct  249   VTTPQGDSGRRHACLEWLDKQPPASVVYVSFGTASTMPDEQINELAIGLRRSGQRFIWVL  308

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             RD D GD++ +   +R  ++   YE  V G G+VVR WAPQLEIL HP+ GGF+SHCGWN
Sbjct  309   RDADVGDIYAECVESRERKLSPDYEREVEGVGMVVRGWAPQLEILAHPATGGFISHCGWN  368

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMES+SMGVPI AWPMHSDQP N  L+TE LK+G+   +W RR E +   EI E +K++
Sbjct  369   SCMESLSMGVPIMAWPMHSDQPGNTVLVTEYLKVGVVAREWDRRKEILPAGEIEESIKRV  428

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + S EG+E+RRRA  L  +++E  + GG  R EL+SFVAH+TR
Sbjct  429   MVSEEGQEIRRRAKALGNAVREAASEGGSSRAELDSFVAHVTR  471



>gb|KCW90115.1| hypothetical protein EUGRSUZ_A02308, partial [Eucalyptus grandis]
Length=440

 Score =   348 bits (892),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 206/420 (49%), Positives = 268/420 (64%), Gaps = 11/420 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+PLPAQGHLNQ L L+ L++++G+PVHY G+ATH RQA  R H     A  ++ FH   
Sbjct  1     MVPLPAQGHLNQLLQLAHLVSSYGVPVHYVGSATHNRQAKLRSHVPPSSAPGDIRFHDFP  60

Query  236   MPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWV  415
              P   SP P+  +  KFP+ L P F A   LR P  + +++LS   +RVVV+ DSLM  V
Sbjct  61    TPPIPSPAPSLSSPHKFPSHLQPAFDAALSLRSPVASFVQSLSSGSRRVVVVHDSLMASV  120

Query  416   VQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCFI  580
             VQD  S+ NAE+Y F+ ISAFT  SF WER G    P+V  + A +++    PS +    
Sbjct  121   VQDAASVPNAEIYEFKTISAFTLCSFKWERIGMAPPPEVELDIAELISSKGFPSIQDSST  180

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLT  751
              EF +F   Q+     +SG + N+CR +E  F+DL    +  G     WAIGP NPV + 
Sbjct  181   DEFLKFRASQKECKKLNSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNPVKVP  240

Query  752   DSINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             +  +T + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIWV+R+ 
Sbjct  241   EKTSTRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIWVLREA  300

Query  929   drgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D+ D+F  G  AR              R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNS
Sbjct  301   DKADIFGGGGEARIIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWNS  360

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + DW  +++ V    I   VK L+
Sbjct  361   CMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDVVKSSIIEGAVKALM  420



>gb|KCW90124.1| hypothetical protein EUGRSUZ_A02314 [Eucalyptus grandis]
Length=462

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 235/463 (51%), Positives = 304/463 (66%), Gaps = 13/463 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLHFHHL  232
             M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ FH  
Sbjct  1     MVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VPPSSVPSDIRFHDF  59

Query  233   SMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGW  412
               P   SP P+P++  KFP+ L P F ATS LR PF +L+R+LS   +RVVV+ DSLM  
Sbjct  60    PTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLRGPFASLVRSLSSVSRRVVVVYDSLMAS  119

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCF  577
             VVQD  S+ NAE+Y F  +SAFT   F WE  G    P+V  E A +++    PS    F
Sbjct  120   VVQDTGSVPNAEIYEFNSVSAFTLCWFTWESKGMAPPPEVEAEIAELISSKGFPSILDSF  179

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSL  748
               EF +F   Q+     +SG + N+CR IE  F+DL    +  G     WAIGP NPV +
Sbjct  180   TDEFMKFRASQKECKKFNSGCIYNTCRVIEGRFVDLFASATANGTATKHWAIGPFNPVKV  239

Query  749   TDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrd  925
              +  +  + H  +EWLD+Q   SV++VSFG+TT+LS+EQI E+  GLE SGQKFIWV+R+
Sbjct  240   PEKRSRRSAHWCMEWLDKQAPSSVIYVSFGTTTALSDEQIREIAMGLERSGQKFIWVLRE  299

Query  926   gdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
              D+ D+F  G  AR  E           R  GV VR+WAPQLEILGHP+ GGF+SHCGWN
Sbjct  300   ADKTDIFGGGGEAREIELPQGFEEMAAARDLGVAVRDWAPQLEILGHPATGGFLSHCGWN  359

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESISMGVPI AWPMHSDQPRNA LIT VLKMG+++ DW  +++ V    I   VK L
Sbjct  360   SCMESISMGVPILAWPMHSDQPRNAVLITRVLKMGLTVKDWTSQHDVVKSTIIEGAVKAL  419

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +A+ EGEE+R+RAAEL  +++  +  GG  R EL+SF+AHI R
Sbjct  420   MATEEGEEVRKRAAELGAAVRGSMDEGGVSRAELDSFIAHIAR  462



>ref|XP_010090218.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB39087.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=477

 Score =   345 bits (884),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 225/458 (49%), Positives = 298/458 (65%), Gaps = 18/458 (4%)
 Frame = +2

Query  74    QGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQS  253
             Q HLNQ L LS +I++H IPVHY G+  HI Q   R +         + FH   +PHF S
Sbjct  24    QSHLNQLLQLSHIISSHKIPVHYVGSTLHISQVKSRANQALNDTKTLIQFHDFPIPHFPS  83

Query  254   PPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVP  430
             P P     TKF + LMP F A+  +LR PF  L+  LS    RVV+I D +M  VVQD  
Sbjct  84    PLP---YDTKFVSHLMPSFEASVKYLREPFANLLTLLSKTATRVVIIHDPMMTSVVQDSS  140

Query  431   SLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQ  610
             +L N E Y F C+S+F  ++   +  G   +  +      ++PS E    PEFE FI  Q
Sbjct  141   TLPNTESYHFHCVSSFYHFAKLRDTLG-IQIRHDGDNDPKNIPSCEKSLTPEFEAFIGYQ  199

Query  611   RPFWDA--SSGDLLNSCREIEALFIDLI---GKESKTGFQ-WAIGPLNPVSLTDSINTNR  772
               F     +SG L N+CR IE+ F+D I    +ES    + WAIGPL  V+   + + NR
Sbjct  200   VQFMKKMKTSGHLYNACRLIESDFLDFILEKARESDEDVKMWAIGPLETVTSFKNRSGNR  259

Query  773   ------HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                   HK LEWLD+QE++SVL++SFG+TT + +EQI EL  GLE+SG KF+WV+RD D+
Sbjct  260   VDSQGQHKCLEWLDKQERNSVLYISFGTTTFIKDEQIRELAIGLEKSGVKFLWVLRDADK  319

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             G+VFD+GE  RR ++P+G+EERV+ +G+VVR+WAPQLEILGH S GGFMSHCGWNSC+ES
Sbjct  320   GNVFDEGEV-RRPQLPQGFEERVKEKGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCVES  378

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             IS+GVPIAAWPMHSDQP NA  IT VLK+G+ + +WA+++E V    I + VK+L+ S E
Sbjct  379   ISLGVPIAAWPMHSDQPMNAVFITNVLKVGVLVREWAKKDELVSSSVIEKVVKRLMKSEE  438

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+ A EL   L++    GG  R EL+SF+AH+TR
Sbjct  439   GDEMRKMAEELGNELRKATDEGGVSRMELDSFIAHVTR  476



>gb|KCW90136.1| hypothetical protein EUGRSUZ_A02328, partial [Eucalyptus grandis]
Length=462

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 224/454 (49%), Positives = 283/454 (62%), Gaps = 11/454 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A +GIPVHY G+A+H RQA  R H     A  ++ F
Sbjct  8     VTVIMVPLPAQGHLNQLLELAHLVACYGIPVHYVGSASHNRQAKFRSHVPPSSAASDIRF  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   SP P+  +  KFP+ L P F ATS LR P  +LIR+LS   +RVVV+ DSL
Sbjct  68    HDLPTPPIPSPAPSLSSPHKFPSHLQPAFDATSSLRGPVASLIRSLSSGSRRVVVVYDSL  127

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVL--NHMPSPE  568
             M  VVQD  S+ NAE+Y F  ISAFT   F WE  G    P+V  +   ++     PSP 
Sbjct  128   MASVVQDAASVPNAEIYEFNPISAFTLCWFTWESIGMAPPPEVEIDIVELIASKGFPSPL  187

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F   Q       SG + N+CR +E  F+DL    +  G     WAIGP NP
Sbjct  188   DSSTDEFLKFAASQNECKKFHSGCIHNTCRVVEGRFVDLYASATANGTATKHWAIGPFNP  247

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + +  +  + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV
Sbjct  248   VKVPEKRSRRSAHGCMEWLDKQATSSVMYVSFGTTTVLSDEQIREIAMGLEYSGQKFIWV  307

Query  917   vrdgdrgdvfddgEAAR--RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR  +           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  308   LREADKVDIFSGGGEARIIQLPQGFEEMVAARDLGVVVRDWAPQLEILGHPATGGFLSHC  367

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQP NA LIT VLK+G+ + D   +++ V    I   V
Sbjct  368   GWNSCMESISMGVPILAWPMHSDQPWNAVLITRVLKIGLIVKDLMSQDDLVKSSSIEGAV  427

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGR  1372
             K L+ S EGEE R+RAAEL  +++  +  GG  R
Sbjct  428   KALMVSEEGEEARKRAAELGAAVRGSMDEGGVSR  461



>ref|XP_009792172.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=484

 Score =   343 bits (880),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 222/482 (46%), Positives = 301/482 (62%), Gaps = 30/482 (6%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHG---IPVHYAGAATHIRQATHRVHGWDPLAVP  211
              VVVVM+PLPAQGHL   L L+R I +     IPVHY G+ATH+RQA  R HGWDPL  P
Sbjct  7     NVVVVMIPLPAQGHLQPLLELARRILSSSNFTIPVHYVGSATHLRQAQSRAHGWDPLTTP  66

Query  212   NLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQ--KRVV  385
             NLHF    MP   + P  PD +  +P+ L+P F+A    R+P   L++NLS     KRVV
Sbjct  67    NLHFSEFQMPTLDNIP--PDTNDFYPSNLIPSFYAAMEFRQPVADLVKNLSAADKVKRVV  124

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGP-----EAAGVLN  550
             VI D LM WVVQDV ++ N E+Y F  +SA    S   E   K +V P     + A +L 
Sbjct  125   VIHDILMSWVVQDVVAIPNTEMYFFHAVSALDVCSRILE--AKLNVDPVTPPADVAEILQ  182

Query  551   HMPSPE---GCFIPEFEEFIKMQRPFWDASSG-DLLNSCREIEALFIDLIGKESKTGFQ-  715
              + S E       P   ++++ Q       SG ++ ++C+ I+ +++DL+ +  K+  + 
Sbjct  183   ELASMEPGSDSPPPLMVKYVEKQMSCAVNYSGLNIFSTCKPIDGIYLDLMQQAFKSYDEH  242

Query  716   ---WAIGP-LNPVSLTDSINTN------RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQI  865
                W +G  +NP+ +  +I  +      RH  L+WLD+QE +SV+ VSFGS  S ++EQI
Sbjct  243   WKTWGLGLFMNPLEMEQNIRKDTTSTLPRHHLLQWLDKQEPNSVMLVSFGSAASFTDEQI  302

Query  866   TELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevp-egyeervrgrgvvvreWAPQ  1042
              EL  GLE+S QKFIW++++ DR +VF D    R      EGYEERV GRG+V R WAPQ
Sbjct  303   RELALGLEQSQQKFIWILKEADRANVFADENINRTTFALPEGYEERVEGRGMVERGWAPQ  362

Query  1043  LEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDW  1222
             LE+LGH S GG++ HCGWNS MESISMGVPIAAWP+H+D PR A L+T+ LK+GI + DW
Sbjct  363   LEVLGHASTGGYLCHCGWNSVMESISMGVPIAAWPLHTDHPRTALLLTKGLKIGIYVRDW  422

Query  1223  ARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHI  1402
             ARRNE V    I   VK L+ S EGE +R++AAEL  ++K     GG  + ++ESF+++I
Sbjct  423   ARRNELVKAETIHNAVKTLMDSPEGENLRQKAAELKDAVKASFMDGGATKKDIESFMSYI  482

Query  1403  TR  1408
             TR
Sbjct  483   TR  484



>gb|EYU18708.1| hypothetical protein MIMGU_mgv1a019962mg [Erythranthe guttata]
Length=484

 Score =   343 bits (879),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 294/458 (64%), Gaps = 8/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+++P PAQGHLNQ L LS LI+++ IPVHY G+A H RQA  R +G +P  V  ++F
Sbjct  29    VTVIIVPFPAQGHLNQMLQLSCLISSYSIPVHYVGSAVHNRQAQLRSNGLNPNDVAGINF  88

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F SPPP+P+++ KFP QL P F AT +LR+P    +R +S   +RVVVI D L
Sbjct  89    HDLPIPPFASPPPDPNSANKFPAQLQPAFDATLNLRQPLADFMRTMSEKHRRVVVIHDPL  148

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             +  VV+D+ S+ NAE Y F CISAF    + +E  GKP   P     L  +P+ E C   
Sbjct  149   IASVVEDIVSIPNAESYAFNCISAFCDVKYLFEMMGKPCPVPR----LQELPTIEECITD  204

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
                 FI +Q       +GDL N+CR +E  ++D++  E   G +  WAIGPL P  L + 
Sbjct  205   GVLRFIALQNEGLQLRNGDLHNTCRLLEDPYLDILESEEIAGGRKSWAIGPLIPAKLPEK  264

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
              +  RH  L WLD+QE  SV++V+FG+TT+L++E+I  +  GLE+S  KF+W V      
Sbjct  265   TDGRRHDCLTWLDKQEPKSVMYVTFGTTTTLTDEEIEVVANGLEQSKHKFLW-VLREADK  323

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
                 DGE  R  ++P G+E RV G G+V REWAPQ EIL H SVGGFMSHCGWNSC+ESI
Sbjct  324   GNVFDGEERREIQLPSGFERRVDGVGMVFREWAPQPEILAHESVGGFMSHCGWNSCIESI  383

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG-VKKLIasae  1294
             +MGVPIA WPMHSDQP NA L+TE+L+ G+ + +W +  E V      E  V++L+ S E
Sbjct  384   TMGVPIATWPMHSDQPTNAVLVTEILRTGLCVKEWTKEREMVVIASTVESIVRRLMGSEE  443

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G E+R+RA +L+  ++     GG  R EL+SFVAHITR
Sbjct  444   GAEVRKRAEDLAAVVRRATEEGGASRLELDSFVAHITR  481



>ref|XP_008794220.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Phoenix 
dactylifera]
Length=471

 Score =   341 bits (875),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 303/462 (66%), Gaps = 9/462 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P  AQGHLNQ LHLS L++A G+ VHYA   + IRQA  R+ GW P A+  +HF
Sbjct  12    VAVVMVPFAAQGHLNQLLHLSLLLSARGLAVHYAAPPSQIRQAKSRLQGWQPAALHAIHF  71

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F +PPP+P+A+TKFP  L+P++ +T  LR P  +L  +LS   +R+VV+ D L
Sbjct  72    HDLPIPPFSTPPPDPNAATKFPNHLIPLWESTLQLRSPLISLFHSLSAVSRRLVVVYDPL  131

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             + +  Q+  +L NAE+Y F C+ AF   S+      +P              S + CF  
Sbjct  132   LSFAAQEAATLPNAEVYGFHCVPAFFHLSYKSSVQDEPAQPKPKHLEAILCQSFDDCFTN  191

Query  584   EFEEFIKMQRPFWD--ASSGDLLNSCREIEALFIDLIGKE-----SKTGFQWAIGPLNPV  742
             EF EF+   R   D  A+ G L+N+CR IE   +DL+ ++      K  F  AIGPLNPV
Sbjct  192   EFLEFVTTHRVLPDSIAADGGLMNTCRPIEGELVDLLAEDPFYRGKKKLF--AIGPLNPV  249

Query  743   SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
             +        RH  LEWLD+Q   SV++VSFG+T+++ +EQI EL  G + SGQ+FIWV+R
Sbjct  250   TTPKGDGGRRHACLEWLDKQPPASVVYVSFGTTSTMLDEQINELAIGFQRSGQRFIWVLR  309

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D D GD++ + E +R  ++P  YE +V G G+VVR WAPQLEIL HP+ GGFMSHCGWNS
Sbjct  310   DADIGDIYAECEESRERKLPPDYERKVEGVGMVVRGWAPQLEILAHPATGGFMSHCGWNS  369

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMES+SMGVP+ AWPMHSDQP NA L+TE LK+G+   +WARR E +   EI E +K+++
Sbjct  370   CMESLSMGVPVMAWPMHSDQPSNAVLVTEFLKVGVVAREWARRKEILPAGEIEESIKRVM  429

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              S EG+E+RRRA  L  +++E  + GG  R EL+SF+AH++R
Sbjct  430   VSQEGQEIRRRAKALGNAVREAASEGGSSRAELDSFIAHVSR  471



>gb|KGN54644.1| hypothetical protein Csa_4G415920 [Cucumis sativus]
Length=489

 Score =   340 bits (872),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 216/489 (44%), Positives = 299/489 (61%), Gaps = 28/489 (6%)
 Frame = +2

Query  5     ILENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRV  184
             I EN  K    + V+VVM+PLP QGHLNQ LHLSRL++A  IPVH+   ATH RQA HR+
Sbjct  8     ISENVGKNTHHLPVMVVMVPLPLQGHLNQLLHLSRLLSAFNIPVHFVSTATHNRQAQHRI  67

Query  185   HGWDPLAVPN--LHFHHLSMPHFQSPPPNPDASTKFPTQLMP-VFFATSHLRRPFNALIR  355
                    + N  + FH   +P F  P PNP+A+ KFP+ L+P V     H  RPF A + 
Sbjct  68    SA----KIKNHLIQFHDFDLPIF--PSPNPNATHKFPSHLVPMVNEVLVHFPRPFAAFLS  121

Query  356   NLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTG--------  511
             +LS   KR++VI DSLM  VVQ V S+ N E Y F  +SAF T   + ER G        
Sbjct  122   SLSQKAKRLIVIHDSLMSSVVQVVDSIVNVESYLFHSVSAFVTTLHNLERKGIVVGDGDD  181

Query  512   -------KPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQR-PFWDASSGDLLNSCREIE  667
                    +          LN   S E  F  EF + IK Q       + G + N+CR IE
Sbjct  182   DEEECESRTFYREYVLKELNTARSWESWFSVEFWDLIKSQFGQLPKKTCGQIYNTCRVIE  241

Query  668   ALFIDLIGKESKTGFQWAIGPLNPVSLTDS--INTNRHKSLEWLDRQEKDSVLFVSFGST  841
                + LI +       WA+GP NPV    +   ++++H  + WLD+QE  SV+++SFG+T
Sbjct  242   GSSLKLIERIESKLNNWALGPFNPVKKLKNGERSSSKHSCMSWLDQQEPRSVIYISFGTT  301

Query  842   TSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvv  1021
             T++ ++QI E+  GL  S QKFIWV+RD D+ D+F + +  +R+++PEGY + +  RG++
Sbjct  302   TTMEDKQINEIAIGLARSHQKFIWVIRDADKVDIFHE-DNNKRSKLPEGYNDLIGDRGLI  360

Query  1022  vreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKM  1201
             +REWAPQLEIL H + GGFM+HCGWNSC+ESI+MGVP+AAWPMHSDQPRN  L+TE+L++
Sbjct  361   IREWAPQLEILSHWATGGFMTHCGWNSCLESITMGVPMAAWPMHSDQPRNMVLVTEILRV  420

Query  1202  GISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNEL  1381
             G+ + DW  + E V    + E V++L+ S +G E+R  A  + ++++  I  GG  R EL
Sbjct  421   GLVVKDWELKEEVVSALTVEETVRRLMVSEDGAEIRMNAMRVGEAVRRSIEDGGDSRKEL  480

Query  1382  ESFVAHITR  1408
             E+FV HITR
Sbjct  481   EAFVNHITR  489



>ref|XP_010024011.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=419

 Score =   338 bits (866),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 207/464 (45%), Positives = 262/464 (56%), Gaps = 61/464 (13%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A +GIPVHY G+A+H RQA  R H     A  ++ F
Sbjct  8     VTVIMVPLPAQGHLNQLLELAHLVACYGIPVHYVGSASHNRQAKFRSHVPPSSAASDIRF  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P   SP P+  +  KFP+QL P F ATS LR P   LIR+LS   +RVVV+ DSL
Sbjct  68    HDLPIPPILSPDPSLSSPYKFPSQLQPAFDATSSLRGPVAYLIRSLSSGSRRVVVVHDSL  127

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVL--NHMPSPE  568
             M  VVQD  S+ NAE+Y F  ISAFT   F WE  G    P+V  + A ++    +PS  
Sbjct  128   MASVVQDAASVLNAEIYEFNPISAFTLCWFTWESIGMAPPPEVEVDIAELIASKGLPSLL  187

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F + Q       SG + N+CR +E  F+DL    +  G     WAIGP NP
Sbjct  188   DSSTDEFLKFAESQNECKKFHSGCIYNTCRVVEGRFVDLYASATANGTATKHWAIGPFNP  247

Query  740   VSLTDSIN-TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V L +  +  + H  +E LD+Q   SV++V FG+TT LS+EQI E+  GL E        
Sbjct  248   VKLPEKRSRRSAHGCMELLDKQAPSSVMYVLFGTTTVLSDEQIREIAMGLLE--------  299

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
                                                         ILGHP+ GGF+SHCGW
Sbjct  300   --------------------------------------------ILGHPATGGFLSHCGW  315

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NSCMESISMGVPI AWPMHSDQPRNA LIT VLK+G+ + DW  +++ V    I   VK 
Sbjct  316   NSCMESISMGVPILAWPMHSDQPRNAVLITRVLKIGLIVKDWMSQDDLVKSSTIEGAVKA  375

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             L+ S EGEE R+RAAEL   ++  +  GG  R EL+SF+AHI R
Sbjct  376   LMVSEEGEEARKRAAELGAVVRGSMDEGGVSRAELDSFIAHICR  419



>ref|XP_010090216.1| Zeatin O-glucosyltransferase [Morus notabilis]
 gb|EXB39085.1| Zeatin O-glucosyltransferase [Morus notabilis]
Length=485

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 295/458 (64%), Gaps = 18/458 (4%)
 Frame = +2

Query  74    QGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQS  253
             Q HLNQ L LS +I++  IPVHY G+  HI Q   R +         + FH   +PHF S
Sbjct  33    QSHLNQLLQLSHIISSRKIPVHYVGSTLHISQVKSRANQALNGTKTLIQFHDFPIPHFPS  92

Query  254   PPPNPDASTKFPTQLMPVFFAT-SHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVP  430
             P P     TKF + LMP F A+  +LR PF  L+  LS    RVV+I D LM  VVQD  
Sbjct  93    PLP---YDTKFVSHLMPSFEASVKYLREPFANLLTLLSKTATRVVIIHDPLMTSVVQDSS  149

Query  431   SLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQ  610
             +L N E YRF C S+F  ++   +  G   +  +      ++PS E    PEF  FI  Q
Sbjct  150   TLPNTESYRFHCASSFYYFASLRDTLG-IQIRHDGDNDPKNIPSCEKSLTPEFGAFIGYQ  208

Query  611   RPFWDA--SSGDLLNSCREIEALFIDLI---GKESKTGFQ-WAIGPLNPVSLTDSINTNR  772
               F     +SG L N+CR IE+ F+D I    +ES    + WAIGPL  V+   +   NR
Sbjct  209   VQFMKKMKTSGHLYNACRLIESDFLDFILEKARESDEDVKLWAIGPLETVTSFKNRWGNR  268

Query  773   ------HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                   HK LEWLD+QE++SVL++SFG+TT + +EQI EL  GLE+SG KF+WV+RD D+
Sbjct  269   VDSQGQHKCLEWLDKQERNSVLYISFGTTTFMKDEQIRELAIGLEKSGVKFLWVLRDADK  328

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             G+VFD+GE  RR ++P+G+EERV+ +G+VVR+WAPQLEILGH S GGFMSHCGWNSC+ES
Sbjct  329   GNVFDEGEV-RRPQLPQGFEERVKEKGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCVES  387

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             IS+GVPIAAWPMHSDQP NA  IT VLK+G+ + +WA+++E V    I + VK+L+ S E
Sbjct  388   ISLGVPIAAWPMHSDQPMNAVFITNVLKVGVLVREWAKKDELVSSSVIEKVVKRLMKSEE  447

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+EMR+ A EL   L++    GG  R EL+SF+AHITR
Sbjct  448   GDEMRKMAEELGNELRKATDEGGVSRMELDSFIAHITR  485



>ref|XP_009611304.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=487

 Score =   339 bits (869),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 220/483 (46%), Positives = 301/483 (62%), Gaps = 29/483 (6%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHG---IPVHYAGAATHIRQATHRVHGWDPLAVP  211
              +VVVM+PLPAQGHL   L L+R I +     IPVHYAG+ TH+RQA  R HGWDPL  P
Sbjct  7     NIVVVMIPLPAQGHLQPLLELARRILSSSNFTIPVHYAGSTTHLRQAQSRAHGWDPLTTP  66

Query  212   NLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQK--RVV  385
             NLHF    MP   + P  PD++  +P+ L+P F+A    R+P   L++NLS   K  RVV
Sbjct  67    NLHFSEFQMPTLDNIP--PDSNDFYPSNLIPSFYAALEFRQPVADLVKNLSAADKFRRVV  124

Query  386   VISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPD-VGPEA--AGVLNHM  556
             VI D LM WVVQDV ++ N E+Y F  +SA    S   E    PD V P A  A +L  +
Sbjct  125   VIHDILMSWVVQDVITIPNTEMYFFHAVSALDVCSRILEAKLNPDPVTPPADVAEILQEL  184

Query  557   PSPE---GCFIPEFEEFIKMQRPFWDASSG-DLLNSCREIEALFIDLIGKESKTGFQ---  715
                E       P   ++++ Q        G ++ ++CR I+ +++DL+ +  K+  +   
Sbjct  185   ACMEPGSDSPPPLMVKYVEKQMSCAVNYGGRNIFSTCRPIDGIYLDLMQQAFKSYDEHWK  244

