BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25793_g1_i6 len=642 path=[12634:0-222 @8672@!:223-582 7121:583-641]

Length=642
                                                                      Score     E

ref|XP_010315042.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   4e-59   
ref|XP_010320281.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    209   5e-59   
ref|XP_006356822.1|  PREDICTED: G-type lectin S-receptor-like ser...    201   2e-56   
ref|XP_009587205.1|  PREDICTED: G-type lectin S-receptor-like ser...    200   5e-56   
ref|XP_004238059.2|  PREDICTED: G-type lectin S-receptor-like ser...    199   1e-55   
ref|XP_010320274.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   1e-55   
ref|XP_010320279.1|  PREDICTED: G-type lectin S-receptor-like ser...    199   1e-55   
ref|XP_006356818.1|  PREDICTED: G-type lectin S-receptor-like ser...    197   1e-54   
ref|XP_006356821.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-54   
ref|XP_006356820.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-54   
ref|XP_009777837.1|  PREDICTED: G-type lectin S-receptor-like ser...    196   2e-54   
ref|XP_009777836.1|  PREDICTED: G-type lectin S-receptor-like ser...    195   3e-54   
ref|XP_009587208.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   7e-54   
ref|XP_009587207.1|  PREDICTED: G-type lectin S-receptor-like ser...    194   8e-54   
emb|CDP05417.1|  unnamed protein product                                191   4e-53   
ref|XP_006377797.1|  hypothetical protein POPTR_0011s12930g             192   4e-53   
ref|XP_011030934.1|  PREDICTED: G-type lectin S-receptor-like ser...    192   5e-53   
ref|XP_009780423.1|  PREDICTED: G-type lectin S-receptor-like ser...    191   1e-52   
ref|XP_009591204.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-52   
ref|XP_009591202.1|  PREDICTED: G-type lectin S-receptor-like ser...    190   2e-52   
ref|XP_009587211.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   4e-52   
ref|XP_010320278.1|  PREDICTED: G-type lectin S-receptor-like ser...    189   6e-52   
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...    188   1e-51   
ref|XP_009617833.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   3e-51   
ref|XP_009617832.1|  PREDICTED: G-type lectin S-receptor-like ser...    187   3e-51   
ref|XP_009800162.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   4e-51   
ref|XP_009611412.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   5e-51   
ref|XP_009800154.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   5e-51   
ref|XP_011073949.1|  PREDICTED: G-type lectin S-receptor-like ser...    186   9e-51   
ref|XP_011002460.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   1e-50   
ref|XP_006370400.1|  hypothetical protein POPTR_0001s42260g             185   1e-50   
ref|XP_006370399.1|  hypothetical protein POPTR_0001s42260g             185   1e-50   
ref|XP_006356819.1|  PREDICTED: G-type lectin S-receptor-like ser...    185   2e-50   
ref|XP_010042219.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   2e-50   
gb|ABK96679.1|  unknown                                                 183   4e-50   Populus trichocarpa x Populus deltoides
ref|XP_006370396.1|  hypothetical protein POPTR_0001s42220g             183   5e-50   
ref|XP_011097955.1|  PREDICTED: G-type lectin S-receptor-like ser...    184   5e-50   
gb|KDP38978.1|  hypothetical protein JCGZ_00735                         183   5e-50   
gb|KDP38990.1|  hypothetical protein JCGZ_00747                         172   6e-50   
gb|KDP38982.1|  hypothetical protein JCGZ_00739                         183   6e-50   
ref|XP_006356902.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   7e-50   
ref|XP_006356901.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   7e-50   
ref|XP_006370398.1|  hypothetical protein POPTR_0001s42250g             182   7e-50   
ref|XP_011015991.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   8e-50   
ref|XP_011029379.1|  PREDICTED: G-type lectin S-receptor-like ser...    183   9e-50   
emb|CDP05418.1|  unnamed protein product                                185   9e-50   
ref|XP_006377792.1|  hypothetical protein POPTR_0011s12880g             182   1e-49   
ref|XP_009787421.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   2e-49   
emb|CDP05414.1|  unnamed protein product                                183   2e-49   
ref|XP_009607319.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   4e-49   
ref|XP_009605851.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   5e-49   
ref|XP_011002465.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   5e-49   
ref|XP_006362969.1|  PREDICTED: G-type lectin S-receptor-like ser...    181   6e-49   
emb|CBI20433.3|  unnamed protein product                                168   6e-49   
emb|CAN70180.1|  hypothetical protein VITISV_000005                     170   1e-48   Vitis vinifera
ref|XP_011002479.1|  PREDICTED: G-type lectin S-receptor-like ser...    182   1e-48   
ref|XP_002525781.1|  S-locus-specific glycoprotein S13 precursor,...    180   1e-48   Ricinus communis
ref|XP_002317549.1|  hypothetical protein POPTR_0011s13240g             179   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_011030955.1|  PREDICTED: uncharacterized protein LOC105130249    182   2e-48   
ref|XP_011002473.1|  PREDICTED: uncharacterized protein LOC105109448    182   2e-48   
emb|CAN77292.1|  hypothetical protein VITISV_004596                     167   2e-48   Vitis vinifera