Query  716   -WAIGP-LNPVSLTDSINTN------RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITE  871
              W +G  +NP+ +  +I  +      RH  L+WLD+QE +SVL VSFGS  S ++EQI E
Sbjct  245   TWGLGLFMNPLEMDQNIKKDTTSTPPRHHLLQWLDKQEPNSVLLVSFGSAASFTDEQIRE  304

Query  872   LGAGLEESGQKFIWvvrdgdrgdvfddg----EAARRAevpegyeervrgrgvvvreWAP  1039
             L  GLE+S QKFIWV+++ DR +VF +      + R   +PEGYE+R  GRG+V R WAP
Sbjct  305   LALGLEQSQQKFIWVLKEADRANVFAENINGGSSTRAFVLPEGYEKRAEGRGIVERGWAP  364

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             QLE+LGH S GG++ HCGWNS MESISMGVPIAAWP+H+D PR A L+ + LK+GI + D
Sbjct  365   QLEVLGHASTGGYLCHCGWNSVMESISMGVPIAAWPLHTDHPRTALLLIKGLKIGIYVRD  424

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             WA RNE V    I   VK L+ S EGE++R++AAEL  ++K     GG  + ++ESF+++
Sbjct  425   WAHRNELVKAETIHNAVKILMDSTEGEKLRQKAAELKDTVKASFMDGGATKKDIESFMSY  484

Query  1400  ITR  1408
             ITR
Sbjct  485   ITR  487



>ref|XP_010056820.1| PREDICTED: zeatin O-xylosyltransferase-like [Eucalyptus grandis]
Length=500

 Score =   338 bits (866),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 306/467 (66%), Gaps = 13/467 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLH  220
             V V+M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ 
Sbjct  35    VAVIMVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VQPSSVPSDIC  93

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P   SP P+P++  KFP+ L P F ATS L  P  +L+R+LS   +RVVV+ DS
Sbjct  94    FHDFPTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLGGPVASLVRSLSSVSRRVVVVYDS  153

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSP  565
             LM  VVQD  S+ NAE+Y F+  SAFT   F WE  G    P+V  + A  ++    PS 
Sbjct  154   LMASVVQDAASVPNAEIYVFQPPSAFTLCWFTWESIGMAPPPEVEVDLAEFISSKGFPSL  213

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLN  736
                +  EF +F++ Q+    ++SG + N+CR +E  F+DL    +  G     WAIGPLN
Sbjct  214   LDSYPNEFLKFMESQKECQKSNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPLN  273

Query  737   PVSLTD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             PV + + S   + H  +EWLD+Q   SV++VSFG+TT L +EQI E+  GLE SGQKFIW
Sbjct  274   PVKVPEKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLCDEQIREIAMGLERSGQKFIW  333

Query  914   vvrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             V+R+ D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SH
Sbjct  334   VLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSH  393

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ L DW   ++ V    I   
Sbjct  394   CGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLILKDWMSPDDVVKSSAIEGA  453

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             VK L+AS EGEE R+RAAEL  +++  +  GG  R EL+SF+AH++R
Sbjct  454   VKTLMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHVSR  500



>ref|XP_004150609.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=465

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 211/473 (45%), Positives = 292/473 (62%), Gaps = 27/473 (6%)
 Frame = +2

Query  47    VVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN--LH  220
             +VVM+PLP QGHLNQ LHLSRL++A  IPVH+   ATH RQA HR+       + N  + 
Sbjct  1     MVVMVPLPLQGHLNQLLHLSRLLSAFNIPVHFVSTATHNRQAQHRISA----KIKNHLIQ  56

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMP-VFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             FH   +P F  P PNP+A+ KFP+ L+P V     H  RPF A + +LS   KR++VI D
Sbjct  57    FHDFDLPIF--PSPNPNATHKFPSHLVPMVNEVLVHFPRPFAAFLSSLSQKAKRLIVIHD  114

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTG---------------KPDVGPE  532
             SLM  VVQ V S+ N E Y F  +SAF T   + ER G               +      
Sbjct  115   SLMSSVVQVVDSIVNVESYLFHSVSAFVTTLHNLERKGIVVGDGDDDEEECESRTFYREY  174

Query  533   AAGVLNHMPSPEGCFIPEFEEFIKMQR-PFWDASSGDLLNSCREIEALFIDLIGKESKTG  709
                 LN   S E  F  EF + IK Q       + G + N+CR IE   + LI +     
Sbjct  175   VLKELNTARSWESWFSVEFWDLIKSQFGQLPKKTCGQIYNTCRVIEGSSLKLIERIESKL  234

Query  710   FQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLE  889
               WA+GP NPV      ++++H  + WLD+QE  SV+++SFG+TT++ ++QI E+  GL 
Sbjct  235   NNWALGPFNPVKKLKR-SSSKHSCMSWLDQQEPRSVIYISFGTTTTMEDKQINEIAIGLA  293

Query  890   ESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSV  1069
              S QKFIWV+RD D+ D+F + +  +R+++PEGY + +  RG+++REWAPQLEIL H + 
Sbjct  294   RSHQKFIWVIRDADKVDIFHE-DNNKRSKLPEGYNDLIGDRGLIIREWAPQLEILSHWAT  352

Query  1070  GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGR  1249
             GGFM+HCGWNSC+ESI+MGVP+AAWPMHSDQPRN  L+TE+L++G+ + DW  + E V  
Sbjct  353   GGFMTHCGWNSCLESITMGVPMAAWPMHSDQPRNMVLVTEILRVGLVVKDWELKEEVVSA  412

Query  1250  REIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
               + E V++L+ S +G E+R  A  + ++++  I  GG  R ELE+FV HITR
Sbjct  413   LTVEETVRRLMVSEDGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNHITR  465



>ref|XP_010918854.1| PREDICTED: zeatin O-glucosyltransferase-like [Elaeis guineensis]
Length=479

 Score =   336 bits (862),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 221/466 (47%), Positives = 290/466 (62%), Gaps = 23/466 (5%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH---FHHL  232
             PLPAQGHLNQ LHLSRL+AA  IPVHY G+A+H RQA  R  GW P   P  H   FH  
Sbjct  20    PLPAQGHLNQLLHLSRLLAARRIPVHYVGSASHNRQARERALGWPP-ETPAHHPIRFHDF  78

Query  233   SMPHFQSPPPNPDASTKFP-TQLMPVFFATS-HLRRPFNALIRNLSVDQKRVVVISDSLM  406
              +P F S    P AST  P   L+P+F A + H R P  AL+R+L+ + +RVV+I DS M
Sbjct  79    FLPPFPS----PPASTHAPLAHLLPLFDAAALHFRYPLAALLRSLTTNSRRVVLIHDSTM  134

Query  407   GWVVQDVPSLQNAELYRFRCISAFTTYSFHWE-RTGKPDVGPEAAGVLNHMPSPEGCFIP  583
              +      S+ + E + F  +SAF    F+ E R   PD    A   L H+P+   CF  
Sbjct  135   AFAASVAASVPHVEAFSFHSVSAFALLLFYCESRRKYPDDPSIAKLNLPHIPN-NACFTQ  193

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             +F +F++ Q     A SG L N+CR IE  FIDL+ +E +   Q  +AIGPLNPVS+T  
Sbjct  194   QFLDFLRRQHESTAADSGRLFNTCRGIEGRFIDLLAREPEWRNQKTFAIGPLNPVSITKM  253

Query  758   INT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
                  RH  L+WLDRQ   SV++VSFG+T++LS+EQ+ EL  GLE S Q+FIWV+RD DR
Sbjct  254   TGYGTRHPCLDWLDRQPPASVMYVSFGTTSALSDEQLLELAWGLEASRQRFIWVLRDADR  313

Query  935   gdvfdd--gEAARRAevpegy------eervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
              D++ +   E  ++A+            +R   R   + EWAPQLEIL HPS GGFMSHC
Sbjct  314   ADIYTEEGAEGKQKAKKRREEWLGRLDYDRRVERVGRLVEWAPQLEILAHPSTGGFMSHC  373

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMES+SMGVP+  WPMHSDQPRNA L+T VL++GI+  DWARRNE V   EI + +
Sbjct  374   GWNSCMESMSMGVPLLTWPMHSDQPRNALLVTRVLRVGITARDWARRNEVVPAAEIRDSI  433

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              +L+ S EG+E+R RA  +   ++     GG  R + ++F+ HIT+
Sbjct  434   VRLMVSEEGKEVRVRAKAVGGVVRHATTEGGTSRADFDAFITHITQ  479



>ref|XP_010056828.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   336 bits (862),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 305/467 (65%), Gaps = 13/467 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLH  220
             V V+M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ 
Sbjct  8     VAVIMVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VPPSSVPSDIR  66

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P   SP P+P++  KFP+ L P F ATS LR P  +L+R+LS   +RVVV+ DS
Sbjct  67    FHDFPTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLRGPVASLVRSLSSVSRRVVVVYDS  126

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSP  565
             LM  VVQD  S+ NAE+Y F+  SAF    F WE  G    P+V  + A +++    PS 
Sbjct  127   LMASVVQDAASVPNAEIYLFQPPSAFMLCWFTWESIGMAPPPEVEVDLAELISSKGFPSI  186

Query  566   EGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLN  736
                   EF +F++ Q+     +SG + N+CR +E  F+DL    +  G     WAIGP N
Sbjct  187   VDSCPNEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFN  246

Query  737   PVSLTD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             PV + + S   + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIW
Sbjct  247   PVKVPEKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAMGLERSGQKFIW  306

Query  914   vvrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             V+R+ D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SH
Sbjct  307   VLREADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSH  366

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNSCMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ + DW   ++ V    I   
Sbjct  367   CGWNSCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSAIEGA  426

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             VK L+AS EGEE R+RAAEL  +++  +  GG  R EL+SF+AHI+R
Sbjct  427   VKALMASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  473



>ref|XP_006356394.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum tuberosum]
Length=501

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 206/481 (43%), Positives = 297/481 (62%), Gaps = 46/481 (10%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLS  235
             M+P   QGHLNQ L++SR+I+++ +P++Y   A  I+Q  +RV+GWDPL   N++FH   
Sbjct  27    MIPFLLQGHLNQLLNISRVISSYNLPIYYLSYADKIKQVKNRVYGWDPLTTCNIYFHEF-  85

Query  236   MPHFQSPPPNPDASTKFPTQ-----------LMPVFFATSHLRRPFNALIRNLSVDQKRV  382
                     PNP +  ++ +            ++P+   T  LR P  A ++ +S   ++V
Sbjct  86    --------PNPPSGEQYSSNKSLSERESQKFILPLLEETLMLREPVGAFLQEVSKKTRKV  137

Query  383   VVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWE----RTGKP-DVGPEAAGVL  547
             VVI DS+M  VV+DV S+ NAE Y F   SAF   S + E    R   P  +G  AA VL
Sbjct  138   VVIYDSMMASVVEDVASIPNAEAYCFNSSSAFMISSMYVEEELIRLHLPLFIGKFAARVL  197

Query  548   --------NHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES-  700
                     N++PS +  FIPEF +F   Q  +    SG+L  +C+ IE  +ID++ + + 
Sbjct  198   LPSGFEFPNNLPSYQSSFIPEFMDFSIRQDLYKKFCSGNLYYTCKAIEGPYIDVLARFNR  257

Query  701   ---KTGFQWAIGPLNPVSLT--DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQI  865
                ++  QWAIGPL  ++    D  N NRH  L+WLD+QE +SV+ VSFG+TTSLS EQI
Sbjct  258   LLRRSPKQWAIGPLLSIATINDDQNNINRHGCLKWLDKQEPNSVILVSFGTTTSLSTEQI  317

Query  866   TELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQL  1045
              EL  GLE+S  KFIW              +   + ++P+GYEERV+GRG+VV++WAPQL
Sbjct  318   KELAIGLEKSQHKFIW-------IVSDVLLKEGEQVQIPKGYEERVQGRGLVVKDWAPQL  370

Query  1046  EILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWA  1225
             EILGH + GGF+SHCGWNS  ES++MGVP+A WPM  D PR A L+T+VLK+GI++ DW 
Sbjct  371   EILGHSATGGFLSHCGWNSVQESVTMGVPLATWPMIFDHPRIAVLVTKVLKIGITVKDWE  430

Query  1226  RRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             RR+E +    I   ++KL+AS EG E+R+   ELS+ +++ I +GG  + E++SF+A+IT
Sbjct  431   RRDELITSITIEIALRKLMASPEGNEVRKNMVELSKKVRQSITLGGDSKREMDSFIAYIT  490

Query  1406  R  1408
             R
Sbjct  491   R  491



>ref|XP_006350268.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=474

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 299/458 (65%), Gaps = 14/458 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAA-HGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             VV+VM+P  AQGHLNQ L LS LI++ + +PV+Y G+ T  RQA  R +  +P  +  +H
Sbjct  28    VVIVMVPFLAQGHLNQLLQLSCLISSLYHLPVYYVGSVTLNRQARLRANALNPSDIAKIH  87

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH + +P F SPPP      KFP    P++ A+   R P  + +R++S   +RV+V+ D 
Sbjct  88    FHDIPIPEFSSPPP---VLRKFPLHHKPLWDASLLQRDPIASFLRDISSKSRRVIVVHDL  144

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCF  577
             LM + VQDV SL N E   F CISAF +Y   +  +G    +G E   +L  +P  EG  
Sbjct  145   LMSYSVQDVSSLPNVESIIFNCISAFNSYCSSFLFSGMSVQLGEE---LLKKLPPLEGTL  201

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGK-ESKTGFQWAIGPLNPVSLTD  754
               EF  FI +QR + D  SGD+ N+   IE  F+DL+ + +SK   QW IGP+ P  L  
Sbjct  202   PDEFNSFIALQRLYMDIRSGDIHNTSNLIEGEFLDLLAQVDSKQ--QWVIGPILPTKLNH  259

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
               N N +  LEWL++Q   SVL++SFG++T+ S+ ++ EL  GLE+S QKFIW++R+ DR
Sbjct  260   ISNRN-NICLEWLNKQSPRSVLYISFGTSTTFSDREVMELAMGLEQSKQKFIWMLREADR  318

Query  935   gdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
             GD+F     AR+ E+PEG+EERV+G G+V+REWAPQ EIL H S GGFMSHCGWNS +ES
Sbjct  319   GDIFIG--EARKFELPEGFEERVKGVGLVLREWAPQPEILAHSSTGGFMSHCGWNSFLES  376

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             I+MGVPIAAWPMH DQP N  L+TE+LK+G+ + +W +  E V    I   V+KL+AS E
Sbjct  377   ITMGVPIAAWPMHGDQPNNGFLVTEMLKIGLIVREWDKHEELVSASTIENVVRKLMASEE  436

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G+ +R+RA EL ++++     GG  R EL+SF+AHITR
Sbjct  437   GDAIRKRAEELGEAIRRSTEKGGSSRIELDSFIAHITR  474



>gb|KCW90130.1| hypothetical protein EUGRSUZ_A02321, partial [Eucalyptus grandis]
Length=460

 Score =   335 bits (858),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 233/462 (50%), Positives = 300/462 (65%), Gaps = 13/462 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLH  220
             V V+M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ 
Sbjct  5     VAVIMVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VPPSSVPSDIR  63

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH    P   SP P+P++  KFP+ L P F ATS LR P  +L+R+LS   +RVVV+ DS
Sbjct  64    FHDFPTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLRGPVASLVRSLSSVSRRVVVVYDS  123

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM  VVQD  S+ NAE+Y F+  SAF    F WE  G     PE  G     PS      
Sbjct  124   LMASVVQDAASVPNAEIYLFQPPSAFMLCWFTWESIGMAP-PPEVEG----FPSIVDSCP  178

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLT  751
              EF +F++ Q+     +SG + N+CR +E  F+DL    +  G     WAIGP NPV + 
Sbjct  179   NEFLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVKVP  238

Query  752   D-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
             + S   + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV+R+ 
Sbjct  239   EKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAMGLERSGQKFIWVLREA  298

Query  929   drgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNS
Sbjct  299   DKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWNS  358

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             CMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ + DW   ++ V    I   VK L+
Sbjct  359   CMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSAIEGAVKALM  418

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             AS EGEE R+RAAEL  +++  +  GG  R EL+SF+AHI+R
Sbjct  419   ASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  460



>ref|XP_004169069.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=491

 Score =   334 bits (857),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 226/483 (47%), Positives = 301/483 (62%), Gaps = 25/483 (5%)
 Frame = +2

Query  20    TKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQAT-HRVHGWD  196
              K   D+ +VVVM+PLPAQGHLNQ LHLS LI+   IPVH+ G  TH RQ    RVH  D
Sbjct  14    VKNSNDLPIVVVMVPLPAQGHLNQLLHLSHLISTFHIPVHFLGTPTHNRQVQLRRVH--D  71

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNLSVDQ  373
               + P + FH   +P F SPPPNP AS +FP+ L+P F A + HL+RP  A +R LS   
Sbjct  72    NNSHPLIQFHDFDIPPFPSPPPNPTASHRFPSHLIPSFIAAALHLQRPLAAFLRTLSSKV  131

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERT------GKPDVGPEA  535
             +R+VVI DSLM   +QDV ++ N E Y F  +SAFT      ER       G  D     
Sbjct  132   RRLVVIHDSLMSSALQDVNAIPNTESYCFHSVSAFTVALHSLERKELFVNDGYKDGEITT  191

Query  536   AGVLNHMP------SPEGCFIPEFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGK  694
                  + P      S E CF PEF EFI  Q R      +G + N+CR IE  F+++I +
Sbjct  192   PTYQQYFPKELNVVSMEQCFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQR  251

Query  695   ESKTGFQWAIGPLNPVSLTDSINTNR-----HKSLEWLDRQEKDSVLFVSFGSTTSLSNE  859
                    WA+GP NP+ ++ +   N+     H  + WLD+QE  SV+++SFG+TT++++E
Sbjct  252   IEPEFRHWALGPFNPLKISKNGGNNKQSSCSHSCMAWLDQQEPRSVIYISFGTTTAMTDE  311

Query  860   QITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAP  1039
             QI E+  GL  S QKFIWV+RD D+GDVFD  E  R++ +PEGY   +  +G+V+R+WAP
Sbjct  312   QIKEIAIGLARSDQKFIWVLRDADKGDVFDVNEI-RKSNLPEGYSNLIGNQGLVIRDWAP  370

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             QLEIL H + GGFM+HCGWNSCMESI+ GVP+ AWPMHSDQPRN  L+T VL +G++L +
Sbjct  371   QLEILSHWATGGFMTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKE  430

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             W  + E V    + E V+KL+ S EG E+RR A  L   +++ +  GG  R E E+F+AH
Sbjct  431   W--QQELVIADAVEEVVRKLMVSEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAH  488

Query  1400  ITR  1408
             ITR
Sbjct  489   ITR  491



>gb|KCW90129.1| hypothetical protein EUGRSUZ_A02320 [Eucalyptus grandis]
Length=462

 Score =   333 bits (854),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 231/463 (50%), Positives = 303/463 (65%), Gaps = 13/463 (3%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVP-NLHFHHL  232
             M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H   P +VP ++ FH  
Sbjct  1     MVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH-VQPSSVPSDICFHDF  59

Query  233   SMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGW  412
               P   SP P+P++  KFP+ L P F ATS L  P  +L+R+LS   +RVVV+ DSLM  
Sbjct  60    PTPPIPSPAPSPNSPYKFPSHLQPAFDATSSLGGPVASLVRSLSSVSRRVVVVYDSLMAS  119

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCF  577
             VVQD  S+ NAE+Y F+  SAFT   F WE  G    P+V  + A  ++    PS    +
Sbjct  120   VVQDAASVPNAEIYVFQPPSAFTLCWFTWESIGMAPPPEVEVDLAEFISSKGFPSLLDSY  179

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSL  748
               EF +F++ Q+    ++SG + N+CR +E  F+DL    +  G     WAIGPLNPV +
Sbjct  180   PNEFLKFMESQKECQKSNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPLNPVKV  239

Query  749   TD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrd  925
              + S   + H  +EWLD+Q   SV++VSFG+TT L +EQI E+  GLE SGQKFIWV+R+
Sbjct  240   PEKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLCDEQIREIAMGLERSGQKFIWVLRE  299

Query  926   gdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
              D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWN
Sbjct  300   ADKADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWN  359

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMESISMGVPI AWPMHSDQP NA LIT+VLK+G+ L DW   ++ V    I   VK L
Sbjct  360   SCMESISMGVPILAWPMHSDQPLNAVLITQVLKIGLILKDWMSPDDVVKSSAIEGAVKTL  419

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +AS EGEE R+RAAEL  +++  +  GG  R EL+SF+AH++R
Sbjct  420   MASEEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHVSR  462



>ref|XP_009620161.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=459

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 203/415 (49%), Positives = 268/415 (65%), Gaps = 6/415 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             + VV++P   QGHLN  L+LSRL++++ IP+++ G +T  RQA  RV GWD L  P + F
Sbjct  20    IAVVIVPYLEQGHLNPLLNLSRLLSSYNIPIYFLGTSTSNRQAKFRVCGWDILDFPTIQF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P   S      +      +    F +   LR P    +R +S   +R VVI+DS 
Sbjct  80    HDL-VPSSSSSTLTNSSGESIMEKKGSFFTSILLLREPIRHFLREISSTYRRTVVINDSG  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M WVVQD  SL   E Y F  IS FT  SF WE T KP   PEA  ++  +P  E  F  
Sbjct  139   MSWVVQDAVSLPKTECYCFHSISVFTALSFAWETTRKPVPSPEAE-IIAELPPRENTFDS  197

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             E  E+IK+QR   D  S  L NSC+EIE +FIDL+ K+ +   QWAIGPLNPV ++    
Sbjct  198   ETLEYIKLQREARDFYSIGLHNSCKEIEGVFIDLLEKQRENK-QWAIGPLNPVEISKKKA  256

Query  764   --TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                 +     WLD+Q+ +SV++VSFGSTT+LSNEQI EL  GLE+SGQKFIWV+R+ D+ 
Sbjct  257   GLDKKDDLFSWLDKQDLNSVIYVSFGSTTTLSNEQIKELALGLEQSGQKFIWVLREADKK  316

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
                +  + +   E+P+GYEE ++G+G + ++WAPQLEIL HPS+GGFMSHCGWNSC+ESI
Sbjct  317   GGDNVKKGS-NFELPKGYEEIIKGKGYIEKDWAPQLEILAHPSIGGFMSHCGWNSCIESI  375

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             SMGVPIAAWP+HSDQPRN  LIT+VLK+GI + DW  R+E V   +I   V+ L+
Sbjct  376   SMGVPIAAWPIHSDQPRNTVLITKVLKIGIVVRDWENRHELVSAEKIENAVRNLM  430



>ref|XP_010312401.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=409

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 266/378 (70%), Gaps = 8/378 (2%)
 Frame = +2

Query  284   FPTQLMPVFFATSHLRRPFNALIRNL-SVDQKRVVVISDSLMGWVVQDVPSLQNAELYRF  460
             +   L+P F+AT+HLR P  +L+  L   + +RV+ I DS+M WVV+DVP++ NAE Y F
Sbjct  37    WSNHLIPSFYATAHLREPVCSLVHQLLDNNHQRVIFIFDSMMTWVVEDVPAILNAECYCF  96

Query  461   RCISAFTTYSFHWERTGKP-DVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFW-DASS  634
               ISAF  YS  WE  GKP   G E   +   +PS E C  PE  E  + Q       SS
Sbjct  97    NSISAFHMYSLFWEIKGKPFQAGTE---LYEDIPSLENCSTPEIWELWRKQEALMGKVSS  153

Query  635   GDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDS  814
             G+L NS R IE L++DL+ KE+    QWA+GP NP+    + N+N+H +L WLD+QE +S
Sbjct  154   GELYNSSRVIEGLYLDLVAKENNGLNQWALGPFNPLLSEQNKNSNKHHTLYWLDKQETNS  213

Query  815   VLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegye  994
             VL VSFG+TTSLSNE+I EL  GLE+S QKFIWV+RD D+GDVF   E  R A +P+GYE
Sbjct  214   VLHVSFGTTTSLSNEEIEELAVGLEKSMQKFIWVLRDADKGDVFAGEE--RIARLPDGYE  271

Query  995   ervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNA  1174
             +R++GRG++VR+WAPQLEIL HPS GGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRN+
Sbjct  272   KRLKGRGIIVRDWAPQLEILAHPSTGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNS  331

Query  1175  TLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIA  1354
              L+T+ LK+G+ +  WA R+E V    +   V+ L+AS EG EMR+RA++LS  +K+ + 
Sbjct  332   QLVTKFLKIGLIVRHWACRDELVTSEIVENAVRTLMASPEGYEMRKRASKLSNVVKQSVM  391

Query  1355  VGGGGRNELESFVAHITR  1408
              GG  R E++SF+ HITR
Sbjct  392   DGGVNREEMDSFITHITR  409



>gb|KGN54645.1| UDP-glucosyltransferase [Cucumis sativus]
Length=490

 Score =   332 bits (851),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 227/483 (47%), Positives = 303/483 (63%), Gaps = 26/483 (5%)
 Frame = +2

Query  20    TKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQAT-HRVHGWD  196
              K   D+ +VVVM+PLPAQGHLNQ LHLS LI+   IPVH+ G  TH RQ    RVH  D
Sbjct  14    VKNSNDLPIVVVMVPLPAQGHLNQLLHLSHLISTFHIPVHFLGTPTHNRQVQLRRVH--D  71

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNLSVDQ  373
               + P + FH   +P F SPPPNP AS +FP+ L+P F A + HL+RP  A +R LS   
Sbjct  72    NNSHPLIQFHDFDIPPFPSPPPNPTASHRFPSHLIPSFIAAALHLQRPLAAFLRTLSSKV  131

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERT------GKPDVGPEA  535
             +R+VVI DSLM   +QDV ++ N E Y F  +SAFT  +   ER       G  D     
Sbjct  132   RRLVVIHDSLMSSALQDVNAIPNTESYCFHSVSAFTV-AHSLERKELFVNDGYKDGEITT  190

Query  536   AGVLNHMP------SPEGCFIPEFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGK  694
                  + P      S E CF PEF EFI  Q R      +G + N+CR IE  F+++I +
Sbjct  191   PTYQQYFPKELNVVSMEQCFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQR  250

Query  695   ESKTGFQWAIGPLNPVSLTDSINTNR-----HKSLEWLDRQEKDSVLFVSFGSTTSLSNE  859
                    WA+GP NP+ ++ +   N+     H  + WLD+QE  SV+++SFG+TT++++E
Sbjct  251   IEPEFRHWALGPFNPLKISKNGGNNKQSSCSHSCMAWLDQQEPRSVIYISFGTTTAMTDE  310

Query  860   QITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAP  1039
             QI E+  GL  S QKFIWV+RD D+GDVFD  E  R++ +PEGY   +  +G+V+R+WAP
Sbjct  311   QIKEIAIGLARSDQKFIWVLRDADKGDVFDVNEI-RKSNLPEGYSNLIGNQGLVIRDWAP  369

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             QLEIL H + GGFM+HCGWNSCMESI+ GVP+ AWPMHSDQPRN  L+T VL +G++L +
Sbjct  370   QLEILSHWATGGFMTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKE  429

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             W  + E V    + E V+KL+AS EG E+RR A  L   +++ +  GG  R E E+F+AH
Sbjct  430   W--QQELVIADAVEEVVRKLMASEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAH  487

Query  1400  ITR  1408
             ITR
Sbjct  488   ITR  490



>ref|XP_004150612.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=486

 Score =   332 bits (850),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 226/479 (47%), Positives = 302/479 (63%), Gaps = 22/479 (5%)
 Frame = +2

Query  20    TKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQAT-HRVHGWD  196
              K   D+ +VVVM+PLPAQGHLNQ LHLS LI+   IPVH+ G  TH RQ    RVH  D
Sbjct  14    VKNSNDLPIVVVMVPLPAQGHLNQLLHLSHLISTFHIPVHFLGTPTHNRQVQLRRVH--D  71

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNLSVDQ  373
               + P + FH   +P F SPPPNP AS +FP+ L+P F A + HL+RP  A +R LS   
Sbjct  72    NNSHPLIQFHDFDIPPFPSPPPNPTASHRFPSHLIPSFIAAALHLQRPLAAFLRTLSSKV  131

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERT------GKPDVGPEA  535
             +R+VVI DSLM   +QDV ++ N E Y F  +SAFT  +   ER       G  D     
Sbjct  132   RRLVVIHDSLMSSALQDVNAIPNTESYCFHSVSAFTV-AHSLERKELFVNDGYKDGEITT  190

Query  536   AGVLNHMP------SPEGCFIPEFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDLIGK  694
                  + P      S E CF PEF EFI  Q R      +G + N+CR IE  F+++I +
Sbjct  191   PTYQQYFPKELNVVSMEQCFPPEFLEFIGSQFRHLPKMGAGKIYNTCRVIEGEFLEVIQR  250

Query  695   ESKTGFQWAIGPLNPVSLTD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITE  871
                    WA+GP NP+ ++    ++  H  + WLD+QE  SV+++SFG+TT++++EQI E
Sbjct  251   IEPEFRHWALGPFNPLKISKVRFSSCSHSCMAWLDQQEPRSVIYISFGTTTAMTDEQIKE  310

Query  872   LGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEI  1051
             +  GL  S QKFIWV+RD D+GDVFD  E  R++ +PEGY   +  +G+V+R+WAPQLEI
Sbjct  311   IAIGLARSDQKFIWVLRDADKGDVFDVNEI-RKSNLPEGYSNLIGNQGLVIRDWAPQLEI  369

Query  1052  LGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARR  1231
             L H + GGFM+HCGWNSCMESI+ GVP+ AWPMHSDQPRN  L+T VL +G++L +W  +
Sbjct  370   LSHWATGGFMTHCGWNSCMESITTGVPVIAWPMHSDQPRNTVLMTMVLCVGVALKEW--Q  427

Query  1232  NERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              E V    + E V+KL+AS EG E+RR A  L   +++ +  GG  R E E+F+AHITR
Sbjct  428   QELVIADAVEEVVRKLMASEEGAEVRRNAERLGNVVRQSLEEGGESRQEFEAFIAHITR  486



>ref|XP_004169070.1| PREDICTED: zeatin O-glucosyltransferase-like [Cucumis sativus]
Length=468

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 209/475 (44%), Positives = 292/475 (61%), Gaps = 28/475 (6%)
 Frame = +2

Query  47    VVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN--LH  220
             +VVM+PLP QGHLNQ LHLSRL++A  IPVH+   ATH RQA +R+       + N  + 
Sbjct  1     MVVMVPLPLQGHLNQLLHLSRLLSAFNIPVHFVSTATHNRQAQYRISA----KIKNHLIQ  56

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMP-VFFATSHLRRPFNALIRNLSVDQKRVVVISD  397
             FH   +P F  P PNP+A+ KFP+ L+P V     H  RPF A + +LS   KR++VI D
Sbjct  57    FHDFDLPIF--PSPNPNATHKFPSHLVPMVNEVLVHFPRPFAAFLSSLSQKAKRLIVIHD  114

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTG---------------KPDVGPE  532
             SLM  VVQ V S+ N E Y F  +SAF T   + ER G               +      
Sbjct  115   SLMSSVVQVVDSIVNVESYIFHSVSAFVTTLHYLERKGIVVGDGDDDEEECESRTFYREY  174

Query  533   AAGVLNHMPSPEGCFIPEFEEFIKMQR-PFWDASSGDLLNSCREIEALFIDLIGKESKTG  709
                 LN + S E  F  EF + IK Q       + G + N+CR IE   + LI +     
Sbjct  175   VLKELNTVSSWERWFSVEFWDLIKSQFGQLPKKTCGQIYNTCRVIEGSSLKLIERIESKF  234

Query  710   FQWAIGPLNPVSLTDS--INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAG  883
               WA+GP NPV    +   ++++H  + WLD+QE  SV+++SFG+TT++ ++QI E+  G
Sbjct  235   NNWALGPFNPVKKLKNGERSSSKHSCMSWLDQQEPRSVIYISFGTTTTMEDKQINEIAIG  294

Query  884   LEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHP  1063
             L  S QKFIWV+RD D+ D+F + +  +R+++PEGY + +  RG+++REWAPQLEIL H 
Sbjct  295   LARSHQKFIWVIRDADKVDIFHE-DNNKRSKLPEGYNDLIGDRGLIIREWAPQLEILSHW  353

Query  1064  SVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERV  1243
             + GGFM+HCGWNSC+ESI+MGVP+AAWPMHSDQPRN   +TE+L++G+ +  W  R E V
Sbjct  354   ATGGFMTHCGWNSCLESITMGVPMAAWPMHSDQPRNMVFVTEILRVGLVVKGWELREEVV  413

Query  1244  GRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                 + E V++L+ S +G E+R  A  + ++++  I  GG  R ELE+FV HITR
Sbjct  414   SALTVEEVVRRLMVSEDGAEIRMNAMRVGEAVRRSIEDGGDSRKELEAFVNHITR  468



>ref|XP_009620160.1| PREDICTED: zeatin O-glucosyltransferase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=459

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 202/415 (49%), Positives = 267/415 (64%), Gaps = 6/415 (1%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             + VV++P   QGHLN  L+LSRL++++ IP+++ G +T  RQA  RV GWD L  P + F
Sbjct  20    IAVVIVPYLEQGHLNPLLNLSRLLSSYNIPIYFLGTSTSNRQAKFRVCGWDILDFPTIQF  79

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P   S      +      +    F +   LR P    +R +S   +R VVI+DS 
Sbjct  80    HDL-VPSSSSSTLTNSSGESIMEKKGSFFTSILLLREPIRHFLREISSTYRRTVVINDSG  138

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M WVVQD  SL   E Y F  IS FT  SF WE T KP   PEA  ++  +P  E  F  
Sbjct  139   MSWVVQDAVSLPKTECYCFHSISVFTALSFAWETTRKPVPSPEAE-IIAELPPRENTFDS  197

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSIN  763
             E  E+IK+QR   D  S  L NSC+EIE +FIDL+ K+ +   QWAIGPLNPV ++    
Sbjct  198   ETLEYIKLQREARDFYSIGLHNSCKEIEGVFIDLLEKQRENK-QWAIGPLNPVEISKKKA  256

Query  764   --TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                 +     WLD+Q+ +SV++VSFGSTT+LSNEQI EL  GLE+SGQKFIWV+R+ D+ 
Sbjct  257   GLDKKDDLFSWLDKQDLNSVIYVSFGSTTTLSNEQIKELALGLEQSGQKFIWVLREADKK  316

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
                +  + +   E+P+GYEE ++G+G + ++WAPQLEIL H S+GGFMSHCGWNSC+ESI
Sbjct  317   GGDNVKKGS-NFELPKGYEEIIKGKGYIEKDWAPQLEILAHQSIGGFMSHCGWNSCIESI  375

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             SMGVPIAAWP+HSDQPRN  LIT+VLK+GI + DW  R+E V   +I   V+ L+
Sbjct  376   SMGVPIAAWPIHSDQPRNTVLITKVLKIGIVVRDWENRHELVSAEKIENAVRNLM  430



>gb|EPS66453.1| hypothetical protein M569_08324, partial [Genlisea aurea]
Length=447

 Score =   328 bits (840),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 194/457 (42%), Positives = 275/457 (60%), Gaps = 12/457 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+P PAQ HLNQ L  S +++++G+PVHY  +A HI Q   RV+G DP  +  + F
Sbjct  1     VAVLMVPFPAQSHLNQLLQFSCIVSSYGLPVHYLSSAIHIHQVKSRVNGIDPRRIGAVRF  60

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
               L  P F SP P+P++   FP+Q  P ++A    R PF   +R    + +RVVV+ D+ 
Sbjct  61    KDLPHPPFDSPQPDPNSENNFPSQFFPAWYAAMAFREPFADYLRETCREYRRVVVVYDAG  120

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VV+D  S++NAE Y FRC+ A    +          +G E       +PS + C   
Sbjct  121   MAHVVRDAVSVENAESYAFRCLPAIFQAAL--------SIGKELPPWFPELPSLQECVPE  172

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             E   F+  +        GD+ N+CR IEA +++++ +E   G +  WAIGP  P +L ++
Sbjct  173   EMLRFVAQRGEALLLRDGDIHNTCRPIEAPYLEVVEREEILGRRKSWAIGPTFPSTLKNT  232

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
                + H+   WLD QE +SV++VSFG+TTSL++EQI E+  GL  SG KF+WV+RD D+ 
Sbjct  233   --RHDHECFRWLDGQEPNSVVYVSFGTTTSLTDEQIGEIAFGLRRSGAKFLWVLRDADKA  290

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+FD              EE   G GVVVR+W PQ+++L HPS GGF+SHCGWNSCMES+
Sbjct  291   DIFDRETRRAELPREFEEEEEAEGVGVVVRDWVPQIDVLRHPSTGGFLSHCGWNSCMESM  350

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
               GVP+ AWPMHSDQP NA  I  VL MG+ + DW+RR E V    +   V++L+ ++EG
Sbjct  351   FAGVPMGAWPMHSDQPTNAVFICGVLGMGLMVRDWSRRTETVKASVVESCVRRLMTTSEG  410

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              E+RR+A EL   + +    GG    E++SF+AHITR
Sbjct  411   AELRRKAEELGGIVAQATRPGGASSLEMDSFIAHITR  447



>ref|XP_011075348.1| PREDICTED: zeatin O-glucosyltransferase-like [Sesamum indicum]
Length=454

 Score =   328 bits (840),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 216/460 (47%), Positives = 293/460 (64%), Gaps = 17/460 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+PLP Q HLNQ L L+ LIA++G+ VH+ G+ATH RQ   R +G  P +   + F
Sbjct  7     VAVVMVPLPGQSHLNQLLQLAGLIASYGLQVHFVGSATHNRQVKLRSNGLKPNS--GIQF  64

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   +  P+P +  K P  + P   A ++LR P   L+  LS+  +RVV+I D +
Sbjct  65    HDLPTPPIAAVDPDPSSFDKLPVHMYPAVQAYANLREPVLGLVEELSLKTRRVVIIYDRM  124

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  VV+D  S+QN E Y F C+S F  +   WE  GKP    +  G L   P P   F+P
Sbjct  125   MFEVVRDAVSVQNVESYAFNCVSGFNLFFVLWEAMGKP---IQVEGPLKD-PPPISEFMP  180

Query  584   E-FEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLT  751
             E   +FI      +    GD+ N+CR I+  +IDL+ +E  +G    QWAI P   V L 
Sbjct  181   EGVIKFIV--SSIFKERDGDIHNTCRLIDGAYIDLLSREEISGSTKPQWAIRPTLQVDLN  238

Query  752   -DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdg  928
              ++    RHK LEWLD+Q   SV++VSFG+TTS SNE+  E+  GLE+S QKFI V+RD 
Sbjct  239   ANNEGKPRHKCLEWLDKQAPGSVIYVSFGTTTSFSNEEAGEIALGLEQSKQKFILVLRDA  298

Query  929   drgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
             D+ D+F   E  R+ E+PEG+EERV+  G+VVR+WAPQL+IL H S GGFM+HCGWNSC 
Sbjct  299   DKADIFAGEE--RKIELPEGFEERVQENGMVVRDWAPQLQILAHKSTGGFMTHCGWNSCF  356

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ES+  GVP+AAWPMHSDQP NA  +T VLK G+ + +WA+R E V    I   V++L+AS
Sbjct  357   ESLWTGVPVAAWPMHSDQPLNALFLTRVLKTGLVVREWAQRKELVTASVIKNVVERLMAS  416

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EG+E+R+RA ELS ++K  +++   G  E++SF+AHITR
Sbjct  417   KEGDEIRKRAEELSAAIK--VSMDEAGCPEIQSFIAHITR  454



>ref|XP_008455779.1| PREDICTED: zeatin O-xylosyltransferase-like [Cucumis melo]
Length=481

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 224/481 (47%), Positives = 299/481 (62%), Gaps = 22/481 (5%)
 Frame = +2

Query  14    NGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQAT-HRVHG  190
             N  K   D+ +VVVM+PLPAQGHLNQ LHLS  I+   IPVH+ G ATH RQ    RVH 
Sbjct  7     NAVKISNDLPIVVVMVPLPAQGHLNQLLHLSHHISTFHIPVHFVGTATHNRQVQLRRVHN  66

Query  191   WDPLAV-PNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATS-HLRRPFNALIRNLS  364
                ++  P++ FH   +P F SPPPNP A  KFP+ L+P F A + HL RP  A +R LS
Sbjct  67    GSQISSHPSIQFHDFDIPPFPSPPPNPAAPHKFPSHLIPSFIAAALHLHRPLAAFLRALS  126

Query  365   VDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERT------GKPDVG  526
                KR+VVI DSLM   +QDV ++ N E Y F  +SAFT    + ER       G  D G
Sbjct  127   SKVKRLVVIHDSLMSSALQDVNAIPNTESYCFHSVSAFTVALHNLERKVRFANDGHKD-G  185

Query  527   PEAAGVLNHMP------SPEGCFIPEFEEFIKMQ-RPFWDASSGDLLNSCREIEALFIDL  685
                     + P      S E CF  EF EFI  Q R      +G + N+C+ IE  F+++
Sbjct  186   EITTIYQQYFPKELNVVSTEECFPTEFLEFIGSQFRHLPKMGAGKIYNTCKFIEGEFLEV  245

Query  686   IGKESKTGFQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQI  865
             I +       WA+GP NP+ ++    +  H  + WLD+QE  SV+++SFG+TT++ +EQI
Sbjct  246   IQRIEPEFRHWALGPFNPLKISKPPCS--HSCMAWLDQQEPRSVIYISFGTTTTMKDEQI  303

Query  866   TELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQL  1045
              E+  GL  S QKFIWV+RD D+GDVFD  E  R++ +PEGY   +  +G+V+++WAPQL
Sbjct  304   KEIAIGLARSDQKFIWVLRDADKGDVFDVNEI-RKSNLPEGYNNLIGDQGLVIKDWAPQL  362

Query  1046  EILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWA  1225
             EILGH + GGFM+HCGWNSC+ESI+ GVP+ AWPMHSDQPRN  L+T VL +G+ L +W 
Sbjct  363   EILGHWATGGFMTHCGWNSCIESITTGVPVIAWPMHSDQPRNTVLMTRVLCVGVGLKEW-  421

Query  1226  RRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
              + E +    I E V+KL+ S EG ++RR A  L   +++ +  GG  R E E+FVAHIT
Sbjct  422   -QQELIMAGAIEEVVRKLMVSEEGAKVRRNAERLGNVVRQSLEEGGESRKEFEAFVAHIT  480

Query  1406  R  1408
             R
Sbjct  481   R  481



>ref|XP_010056863.1| PREDICTED: zeatin O-glucosyltransferase-like [Eucalyptus grandis]
Length=473

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 228/460 (50%), Positives = 295/460 (64%), Gaps = 11/460 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHLNQ L L+ L+A++GIPVH+ G+A+  RQA  R H     A  ++ FH    P
Sbjct  14    PLPAQGHLNQLLQLAHLVASYGIPVHFVGSASVNRQAKLRSHVPLSSAPGDISFHDFPTP  73

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
                SP P+  +  KFP+QL P F ATS LR P  +L+R+LS   +RVVV+ DSLM  VVQ
Sbjct  74    PIPSPAPSLSSPYKFPSQLQPAFNATSSLRGPVASLVRSLSSVSRRVVVVYDSLMASVVQ  133

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPEGCFIPE  586
             D  S+ NAE+Y F+  SAF    F WE  G    P+V  + A +++    PS       E
Sbjct  134   DAASVPNAEIYVFQPPSAFMLCWFTWESIGMAPPPEVEVDLAELISSKGFPSIVDSCPNE  193

Query  587   FEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLTD-  754
             F +F++ Q+     +SG + N+CR +E  F+DL    +  G     WAIGP NPV + + 
Sbjct  194   FLKFVESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVKVPEK  253

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             S   + H  +EWLD+Q   SV++VSFG+TT LS EQI E+  GLE SGQKFIWV+R+ D+
Sbjct  254   SSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSGEQIREIAMGLERSGQKFIWVLREADK  313

Query  935   gdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCM  1108
              D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNSCM
Sbjct  314   ADIFGGGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWNSCM  373

Query  1109  ESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIas  1288
             ESISMGVPI AWPMHSDQP NA LIT+VLK+G+ + DW   ++ V    I   VK L+AS
Sbjct  374   ESISMGVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSAIEGAVKALMAS  433

Query  1289  aegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EGEE R+RAAEL  +++  +  GG  R EL+SF+AHI+R
Sbjct  434   EEGEEARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  473



>gb|KCW90134.1| hypothetical protein EUGRSUZ_A02323, partial [Eucalyptus grandis]
Length=460

 Score =   326 bits (835),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 228/455 (50%), Positives = 290/455 (64%), Gaps = 11/455 (2%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMP  241
             PLPAQGHLNQ L L+ L+A++GIPVH+ G+A+  RQA  R H     A  ++ FH    P
Sbjct  11    PLPAQGHLNQLLQLAHLVASYGIPVHFVGSASVNRQAKLRSHVPLSSAPGDISFHDFPTP  70

Query  242   HFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQ  421
                SP P+  +  KFP+QL P F ATS LR P  +L+R+LS   +RVVV+ DSLM  VVQ
Sbjct  71    PIPSPAPSLSSPYKFPSQLQPAFNATSSLRGPVASLVRSLSSVSRRVVVVYDSLMASVVQ  130

Query  422   DVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFI  601
             D  S+ NAE+Y F+  SAF    F WE  G     PE  G     PS       EF +F+
Sbjct  131   DAASVPNAEIYVFQPPSAFMLCWFTWESIGMAP-PPEVEG----FPSIVDSCPNEFLKFV  185

Query  602   KMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNPVSLTD-SINTN  769
             + Q+     +SG + N+CR +E  F+DL    +  G     WAIGP NPV + + S   +
Sbjct  186   ESQKECQKFNSGCIHNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNPVKVPEKSSRRS  245

Query  770   RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfd  949
              H  +EWLD+Q   SV++VSFG+TT LS EQI E+  GLE SGQKFIWV+R+ D+ D+F 
Sbjct  246   AHGCMEWLDKQAPSSVIYVSFGTTTVLSGEQIREIAMGLERSGQKFIWVLREADKADIFG  305

Query  950   dgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISM  1123
              G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHCGWNSCMESISM
Sbjct  306   GGGEARKIELPQGFEEMAAARDLGVVVRDWAPQLEILGHPATGGFLSHCGWNSCMESISM  365

Query  1124  GVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegee  1303
             GVPI AWPMHSDQP NA LIT+VLK+G+ + DW   ++ V    I   VK L+AS EGEE
Sbjct  366   GVPILAWPMHSDQPLNAVLITQVLKIGLIVKDWMSPDDVVKSSAIEGAVKALMASEEGEE  425

Query  1304  mrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              R+RAAEL  +++  +  GG  R EL+SF+AHI+R
Sbjct  426   ARKRAAELGAAVRGSMDEGGVSRAELDSFIAHISR  460



>ref|XP_009598914.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=514

 Score =   327 bits (839),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 214/499 (43%), Positives = 287/499 (58%), Gaps = 49/499 (10%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P P QGHLNQ LHLSRL++++ +P+HY G   HI+QA  RVHGWD  A   ++F
Sbjct  21    VAVVMVPFPVQGHLNQLLHLSRLLSSYNLPIHYIGFEDHIKQAKLRVHGWDLNARSTIYF  80

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFF-ATSHLRRPFNALIRNLSVDQKRVVVISDS  400
                    F  PP    +S    T+LM   F AT  LR P    ++ +S   +RVV+I DS
Sbjct  81    QE-----FPVPPSLNISSQISRTELMTCLFHATLQLREPVFTFLKEVSAKYRRVVIIYDS  135

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWE----------RTGKPDVGPE------  532
             LM   VQDV  + N E Y F   SAF TYSF W+          +T  P +  E      
Sbjct  136   LMTCTVQDVRLIPNMEAYCFHGSSAFNTYSFIWDAITKLFPAYVKTNHPTMVSERLLKSF  195

Query  533   ---------------------AAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLN  649
                                     +L ++PS E  + PE  E +K Q        GD+ +
Sbjct  196   MKAFANLKVSSLIFSSPNIRRKMKILKNLPSIESSYPPEILEVLKKQLECGKIKCGDIHD  255

Query  650   SCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDS---INTNRHKSLEWLDRQEKDSVL  820
             +   IE  ++DL+ K      QWA+GP NP+ + +    I   RH+ LEWLD+   +SV+
Sbjct  256   TSSVIEGPYLDLLTKFMGNDKQWALGPFNPMVIMEKKGPIIVRRHECLEWLDKHAPNSVI  315

Query  821   FVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAAR---RAevpegy  991
              VSFG++ SLS++QI EL  GLE S QKFIW++R  D        E       A++PEG 
Sbjct  316   LVSFGTSVSLSHDQINELAIGLERSQQKFIWLLRTADDRKANASTEENNVLVEAQLPEGL  375

Query  992   eervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRN  1171
             E+R+ GRG++V++WAPQLEIL H S GGFMSHCGWNSCMESI+MGVPIAAWPM  DQPRN
Sbjct  376   EKRLEGRGIIVKDWAPQLEILAHQSTGGFMSHCGWNSCMESITMGVPIAAWPMQVDQPRN  435

Query  1172  ATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPI  1351
             A LITEVL++G+++  W  ++       I   VK+L+ S EG++MR+ A  L  ++KE +
Sbjct  436   AVLITEVLRIGLNVRKWDSKDNLTSSMTIENVVKRLMTSLEGDDMRKNAKLLGNAIKESM  495

Query  1352  AVGGGGRNELESFVAHITR  1408
               GG  R EL++F+AHI R
Sbjct  496   VDGGATRKELDTFIAHIRR  514



>gb|EYU18707.1| hypothetical protein MIMGU_mgv1a005868mg [Erythranthe guttata]
Length=467

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 297/458 (65%), Gaps = 9/458 (2%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+++P PAQGHLNQ L LS LI+++ IPVHY G+A H RQA  R +G +P  V  +HF
Sbjct  16    VTVIIVPFPAQGHLNQMLQLSCLISSYSIPVHYVGSAVHNRQAQLRSNGLNPNDVAGIHF  75

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P F SPPPNP++S KFP QL P F AT +LR+P    +R LS   +RVVVI D L
Sbjct  76    HDLPIPPFPSPPPNPNSSNKFPAQLQPAFDATLNLRQPLADFMRTLSEKHRRVVVIHDPL  135

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             +  VV+D+ S+ NAE Y F C+S F    F  E  GK      +      +P+   C   
Sbjct  136   IASVVEDIVSIPNAESYAFNCLSGFFQVFFVHELMGKKC----SLKSPKELPTVASCITK  191

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTDS  757
             +   FI  Q        GDL N+CR +EA F+D++  E   G +  WAIGPL P +   S
Sbjct  192   DLMRFIFSQNQALGYRKGDLYNTCRLLEAPFLDILESEEVAGNRKSWAIGPLIPATKFSS  251

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
              +  +H  L WLD+QE  SV++V+FG+TT+L++E+I  L  GLE+S  KF+WV+R+ D+G
Sbjct  252   -SEKKHNCLTWLDKQEPKSVMYVTFGTTTTLTDEEIEVLANGLEQSKHKFLWVLREADKG  310

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             +VFD  E  R  ++P G+  RV G G+VVR+WAPQ EIL H SVGGFMSHCGWNSC+ESI
Sbjct  311   NVFDGEE-RREIQLPSGFVRRVDGVGLVVRDWAPQPEILAHESVGGFMSHCGWNSCIESI  369

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI-asae  1294
             +MGVP+AAWPMHSDQP NA  +TE+LKMG+++ +W    E V    +   V++L+  S E
Sbjct  370   TMGVPMAAWPMHSDQPTNAVFVTEILKMGLAVREWTNGGEEVEASTVENVVRRLMGGSEE  429

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             G  +R+RA EL+  ++  +  GG  R E +SF+AH+TR
Sbjct  430   GGRIRKRAEELAAVVRGAVEEGGASRLEFDSFIAHVTR  467



>ref|XP_008808448.1| PREDICTED: zeatin O-glucosyltransferase-like [Phoenix dactylifera]
Length=490

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 289/463 (62%), Gaps = 22/463 (5%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPN--LHFHHLSMPH  244
             AQGHLNQ LHLS L+AA GIPVHY G+A+H RQA  R  GW P +  +  + FH   +P 
Sbjct  33    AQGHLNQLLHLSHLLAARGIPVHYVGSASHNRQARERALGWQPESPGHRPIRFHDFILPP  92

Query  245   FQSPPPNPDASTKFP-TQLMPVFFATS-HLRRPFNALIRNLSVDQKRVVVISDSLMGWVV  418
             F SPP    AST  P   L+P+F A + H R P  AL+R+L+   +RVV+I DS M + V
Sbjct  93    FPSPP----ASTHAPLAHLLPLFDAAALHFRSPLAALLRSLTTSSRRVVLIHDSTMAFAV  148

Query  419   QDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGV-LNHMPSPEGCFIPEFEE  595
                 S+ + E + F  +SAF+   ++ E  GKP   P  A + +  +P+   CF  +F +
Sbjct  149   SVAASVPHVEAFSFHSVSAFSLLLYYCESRGKPPDDPSIAKLNIPDIPN-NACFTEQFLD  207

Query  596   FIKMQRPFWDASSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNPVSLTDSINTN  769
             F++ Q     A SG L N+CR IE  FIDL+ +E   +T   +AIGPLNP+S+T      
Sbjct  208   FLRRQHESTAADSGRLFNTCRGIEGRFIDLLAREPQWRTQKTFAIGPLNPLSITKRTGCG  267

Query  770   -RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvf  946
              RH  LEWLD+Q   SVL+VSFG+ ++LS++Q+ EL  GLE S Q+FIWV+RD DR D++
Sbjct  268   PRHPCLEWLDKQPPASVLYVSFGTASALSDDQVVELAWGLEASRQRFIWVLRDADRADIY  327

Query  947   dd---------gEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
              +          ++         Y+ RV   G VVR WAPQLEIL HPS GGFMSHCGWN
Sbjct  328   TEEGDEGKQKPKKSQEERLGRLDYDRRVERVGRVVRGWAPQLEILAHPSTGGFMSHCGWN  387

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             SCMES+SMGVP+ AWPMHSDQPRN  L+T VL++GI+  DWARRNE V    I + + +L
Sbjct  388   SCMESMSMGVPLLAWPMHSDQPRNTLLLTRVLRVGITARDWARRNEVVPAAAIRDSIVRL  447

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + S EG+E+R RA  +    ++    GG  R + ++F+ HIT+
Sbjct  448   MVSEEGKEVRARATAVGGVARQATTEGGTSRADFDAFITHITK  490



>gb|EYU18709.1| hypothetical protein MIMGU_mgv1a024073mg [Erythranthe guttata]
Length=456

 Score =   323 bits (828),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 287/466 (62%), Gaps = 25/466 (5%)
 Frame = +2

Query  56    MLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRV--HGWDP--LAVPNLHF  223
             M+PLP+Q HLNQ L LS LI++ G+PVH+ G+ATH RQA  R   HG +P   A   +HF
Sbjct  1     MVPLPSQSHLNQLLQLSYLISSGGLPVHFLGSATHNRQAKLRSSHHGLNPNSAAANTIHF  60

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L  P   +P P  +++ K PT + P   A   LR P    +R LS   KRVV+I D L
Sbjct  61    HDLPTPPIPTPDPISNSTDKLPTHMAPAVLAYMALREPIAEFLRRLSEKTKRVVLIHDWL  120

Query  404   MGWVV-QDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHM--PSPEGC  574
             +   V  D  S+ N E Y F C+SA   +   WE  GKP      AG  N +  PS    
Sbjct  121   VAEAVSDDAVSIPNLETYAFNCMSAVNLFYILWETAGKPF---SLAGEPNELVVPSVTEF  177

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF--QWAIGPL-----  733
             F  E   FI ++   +    GD+ N+ R IE  +I+ +G+    G   QWAI P      
Sbjct  178   FPEEIINFIAVKPEHFKKRDGDIFNTTRLIEGRYIEYLGRREIGGVEKQWAIRPTLLLRS  237

Query  734   -NPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
              NP +    +N  RHK +EWLD+Q   SV++V FG++ SLS E+  E+  GLEES QKF+
Sbjct  238   RNPAA--GELNLRRHKCMEWLDKQAPKSVVYVCFGTSVSLSEEEAKEIALGLEESKQKFL  295

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+RD D+ D+F     +R+ E+P G+EERV+  G+VVR+WAPQ+EIL H SVGGFMSHC
Sbjct  296   WVLRDADKADIFAGE--SRKIELPLGFEERVKEDGMVVRDWAPQVEILAHESVGGFMSHC  353

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSC ES+ MGVP+AAWPMHSDQP NA  +TEVLK+G+ + +WARR E V    IG+ V
Sbjct  354   GWNSCFESLVMGVPVAAWPMHSDQPLNAVFLTEVLKVGVVVREWARREEVVEAAVIGKVV  413

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++L+     EE+RR A ELS ++K+ +  GG    E++SF+AHITR
Sbjct  414   ERLM---ASEEIRRTAVELSAAVKKSMEDGGECSREMDSFIAHITR  456



>ref|XP_006351296.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X3 [Solanum 
tuberosum]
Length=445

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 276/462 (60%), Gaps = 44/462 (10%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +V++P   QGHLN  L+LSR+++++ +PV + G +T  RQA  R+   + +       
Sbjct  21    VAIVIVPYLEQGHLNPLLNLSRILSSYKLPVFFLGTSTSNRQAKFRLSVMEKIG------  74

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
                                         F +   LR P    ++ +S   +R VVI+DS 
Sbjct  75    --------------------------SFFTSILLLREPIREFLQEVSSTYRRTVVINDSG  108

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M WVVQD  S+ N E Y F  IS FT  SF  E T K    P  A ++  +P  E  F  
Sbjct  109   MSWVVQDAVSIPNTECYCFHTISVFTALSFACETTKKLLPSP-VAEIIAELPPRENTFDS  167

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWAIGPLNPVSLTDS  757
             E  E+IKMQR   +  S  L NSC+EIE +FIDL  + +E+K   QWAIGPLNPV ++  
Sbjct  168   ETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLLEVQRENK---QWAIGPLNPVKISKK  224

Query  758   INTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              ++ + H+   WL++Q+ +SV++VSFGSTT+LS EQI EL  GLE+S QKFIWV+R  D+
Sbjct  225   KSSEQTHECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADK  284

Query  935   gdvfddgEAARRAevpe----gyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
                 +     R +            R +G G + + W+PQLEIL H S+GGFMSHCGWNS
Sbjct  285   KGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGGFMSHCGWNS  344

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             C+ESISMGVP+AAWP+HSDQPRN  LIT+VLK+GI + DW  R+E V   +I   V+ L+
Sbjct  345   CIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAKIENVVRNLM  404

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              SAEGEE+RRR  ELS ++K+ + + G  R E++SFVAHITR
Sbjct  405   GSAEGEELRRRVTELSSAVKKSV-MNGASRKEMDSFVAHITR  445



>ref|XP_006351295.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
tuberosum]
Length=446

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 277/462 (60%), Gaps = 43/462 (9%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +V++P   QGHLN  L+LSR+++++ +PV + G +T  RQA  R+             
Sbjct  21    VAIVIVPYLEQGHLNPLLNLSRILSSYKLPVFFLGTSTSNRQAKFRL-------------  67

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
                               +    ++   F +   LR P    ++ +S   +R VVI+DS 
Sbjct  68    ------------------SAVMEKIGSFFTSILLLREPIREFLQEVSSTYRRTVVINDSG  109

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M WVVQD  S+ N E Y F  IS FT  SF  E T K    P  A ++  +P  E  F  
Sbjct  110   MSWVVQDAVSIPNTECYCFHTISVFTALSFACETTKKLLPSP-VAEIIAELPPRENTFDS  168

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWAIGPLNPVSLTDS  757
             E  E+IKMQR   +  S  L NSC+EIE +FIDL  + +E+K   QWAIGPLNPV ++  
Sbjct  169   ETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDLLEVQRENK---QWAIGPLNPVKISKK  225

Query  758   INTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
              ++ + H+   WL++Q+ +SV++VSFGSTT+LS EQI EL  GLE+S QKFIWV+R  D+
Sbjct  226   KSSEQTHECFSWLNKQDLNSVIYVSFGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADK  285

Query  935   gdvfddgEAARRAevpe----gyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
                 +     R +            R +G G + + W+PQLEIL H S+GGFMSHCGWNS
Sbjct  286   KGGDNIENVERGSNFDLPEGFEERIRDKGVGFIEKNWSPQLEILAHGSIGGFMSHCGWNS  345

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
             C+ESISMGVP+AAWP+HSDQPRN  LIT+VLK+GI + DW  R+E V   +I   V+ L+
Sbjct  346   CIESISMGVPMAAWPIHSDQPRNTVLITKVLKIGIIVRDWENRDELVSAAKIENVVRNLM  405

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              SAEGEE+RRR  ELS ++K+ + + G  R E++SFVAHITR
Sbjct  406   GSAEGEELRRRVTELSSAVKKSV-MNGASRKEMDSFVAHITR  446



>ref|XP_006355031.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=449

 Score =   320 bits (820),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 293/457 (64%), Gaps = 26/457 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+P PAQGHLNQ L LS LI+++G+PV+Y G ATH  QA  R +  +P  +  +HF
Sbjct  17    VAIVMVPFPAQGHLNQLLQLSCLISSYGLPVYYVGLATHNDQARIRANALNPSNIAKIHF  76

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L         PNP+    F T    ++ A+  LR P  + IR++S   +RV+V+ D +
Sbjct  77    HDL---------PNPEL-IAFET----IWDASMLLRDPIASFIRDISSKVRRVIVVHDPM  122

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + VQDV SL NAE Y   CIS F+ Y        K  V  E   +L  + S EG    
Sbjct  123   MSYNVQDVSSLPNAESY--NCISVFSCYILMC-LLLKISVQHEEE-LLTKLSSLEGVTTD  178

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDS  757
             E  +    Q P+ D  SGD+ N+ + IE+ +IDL+ +   S    QWAIGP+ P    D 
Sbjct  179   EARDLSDFQYPYMDIRSGDIHNTSKLIESKYIDLMEQAEISLNKKQWAIGPILPTKF-DY  237

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
             I++     L+WL++Q   SV++VSFG+TTS S+ QI EL  GLE+S Q+FIWV+RD DRG
Sbjct  238   ISS---ICLDWLNKQPPRSVIYVSFGTTTSFSDRQIKELAMGLEQSKQRFIWVLRDADRG  294

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
              +F   +  R+ E+PEG+EERV G G+VVREWAPQ EIL H S GGFMSHCGWNSC+ESI
Sbjct  295   HIFKRED--RKFELPEGFEERVEGVGLVVREWAPQPEILAHSSTGGFMSHCGWNSCLESI  352

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPIAAWP+H+DQP N  L+TE+LK+G+ + DW +R E V    I   V+KL+AS EG
Sbjct  353   TMGVPIAAWPIHTDQPINGFLVTEILKIGLLVRDWGKREEVVSESTIENVVRKLMASEEG  412

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + +R+RA EL +++++    GG  + EL+SF+AHITR
Sbjct  413   DLIRKRAEELGEAIRQSTEKGGASQIELDSFIAHITR  449



>ref|XP_006605211.1| PREDICTED: zeatin O-glucosyltransferase-like, partial [Glycine 
max]
Length=371

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 193/373 (52%), Positives = 259/373 (69%), Gaps = 2/373 (1%)
 Frame = +2

Query  290   TQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCI  469
             + L+P F A++ LR P  AL+++LS   +RVVVI DSLM  VVQD   + N E Y F  +
Sbjct  1     SHLLPSFEASTSLRVPVYALLQSLSSVARRVVVIYDSLMASVVQDAIHVPNCESYTFHSV  60

Query  470   SAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLN  649
             SAFT + + W+  G+P V  + + V+  +PS EGCF     +FI  Q  F   S G + N
Sbjct  61    SAFTMFLYFWDAMGRPPV-EKVSHVIPEVPSLEGCFTTRCIDFITSQYEFHKFSKGTIYN  119

Query  650   SCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVS  829
             + R IE+ +++LI +   +   WA+GP NP+S+   +   +H S+EWLD+QE  SVL+VS
Sbjct  120   TTRVIESPYLELIKRIISSKTHWALGPFNPLSIEKGVYNTKHFSVEWLDKQEAGSVLYVS  179

Query  830   FGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrg  1009
             FG+TT  S EQI E+  GLE+S QKFIWVVRD D+GDVF + +  R +E+P+G+EERV+G
Sbjct  180   FGTTTCFSEEQIKEVANGLEKSKQKFIWVVRDADKGDVFIE-DGVRTSELPKGFEERVKG  238

Query  1010  rgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITE  1189
              G+VVR+WAPQLEIL H S GGFMSHCGWNSCMESI+MGVPIAAWPMHSDQPRN  L+TE
Sbjct  239   TGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCMESITMGVPIAAWPMHSDQPRNRVLVTE  298

Query  1190  VLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGG  1369
             VLK+G+ + DW  R+E V   ++   V++LIA+ EG+EMR+RA  L  +++     GG  
Sbjct  299   VLKIGVVVKDWDHRDELVTASDVENAVRRLIATKEGDEMRQRAMNLKNAIRRSRDEGGVS  358

Query  1370  RNELESFVAHITR  1408
             R EL+ F+AHITR
Sbjct  359   RVELDDFIAHITR  371



>ref|XP_010312115.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312116.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312117.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010312118.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X2 [Solanum 
lycopersicum]
Length=457

 Score =   317 bits (813),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 197/429 (46%), Positives = 259/429 (60%), Gaps = 14/429 (3%)
 Frame = +2

Query  137   HYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA  316
             +  G +T  RQA  R+ GW+ L  P + FH L       P      S     +L   F +
Sbjct  38    YCYGTSTSNRQAKFRLSGWNILDFPTIRFHDLV------PGSCSSVSASVMEKLGSFFTS  91

Query  317   TSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFH  496
                LR P    ++ +S   +R VVI+D+ M WVVQD  S+ N E Y F  ISAFT  SF 
Sbjct  92    ILLLREPIREFLQEVSSTYRRTVVINDTGMSWVVQDAVSIPNTECYCFHTISAFTALSFA  151

Query  497   WERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALF  676
              E T KP   P  A ++  +P  E  F  E  E+I MQ    D  S  L NSC+EIE +F
Sbjct  152   CEATKKPLPSP-VAEIIAELPPKENTFDSETIEYIMMQHESRDFYSVGLHNSCKEIEGVF  210

Query  677   IDLIGKESKTGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLS  853
             I+L+ +E +   QWAIGP+ PV ++   ++   H+   WLD+Q+ +SV++VSFGSTT+LS
Sbjct  211   IELL-EEQRENKQWAIGPVYPVEISKRKSSELTHECFSWLDKQDLNSVIYVSFGSTTTLS  269

Query  854   NEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpe----gyeervrgrgvv  1021
              EQI EL  GLE+S QKFIWV+R  D+    +     R +            + +G G +
Sbjct  270   KEQINELAFGLEQSEQKFIWVLRGADKKGGDNIENVERGSNSDLPDGFEERIKEKGVGFI  329

Query  1022  vreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKM  1201
              + WAPQLEIL H S+GGFMSHCGWNSC+ESISMGVP+AAWP+HSDQPRN  LIT+VLK+
Sbjct  330   EKNWAPQLEILAHGSIGGFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKI  389

Query  1202  GISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNEL  1381
             GI + DW  R E V   +I   V+ L+ SAEGEE+RRR  ELS S+K+ + + G  R E+
Sbjct  390   GIIVRDWENRYELVSAAKIKNAVRFLMDSAEGEELRRRVTELSSSVKKSV-MNGASRKEM  448

Query  1382  ESFVAHITR  1408
             +SFVAHITR
Sbjct  449   DSFVAHITR  457



>gb|EMT20809.1| Putative cis-zeatin O-glucosyltransferase [Aegilops tauschii]
Length=459

 Score =   314 bits (804),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 200/466 (43%), Positives = 277/466 (59%), Gaps = 21/466 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +A+ G+ VHYA AA HIRQA  RVHGW   A+ ++ F
Sbjct  4     VAVVAVPFPAQGHLNQLLHLSLQLASRGVDVHYAAAAQHIRQARTRVHGWGEEALRSIQF  63

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  + SPPP+P A + FP+ LMP+F A T+  R P  AL+ +LS   +RVVV+ D 
Sbjct  64    HDLGISSYVSPPPDPTADSPFPSHLMPLFEAYTASARAPLAALLEDLSGSCRRVVVVHDR  123

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPE---AAGVLNHMPSPEG  571
             +  +  ++   L N E +   C++            G+ D         GV+  + S E 
Sbjct  124   INAFAAEEAARLPNGEAFGLNCVAVSML-------VGRIDANHRLLRENGVV--LSSVER  174

Query  572   CFIPEFEEFIKMQRPFWDASSGD--LLNSCREIEALFIDLI-GKESKTGFQ-WAIGPLNP  739
                 EF E+    RP    S+G   L N+CR +E  FID++ G  +  G + +AIGPLNP
Sbjct  175   YATKEFIEYANRARPAKQISTGAGILANTCRALEGDFIDVVAGHLAADGKKLFAIGPLNP  234

Query  740   VSLTDSINTN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
             + L DS +     RH+ L WLD+Q   SVL+VSFG+T+SL  EQI EL A L  S Q+FI
Sbjct  235   L-LDDSASKQSKQRHECLNWLDKQPPASVLYVSFGTTSSLRAEQIEELAAALRGSRQRFI  293

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+RD DRGD+F +   +R  +    + +   G G+V+  WAPQL+IL H +   FMSHC
Sbjct  294   WVLRDADRGDIFVEAGESRHEKFLSEFTKHTEGTGLVITGWAPQLDILAHSATAAFMSHC  353

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNS MES+S G PI AWPMH DQP +A L+   LK GI +  W + +E V  + I E +
Sbjct  354   GWNSTMESMSHGKPILAWPMHCDQPWDAELVCNYLKAGILVRPWEKHSEVVTAKAIQEVI  413

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++ + S +G  +R+RA  L  +++  +A GG  R +L+ F A+ITR
Sbjct  414   EEAMISDKGMAVRQRARALGDAVRASVADGGSSRKDLDDFTAYITR  459



>ref|XP_009779217.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana sylvestris]
Length=460

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 199/462 (43%), Positives = 280/462 (61%), Gaps = 14/462 (3%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
              V VVM+P P  GH   FLHLSR+I+++ IPVHY       ++   R+ G +    PN+ 
Sbjct  7     NVAVVMVPFPEYGHQTPFLHLSRIISSYDIPVHYVSIGARNQELKRRLQGSNLDQFPNIQ  66

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH LS+P  ++       + K     M  F +   L  P  A+   L    KRVV+I DS
Sbjct  67    FHDLSIPSARAT-----TAEKEDDNYMSYFASLELLGEPLCAICHQLLTTCKRVVIIHDS  121

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             +M  VVQ V S+ N E Y F  ISAFT  S   + +G  +       + +H+PS + C+ 
Sbjct  122   IMLSVVQGVISITNVETYIFHVISAFTVCSLFQQVSGSAENNDLFLPLQHHIPSFQSCYP  181

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPL-NPVSL---  748
             PE  EFIKM R  W   SG++ N+C +IE  +++ + K+S+    W +GPL NPV L   
Sbjct  182   PEMLEFIKMLRD-WTFKSGEIFNTCIDIEGPYLNALAKQSEKPL-WDLGPLINPVYLHND  239

Query  749   --TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
               + S     H+ +EWLD+Q K+SV++VSFG+  + S EQI EL  GLE S QKFIWV+R
Sbjct  240   EYSASPKIVSHRCIEWLDKQPKNSVIYVSFGTARTFSLEQIIELALGLERSEQKFIWVLR  299

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             + D+       +   + E+P G+EERV  RG++ R++ PQ+EIL HPS GG++ H GWNS
Sbjct  300   EADKKGNDFTTDVP-KIELPIGFEERVAERGIIARDFVPQMEILAHPSTGGYLFHSGWNS  358

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
              +ES++MGVP+A WP+HSD P N  LIT+VLK+G+ + DWA +++ V    I  GV+ LI
Sbjct  359   FLESLTMGVPMATWPIHSDNPFNDVLITKVLKVGLVVKDWAHKDDLVKADRIENGVRTLI  418

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              S EGEEMR+RA  LSQ++K  +  GG  + + ESF+AHITR
Sbjct  419   TSPEGEEMRQRAIALSQAIKMSVKDGGATKEQTESFIAHITR  460



>ref|XP_004236910.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=447

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 288/457 (63%), Gaps = 28/457 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V +VM+PLPAQGHLNQ L LS LI+++  PV+Y G ATH RQA  R+   +P  +  LHF
Sbjct  17    VAIVMVPLPAQGHLNQLLQLSCLISSYHHPVYYVGLATHNRQA--RI-ALNPSNISKLHF  73

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L         PNP+    F T    ++ A+ HLR P  + IR++S   +RV+V+ D +
Sbjct  74    HDL---------PNPEL-IAFET----IWDASMHLRDPIASFIRDISSKVRRVIVVHDPM  119

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M + VQDV SL NAE Y F  IS F+ Y        K  V  E   +L  + S EG    
Sbjct  120   MSYNVQDVSSLPNAESYIFNNISVFSCYIIMCLFL-KTSVQHEEE-LLKKLYSFEGVTTD  177

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKE--SKTGFQWAIGPLNPVSLTDS  757
             E  +    Q P+ D  SGD+ N+ + IE  +ID + +   S    QWAIGP+ P  L D 
Sbjct  178   EAMDLSDSQHPYMDIRSGDIHNTSKVIERKYIDSMEQAELSLNKKQWAIGPILPTKL-DY  236

Query  758   INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
             I+      L+WL++Q   SVL+VSFG+TTSLS+ QI EL  GLE+S Q+FIWV+RD DRG
Sbjct  237   ISNKEDVCLDWLNKQPPRSVLYVSFGTTTSLSDRQIKELAMGLEQSKQRFIWVLRDADRG  296

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
                   +  R+ E+P+G+EERV+G G+VVREW PQL+IL H S GGFMSHC W SC+ESI
Sbjct  297   ------DIDRKVELPQGFEERVKGVGLVVREWTPQLQILAHSSTGGFMSHCDWTSCLESI  350

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVPI  WP+H++QP N  L+T++LK+G+ + DW +R E V    I   V+KL+AS EG
Sbjct  351   TMGVPIGVWPIHTNQPINGFLVTDILKVGLLVRDWGKREEVVSASTIQNVVRKLMASEEG  410

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + +R+RA EL +++++    GG  + EL+SF+AHITR
Sbjct  411   DTIRKRAEELGEAVRQSTEKGGAFQIELDSFIAHITR  447



>ref|XP_009593501.1| PREDICTED: zeatin O-xylosyltransferase-like [Nicotiana tomentosiformis]
Length=466

 Score =   307 bits (787),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 280/463 (60%), Gaps = 10/463 (2%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
              V VVM+P P  GH   FLHLSRLI+++ IPVHY       ++   R+ G +    PN+ 
Sbjct  7     NVAVVMVPFPEYGHQTPFLHLSRLISSYDIPVHYFSIGARNQELKRRLQGSNLDQFPNIQ  66

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLR-RPFNALIRNLSVDQKRVVVISD  397
             FH LS+P  ++     +   +        +FA+  L   P  ++   L    KRVV+I D
Sbjct  67    FHDLSIPSTKAEKEAEEEEEEEDEDDYMSYFASLELLGEPLCSICHELLNTCKRVVIIHD  126

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             S+M  VVQ V S+ N E Y F  ISAFT  S   + +G  +       +  H+PS + C+
Sbjct  127   SIMLSVVQGVISITNVETYIFHVISAFTVCSLFQQVSGSAENYDLFLPLQPHIPSFQSCY  186

Query  578   IPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPL-NPVSLTD  754
              PE  EFI+M R  W   SG++ N+CR+IE L++D + K+S+    W +GPL NPV L +
Sbjct  187   PPEMLEFIEMLRD-WTFKSGEIFNTCRDIEGLYLDALAKQSEKPL-WGLGPLINPVYLQN  244

Query  755   -----SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
                  S     H+ +EWLD+Q K+SV++VSFG+  + S EQI EL  GLE S QKFIWV+
Sbjct  245   DEYSASPKIVSHRCIEWLDKQPKNSVIYVSFGTARTFSLEQIIELALGLERSEQKFIWVL  304

Query  920   rdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWN  1099
             R+ D+       +   + E+P G+E+RV  RG++ R++ PQ+EIL HPS GG++ H GWN
Sbjct  305   READKKGNDFTTDVP-KIELPIGFEDRVAERGIIARDFVPQMEILAHPSTGGYLFHSGWN  363

Query  1100  SCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKL  1279
             S +ES+ MGVP+A WP+HSD P N  LIT+VLK+G+ + DW  R+E V    I  GV+ L
Sbjct  364   SFLESLIMGVPMATWPIHSDNPFNDVLITKVLKVGLVVKDWEHRDELVRANTIENGVRDL  423

Query  1280  IasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             + S EGEEMR+RA ELSQ++K  +  GG  + + ESF+AHI R
Sbjct  424   MTSTEGEEMRQRAIELSQAIKMSVKDGGATKKQTESFIAHIAR  466



>dbj|BAJ89478.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 196/466 (42%), Positives = 274/466 (59%), Gaps = 21/466 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +A+ G+ VHYA  A HIRQA  RVHGW   A+ ++ F
Sbjct  11    VAVVAVPFPAQGHLNQLLHLSLQLASRGVDVHYAAPAQHIRQARARVHGWGEEALLSIQF  70

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  + SPPP+P A + FP+ LMP+F   T+  R P  AL+ NLS   +RVVV+ D 
Sbjct  71    HDLGISSYVSPPPDPTADSPFPSHLMPLFETFTAGARAPLAALLENLSGSCRRVVVVHDR  130

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGP---EAAGVLNHMPSPEG  571
             +  +  ++   L N E +   C++            G+ D         GV+  + + E 
Sbjct  131   INAFAAEEALRLPNGEAFGLHCVAVSML-------VGRIDANHPLLRENGVV--LSAIER  181

Query  572   CFIPEFEEFIKMQRPFWDASSGD--LLNSCREIEALFIDLI-GKESKTGFQ-WAIGPLNP  739
                 +F E+    RP    S+G   L N+C  +E  FID++ G  +  G + +AIGPLNP
Sbjct  182   YATKDFVEYANRARPVKQISTGAGILANTCHALEGDFIDVVAGHLAADGKKLFAIGPLNP  241

Query  740   VSLTDSINT---NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
             + L DS +     RH+ L WLD Q   SVL+VSFG+T+SL  EQI EL A L  S Q+FI
Sbjct  242   L-LDDSASKPSKQRHECLNWLDDQPPASVLYVSFGTTSSLRAEQIEELAAALCGSRQRFI  300

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+RD DRGD+F D   +R  ++   + +   G G+V+  WAPQLEIL H +   FMSHC
Sbjct  301   WVLRDADRGDIFADAGDSRHEKLLSEFTKNTEGTGLVITGWAPQLEILAHTATAAFMSHC  360

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNS MES+S G PI AWPMH DQP +A L+   L+ GI +  W + +E    + I E +
Sbjct  361   GWNSTMESLSHGKPILAWPMHCDQPWDAELVCNYLEAGILVRPWEKHSEVTTAKAIQEVI  420

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++ + S +G  +R+RA  L ++++  +A GG  R +L+ F A+ITR
Sbjct  421   EEAMLSDKGIAVRQRARALGEAVRASVADGGSSRKDLDLFTAYITR  466



>gb|KCW86031.1| hypothetical protein EUGRSUZ_B02735, partial [Eucalyptus grandis]
Length=424

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 273/454 (60%), Gaps = 49/454 (11%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V V+M+PLPAQGHLNQ L L+ L+A+ G+PVHY G+++H RQA  R H            
Sbjct  8     VAVIMVPLPAQGHLNQLLQLAHLVASCGVPVHYVGSSSHNRQAKLRSH------------  55

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
                                       P F ATS LR P  +L+R+LS   +RVVV+ DSL
Sbjct  56    --------------------------PAFDATSSLRGPVASLVRSLSSVSRRVVVVYDSL  89

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNH--MPSPE  568
             M  VVQD  S+ NAE+Y F+  SAFT   F WE  G    P+V  + A +++    PS  
Sbjct  90    MASVVQDAASVPNAEIYVFKPSSAFTFCWFTWESIGMAPPPEVEVDIAELISSKGFPSLL  149

Query  569   GCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF---QWAIGPLNP  739
                  EF +F+  Q      +SG +LN+CR +E  F+DL    +  G     WAIGP NP
Sbjct  150   DSCPNEFLKFVASQTECKKFNSGCILNTCRVVEGRFVDLFASATANGTAIKHWAIGPFNP  209

Query  740   VSLTD-SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             V + + S   + H  +EWLD+Q   SV++VSFG+TT LS+EQI E+  GLE SGQKFIWV
Sbjct  210   VKVPEKSSRRSAHGCMEWLDKQAPSSVIYVSFGTTTVLSDEQIREIAMGLERSGQKFIWV  269

Query  917   vrdgdrgdvfddgEAARRAe--vpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             +R+ D+ D+F  G  AR+ E           R  GVVVR+WAPQLEILGHP+ GGF+SHC
Sbjct  270   LREADKADIFGGGGEARKIELPQGFEEMAAARELGVVVRDWAPQLEILGHPATGGFLSHC  329

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNSCMESISMGVPI AWPMHSDQP NA LI +VLK+G+ + DW  +++ V    I   V
Sbjct  330   GWNSCMESISMGVPILAWPMHSDQPHNAVLIAQVLKIGLIVKDWMSQDDVVKSSAIEGAV  389

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGR  1372
             K L+AS EGEE R+RAAEL  +++  +  GG  R
Sbjct  390   KALMASEEGEEARKRAAELGAAVRGSMDEGGVSR  423



>ref|XP_009390437.1| PREDICTED: cis-zeatin O-glucosyltransferase 2-like [Musa acuminata 
subsp. malaccensis]
Length=468

 Score =   299 bits (766),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 207/462 (45%), Positives = 292/462 (63%), Gaps = 24/462 (5%)
 Frame = +2

Query  62    PLPAQGHLNQFLHLSRLIAAH-GIPVHYAGAATHIRQATHRVH-GWDPLAVPNLHFHHLS  235
             PLPAQ HL Q  H + L+    G+ VH+A +ATHI QA  RV+  W       LHFH L 
Sbjct  18    PLPAQSHLAQLHHFALLLCGRPGLSVHFATSATHIHQAKSRVNPAWG--GDSRLHFHELP  75

Query  236   MPHFQSPPPNPDAST-KFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGW  412
             +P F SPPP+ +++T +FP  L P+F A  HL  P + L+R+LS   +RVVV+ DSL  +
Sbjct  76    IPAFPSPPPDRNSTTTRFPAHLQPMFDAFEHLDEPISVLLRSLSASSRRVVVVHDSLASF  135

Query  413   VVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH----MPSPEGCFI  580
                +  +L NAE Y F C+ A   +   ++R       P AA  L      +P  +G   
Sbjct  136   AAVEAAALHNAESYNFSCLPAL--FQVFYDR-------PSAADELRDRGLALPPLDGIIT  186

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSLTD  754
              EF  F + +     +S+G LLN+CR IE  FIDL+ +E K   +  + +GPL+P+++ D
Sbjct  187   EEFGAFARRRMDENTSSAGRLLNTCRPIEGEFIDLLAREPKHRDRKIFTLGPLSPMAVID  246

Query  755   SINTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                  + H+ L WLD+Q   SV++VSFG+TT++++EQ+ EL  GL  SGQ+F+WVVRD D
Sbjct  247   GGRRRQPHECLYWLDKQPPASVVYVSFGTTTAMADEQVEELANGLLLSGQRFVWVVRDAD  306

Query  932   rgdvfddgEAA--RRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSC  1105
             RGD+F   +    RR E+P  +E++V G G+VVR WAPQL+IL HP+ G F+SHCGWNSC
Sbjct  307   RGDIFAAEDNGHVRRMELPPEFEQKVAGTGLVVRGWAPQLDILSHPATGAFVSHCGWNSC  366

Query  1106  MESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRRE-IGEGVKKLI  1282
             MES+ MGVP+ AWPMHSDQP  A L+T  LK G+++ +W  R ++V  R  I E +K+++
Sbjct  367   MESLCMGVPVIAWPMHSDQPTIAALVTGHLKAGVTVGEWTPRADKVTTRAVIEEAIKRVM  426

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                EG E+R RA  + ++++E IA GG  R EL++FVAHITR
Sbjct  427   VYDEGREIRERARVIGEAVREAIAEGGASRAELDAFVAHITR  468



>ref|XP_010312121.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
lycopersicum]
 ref|XP_010312122.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
lycopersicum]
Length=382

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 239/377 (63%), Gaps = 8/377 (2%)
 Frame = +2

Query  293   QLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCIS  472
             +L   F +   LR P    ++ +S   +R VVI+D+ M WVVQD  S+ N E Y F  IS
Sbjct  9     KLGSFFTSILLLREPIREFLQEVSSTYRRTVVINDTGMSWVVQDAVSIPNTECYCFHTIS  68

Query  473   AFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNS  652
             AFT  SF  E T KP   P  A ++  +P  E  F  E  E+I MQ    D  S  L NS
Sbjct  69    AFTALSFACEATKKPLPSP-VAEIIAELPPKENTFDSETIEYIMMQHESRDFYSVGLHNS  127

Query  653   CREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVS  829
             C+EIE +FI+L+ +E +   QWAIGP+ PV ++   ++   H+   WLD+Q+ +SV++VS
Sbjct  128   CKEIEGVFIELL-EEQRENKQWAIGPVYPVEISKRKSSELTHECFSWLDKQDLNSVIYVS  186

Query  830   FGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpe----gyee  997
             FGSTT+LS EQI EL  GLE+S QKFIWV+R  D+    +     R +            
Sbjct  187   FGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADKKGGDNIENVERGSNSDLPDGFEERI  246

Query  998   rvrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNAT  1177
             + +G G + + WAPQLEIL H S+GGFMSHCGWNSC+ESISMGVP+AAWP+HSDQPRN  
Sbjct  247   KEKGVGFIEKNWAPQLEILAHGSIGGFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTV  306

Query  1178  LITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAV  1357
             LIT+VLK+GI + DW  R E V   +I   V+ L+ SAEGEE+RRR  ELS S+K+ + +
Sbjct  307   LITKVLKIGIIVRDWENRYELVSAAKIKNAVRFLMDSAEGEELRRRVTELSSSVKKSV-M  365

Query  1358  GGGGRNELESFVAHITR  1408
              G  R E++SFVAHITR
Sbjct  366   NGASRKEMDSFVAHITR  382



>ref|XP_008806810.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Phoenix 
dactylifera]
Length=462

 Score =   298 bits (763),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 290/464 (63%), Gaps = 23/464 (5%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             GV VV++P P+QGHLNQ LHLS  +++HG+ VHYA + +HI QA  R+ GW P ++ ++H
Sbjct  14    GVAVVVVPFPSQGHLNQLLHLSLHLSSHGLSVHYATSPSHILQAKSRLQGWHPNSLQSIH  73

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH L +P   +PPP P A +     L     A  +LR P  +L+R+LS    R+VVI DS
Sbjct  74    FHDLPLPPVSTPPPKPGALSSHLQPLREALLA--NLRAPLASLLRSLSAASPRLVVIYDS  131

Query  401   LMGWVVQDVPSLQNAELYRFRCISA-FTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             L+    Q+  +  NAE+Y FR   A F          GKPD           + S EGCF
Sbjct  132   LVSLAAQEAMAFPNAEVYCFRTTPASFLLPFISASSQGKPDA---------ILASFEGCF  182

Query  578   IPEFEEFIKMQRPFWD--ASSGDLLNSCREIEALFIDLIGKE----SKTGFQWAIGPLNP  739
              P   +FI       +  A +G L+N+CR +E  FID + +E     KT F  AIGPLNP
Sbjct  183   PPALVDFIITNHRLRESVAEAGILINTCRPVEGEFIDRLAREPSFQGKTLF--AIGPLNP  240

Query  740   VSLT-DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
               L+ + +   +H  LEWLD+Q   SV++VSFG+ +++ +EQI EL  GL+ S Q+FIWV
Sbjct  241   TILSREDLGRRQHGCLEWLDKQPPASVVYVSFGTLSTVPDEQIEELAVGLQRSRQRFIWV  300

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
              R+ DRG V  + +  R+  +P  YE  V G G+VVR WAPQLEIL HP+ G FMSHCGW
Sbjct  301   CREADRGFVHGESQLQRK--LPAEYERMVEGVGMVVRGWAPQLEILAHPATGAFMSHCGW  358

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NSCMESISMGVPI AWPM SDQP NA L+T+ LK+GI   +WARR E V    I E +KK
Sbjct  359   NSCMESISMGVPILAWPMQSDQPSNAVLVTQHLKVGIMAREWARREEIVSSAGIEESIKK  418

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++    G+E+R+RA  L+++++E +A GG  R EL+SF+A ++R
Sbjct  419   VMVYDGGKELRKRAKALAEAVREAMAKGGSSRAELDSFIARVSR  462



>ref|XP_003580302.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Brachypodium 
distachyon]
Length=471

 Score =   298 bits (763),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 195/479 (41%), Positives = 276/479 (58%), Gaps = 32/479 (7%)
 Frame = +2

Query  29    GADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHG-IPVHYAGAATHIRQATHRVHGWDPLA  205
              A+  V VV +P PAQGHLNQ LHLS  +A+ G + VHYA    H+RQA  RVHGW   A
Sbjct  6     AAESSVAVVAVPFPAQGHLNQLLHLSLQLASRGGLDVHYAAPTPHVRQARARVHGWGEDA  65

Query  206   VPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRV  382
             + ++ FH L +  + SPPP+P A + FP+ LMP+F A T+  R P  A++R LS  ++RV
Sbjct  66    LLSIRFHDLGISSYVSPPPDPTAGSPFPSHLMPLFEAFTADARAPLAAVLRELSASRRRV  125

Query  383   VVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPE--AAGVLNHM  556
             VV+ D +  +  ++   L N E     C +  +         G+ D G        LN+ 
Sbjct  126   VVVHDLMNTFAAEEAAGLPNGEAVGLHCTAVSSI-------VGRIDAGHRLLRDNGLNYH  178

Query  557   PSPEGCFIPEFEEFIKMQRPFWDASS---GDLLNSCREIEALFIDLIGKESKTGFQ--WA  721
             P  + C   E  E+I  +    ++ +   G + N+CR +E  FID   +    G +  +A
Sbjct  179   PF-DACVPGEVMEYIMKRARVAESMASCVGIVCNTCRALEGEFIDAAAESLAAGGKKIFA  237

Query  722   IGPLNPVSLTDSINT----------NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITE  871
             +GPLNP  L D+  T           RH+ L+WLD+Q   SVL+VSFGST+SL  EQ+ E
Sbjct  238   VGPLNP--LLDAHATAGEKQGKEQRQRHECLDWLDKQPAASVLYVSFGSTSSLREEQVAE  295

Query  872   LGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEI  1051
             L A L  S Q+FIWV+RD DRG+++ D    R A++   +  R  G G+V+  WAPQLEI
Sbjct  296   LAAALHGSKQRFIWVLRDADRGNIYTDDRDDRHAKLLSEFTRRTEGTGLVITGWAPQLEI  355

Query  1052  LGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARR  1231
             L H +   FMSHCGWNS MES+S G PI AWPMHSDQP +A L+   LK G+ +  W + 
Sbjct  356   LAHGATAAFMSHCGWNSTMESMSHGKPILAWPMHSDQPWDAELVCGYLKAGLLVRPWEKH  415

Query  1232  NERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             NE +    I E ++ ++ + EG  +R+RA  L ++++     GG  R ELE F+A++TR
Sbjct  416   NEVIPVAAIQEVIETMMVAEEGLAVRQRAKALGEAVRSE---GGSSRKELEDFIAYMTR  471



>ref|XP_010312120.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X4 [Solanum 
lycopersicum]
Length=421

 Score =   296 bits (758),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 239/377 (63%), Gaps = 8/377 (2%)
 Frame = +2

Query  293   QLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCIS  472
             +L   F +   LR P    ++ +S   +R VVI+D+ M WVVQD  S+ N E Y F  IS
Sbjct  48    KLGSFFTSILLLREPIREFLQEVSSTYRRTVVINDTGMSWVVQDAVSIPNTECYCFHTIS  107

Query  473   AFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNS  652
             AFT  SF  E T KP   P  A ++  +P  E  F  E  E+I MQ    D  S  L NS
Sbjct  108   AFTALSFACEATKKPLPSP-VAEIIAELPPKENTFDSETIEYIMMQHESRDFYSVGLHNS  166

Query  653   CREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVS  829
             C+EIE +FI+L+ +E +   QWAIGP+ PV ++   ++   H+   WLD+Q+ +SV++VS
Sbjct  167   CKEIEGVFIELL-EEQRENKQWAIGPVYPVEISKRKSSELTHECFSWLDKQDLNSVIYVS  225

Query  830   FGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpe----gyee  997
             FGSTT+LS EQI EL  GLE+S QKFIWV+R  D+    +     R +            
Sbjct  226   FGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADKKGGDNIENVERGSNSDLPDGFEERI  285

Query  998   rvrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNAT  1177
             + +G G + + WAPQLEIL H S+GGFMSHCGWNSC+ESISMGVP+AAWP+HSDQPRN  
Sbjct  286   KEKGVGFIEKNWAPQLEILAHGSIGGFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTV  345

Query  1178  LITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAV  1357
             LIT+VLK+GI + DW  R E V   +I   V+ L+ SAEGEE+RRR  ELS S+K+ + +
Sbjct  346   LITKVLKIGIIVRDWENRYELVSAAKIKNAVRFLMDSAEGEELRRRVTELSSSVKKSV-M  404

Query  1358  GGGGRNELESFVAHITR  1408
              G  R E++SFVAHITR
Sbjct  405   NGASRKEMDSFVAHITR  421



>ref|XP_006351297.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X4 [Solanum 
tuberosum]
 ref|XP_006351298.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X5 [Solanum 
tuberosum]
 ref|XP_006351299.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X6 [Solanum 
tuberosum]
Length=376

 Score =   294 bits (753),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 182/368 (49%), Positives = 239/368 (65%), Gaps = 12/368 (3%)
 Frame = +2

Query  326   LRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWER  505
             LR P    ++ +S   +R VVI+DS M WVVQD  S+ N E Y F  IS FT  SF  E 
Sbjct  14    LREPIREFLQEVSSTYRRTVVINDSGMSWVVQDAVSIPNTECYCFHTISVFTALSFACET  73

Query  506   TGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL  685
             T K    P  A ++  +P  E  F  E  E+IKMQR   +  S  L NSC+EIE +FIDL
Sbjct  74    TKKLLPSP-VAEIIAELPPRENTFDSETIEYIKMQRESRNFYSVGLHNSCKEIEGVFIDL  132

Query  686   --IGKESKTGFQWAIGPLNPVSLTDSINTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSN  856
               + +E+K   QWAIGPLNPV ++   ++ + H+   WL++Q+ +SV++VSFGSTT+LS 
Sbjct  133   LEVQRENK---QWAIGPLNPVKISKKKSSEQTHECFSWLNKQDLNSVIYVSFGSTTTLSK  189

Query  857   EQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpe----gyeervrgrgvvv  1024
             EQI EL  GLE+S QKFIWV+R  D+    +     R +            R +G G + 
Sbjct  190   EQINELAFGLEQSEQKFIWVLRGADKKGGDNIENVERGSNFDLPEGFEERIRDKGVGFIE  249

Query  1025  reWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMG  1204
             + W+PQLEIL H S+GGFMSHCGWNSC+ESISMGVP+AAWP+HSDQPRN  LIT+VLK+G
Sbjct  250   KNWSPQLEILAHGSIGGFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTVLITKVLKIG  309

Query  1205  ISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELE  1384
             I + DW  R+E V   +I   V+ L+ SAEGEE+RRR  ELS ++K+ + + G  R E++
Sbjct  310   IIVRDWENRDELVSAAKIENVVRNLMGSAEGEELRRRVTELSSAVKKSV-MNGASRKEMD  368

Query  1385  SFVAHITR  1408
             SFVAHITR
Sbjct  369   SFVAHITR  376



>ref|XP_010312119.1| PREDICTED: zeatin O-xylosyltransferase-like isoform X3 [Solanum 
lycopersicum]
Length=434

 Score =   296 bits (758),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 182/377 (48%), Positives = 239/377 (63%), Gaps = 8/377 (2%)
 Frame = +2

Query  293   QLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCIS  472
             +L   F +   LR P    ++ +S   +R VVI+D+ M WVVQD  S+ N E Y F  IS
Sbjct  61    KLGSFFTSILLLREPIREFLQEVSSTYRRTVVINDTGMSWVVQDAVSIPNTECYCFHTIS  120

Query  473   AFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNS  652
             AFT  SF  E T KP   P  A ++  +P  E  F  E  E+I MQ    D  S  L NS
Sbjct  121   AFTALSFACEATKKPLPSP-VAEIIAELPPKENTFDSETIEYIMMQHESRDFYSVGLHNS  179

Query  653   CREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSINTN-RHKSLEWLDRQEKDSVLFVS  829
             C+EIE +FI+L+ +E +   QWAIGP+ PV ++   ++   H+   WLD+Q+ +SV++VS
Sbjct  180   CKEIEGVFIELL-EEQRENKQWAIGPVYPVEISKRKSSELTHECFSWLDKQDLNSVIYVS  238

Query  830   FGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpe----gyee  997
             FGSTT+LS EQI EL  GLE+S QKFIWV+R  D+    +     R +            
Sbjct  239   FGSTTTLSKEQINELAFGLEQSEQKFIWVLRGADKKGGDNIENVERGSNSDLPDGFEERI  298

Query  998   rvrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNAT  1177
             + +G G + + WAPQLEIL H S+GGFMSHCGWNSC+ESISMGVP+AAWP+HSDQPRN  
Sbjct  299   KEKGVGFIEKNWAPQLEILAHGSIGGFMSHCGWNSCIESISMGVPMAAWPIHSDQPRNTV  358

Query  1178  LITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAV  1357
             LIT+VLK+GI + DW  R E V   +I   V+ L+ SAEGEE+RRR  ELS S+K+ + +
Sbjct  359   LITKVLKIGIIVRDWENRYELVSAAKIKNAVRFLMDSAEGEELRRRVTELSSSVKKSV-M  417

Query  1358  GGGGRNELESFVAHITR  1408
              G  R E++SFVAHITR
Sbjct  418   NGASRKEMDSFVAHITR  434



>gb|ACD03254.1| UDP-glycosyltransferase UGT93B9 [Avena strigosa]
Length=465

 Score =   296 bits (758),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 277/472 (59%), Gaps = 16/472 (3%)
 Frame = +2

Query  17    GTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWD  196
             G++  A   V VV +P PAQGHLNQ LHLS  +A+ G  VHYA  A HIRQA  RVHGWD
Sbjct  2     GSEHHAMGSVAVVAVPFPAQGHLNQLLHLSLQLASRGADVHYAAPAPHIRQARARVHGWD  61

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQ  373
               A+ ++ FH L++  + SPPP+P A + FP+ +MP+  A  +  R P  AL+  LS  +
Sbjct  62    QEALRSIQFHDLAISSYDSPPPDPTADSPFPSHIMPLTVAYITGARAPLAALLHELSGSR  121

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH  553
             +RVVV+ D +  +  ++   L N E +   C+ A +    H +     + G    GV  H
Sbjct  122   RRVVVVHDRINAFAHEEAARLPNGEAFGLHCL-AVSLLVGHIDAELLREKGLVYTGVERH  180

Query  554   MPSPEGCFIPEFEEFIKMQRPFWDAS--SGDLLNSCREIEALFIDLI-GKESKTGFQ-WA  721
                       EF E+ +  RP    S  +G L N+CR +E  F+D++ G  +  G + +A
Sbjct  181   A-------TKEFLEWARRARPSRQISPGAGVLANTCRALEGEFVDVVAGHLAPDGKKIFA  233

Query  722   IGPLNPV---SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             IGPLNPV   S ++     RH+ L WLD Q   SVL+VSFG+T+SL +EQI EL A L  
Sbjct  234   IGPLNPVLPASASNQGKQQRHECLGWLDEQPPASVLYVSFGTTSSLRDEQIQELAAALRG  293

Query  893   SGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVG  1072
             S Q+FIWV+RD DRGD+F +   +R  ++   +       G+V+  WAPQLEIL H +  
Sbjct  294   SKQRFIWVLRDADRGDIFAEAGESRHQKLLSEFTNNTEQTGLVITGWAPQLEILAHGATA  353

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
              FMSHCGWNS +ES+S G PI AWPMH DQP +A L+   LK GI +  W + +E +   
Sbjct  354   AFMSHCGWNSTVESLSHGKPILAWPMHCDQPWDAELVCNYLKAGILVRPWEKHSEVIAAH  413

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              I E +++ + S  G  +R+RA  L  ++++ +A GG  R +L+ F+A+ITR
Sbjct  414   AIQEVIEEAMLSDRGIAVRQRAKALGDAVRDSVADGGSSRKDLDDFIAYITR  465



>ref|XP_004976466.1| PREDICTED: putative cis-zeatin O-glucosyltransferase-like [Setaria 
italica]
Length=463

 Score =   295 bits (755),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 203/465 (44%), Positives = 274/465 (59%), Gaps = 17/465 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +AA G+PVHYA  A H+RQA  RVHGW   A+  + F
Sbjct  6     VAVVAVPFPAQGHLNQLLHLSLQLAALGLPVHYAAPAEHVRQARARVHGWGDDALRRVRF  65

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L++  + SP P+P A + FP+ LMP++ A T+    P  AL+R  S   +RVVV+ D 
Sbjct  66    HDLAISGYVSPRPDPAAVSPFPSHLMPLWEAFTASAAAPVAALLREASASHRRVVVLYDP  125

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L G+V ++   L N E Y   C +A ++     E  G   V     G L     P   ++
Sbjct  126   LNGFVAEEAARLPNGEAYALHC-TAVSSIVGRME-DGNALVRERGLGFL-----PLDEYV  178

Query  581   PE--FEEFIKMQRPFWDASS--GDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPV  742
              E   E  IK  R     +S  G L NSCR +E  FID + ++  TG +  +AIGPLNP+
Sbjct  179   TEEFLEYAIKRARAEEGIASPAGLLANSCRALEGEFIDFLAEQMATGGKKLFAIGPLNPL  238

Query  743   ---SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
                S  +  +   H+ L+WLD Q   SVL+VSFGS +SL  EQI EL A L  S Q+FIW
Sbjct  239   LGASAPEHSSKRHHECLDWLDEQPPASVLYVSFGSMSSLPREQIVELAAALRGSHQRFIW  298

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD DRG++F D    + A +   + ++  GRG+VV  WAPQLEIL HP+   FMSHCG
Sbjct  299   VLRDADRGNIFADNGETQHARLLAEFTKQTDGRGLVVTGWAPQLEILAHPATAAFMSHCG  358

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNS MES+S G PI AWPMHSDQP +A L+ E L  G  +    ++ +      I   ++
Sbjct  359   WNSTMESMSYGKPILAWPMHSDQPWDAELVCEYLGAGFLVRPCEKQTKVTPAATIQPVIE  418

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +++ S EG   R+RAAE+ ++++   A GG  R + E F+AHITR
Sbjct  419   RMMVSDEGRAARQRAAEVGEAVRASAAAGGSSRKDFEDFIAHITR  463



>ref|XP_003580303.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Brachypodium 
distachyon]
Length=466

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 193/462 (42%), Positives = 274/462 (59%), Gaps = 14/462 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHG-IPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             V VV +P PAQGHLNQ LHLS L+A+ G + VHYA  A H+RQA  RVHGWD  A+ ++ 
Sbjct  12    VAVVAVPFPAQGHLNQLLHLSLLLASRGGLQVHYAAPAQHVRQARARVHGWDEDALLSIR  71

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISD  397
             FH L +  + SPPPNP A + FP+ LMP+F A T+  R P  AL+  LS   +RVVV+ D
Sbjct  72    FHELGISSYVSPPPNPTADSPFPSHLMPLFEAFTADARGPLAALLGKLSASCRRVVVVHD  131

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSP-EGC  574
              +  +  ++   L N E +   C++  T         GK D             +P E C
Sbjct  132   RINAFAGEEAARLPNGEAFGLHCLAVSTL-------VGKMDADHRLMRENGLTFAPIENC  184

Query  575   FIPEFEEFIKMQRPFWDASSG--DLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPV  742
                EF E+    RP    S G   L N+CR +E  FID++ ++     +  +AIGPLNP+
Sbjct  185   ATKEFVEYANRARPLAQISPGVGILTNTCRALEGDFIDVVAEDLAADGKKVFAIGPLNPL  244

Query  743   SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
                 +     H+ L+WLD+Q   SVL+VSFG+T+SL  EQI EL A L  S Q+FIWV+R
Sbjct  245   LHASASKQRPHECLDWLDKQPPASVLYVSFGTTSSLRAEQIEELAAALRGSKQRFIWVLR  304

Query  923   dgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNS  1102
             D DRGD+F +   +R  ++   + ++ +G G+V+  WAPQLEIL H +   FMSHCGWNS
Sbjct  305   DADRGDIFAEAGESRHEKLLSEFTKQTQGTGLVITGWAPQLEILAHGATAAFMSHCGWNS  364

Query  1103  CMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLI  1282
              MES+S G PI AWPMH DQP +A L+   LK GI +  W + +E +  + I E +++ +
Sbjct  365   TMESLSHGKPILAWPMHCDQPWDAELVCNYLKAGILVRPWEKHSEVITAKAIQEVIEEAM  424

Query  1283  asaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              S +G  +++RA  L  +++  +A GG  R +L+  +A++TR
Sbjct  425   LSDKGMAVQQRARVLGDAVRAAVAPGGSSRKDLDDLIAYMTR  466



>dbj|BAJ94231.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=467

 Score =   294 bits (753),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 187/467 (40%), Positives = 278/467 (60%), Gaps = 20/467 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V  V +P PAQGHLNQ +HLS L A+ G+ VHYA  A H+RQA  R+HGWD  A+ ++ F
Sbjct  9     VAFVAVPFPAQGHLNQLMHLSLLAASRGLSVHYAAPAAHLRQARSRLHGWDAQALGSVQF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  ++SP P+P A   FP  L+ ++   T+  R P  AL+ +LS   +RVVV+ D 
Sbjct  69    HDLGVSAYESPAPDPTAPCPFPNHLLSMWQTFTTAARAPLAALLESLSATHRRVVVVHDR  128

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C++   +Y+  W  T  P +       L  +P  + C  
Sbjct  129   LNSFAAVEAARLSNGESFALQCVA--ISYNIGWLDTEHPLLRDNG---LEFLPI-DACMS  182

Query  581   PEFEEFI-----KMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ----WAIGPL  733
              EF EF+     +MQ      S+G ++N+CR +E  F+D I  E+   F+    +A+GPL
Sbjct  183   KEFLEFVFQTEKEMQEQGGVPSAGMVMNTCRALEGEFMDAI--EAHPVFKDQKLFAVGPL  240

Query  734   NPV--SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKF  907
             NP+  +   +    RH+ ++WLD Q   SVL+VSFG+TTSL  EQI EL A L+ S Q+F
Sbjct  241   NPLLDATARTPAKTRHECMDWLDMQPPASVLYVSFGTTTSLRGEQIAELAAALKGSKQRF  300

Query  908   IWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             IWV+R+ DR D+F +   +R  ++   + +   G G+V+  WAPQLEIL H +   FMSH
Sbjct  301   IWVLREADRADIFTEPGESRHDKLLSEFTKETEGTGLVITGWAPQLEILAHGATAAFMSH  360

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNS MES+S G PI AWPMHSDQP +A L+ + LK+G+ +  W + +E V    I E 
Sbjct  361   CGWNSTMESLSHGKPILAWPMHSDQPWDAELLCKYLKVGLLVRPWEKHSEVVPSEAIQEV  420

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +++ + + +G  +R+RA  L ++++  +A GG     L+ FVA++TR
Sbjct  421   IEEAMLTDKGMAVRQRAKVLGEAVRAAVADGGSSSKGLDDFVAYVTR  467



>ref|XP_006854306.1| hypothetical protein AMTR_s00039p00102080 [Amborella trichopoda]
 gb|ERN15773.1| hypothetical protein AMTR_s00039p00102080 [Amborella trichopoda]
Length=488

 Score =   293 bits (750),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 202/457 (44%), Positives = 278/457 (61%), Gaps = 9/457 (2%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             GVVV+++P PA  HLNQ L+ +R++A HG+PV +A + TH RQ THR  G++  + PNL 
Sbjct  39    GVVVLVVPFPAASHLNQLLNFARVLAEHGLPVVFACSETHARQTTHRSGGFNCASNPNLR  98

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             FH L  P F +  P+P++S KFP  L P+F AT HL  P   L+  L+   +RV VI D+
Sbjct  99    FHILPFPSFPALLPDPESSNKFPGHLQPLFDATEHLLSPLTTLVHELASIHRRVAVIHDA  158

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM           NAE Y + C S   T  F  E  G+ +  P   G+    PS  GC  
Sbjct  159   LMSVAAGAAVECLNAEAYSYNCGSTCATICFQREAEGQQE--PIVPGLPP--PSFRGCVN  214

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSLTDSI  760
               F +F+     F     G   NS   IE  F+  I     +   WAIGP   +      
Sbjct  215   DSFIDFLPRAVKFRHLDRGVFFNSFHAIEGQFLSRIA----SSHVWAIGPTVLLQKKPQE  270

Query  761   NTNR-HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
               ++ H+ ++WLD+Q   SVL+VSFG+  S+S  ++ EL  GLE SGQ F+WV+R  D+G
Sbjct  271   PPHKLHECMQWLDKQAPRSVLYVSFGTVVSMSAAEVRELAQGLEASGQPFLWVLRYADKG  330

Query  938   dvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESI  1117
             D+F   EA     +P+GYEERV+GRG++VR+WAPQLEIL HPS GGF++HCGWNSCMESI
Sbjct  331   DIFAGREADSPRGLPDGYEERVQGRGLIVRDWAPQLEILHHPSTGGFLTHCGWNSCMESI  390

Query  1118  SMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaeg  1297
             +MGVP+ AWPMHSDQP NA L+T VL +G+++ +W  R++ V    +   V+KL+AS EG
Sbjct  391   AMGVPMVAWPMHSDQPVNAQLVTGVLGVGVAVGEWHERDDIVRAESVERAVRKLMASEEG  450

Query  1298  eemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              EM R+AAEL  + ++ +  GG     L++F+A I+R
Sbjct  451   AEMGRKAAELRDAAQQAVGEGGTSGAALDTFLALISR  487



>gb|ADG56506.1| putative cis-zeatin O-glucosyltransferase [Hordeum vulgare subsp. 
vulgare]
Length=467

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 186/467 (40%), Positives = 277/467 (59%), Gaps = 20/467 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V  V +P PAQGHLNQ +HLS L A+ G+ VHYA  A H+RQA  R+HGWD  A+ ++ F
Sbjct  9     VAFVAVPFPAQGHLNQLMHLSLLAASRGLSVHYAAPAAHLRQARSRLHGWDAQALGSVQF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  ++SP P+P A   FP  L+ ++   T+  R P  AL+ +LS   +RVVV+ D 
Sbjct  69    HDLGVSAYESPAPDPTAPCPFPNHLLSMWQIFTTAARAPLAALLESLSATHRRVVVVHDR  128

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C++   +Y+  W     P +       L  +P  + C  
Sbjct  129   LNSFAAVEAARLSNGESFALQCVA--ISYNVGWLDIEHPLLRDNG---LEFLPI-DACMS  182

Query  581   PEFEEFI-----KMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ----WAIGPL  733
              EF EF+     +MQ      S+G ++N+CR +E  F+D I  E+   F+    +A+GPL
Sbjct  183   KEFLEFVFQTEKEMQEQGGVPSAGMVMNTCRALEGEFMDAI--EAHPVFKDQKLFAVGPL  240

Query  734   NPV--SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKF  907
             NP+  +   +    RH+ ++WLD Q   SVL+VSFG+TTSL  EQI EL A L+ S Q+F
Sbjct  241   NPLLDATARTPAKTRHECMDWLDMQPPASVLYVSFGTTTSLRGEQIAELAAALKGSRQRF  300

Query  908   IWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             IWV+R+ DR D+F +   +R  ++   + +   G G+V+  WAPQLEIL H +   FMSH
Sbjct  301   IWVLREADRADIFTEPGESRHDKLLSEFTKETEGTGLVITGWAPQLEILAHGATAAFMSH  360

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGWNS MES+S G PI AWPMHSDQP +A L+ + LK+G+ +  W + +E V    I E 
Sbjct  361   CGWNSTMESLSHGKPILAWPMHSDQPWDAELLCKYLKVGLLVRPWEKHSEVVPSEAIQEV  420

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +++ + + +G  +R+RA  L ++++  +A GG     L+ FVA++TR
Sbjct  421   IEEAMLTDKGMAVRQRAKVLGEAVRAAVADGGSSSKGLDDFVAYVTR  467



>ref|XP_004239467.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=444

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 281/465 (60%), Gaps = 31/465 (7%)
 Frame = +2

Query  29    GADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHY--AGAATH---IRQATHRVHGW  193
              ++  VVV+M+P P  GH    L LS+LI+++ IPVHY   GA  H    RQ     H  
Sbjct  4     NSNSNVVVIMVPFPEYGHQIPLLRLSQLISSYNIPVHYMSVGARNHELKQRQRQQEQH--  61

Query  194   DPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQ  373
                  PN+ FH LS+   ++   N           MP   +   +R P +A+    S + 
Sbjct  62    -----PNIQFHDLSITSKENDEEN----------YMPYLESLLQIREPLSAICH--SNND  104

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH  553
             KRV+VI D++M +VV+ V ++ + ++Y F  +SAFTTYS   +     +       +  +
Sbjct  105   KRVIVIHDAIMQFVVETVYTMSHVKVYFFHAVSAFTTYSMLQQIKENNEDDSLFTSLQGY  164

Query  554   MPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPL  733
             +PS E CF P  EE  KM R       G++LNSCREIE  +ID + K+S T F W +GP 
Sbjct  165   IPSIESCFKPGMEELTKMLRD-CKFKCGEILNSCREIEGRYIDELCKQSATPF-WGLGPF  222

Query  734   NPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             NPV++  + +   H+ ++WLD+Q  +SV+FVSFG+  S S EQI E+  GLE S Q+FIW
Sbjct  223   NPVNIVRN-SDKTHRCIDWLDKQPVNSVIFVSFGTANSFSIEQIHEIAIGLERSEQRFIW  281

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
              V  G        G++  + ++P G+E+RV  RG++ REW PQLEIL H S GG++ H G
Sbjct  282   -VLRGKDKKGEKVGDSIEKMDLPNGFEQRVENRGIIAREWVPQLEILAHRSTGGYLFHSG  340

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNS +ES SMGVP+A WP++SD P N  LIT+VLK+G+ + DW  +NE +    I  GV+
Sbjct  341   WNSFLESASMGVPMATWPLNSDNPYNDVLITKVLKVGLVVRDWVNKNELIKHEIIESGVR  400

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              L+ SAEG+EMR RA ELS+++K+  +VG GG +++++F+AHIT+
Sbjct  401   TLMDSAEGKEMRNRAIELSRAIKK--SVGDGG-SQMDTFIAHITQ  442



>gb|EAY95124.1| hypothetical protein OsI_16941 [Oryza sativa Indica Group]
Length=463

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 275/468 (59%), Gaps = 26/468 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ +HLS L+A+ G+ VHYA    H+RQA  R+HGWDP A+ ++ F
Sbjct  9     VAVVAVPFPAQGHLNQLMHLSLLLASRGLDVHYAAPPAHLRQARLRLHGWDPDALRSIRF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF--FATSHLRRPFNALIRNLSVDQKRVVVISD  397
             H L +P ++SPPP+P A     + LMP+   FA +  R P  AL+  LS   +RVVV+ D
Sbjct  69    HDLDVPAYESPPPDPTAPPFP-SHLMPMLESFAVA-ARVPLAALLERLSASYRRVVVVYD  126

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH---MPSPE  568
              L  +       L N E +  +C++   +Y+  W       + PE   V  H       E
Sbjct  127   RLNSFAAAQAARLPNGEAFGLQCVA--MSYNIGW-------LDPEHRLVREHGLQFHPVE  177

Query  569   GCFIPEFEEFIKM--QRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ----WAIGP  730
              C   EF E I    Q     ASSG L+N+ R +EA FID I    K  F+    +A GP
Sbjct  178   ACMTKEFVELISRAEQDEENAASSGILMNTSRALEAEFIDEIAAHPK--FKELKLFAAGP  235

Query  731   LNPV--SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQK  904
             LNP+  +   +    RH+ ++WLD+Q   SVL+VSFG+T+SL  +Q+ EL A L+ S Q+
Sbjct  236   LNPLLDATARTPGQTRHECMDWLDKQPLASVLYVSFGTTSSLRGDQVAELAAALKGSKQR  295

Query  905   FIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMS  1084
             FIWV+RD DR ++F D   +R AE+   +     G G+V+  WAPQLEIL H +   FMS
Sbjct  296   FIWVLRDADRANIFADSGESRHAELLSRFTAETEGVGLVITGWAPQLEILAHGATAAFMS  355

Query  1085  HCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGE  1264
             HCGWNS MES+S G PI AWPMHSDQP +A L+ + LK G+ +  W + +E V    I E
Sbjct  356   HCGWNSTMESLSYGKPILAWPMHSDQPWDAELVCKYLKAGLLVRPWEKHSEVVPAEAIQE  415

Query  1265  GVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              +++ +   +G  +RRRA EL ++++  +A GG  R  L+ FV +ITR
Sbjct  416   VIEEAMLPEKGMTIRRRAKELGEAVRASVADGGSSRKGLDDFVGYITR  463



>ref|NP_001053526.1| Os04g0556500 [Oryza sativa Japonica Group]
 emb|CAD41646.2| OSJNBb0012E24.11 [Oryza sativa Japonica Group]
 dbj|BAF15440.1| Os04g0556500 [Oryza sativa Japonica Group]
 dbj|BAH00176.1| unnamed protein product [Oryza sativa Japonica Group]
Length=463

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 275/469 (59%), Gaps = 28/469 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ +HLS L+A+ G+ VHYA    H+RQA  R+HGWDP A+ ++ F
Sbjct  9     VAVVAVPFPAQGHLNQLMHLSLLLASRGLDVHYAAPPAHLRQARLRLHGWDPDALRSIRF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF--FATSHLRRPFNALIRNLSVDQKRVVVISD  397
             H L +P ++SPPP+P A     + LMP+   FA +  R P  AL+  LS   +RVVV+ D
Sbjct  69    HDLDVPAYESPPPDPTAPPFP-SHLMPMLESFAVA-ARVPLAALLERLSASYRRVVVVYD  126

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH---MPSPE  568
              L  +       L N E +  +C++   +Y+  W       + PE   V  H       E
Sbjct  127   RLNSFAAAQAARLPNGEAFGLQCVA--MSYNIGW-------LDPEHRLVREHGLQFHPVE  177

Query  569   GCFIPEFEEFIKM--QRPFWDASSGDLLNSCREIEALFIDLIG-----KESKTGFQWAIG  727
              C   EF E I    Q     ASSG L+N+ R +EA FID I      KE K    +A G
Sbjct  178   ACMTKEFVELISRAEQDEENAASSGILMNTSRALEAEFIDEIATHPMFKELKL---FAAG  234

Query  728   PLNPV--SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             PLNP+  +   +    RH+ ++WLD+Q   SVL+VSFG+T+SL  +Q+ EL A L+ S Q
Sbjct  235   PLNPLLDATARTPGQTRHECMDWLDKQPLASVLYVSFGTTSSLRGDQVAELAAALKGSKQ  294

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             +FIWV+RD DR ++F D   +R AE+   +     G G+V+  WAPQLEIL H +   FM
Sbjct  295   RFIWVLRDADRANIFADSGESRHAELLSRFTAETEGVGLVITGWAPQLEILAHGATAAFM  354

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNS MES+S G PI AWPMHSDQP +A L+ + LK G+ +  W + +E V    I 
Sbjct  355   SHCGWNSTMESLSYGKPILAWPMHSDQPWDAELVCKYLKAGLLVRPWEKHSEVVPAEAIQ  414

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             E +++ +   +G  +RRRA EL ++++  +A GG  R  L+ FV +ITR
Sbjct  415   EVIEEAMLPEKGMTIRRRAKELGEAVRASVADGGSSRKGLDDFVGYITR  463



>ref|XP_006350111.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum tuberosum]
Length=460

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 193/459 (42%), Positives = 271/459 (59%), Gaps = 17/459 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V+V ++P P  GHLNQ  H++  I++H IP+H+       +   +RV          +HF
Sbjct  15    VIVAVIPWPEHGHLNQLFHIANFISSHNIPLHFISLTDRNQDLKNRVQN-----TSKIHF  69

Query  224   HHLSMPHF-QSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             + L  P   Q   P  D + +F             L  P   +   +S   K++VV+ DS
Sbjct  70    NDLLAPPLTQMSEPREDFADEFA-----FLEFLDKLGEPICEICVEISKQAKKLVVVFDS  124

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             LM  V++ V ++ N E Y F  ISAF  YS   +  G+ + G  A  V + MP    CF 
Sbjct  125   LMTDVIKGVYAISNVECYSFHAISAFCMYSTFQQVVGEVEDGV-ARQVFDEMPEVGDCFG  183

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPVSL--TD  754
             P+  EF++ +R   + + G+ +NSCRE+E  ++DL+    K    +A+GP + +      
Sbjct  184   PDIFEFVQKERE-CNLNCGEFMNSCRELEGEYLDLLVNVRKKPL-FALGPFHMLQELPES  241

Query  755   SINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdr  934
             S N +RH+ LE+LD Q+ DSV+FVSFG+TT+LS EQ+ EL  GLE S  KFIWV+R+ D+
Sbjct  242   SGNRDRHECLEFLDEQDFDSVMFVSFGTTTTLSREQVNELALGLERSNHKFIWVIREADK  301

Query  935   gdvfddgEAAR-RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
                 +         E+PEG+EER+ GRG+VVR W PQLEILGH S GGF+SHCGWNSCME
Sbjct  302   KMETEKCGGKDWNFELPEGFEERMEGRGMVVRNWVPQLEILGHKSTGGFLSHCGWNSCME  361

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             S+SMGVPIA WP+  DQP NA  +T VLK+GI +  WARR E V    I + V+ L+ + 
Sbjct  362   SVSMGVPIATWPIQVDQPYNAVFVTNVLKIGIPVRSWARREELVTATTIEKAVRTLMGTP  421

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EGEE+R+RA ELS  +K  ++ GG  + E ESF+  IT+
Sbjct  422   EGEEIRQRAIELSNKIKNSVSHGGLAQKERESFITCITK  460



>ref|NP_001136576.1| hypothetical protein [Zea mays]
 gb|ACF82201.1| unknown [Zea mays]
 tpg|DAA38207.1| TPA: hypothetical protein ZEAMMB73_556274 [Zea mays]
Length=468

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 272/472 (58%), Gaps = 26/472 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLN  LHLS  +AA G+PVHYA    H+RQA  RV GW    +  +HF
Sbjct  6     VAVVAVPFPAQGHLNALLHLSLQLAARGVPVHYAAPMEHVRQARSRVQGWGDDTLCRVHF  65

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H LS+  + SPPP+P A + FP+ L+P++ A T+    P  AL+  +S   +R VV+ D 
Sbjct  66    HELSVSAYASPPPDPAAESAFPSHLVPMWEAFTTDAPAPLAALLGGISASCRRFVVLYDI  125

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
               G+  ++   L N E +   C +            G+ D G            P   F+
Sbjct  126   ANGFAAEEAARLPNGEGFGLVCTAVSCI-------VGRTDAGSRLVRERGLDFFPVNSFV  178

Query  581   PEFEEFIKM--QRPFWD----ASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLN  736
                EEF+    +R  W      S G L N+CR +E  FID+  ++     +  + +GPLN
Sbjct  179   T--EEFLATVGKRARWAQSIPCSVGILANTCRALEGEFIDIFAQQLAAAGKNLFVVGPLN  236

Query  737   PVSLTDS------INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             P+ L D+      I+  RH+ L+WLD Q   SV++VS GST+SL +EQ+ EL + L +S 
Sbjct  237   PLLLPDARSPKHGISKERHECLDWLDLQPPASVVYVSLGSTSSLRDEQVEELASALRDSK  296

Query  899   QKFIWvvrdgdrgdv-fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGG  1075
             Q+FIWV+RD DR ++  D GE+ R A+    + E  + RG+V+  WAPQLEIL H +   
Sbjct  297   QRFIWVLRDADRANIFADHGESPRHAKFLPEFAEHTQDRGLVITGWAPQLEILAHGATAA  356

Query  1076  FMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRRE  1255
             F+SHCGWNS MES+  G PI AWPMHSDQP +A L+ +  K GI +    ++ E +    
Sbjct  357   FLSHCGWNSIMESMGHGKPILAWPMHSDQPWDAELVCKHHKAGILIRPMEKQREVISAAA  416

Query  1256  IGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRN-ELESFVAHITR  1408
             I E ++K++ S EG ++++RA  L Q+++   AVGGG  N +L+ F+AHI+R
Sbjct  417   IQEAIEKMMVSDEGYKIQQRAMALGQAIRASAAVGGGSENKDLDKFIAHISR  468



>emb|CAH67400.1| OSIGBa0137D06.1 [Oryza sativa Indica Group]
Length=463

 Score =   290 bits (743),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 199/469 (42%), Positives = 275/469 (59%), Gaps = 28/469 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ +HLS L+A+ G+ VHYA    H+RQA  R+HGWDP A+ ++ F
Sbjct  9     VAVVAVPFPAQGHLNQLMHLSLLLASRGLDVHYAAPPAHLRQARLRLHGWDPDALRSIRF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF--FATSHLRRPFNALIRNLSVDQKRVVVISD  397
             H L +P ++SPPP+P A     + LMP+   FA +  R P  AL+  LS   +RVVV+ D
Sbjct  69    HDLDVPAYESPPPDPTAPPFP-SHLMPMLESFAVA-ARVPLAALLERLSASYRRVVVVYD  126

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH---MPSPE  568
              L  +       L N E +  +C++   +Y+  W       + PE   V  H       E
Sbjct  127   RLNSFAAAQASRLPNGEAFGLQCVA--MSYNIGW-------LDPEHRLVREHGLQFHPVE  177

Query  569   GCFIPEFEEFIKM--QRPFWDASSGDLLNSCREIEALFIDLIG-----KESKTGFQWAIG  727
              C   EF E I    Q     ASSG L+N+ R +EA FID I      KE K    +A G
Sbjct  178   ACMTKEFVELITRAEQDEENAASSGILMNTSRALEAEFIDEIAAHPMFKELKL---FAAG  234

Query  728   PLNPV--SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             PLNP+  +   +    RH+ ++WLD+Q   SVL+VSFG+T+SL  +Q+ EL A L+ S Q
Sbjct  235   PLNPLLDATARTPGQTRHECMDWLDKQPLASVLYVSFGTTSSLRGDQVAELAAALKGSKQ  294

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFM  1081
             +FIWV+RD DR ++F D   +R AE+   +     G G+V+  WAPQLEIL H +   FM
Sbjct  295   RFIWVLRDADRANIFADSGESRHAELLSRFTAETEGVGLVITGWAPQLEILAHGATAAFM  354

Query  1082  SHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIG  1261
             SHCGWNS MES+S G PI AWPMHSDQP +A L+ + LK G+ +  W + +E V    I 
Sbjct  355   SHCGWNSTMESLSYGKPILAWPMHSDQPWDAELVCKYLKAGLLVRPWEKHSEVVPAEAIQ  414

Query  1262  EGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             E +++ +   +G  +RRRA EL ++++  +A GG  R  L+ FV +ITR
Sbjct  415   EVIEEAMLPEKGMTIRRRAKELGEAVRASVADGGSSRKGLDDFVGYITR  463



>ref|XP_008667332.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=472

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 189/472 (40%), Positives = 272/472 (58%), Gaps = 26/472 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLN  LHLS  +AA G+PVHYA    H+RQA  RV GW    +  +HF
Sbjct  6     VAVVAVPFPAQGHLNALLHLSLQLAARGVPVHYAAPMEHVRQARSRVQGWGDDTLCRVHF  65

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H LS+  + SPPP+P A + FP+ L+P++ A T+    P  AL+  +S   +R VV+ D 
Sbjct  66    HELSVSAYASPPPDPAAESAFPSHLVPMWEAFTTDAPAPLAALLGGISASCRRFVVLYDI  125

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
               G+  ++   L N E +   C +            G+ D G            P   F+
Sbjct  126   ANGFAAEEAARLPNGEGFGLVCTAVSCI-------VGRTDAGSRLVRERGLDFFPVNSFV  178

Query  581   PEFEEFIKM--QRPFWD----ASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLN  736
                EEF+    +R  W      S G L N+CR +E  FID+  ++     +  + +GPLN
Sbjct  179   T--EEFLATVGKRARWAQSIPCSVGILANTCRALEGEFIDIFAQQLAAAGKNLFVVGPLN  236

Query  737   PVSLTDS------INTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             P+ L D+      I+  RH+ L+WLD Q   SV++VS GST+SL +EQ+ EL + L +S 
Sbjct  237   PLLLPDARSPKHGISKERHECLDWLDLQPPASVVYVSLGSTSSLRDEQVEELASALRDSK  296

Query  899   QKFIWvvrdgdrgdv-fddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGG  1075
             Q+FIWV+RD DR ++  D GE+ R A+    + E  + RG+V+  WAPQLEIL H +   
Sbjct  297   QRFIWVLRDADRANIFADHGESPRHAKFLPEFAEHTQDRGLVITGWAPQLEILAHGATAA  356

Query  1076  FMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRRE  1255
             F+SHCGWNS MES+  G PI AWPMHSDQP +A L+ +  K GI +    ++ E +    
Sbjct  357   FLSHCGWNSIMESMGHGKPILAWPMHSDQPWDAELVCKHHKAGILIRPMEKQREVISAAA  416

Query  1256  IGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRN-ELESFVAHITR  1408
             I E ++K++ S EG ++++RA  L Q+++   AVGGG  N +L+ F+AHI+R
Sbjct  417   IQEAIEKMMVSDEGYKIQQRAMALGQAIRASAAVGGGSENKDLDKFIAHISR  468



>emb|CDP14135.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   285 bits (728),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 184/339 (54%), Positives = 242/339 (71%), Gaps = 6/339 (2%)
 Frame = +2

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG-PEAAGVLNHMPSPEGCFI  580
             M +V+QDV  + NAE Y F   SAFT YSF  E   KP++  PE    L  +P+ E CF 
Sbjct  1     MPYVIQDVRLIPNAESYCFPSSSAFTIYSFFGEPEWKPELSQPELLEPLEDLPTWESCFP  60

Query  581   PEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL--IGKESKTGFQWAIGPLNPVSLTD  754
              E  +F+K Q  F   SSG L N+CR IE  ++DL    K + +  QWAIGP NPV +  
Sbjct  61    QELTDFVKFQNDFKPISSGYLFNTCRAIEGPYLDLHVKSKITDSDKQWAIGPFNPVEMNG  120

Query  755   SINT-NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
               N+  RH  L WLD+Q  DSV+F+SFGSTTS+S+E+  E+  GL++SGQ FIWV+RD D
Sbjct  121   QKNSEKRHYCLNWLDKQAPDSVIFISFGSTTSVSDEEAKEIATGLDKSGQNFIWVLRDAD  180

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCME  1111
             +GDVF   +  RR ++PEG+EER+ GRG+VVR+WAPQLEILGH S GGFMSHCGWNSC+E
Sbjct  181   KGDVFQGED--RRVQLPEGFEERIEGRGIVVRDWAPQLEILGHSSTGGFMSHCGWNSCIE  238

Query  1112  SISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasa  1291
             SISMGVP+AAWPMHSDQPRNA L+ +VLK+G+ + DW+++NE V    +   V++L+ SA
Sbjct  239   SISMGVPVAAWPMHSDQPRNAILLEKVLKIGLIIRDWSKQNELVTSITVENAVRRLMDSA  298

Query  1292  egeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             EGEEMR+RA ELS+++K  +  GG  R+E++SF++HI R
Sbjct  299   EGEEMRQRARELSKAVKGSVIEGGVSRSEMDSFISHIRR  337



>ref|XP_004975978.1| PREDICTED: putative cis-zeatin O-glucosyltransferase-like [Setaria 
italica]
Length=463

 Score =   288 bits (737),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 201/470 (43%), Positives = 274/470 (58%), Gaps = 26/470 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPL-AVPNLH  220
             + VV +P PAQGHLN  LHLS  +A+ G+PVHYA  A H RQA  RVHGW    A+  + 
Sbjct  5     IAVVAVPFPAQGHLNALLHLSLQLASRGLPVHYAAPAEHARQARARVHGWGADDALRAVR  64

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISD  397
             F+ L +  + SPPP   A   FP+ LMP++ A T+    P  AL+  LS   +RVVV+ D
Sbjct  65    FYDLPIAAYASPPPADAAG--FPSHLMPLWEAFTAGAPAPLEALLGALSASHRRVVVLYD  122

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
                 +  +    L N E +   C S  T         G+ D G            P   +
Sbjct  123   IANAFAAEAAARLPNGEGFGLVCTSLSTLL-------GRTDAGSRLMRERGVDCVPICTY  175

Query  578   IPEFEEFIKMQRP------FWDASSGDLLNSCREIEALFIDLIGKE---SKTGFQ-WAIG  727
             + E  EFI+             +S+G L N+CR +E  FIDL  +E   S  G + + +G
Sbjct  176   MTE--EFIEYASKRARSGQTIPSSAGVLTNTCRALEGEFIDLFAEELAVSAAGKKLFNVG  233

Query  728   PLNPV---SLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESG  898
             PLNPV     +D  +  RH  L+WLD+Q   +VL+VSFGSTTSL  EQ+TEL A L +S 
Sbjct  234   PLNPVLDAGSSDQRSNKRHDCLDWLDKQPPATVLYVSFGSTTSLRGEQVTELAAALLDSK  293

Query  899   QKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGF  1078
             Q+F+WV+RD DRG++F D    R A++   + E+  GRGVV+  WAPQLEIL H +   F
Sbjct  294   QRFVWVLRDADRGNIFTDRGENRHAKLLSEFTEQTGGRGVVITGWAPQLEILAHGATAAF  353

Query  1079  MSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREI  1258
             +SHCGWNS +ES+S G PI AWPMHSDQP NA L+ + LK GI +   A++ E V R  I
Sbjct  354   LSHCGWNSTIESMSHGKPILAWPMHSDQPLNAELVCKHLKAGILVRPMAKQREVVPRATI  413

Query  1259  GEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              E ++K++ S EG ++++RA  L ++++   AVGG  R +LE F+AHITR
Sbjct  414   REVIEKIMVSDEGHQIQQRAMALGEAVRSSAAVGGASRRDLEDFIAHITR  463



>ref|XP_004252081.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=460

 Score =   287 bits (735),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 195/458 (43%), Positives = 273/458 (60%), Gaps = 15/458 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V+V ++P P  GHLNQ  H++  I++H IP+H+       +    RV          +HF
Sbjct  15    VIVAVIPWPEHGHLNQLFHIANFISSHNIPLHFISLTDRNQDLKTRVQN-----TSKIHF  69

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             + L  P      P  +    F  +   + F    L  P   +   +S   K++VV+ DSL
Sbjct  70    NDLLAPPL---IPISEPREDFADEFAFLEF-LDKLGEPICEICVEISKKAKKLVVVFDSL  125

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             M  V+++V S+ N E Y F  ISAF  YS   +   + + G  A  + + MP    CF P
Sbjct  126   MTDVIKEVYSISNVECYSFHAISAFCMYSTFQQVADEVEDGV-ARQLFDEMPEVGDCFGP  184

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQWAIGPLNPV-SLTDSI  760
             +  EF+K +R   + + G+L+NSCRE+E  ++DL+    K    +A+GP + +  L +S+
Sbjct  185   DIFEFVKKERE-CNRNCGELMNSCRELEGEYLDLLVNVRKKPL-FALGPFHLLQELPESM  242

Query  761   -NTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrg  937
              N +RH+ LE+LD Q+ DSV+FVSFG+TT+LS EQ+ EL  GLE S  KFIWV+R+ D+ 
Sbjct  243   SNRDRHECLEFLDEQDFDSVMFVSFGTTTTLSREQVNELALGLERSNHKFIWVIREADKK  302

Query  938   dvfddgEA-ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMES  1114
                +         E+PEG+EERV GRG+VVR W PQLEILGH S GGF+SHCGWNSCMES
Sbjct  303   METEKCGGKGSNFELPEGFEERVGGRGMVVRNWVPQLEILGHKSTGGFLSHCGWNSCMES  362

Query  1115  ISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasae  1294
             +SMGVPIA WP+  DQP NA  +T VLK+GI +  W+RR E V    I + V+ L+ S E
Sbjct  363   VSMGVPIATWPIQVDQPYNAVFVTNVLKIGIPVRSWSRREELVTATTIEKAVRTLMGSPE  422

Query  1295  geemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             GEE+R+RA  LS  +K  I+ GG    E ESF++ IT+
Sbjct  423   GEEIRQRAIGLSNKIKNSISHGGLAHKERESFISCITK  460



>gb|AEV76976.1| cis-zeatin O-glucosyltransferase 1 [Triticum aestivum]
Length=467

 Score =   286 bits (732),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 185/466 (40%), Positives = 273/466 (59%), Gaps = 18/466 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V  V +P PAQGHLNQ +HLS L A+ G+ VHYA  A H+RQA  R+HGWDP A+ +  F
Sbjct  9     VACVAVPFPAQGHLNQLMHLSLLAASRGLSVHYAAPAAHLRQARSRLHGWDPQALGSFQF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  F+SP P+P A   FP  LM ++   T+  R P  AL+ +LS   +RVVV+ D 
Sbjct  69    HDLGVSAFESPAPDPTAPCPFPNHLMSMWQTFTTAARAPLAALLESLSATHRRVVVVHDR  128

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C++   +Y+  W     P +       L   P  + C  
Sbjct  129   LNSFAAVEAARLSNGEAFALQCVA--ISYNIGWLDPAHPLLRD---CDLQFHPI-DACMS  182

Query  581   PEFEEFI-KMQRPFWDA----SSGDLLNSCREIEALFIDLIGKES--KTGFQWAIGPLNP  739
              EF E++ + ++   D     ++G ++N+CR +E  F+D I      K    +A+GPLNP
Sbjct  183   KEFLEYVFQTEKEMEDQGGVPTAGMVMNTCRALEGEFMDAIAAHPVFKDQKLFAVGPLNP  242

Query  740   VSLTDSINT---NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFI  910
             + L  S  T    RH+ +EWLD+Q   SVL+VSFG+T+SL  EQI EL A L+ S Q+FI
Sbjct  243   L-LDASARTPAKTRHECMEWLDKQPPASVLYVSFGTTSSLLAEQIAELAAALKGSRQRFI  301

Query  911   WvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHC  1090
             WV+R+ DR D++ +   +   ++   + E   G G+V+  WAPQLEIL H +   FMSHC
Sbjct  302   WVLREADRADIYKEPGESLHDKLLSEFTEETEGTGLVITGWAPQLEILAHGATAAFMSHC  361

Query  1091  GWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGV  1270
             GWNS MES+S G PI AWPMHSDQP +A L+ + +K G+ +  W + +E V    I E +
Sbjct  362   GWNSTMESLSHGKPILAWPMHSDQPWDAELLCKYVKAGLLVRPWEKHSEVVPAAAIQEVI  421

Query  1271  KKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             ++ + + +G  +R+RA  L ++++  +A GG     L+ FV ++TR
Sbjct  422   EEAMLTDKGMAVRQRAKVLGEAVRAAVADGGSSSKGLDDFVGYVTR  467



>ref|XP_010918553.1| PREDICTED: putative cis-zeatin O-glucosyltransferase [Elaeis 
guineensis]
Length=464

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 210/465 (45%), Positives = 284/465 (61%), Gaps = 23/465 (5%)
 Frame = +2

Query  41    GVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLH  220
             GV V +LP PAQGHLNQ LHLS  +++HG+ VHYA + +HI QA  R+ GW P ++ ++H
Sbjct  14    GVAVGVLPFPAQGHLNQLLHLSLHLSSHGLSVHYATSPSHILQAKSRLQGWHPNSLQSVH  73

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISD  397
             FH L +P   +PPP P A     + L P+  A  S LR P  +L+R+LS   +R+VVI D
Sbjct  74    FHDLPLPPVSTPPPKPGA---LSSHLQPLREALLSSLRPPLASLLRSLSAGSRRLVVIYD  130

Query  398   SLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCF  577
             SL+    Q+  +  NAE+YRF   SA    SF    +    V P    +L    S EGCF
Sbjct  131   SLVSLAAQEAMAFPNAEVYRFGTTSASFLLSFI---SASSQVKPSKDAIL---ASFEGCF  184

Query  578   IPEFEEFIKMQRPFWD--ASSGDLLNSCREIEALFIDLIGKESKTGFQ----WAIGPLNP  739
              P   +F+          A +G L+N+CR +E   ID + ++    FQ    +AIGPLNP
Sbjct  185   TPALVDFVITNHRLRASVAEAGILINTCRPVEGESIDRLARQPS--FQGKSLFAIGPLNP  242

Query  740   VSLT--DSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
               L+  D +    H  LEWLD+Q   SV++VSFG+ +++ +EQI EL   L+ SGQ+FIW
Sbjct  243   TILSRQDILGRRPHDCLEWLDKQPAASVVYVSFGTLSTVPDEQIEELATALQRSGQRFIW  302

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V R+ DRG    + +  +   +P  YE  V G G+VVR WAPQLEIL HP+ G FMSHCG
Sbjct  303   VCREADRGFAHGECQQRK---LPAEYERMVEGVGMVVRGWAPQLEILAHPATGAFMSHCG  359

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSCMESIS+GVPI AWPM SDQP NA L+T  LK+GI + +W RR E V    I E +K
Sbjct  360   WNSCMESISLGVPILAWPMQSDQPSNAVLVTRHLKVGIMVREWDRREEIVSSSGIEESIK  419

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             +++    G+E+R RA  L ++++  +A GG  R EL+S VA I+R
Sbjct  420   RVMVDDGGKEIRTRAKALGEAVRGAMAEGGSSRAELDSLVARISR  464



>ref|XP_004243637.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=456

 Score =   285 bits (729),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 271/467 (58%), Gaps = 29/467 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV+ PL  Q HL Q LH +  I+++G+PV+Y G A   R+A       +P  +  +HF
Sbjct  7     VAVVIAPLHLQSHLRQLLHFACRISSYGLPVYYLGLAASNREARQHSTTLNPCDIEKIHF  66

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             H L +P+   PP  P          M ++ A+   R P  + + ++S   +R+VV+ D L
Sbjct  67    HDLQIPNEDPPPDIP----------MHIWHASMRTREPIASFLGDISSKARRIVVVHDLL  116

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG---PEAAGVLNHMPSPEGC  574
             M + VQD+ S  N E Y F C+  F  Y  H+     P  G   P    +L  +PS +GC
Sbjct  117   MSYNVQDISSYPNGESYVFHCLPIFDMYCSHY----APAAGFPIPLEEALLKRLPSNDGC  172

Query  575   FIPE-FEEFIKMQRPFWDASSGDLLNSCREIEALFI-----DLIGKESKTGFQWAIGPLN  736
             + PE  E   K        ++GD+ N+ + I+   I     +L   ++K    WA+GP+ 
Sbjct  173   YNPEDVEHHAKYLNHCMGKNAGDIFNTSQVIDGTAIVDSMANLATMQNKK--LWALGPIL  230

Query  737   PVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
                  D + T +H  L+WL++Q   SV++VSFG++TS S EQI EL  GLE S QKFIWV
Sbjct  231   LTQDHDKVQT-KHFCLDWLNKQPPKSVIYVSFGTSTSFSAEQIKELAIGLELSKQKFIWV  289

Query  917   vrdgdrgdvfddgEAARRAevpeg---yeervrgrgvvvreWAPQLEILGHPSVGGFMSH  1087
             +R+ D GD  ++     R+   E    +EERV+G G+VVREWAPQ EI  HPS GGFMSH
Sbjct  290   LRNADVGDPVNNKCEENRSGTLELPEGFEERVKGVGLVVREWAPQQEIFAHPSTGGFMSH  349

Query  1088  CGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEG  1267
             CGW SC+ESI  GVPIAAWP+  DQP+NA L+ EVLK+G+ + +W +RNE V    +   
Sbjct  350   CGWTSCLESIIEGVPIAAWPIQFDQPKNAFLVAEVLKIGLHVREWEQRNELVTASTVQNI  409

Query  1268  VKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             V KL+AS EG+ +R+RA EL  ++K     GG  R EL+SF+AHITR
Sbjct  410   VCKLMASEEGDMIRKRAQELRTAVKRSTEEGGVSRMELDSFIAHITR  456



>ref|XP_004978175.1| PREDICTED: uncharacterized protein LOC101764819 [Setaria italica]
Length=1002

 Score =   296 bits (758),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 198/465 (43%), Positives = 276/465 (59%), Gaps = 17/465 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +A  G+PVH+A  A H+RQA  RVHGW   A+  + F
Sbjct  545   VAVVAVPFPAQGHLNQLLHLSLHLATRGLPVHFAAPAEHVRQAKARVHGWGDDALRRVDF  604

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L++  + SPPP+P A + +P+ LMP+  A  +       AL+R +S   +RVVV+ DS
Sbjct  605   HELAISEYASPPPDPAAVSPYPSHLMPLLEAFIADAPAALAALLRGVSASHRRVVVVYDS  664

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPS-PEGCF  577
                +  ++   L N E + F C +A           G+ D G +    ++ +   P   F
Sbjct  665   ANAFAAEEAARLHNGEGFAFHCTAASAF-------VGRMDGGAQLLRDVHGLDDLPVHAF  717

Query  578   IPE-FEEFIKMQRPFWD---ASSGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNP  739
             + E F EFI  +        +S+G L+N+ R +E  FID + +    G +  ++IGPLNP
Sbjct  718   VTEEFLEFIGKRARVAQTIPSSAGILMNTSRALEGEFIDFVAERLTAGGKKVFSIGPLNP  777

Query  740   VSLTDSIN--TNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIW  913
             +    ++   T RH+ L WLDRQ   SVL+VSFGS +SL  EQI EL A L  S Q+FIW
Sbjct  778   MLDASALEQGTARHECLCWLDRQPVASVLYVSFGSMSSLRGEQIEELAAALHGSKQRFIW  837

Query  914   vvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             V+RD DRG++F D    R  +    + + + G G+V+ EWAPQLEIL HPS   FMSHCG
Sbjct  838   VLRDADRGNLFTDSGENRHTKFQTKFTKEIEGTGLVIIEWAPQLEILAHPSTAAFMSHCG  897

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNS MES+S G PI AWPMHSDQP  A L+ + LK G  L    +  E +    I + ++
Sbjct  898   WNSIMESMSHGKPILAWPMHSDQPWVAELVCKYLKAGFLLRPCDKHAEVIPATTIQQVIE  957

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             K++ S EG  MR+RA  L ++++  +AVGG  +N++E F+AHITR
Sbjct  958   KMMVSEEGLAMRQRAMALGEAVRTSVAVGGSSQNDIEDFIAHITR  1002


 Score =   290 bits (741),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 203/477 (43%), Positives = 282/477 (59%), Gaps = 26/477 (5%)
 Frame = +2

Query  20    TKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDP  199
              KG     V VV +P PAQGHLNQ LHLS  +AA G+PVHYA  A   RQA  RVHGWD 
Sbjct  3     AKGSGMESVAVVAVPFPAQGHLNQLLHLSLRLAARGLPVHYAAPAAQARQARARVHGWDE  62

Query  200   LAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQK  376
              A+ ++ FH L +P +   PP+P A + FPT LMP+F A T+  R P  AL+  LS   +
Sbjct  63    AALGSVEFHELGIPEYVCSPPDPTAPSPFPTHLMPLFEAYTAGARAPLAALLARLSASHR  122

Query  377   RVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVG---PEAAGVL  547
             RVVV+ D + G+  ++   L N E +   C++A T         GK + G       G++
Sbjct  123   RVVVVHDRINGYAAEEAARLPNGEAFGLHCLAASTL-------AGKMEAGLPVLRERGLV  175

Query  548   NHMPSPEGCFIPEFEEF-IKMQRPFWDAS--SGDLLNSCREIEALFIDLIGK----ESKT  706
                 + + C   EF E+ +K  RP  + S  +G L+N+CR +E  FID++      + K 
Sbjct  176   --FLATDACASKEFVEYVVKRARPSKEISPGAGILMNTCRALEGEFIDVVADHLAADGKK  233

Query  707   GFQWAIGPLNPVSLTDSINTN--RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGA  880
              F  AIGPLNP+  TD+   +  RH+ L+WL++Q   SVL+VSFG+T++L  EQI EL A
Sbjct  234   CF--AIGPLNPLLHTDAQEQSKPRHEWLDWLNKQPPASVLYVSFGTTSTLRTEQIAELAA  291

Query  881   GLEESGQKFIWvvrdgdrgdvfddgE--AARRAevpegyeervrgrgvvvreWAPQLEIL  1054
              L +S Q+FIWV+RD DRG  F   +   +R AE+   + ++  GRG V+  WAPQLEIL
Sbjct  292   ALRDSNQRFIWVLRDADRGHEFTGHDESQSRHAELLPEFTKQTEGRGRVITGWAPQLEIL  351

Query  1055  GHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRN  1234
              H +   FMSHCGWNS +ES+S G PI AWPMH DQP +A L+ + LK GI +  W +  
Sbjct  352   AHCATAAFMSHCGWNSTVESLSHGKPILAWPMHGDQPWDAELVCKYLKAGILVRPWEKHG  411

Query  1235  ERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
             E +    I E +   + S  G  +++RA  L ++++  +A GG  R +LE F+AHIT
Sbjct  412   EVIPAEAIREVIVTAMVSEGGMAVQQRAKVLGEAVRASLADGGSSRKDLEDFIAHIT  468



>ref|XP_004241956.1| PREDICTED: zeatin O-glucosyltransferase-like [Solanum lycopersicum]
Length=467

 Score =   283 bits (725),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 274/464 (59%), Gaps = 24/464 (5%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLA-VPNLH  220
             V+V M+P P  GHLN    LSR IA+H IPVH+           +R+ G    A   NLH
Sbjct  16    VIVAMVPWPEHGHLNPLFLLSRFIASHNIPVHFLCLTARNHDLKNRLQGVRRNATCENLH  75

Query  221   FHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             F  LS+P                 +L        H+          LS + KR+V++ D 
Sbjct  76    FCDLSVPKSNEAES---DKDLLLKKLGKSICEKCHI----------LSKNTKRLVIVHDC  122

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEA--AGVLNHMPSPEGC  574
             LM   ++D+ S+ N + Y F  IS+F +YS   +     D   +     + +  P+ E  
Sbjct  123   LMITYIKDLDSIPNIKCYSFHSISSFVSYSTLRQVVHIVDEDQDKLIQELGDEFPTVEST  182

Query  575   FIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGF-QWAIGPLNPVSLT  751
             F P  EE+I+ +R  W  +SG ++NS RE E  ++D +   ++     W +GP + +  +
Sbjct  183   FGPHLEEYIQEERE-WKLNSGVVMNSFREFEGKYLDSLAIHAEDNMPVWCLGPFHMLLQS  241

Query  752   DSINTNR---HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvr  922
               ++ NR   H SLE+LD+Q+  SV+FVSFG+TT+LS EQ+ E+  GLE+S  KFIWVVR
Sbjct  242   SVVSCNRSVRHVSLEFLDKQDAISVIFVSFGTTTTLSQEQVNEVALGLEQSNYKFIWVVR  301

Query  923   dgdrgdvfddgEAAR---RAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCG  1093
             D D   +  +  + R   R  +PEG+E+RV GRG+VVR WAPQLEILGH S GGFMSHCG
Sbjct  302   DADDKRLDAENNSERKDGRVVLPEGFEKRVEGRGIVVRNWAPQLEILGHTSTGGFMSHCG  361

Query  1094  WNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVK  1273
             WNSC+ESISMGVPIA+WP+H DQP N   IT VLK+GIS+  W+RR E V    I + VK
Sbjct  362   WNSCLESISMGVPIASWPVHVDQPYNTVFITNVLKIGISVWKWSRREEIVPAAAIEKAVK  421

Query  1274  KLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
              L+++ EGEEMR+RA ELS  +K  ++ GG  R E+ESF+++IT
Sbjct  422   TLMSTPEGEEMRQRAVELSNKIKNSVSHGGLARKEMESFISNIT  465



>ref|XP_002448305.1| hypothetical protein SORBIDRAFT_06g024960 [Sorghum bicolor]
 gb|AAT42161.1| putative cis-zeatin O-glucosyltransferase [Sorghum bicolor]
 gb|EES12633.1| hypothetical protein SORBIDRAFT_06g024960 [Sorghum bicolor]
Length=464

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 280/474 (59%), Gaps = 32/474 (7%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +A+ G+PVHYA  A  +RQA  RVHGWD  A+ ++ F
Sbjct  4     VAVVAVPFPAQGHLNQLLHLSLQLASRGLPVHYAAPAAQVRQARARVHGWDETALRSVEF  63

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +  + SPPP+P A + FPT LMP+F A T+  R P  AL+  LS   +RVVV+ D 
Sbjct  64    HDLGISEYVSPPPDPTAPSPFPTHLMPLFEAYTAGARAPLAALLARLSASHRRVVVVHDR  123

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             +  +  ++   L N E +   C++A T         GK D G      L  +      F+
Sbjct  124   INAYAAEEAARLHNGEAFGLHCLAASTL-------AGKTDAG------LRLLRERGLAFL  170

Query  581   P-------EFEEFI-KMQRPFWDAS--SGDLLNSCREIEALFIDLI-GKESKTGFQW-AI  724
                     EF +++ K   P  D S  +G L+NSCR +E  FID++ G  +  G ++ A+
Sbjct  171   DVAHHASREFADYVAKRAMPTKDISPGAGILVNSCRALEGEFIDVVAGDLAADGKKYFAV  230

Query  725   GPLNPV-SLTDSINTN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             GP NP+  L     T    RH+ L+WLD+Q   SVL+VSFG+T+SL  EQI EL A L +
Sbjct  231   GPFNPLLDLRADAQTQSKPRHECLDWLDKQPPASVLYVSFGTTSSLRTEQIAELAAALRD  290

Query  893   SGQKFIWvvrdgdrgdvfddgEAA--RRAevpegyeervrgrgvvvreWAPQLEILGHPS  1066
             S Q+FIWV+RD DRG+   D   +  R AE+   + ++  GRG V+  WAPQLEIL H +
Sbjct  291   SDQRFIWVLRDADRGNESADDGESQNRHAELLSKFTDQTEGRGRVITGWAPQLEILAHGA  350

Query  1067  VGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVG  1246
                FMSHCGWNS MES+S G PI AWPMHSDQP +A L+ + L  GI +  W +  E + 
Sbjct  351   TAAFMSHCGWNSTMESLSNGKPILAWPMHSDQPWDAELVCKYLNAGILVRPWEKHGEVIP  410

Query  1247  RREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                I + ++  + S +G  +R+RA  L ++++  +A GG  R +L+ F+AHIT+
Sbjct  411   AEVIRQVIEDAMLSDQGVAVRQRAKVLGEAVRACLADGGSSRKDLDDFIAHITK  464



>ref|NP_001053574.1| Os04g0565400 [Oryza sativa Japonica Group]
 emb|CAE03098.2| OSJNBa0017B10.13 [Oryza sativa Japonica Group]
 dbj|BAF15488.1| Os04g0565400 [Oryza sativa Japonica Group]
 emb|CAH66758.1| OSIGBa0158F05.7 [Oryza sativa Indica Group]
 gb|EAY95185.1| hypothetical protein OsI_17003 [Oryza sativa Indica Group]
 gb|EAZ31657.1| hypothetical protein OsJ_15801 [Oryza sativa Japonica Group]
Length=464

 Score =   283 bits (723),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 200/474 (42%), Positives = 278/474 (59%), Gaps = 25/474 (5%)
 Frame = +2

Query  23    KGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAA--HGIPVHYAGAATHIRQATHRVHGWD  196
             KG     V +V +P PAQGHLNQ LHLS  +A+  HG+ VHYA  A  +RQA  RVHGWD
Sbjct  4     KGNPANKVAIVAVPFPAQGHLNQVLHLSLQLASSSHGLAVHYAAPAPQLRQARARVHGWD  63

Query  197   PLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQ  373
               A+ ++ FH L +  + SPPP+P A T FP+ LMP++ A T+  R P +AL+  LS   
Sbjct  64    DKALLSVQFHDLGISTYVSPPPDPTADTPFPSHLMPLWEAYTADARAPLSALLDELSASH  123

Query  374   KRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNH  553
             +RVVV+ D++  + V++   L N E +   C+ A +  + H + TG   +       LNH
Sbjct  124   RRVVVVCDTINSFAVEEAARLPNGEAFPVSCV-AVSALALHID-TGHRLLRENG---LNH  178

Query  554   MPSPEGCFIPEFEEFIKMQRPFWDA---SSGDLLNSCREIEALFIDLIGKESKTGFQ--W  718
              P  E     EF ++   +    ++    +G L N+ R +E  FID + +    G +  +
Sbjct  179   APL-ETYMTQEFLDYASERARASESILSGAGILANASRALEGDFIDDLAETLAAGGKKLF  237

Query  719   AIGPLNPVSLTDSINT--NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEE  892
             AIGPLNP+  T S      RH+ L+WLDRQ  DSVL+VSFG+T SL  EQ+ EL A L  
Sbjct  238   AIGPLNPLLNTGSSEQGRRRHECLDWLDRQPPDSVLYVSFGTTCSLRVEQVAELAATLRG  297

Query  893   SGQKFIWvvrdgdrgd--vfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPS  1066
             S Q+FIWV+RD DRG+          R A++   + ++  G G+V+  WAPQLEIL H +
Sbjct  298   SKQRFIWVMRDADRGNIFTDTGEGETRHAKLLSEFSKQTEGTGMVITGWAPQLEILAHGA  357

Query  1067  VGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVG  1246
                FMSHCGWNS MES+S G PI AWPMHSDQP +A L+ +  K G+ +  W +  E + 
Sbjct  358   TAAFMSHCGWNSTMESMSHGKPILAWPMHSDQPWDAELVCKYFKAGLLVRPWEKHGEVLP  417

Query  1247  RREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
                I E +KK++AS EG  +R+RA  L  +++         RN+LE F+AHITR
Sbjct  418   AATIQEVIKKMMASDEGLAVRQRAKALGDAVR-------SSRNDLEDFIAHITR  464



>ref|XP_003580300.2| PREDICTED: cis-zeatin O-glucosyltransferase 1-like [Brachypodium 
distachyon]
Length=507

 Score =   283 bits (725),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 268/472 (57%), Gaps = 26/472 (6%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS  +A+ G+PVHYA  A H+RQA  RVHGWDP A+ ++HF
Sbjct  45    VAVVAVPFPAQGHLNQLLHLSLHLASRGLPVHYAAPAPHVRQARSRVHGWDPQALASVHF  104

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +P ++ PPP+P   T FP+ LMP+  A  SH   P   L+  LS   +RVVV+ D 
Sbjct  105   HDLDLPAYEQPPPDPTVPTSFPSHLMPMLDAFVSHAGAPLARLLARLSARHRRVVVVYDR  164

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C+S   +Y+  ++      +     G+  H    + C  
Sbjct  165   LSSFAAVEAAGLPNGEAFCVQCVS--VSYNVAFKDAAHRLL--RGHGLEFH--PVDACVS  218

Query  581   PEFEEFIKMQRPFWDASSGD-----LLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNP  739
              EFEE+I      W    G      ++N+CR +E  F        +   Q  +A+GPLNP
Sbjct  219   KEFEEYIAKT---WQDGQGTTVRGLVVNTCRALEGEFHRREAHSPEYAGQRIFAVGPLNP  275

Query  740   VSLTDSINTN------RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQ  901
             + L  +  T       RH+ L+WLDRQ   SVL+VSFG+T+SL  EQ+ E+GA L +S  
Sbjct  276   LLLDATTTTTTTPGLPRHECLDWLDRQPPASVLYVSFGTTSSLLAEQVAEIGAALRDSKH  335

Query  902   KFIWvvrdgdrgdvfddgEAARRAevpegy---eervrgrgvvvreWAPQLEILGHPSVG  1072
             +FIWV+RD DR    ++   +R A           + +G G+V+  WAPQLEIL H S  
Sbjct  336   RFIWVLRDADRASHDEEATESRHARALSSLPGFARQTQGTGLVITGWAPQLEILAHGSTA  395

Query  1073  GFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRR  1252
              FMSHCGWNS +ES+S G PI AWPMHSDQP +A L+ + LK G+ +    +R+  V   
Sbjct  396   AFMSHCGWNSTVESLSHGKPILAWPMHSDQPWDAELLCKYLKAGLLVRPLEKRDTVVPAE  455

Query  1253  EIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              I E ++K + S EG + R RA  L +S++  +A GG    +LE F+ +I R
Sbjct  456   AIREVIEKALVSDEGLQTRERAKALGESIRASVADGGSSHKDLEEFITYIAR  507



>ref|XP_009603042.1| PREDICTED: zeatin O-glucosyltransferase-like [Nicotiana tomentosiformis]
Length=411

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 181/452 (40%), Positives = 245/452 (54%), Gaps = 59/452 (13%)
 Frame = +2

Query  71    AQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHFHHLSMPHFQ  250
             AQGHLNQ L  S LI+++ IP H+ G  THI+QA  R    +   +  + FH L  P F+
Sbjct  13    AQGHLNQLLQFSCLISSYEIPTHFVGFQTHIQQAKSR----NLQDMQKIQFHELPTPDFE  68

Query  251   SPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVP  430
             SPPP  ++++KFPT L P F A+  L  PF+ L+   S   KR+VVI D LM  VVQDV 
Sbjct  69    SPPPVQNSTSKFPTHLQPSFEASKQLHEPFSNLLHEFSNKVKRIVVIHDPLMSSVVQDVS  128

Query  431   SLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQ  610
             S+ NAE Y F CISAFT +   WE  G+P       G+  ++PS EGCF  E   F+  Q
Sbjct  129   SIPNAESYAFNCISAFTQFFSFWEAIGRPF---PVEGMPKNLPSMEGCFSSEIMNFMAYQ  185

Query  611   RPFWDASSGDLLNSCREIEALFIDLIGK--ESKTGFQWAIGPLNP----VSLTDSINTNR  772
               F    SGD+ NSCR IE  ++D++ K   +    QW+IGP+ P    V+  DS   +R
Sbjct  186   YEFMHYRSGDVFNSCRLIEGTYVDMLNKLEMNANKKQWSIGPILPDLTMVAGKDS--RSR  243

Query  773   HKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgdrgdvfdd  952
             HKSLEWLD+Q   SVL++SFGSTT++++EQI EL  GLE S Q F+W        D  + 
Sbjct  244   HKSLEWLDKQAPKSVLYISFGSTTTMTDEQIQELAMGLERSKQMFLW---VLRDADKGNV  300

Query  953   gEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGWNSCMESISMGVP  1132
              +  RR                                        G+   ME I     
Sbjct  301   FDGERRKARLPK----------------------------------GYEERMEGI-----  321

Query  1133  IAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKKLIasaegeemrr  1312
               AWPMHS+QP NATLIT++L++GI + + A + E V    I + V +L+ S E EEMR 
Sbjct  322   --AWPMHSEQPWNATLITDILEVGIQVAEQAHKMELVSSLTIEKVVNRLMVSKEAEEMRS  379

Query  1313  raaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
             RA +L + + +    GG  + EL SF+ +I+R
Sbjct  380   RAEKLGREVWQSRNEGGVSQLELNSFIDYISR  411



>sp|Q6JAH0.1|CZOG_SORBI RecName: Full=Putative cis-zeatin O-glucosyltransferase [Sorghum 
bicolor]
 gb|AAT42160.1| putative cis-zeatin O-glucosyltransferase [Sorghum bicolor]
Length=466

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 279/464 (60%), Gaps = 15/464 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS L+A+ G+ VHYA    H+RQA  RVHGWDP A+ ++ F
Sbjct  9     VAVVAVPFPAQGHLNQLLHLSLLLASRGLSVHYAAPPPHVRQARARVHGWDPKALGSIEF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +P + SPPP+  A + FP  LMP+F    +  R P  AL++ LS   +RV V+ D 
Sbjct  69    HDLDVPAYDSPPPDLAAPSPFPNHLMPMFEAFAAAARAPLAALLQRLSATHRRVAVVFDR  128

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C++   +Y   W   G   +       L    +P+ C  
Sbjct  129   LNPFAATEAARLGNGEAFGLQCVA--ISYDLGWLDPGHRLIRDYGLQFL----APDACMS  182

Query  581   PEFEEFI-KMQRPFWDAS-SGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSL  748
              EF +F+ +M+     A  +G ++N+CR +E  FID++  +     Q  +A+GPLNP+ L
Sbjct  183   KEFVDFVLRMEEAEQGAPVAGLVMNTCRALEGEFIDVVAAQPSFQGQRFFAVGPLNPLLL  242

Query  749   TDSINTN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
                  T    RH++LEWLD+Q   SVL+VSFG+T+ L  EQ+ EL A ++ S Q+FIWV+
Sbjct  243   DADARTTPGRRHQALEWLDKQPPASVLYVSFGTTSCLHAEQVAELAAAIKGSKQRFIWVL  302

Query  920   rdgdrgdvfddgEA-ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
             RD DR D++ D    +R A+    + E  RG G+++  WAPQLEIL H +   FMSHCGW
Sbjct  303   RDADRADIYADASGESRHAKFLSEFTEETRGIGLLITGWAPQLEILAHGATAAFMSHCGW  362

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NS MES+S G P+ AWPMHSDQP ++ L+ + LK G+ +  W +  + +  + I + +++
Sbjct  363   NSTMESLSHGKPVLAWPMHSDQPWDSELLCKYLKAGLLVRPWEKHADIIPAQAIQKVIEE  422

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + S  G  +R+RA EL ++++  +A GG  R +L+ F+ +ITR
Sbjct  423   AMLSDSGMAVRQRAKELGEAVRASVADGGNSRKDLDDFIGYITR  466



>ref|XP_002448306.1| hypothetical protein SORBIDRAFT_06g024970 [Sorghum bicolor]
 gb|EES12634.1| hypothetical protein SORBIDRAFT_06g024970 [Sorghum bicolor]
Length=469

 Score =   280 bits (717),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 279/464 (60%), Gaps = 15/464 (3%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS L+A+ G+ VHYA    H+RQA  RVHGWDP A+ ++ F
Sbjct  12    VAVVAVPFPAQGHLNQLLHLSLLLASRGLSVHYAAPPPHVRQARARVHGWDPKALGSIEF  71

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +P + SPPP+  A + FP  LMP+F    +  R P  AL++ LS   +RV V+ D 
Sbjct  72    HDLDVPAYDSPPPDLAAPSPFPNHLMPMFEAFAAAARAPLAALLQRLSATHRRVAVVFDR  131

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFI  580
             L  +   +   L N E +  +C++   +Y   W   G   +       L    +P+ C  
Sbjct  132   LNPFAATEAARLGNGEAFGLQCVA--ISYDLGWLDPGHRLIRDYGLQFL----APDACMS  185

Query  581   PEFEEFI-KMQRPFWDAS-SGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNPVSL  748
              EF +F+ +M+     A  +G ++N+CR +E  FID++  +     Q  +A+GPLNP+ L
Sbjct  186   KEFVDFVLRMEEAEQGAPVAGLVMNTCRALEGEFIDVVAAQPSFQGQRFFAVGPLNPLLL  245

Query  749   TDSINTN---RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvv  919
                  T    RH++LEWLD+Q   SVL+VSFG+T+ L  EQ+ EL A ++ S Q+FIWV+
Sbjct  246   DADARTTPGRRHQALEWLDKQPPASVLYVSFGTTSCLHAEQVAELAAAIKGSKQRFIWVL  305

Query  920   rdgdrgdvfddgEA-ARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
             RD DR D++ D    +R A+    + E  RG G+++  WAPQLEIL H +   FMSHCGW
Sbjct  306   RDADRADIYADASGESRHAKFLSEFTEETRGIGLLITGWAPQLEILAHGATAAFMSHCGW  365

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NS MES+S G P+ AWPMHSDQP ++ L+ + LK G+ +  W +  + +  + I + +++
Sbjct  366   NSTMESLSHGKPVLAWPMHSDQPWDSELLCKYLKAGLLVRPWEKHADIIPAQAIQKVIEE  425

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + S  G  +R+RA EL ++++  +A GG  R +L+ F+ +ITR
Sbjct  426   AMLSDSGMAVRQRAKELGEAVRASVADGGNSRKDLDDFIGYITR  469



>ref|XP_010319171.1| PREDICTED: zeatin O-xylosyltransferase-like [Solanum lycopersicum]
Length=360

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 244/363 (67%), Gaps = 7/363 (2%)
 Frame = +2

Query  326   LRRPFNALIRNLSVDQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWER  505
             LR    + +R++S   +RVVV+ DSLM + VQDV SL NAE Y F CIS FT Y F    
Sbjct  3     LRESIASFLRDISSKARRVVVVHDSLMSYNVQDVSSLLNAESYVFNCISVFTLYCFLSLP  62

Query  506   TGKPDVGPEAAGVLNHMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDL  685
              G      E  G+L  +PS EG    + +     QRP+ D  SGD+ N+ + I+  F+DL
Sbjct  63    MGMHVQLEE--GLLKKLPSIEGTLTDKIKNLGASQRPYMDIRSGDIHNTSKVIKGEFLDL  120

Query  686   IGKES--KTGFQWAIGPLNPVSLTDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNE  859
             + + +  K   QWAIGP+ P+ L   +N N    LEWL++Q   SVL+ SFG+TTS S+ 
Sbjct  121   LVQVASIKEKKQWAIGPILPMKLDYVLNKN-DICLEWLNKQPPRSVLYASFGTTTSFSDR  179

Query  860   QITELGAGLEESGQKFIWvvrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAP  1039
             +I EL  GLE+S Q+F+WV+RD DRGD+F     ARR E+PEG+EERV+G G+VVREWAP
Sbjct  180   EIKELAMGLEQSKQRFLWVLRDADRGDIFTG--GARRLELPEGFEERVKGVGLVVREWAP  237

Query  1040  QLEILGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVD  1219
             Q EIL H S GGFMSHCGWNSC+ESI+MGVPIAAWPMHSDQP N  L+TE+LK+G+ + +
Sbjct  238   QPEILAHSSTGGFMSHCGWNSCIESITMGVPIAAWPMHSDQPNNGFLVTELLKIGLIVRE  297

Query  1220  WARRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAH  1399
             W +R E V    I   V+KL+AS EG+ +R+RA EL ++++     GG  R EL+SF+A+
Sbjct  298   WEKREELVSASTIENVVRKLMASEEGDAIRKRAEELRETVRRSTEKGGASRMELDSFIAY  357

Query  1400  ITR  1408
             ITR
Sbjct  358   ITR  360



>ref|XP_008657045.1| PREDICTED: cis-zeatin O-glucosyltransferase 2 [Zea mays]
 sp|Q8RXA5.1|CZOG2_MAIZE RecName: Full=Cis-zeatin O-glucosyltransferase 2; Short=cisZOG2 
[Zea mays]
 gb|AAL92460.1| cis-zeatin O-glucosyltransferase 2 [Zea mays]
 gb|AFW84531.1| cis-zeatin O-glucosyltransferase 2 [Zea mays]
Length=463

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 278/464 (60%), Gaps = 18/464 (4%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VV +P PAQGHLNQ LHLS L+A+ G+ VHYA    H+RQA  RVHGWDP A+ ++HF
Sbjct  9     VAVVAVPFPAQGHLNQLLHLSLLLASRGLSVHYAAPPPHVRQARARVHGWDPRALGSIHF  68

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVF-FATSHLRRPFNALIRNLSVDQKRVVVISDS  400
             H L +P + SP P+  A + FP  LMP+F    +  R P  AL++ LS   +RV V+ D 
Sbjct  69    HDLDVPAYDSPAPDLAAPSPFPNHLMPMFEAFAAAARAPLAALLQRLSTSYRRVAVVFDR  128

Query  401   LMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGK---PDVGPEAAGVLNHMPSPEG  571
             L  +   +   L NA+ +  +C++   +Y+  W   G     D G      L  +P P+ 
Sbjct  129   LNPFAATEAARLANADAFGLQCVA--ISYTVGWLDPGHRLLSDYG------LQFLP-PDD  179

Query  572   CFIPEFEEFI-KMQRPFWDAS-SGDLLNSCREIEALFIDLIGKESKTGFQ--WAIGPLNP  739
             C   EF + + +M+     A  +G ++N+CR +E  F+D +  +     Q  +A+GPLNP
Sbjct  180   CMSREFVDLVFRMEEEEQGAPVAGLVMNTCRALEGEFLDAVAAQPPFQGQRFFAVGPLNP  239

Query  740   VSL-TDSINTNRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWv  916
             + L  D+    RH+ LEWLDRQ  +SVL+VSFG+T+ L  +Q+ EL A L+ S Q+F+WV
Sbjct  240   LLLDADARTAPRHECLEWLDRQPPESVLYVSFGTTSCLHADQVAELAAALKGSKQRFVWV  299

Query  917   vrdgdrgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGHPSVGGFMSHCGW  1096
             +RD DR D++ +   +R A+    +     G G+VV  WAPQLEIL H +   FMSHCGW
Sbjct  300   LRDADRADIYAESGDSRHAKFLSEFTRETEGTGLVVTGWAPQLEILAHGATAAFMSHCGW  359

Query  1097  NSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARRNERVGRREIGEGVKK  1276
             NS +ES+S G P+ AWPMHSDQP ++ L+    K G+ +  W +  E +  + I + +++
Sbjct  360   NSIIESLSHGKPVLAWPMHSDQPWDSELLCNYFKAGLLVRPWEKHAEIIPAQAIQKVIEE  419

Query  1277  LIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              + S  G  +R+RA EL ++++  +A GG  R +L+ F+ +ITR
Sbjct  420   AMLSDSGMAVRQRAKELGEAVRASVADGGNSRKDLDDFIGYITR  463



>emb|CBI29809.3| unnamed protein product [Vitis vinifera]
Length=847

 Score =   289 bits (739),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 200/481 (42%), Positives = 271/481 (56%), Gaps = 49/481 (10%)
 Frame = +2

Query  44    VVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHGWDPLAVPNLHF  223
             V VVM+P PAQGHLNQ L LSRLI+++ + VHY G+ TH  QA  RV GWDPL  PN  F
Sbjct  390   VAVVMVPFPAQGHLNQLLQLSRLISSYNVSVHYVGSVTHTHQAKLRVQGWDPLLHPNFQF  449

Query  224   HHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVDQKRVVVISDSL  403
             HH   PHF SPPPNP++S +FP  L   F A+S LR+P  AL+R LS   +R++VI DSL
Sbjct  450   HHFPTPHFHSPPPNPNSSVQFPAHLESSFEASSQLRQPVAALLRELSPRARRIIVIHDSL  509

Query  404   MGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLNHMPSPEGCFIP  583
             MG V+QDV S++NAE           +Y+FH            +A  L  +PS +GCF  
Sbjct  510   MGSVIQDVASIRNAE-----------SYTFH------------SAKFLEDVPSLDGCFPL  546

Query  584   EFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLI-GKESKTGFQ--WAIGPLNPVSLTD  754
             EF  FI  Q  F   +SG++ N+C+ +E  ++DL+ G E   G +  WA+GP NP+++  
Sbjct  547   EFLNFIASQHQFKKLNSGNIYNTCKSMEGCYVDLLDGLEIYGGKKKHWALGPFNPLTICY  606

Query  755   SINTN-RHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELGAGLEESGQKFIWvvrdgd  931
                +N  H+ L WLD+Q   SVL VSFG+TTSL++EQI EL  GLE+S QKFIWV+RD D
Sbjct  607   DKKSNPGHRCLGWLDKQAPKSVLLVSFGTTTSLTDEQIKELAIGLEQSKQKFIWVLRDAD  666

Query  932   rgdvfddgEAARRAevpegyeervrgrgvvvreWAPQLEILGH-----------------  1060
             +GDVF                   RG G+VVR+WAPQLEILGH                 
Sbjct  667   KGDVFSGEVRRAELPEGYEERVGGRGMGLVVRDWAPQLEILGHTQVLKVGLVVRDWAQRE  726

Query  1061  ----PSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLK-MGISLVDWA  1225
                  S GGF +     S + S+   V      +      ++  IT      G+   +W 
Sbjct  727   QLVAASTGGFPARSWILSLLTSLDRLVCPGGLRVCPCIRMSSKFITHSFSFFGLVFREWE  786

Query  1226  RRNERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHIT  1405
              + E V    I + +++L+AS EG ++R+RA EL  ++   +   G    EL+SF+AHI+
Sbjct  787   HQEELVTSSTIEKALRRLMASKEGNDIRKRAVELGGAIWRSMDDRGASCMELDSFIAHIS  846

Query  1406  R  1408
             R
Sbjct  847   R  847


 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 150/235 (64%), Gaps = 4/235 (2%)
 Frame = +2

Query  11   ENGTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAAHGIPVHYAGAATHIRQATHRVHG  190
            ENG K    V VV  M+P PAQGHLNQ L LSR+I+++ IPVHY G+ATHI QA  R+ G
Sbjct  83   ENGVKEAPHVAVV--MVPFPAQGHLNQLLQLSRIISSYNIPVHYVGSATHINQAKLRLQG  140

Query  191  WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFATSHLRRPFNALIRNLSVD  370
            WDPL  PN HFH    PHF SPPP+PDAS +FP  L P F A+S LR P  AL+R LS+ 
Sbjct  141  WDPLLEPNFHFHDFPTPHFHSPPPDPDASVQFPAHLQPCFEASSELREPVAALLRELSLT  200

Query  371  QKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEAAGVLN  550
              R++VI+DSLMG VVQD   + NAE Y F  +S F+ + F WE  G+P +  E   +  
Sbjct  201  VDRLIVINDSLMGSVVQDFVGIGNAESYTFHSVSVFSIFFFFWESLGRPAL--EGVKIPE  258

Query  551  HMPSPEGCFIPEFEEFIKMQRPFWDASSGDLLNSCREIEALFIDLIGKESKTGFQ  715
             +PS +GCF  EF +F+  Q  F   SSG+L  + + IE  ++D++ +E   G Q
Sbjct  259  DVPSLDGCFTLEFFKFLVFQHEFKKLSSGNLYYTSKLIEGPYVDILREEEIDGIQ  313



>emb|CAH66756.1| OSIGBa0158F05.5 [Oryza sativa Indica Group]
 gb|EAY95183.1| hypothetical protein OsI_17001 [Oryza sativa Indica Group]
Length=464

 Score =   279 bits (713),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 198/479 (41%), Positives = 275/479 (57%), Gaps = 31/479 (6%)
 Frame = +2

Query  17    GTKGGADVGVVVVMLPLPAQGHLNQFLHLSRLIAA--HGIPVHYAGAATHIRQATHRVHG  190
               KG     V +V +P PAQGHLNQ LHLS  +A+  HG+ VHYA  A  +RQA  RVHG
Sbjct  2     AAKGNPADAVAIVAVPFPAQGHLNQLLHLSLQLASSSHGLTVHYAAPAPQLRQARARVHG  61

Query  191   WDPLAVPNLHFHHLSMPHFQSPPPNPDASTKFPTQLMPVFFA-TSHLRRPFNALIRNLSV  367
             WD  A+ ++ FH L +  + SPPP+P A   FP+ LMP++ A T+  R P +AL+  LS 
Sbjct  62    WDDKALLSVQFHDLGISTYVSPPPDPTADAPFPSHLMPLWEAYTADARAPLSALLGELSA  121

Query  368   DQKRVVVISDSLMGWVVQDVPSLQNAELYRFRCISAFTTYSFHWERTGKPDVGPEA--AG  541
               +RVVVI D +  + V++   L N E +   C++  +        TG  D G       
Sbjct  122   SYRRVVVICDIMNSFAVKEAARLPNGEAFVCNCVAVSSA-------TGSIDPGHRLLREN  174

Query  542   VLNHMPSPEGCFIPEFEEFIKMQRPFWDAS----SGDLLNSCREIEALFIDLIGK--ESK  703
              L  +P  +     EF ++ + QR     S    +G L N+CR +E  FID+  +  ++ 
Sbjct  175   GLRFIPM-DTYLTKEFMDY-EQQRARAAQSISSCAGILANACRALEGEFIDVFAERLDAS  232

Query  704   TGFQWAIGPLNPVSLTDSINT--NRHKSLEWLDRQEKDSVLFVSFGSTTSLSNEQITELG  877
             +   +AIGPLNP+  T ++     RH+ L+WLDRQ  +SVL+VSFG+T+SL  EQ+ EL 
Sbjct  233   SKKLFAIGPLNPLLDTGALKQGRRRHECLDWLDRQPPESVLYVSFGTTSSLRVEQVAELA  292

Query  878   AGLEESGQKFIWvvrdgdrgd--vfddgEAARRAevpegyeervrgrgvvvreWAPQLEI  1051
             A L  S Q+FIWV+RD DRG+         +R A++   + +   G G+V+  WAPQLEI
Sbjct  293   AALRGSKQRFIWVLRDADRGNIFAGSGESESRYAKLLSEFCKETEGTGLVITGWAPQLEI  352

Query  1052  LGHPSVGGFMSHCGWNSCMESISMGVPIAAWPMHSDQPRNATLITEVLKMGISLVDWARR  1231
             L H +   FMSHCGWNS MES+S G PI AWPMHSDQP +A L+   LK G  +  W + 
Sbjct  353   LAHGATAAFMSHCGWNSTMESLSHGKPILAWPMHSDQPWDAELVCNYLKAGFLVRPWEKH  412

Query  1232  NERVGRREIGEGVKKLIasaegeemrrraaeLSQSLKEPIAVGGGGRNELESFVAHITR  1408
              E V    I   ++K++AS EG  +R+RA  L  +++         RN+LE FV HITR
Sbjct  413   GEVVPATTIQAVIEKMMASEEGLAVRQRAKALGDAVR-------SSRNDLEDFVDHITR  464



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4247309536456