ref|XP_007099569.1|  S-locus-specific glycoprotein S6, putative         167   3e-48   
ref|XP_008356167.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   3e-48   
ref|XP_011015604.1|  PREDICTED: G-type lectin S-receptor-like ser...    179   3e-48   
ref|XP_011015606.1|  PREDICTED: G-type lectin S-receptor-like ser...    179   3e-48   
ref|XP_011015605.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   3e-48   
ref|XP_010644282.1|  PREDICTED: G-type lectin S-receptor-like ser...    180   3e-48   
ref|XP_010644302.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   4e-48   
ref|XP_004244166.2|  PREDICTED: uncharacterized protein LOC101262029    181   4e-48   
ref|XP_009769962.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   4e-48   
emb|CDP05413.1|  unnamed protein product                                179   4e-48   
ref|XP_009769963.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   4e-48   
ref|XP_010327263.1|  PREDICTED: uncharacterized protein LOC101244232    181   5e-48   
ref|XP_010644300.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   5e-48   
ref|XP_006370375.1|  hypothetical protein POPTR_0001s42100g             177   5e-48   
ref|XP_010644299.1|  PREDICTED: G-type lectin S-receptor-like ser...    178   5e-48   
gb|KCW69725.1|  hypothetical protein EUGRSUZ_F03110                     166   6e-48   
ref|XP_002317544.2|  hypothetical protein POPTR_0011s13180g             177   6e-48   Populus trichocarpa [western balsam poplar]
gb|EYU33576.1|  hypothetical protein MIMGU_mgv1a003061mg                176   7e-48   
emb|CBI20426.3|  unnamed protein product                                180   8e-48   
ref|XP_007021196.1|  S-locus lectin protein kinase family protein...    179   1e-47   
ref|XP_009787422.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   1e-47   
ref|XP_009361788.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   1e-47   
emb|CBI20456.3|  unnamed protein product                                172   1e-47   
ref|XP_009787420.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   2e-47   
ref|XP_010324340.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   2e-47   
emb|CDP05828.1|  unnamed protein product                                176   2e-47   
ref|XP_011030927.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   2e-47   
ref|XP_011002477.1|  PREDICTED: uncharacterized protein LOC105109453    179   2e-47   
ref|XP_010062920.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   3e-47   
ref|XP_006370372.1|  hypothetical protein POPTR_0001s42070g             176   3e-47   
gb|KDP38980.1|  hypothetical protein JCGZ_00737                         176   3e-47   
ref|XP_010064917.1|  PREDICTED: G-type lectin S-receptor-like ser...    176   3e-47   
ref|XP_002317551.2|  hypothetical protein POPTR_0011s13260g             175   3e-47   Populus trichocarpa [western balsam poplar]
gb|KCW70067.1|  hypothetical protein EUGRSUZ_F03370                     176   4e-47   
ref|XP_009607317.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   4e-47   
gb|EYU33571.1|  hypothetical protein MIMGU_mgv1a020014mg                175   4e-47   
emb|CBI20441.3|  unnamed protein product                                166   4e-47   
ref|XP_006370380.1|  hypothetical protein POPTR_0001s42140g             175   4e-47   
gb|KCW44740.1|  hypothetical protein EUGRSUZ_L01708                     174   4e-47   
ref|XP_009355541.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   4e-47   
ref|XP_009355538.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   5e-47   
ref|XP_011002478.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   5e-47   
ref|XP_009355540.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   5e-47   
ref|XP_002317548.1|  hypothetical protein POPTR_0011s13230g             175   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002317538.2|  hypothetical protein POPTR_0011s13000g             174   5e-47   Populus trichocarpa [western balsam poplar]
gb|KDP38981.1|  hypothetical protein JCGZ_00738                         174   6e-47   
ref|XP_008363600.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   7e-47   
ref|XP_010040971.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   7e-47   
ref|XP_011030922.1|  PREDICTED: G-type lectin S-receptor-like ser...    175   8e-47   
ref|XP_002317541.2|  hypothetical protein POPTR_0011s13150g             173   9e-47   Populus trichocarpa [western balsam poplar]
ref|XP_006377813.1|  hypothetical protein POPTR_0011s13170g             174   9e-47   
ref|XP_007021210.1|  S-locus lectin protein kinase family protein...    174   9e-47   
emb|CDP05835.1|  unnamed protein product                                174   1e-46   
ref|XP_006356899.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-46   
ref|XP_004238057.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-46   
ref|XP_006356900.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   1e-46   
ref|XP_002316947.1|  hypothetical protein POPTR_0011s12950g             174   1e-46   Populus trichocarpa [western balsam poplar]
gb|EYU33573.1|  hypothetical protein MIMGU_mgv1a024422mg                173   1e-46   
ref|XP_006370376.1|  hypothetical protein POPTR_0001s42110g             174   1e-46   
emb|CBI14789.3|  unnamed protein product                                164   2e-46   
ref|XP_006356864.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   2e-46   
gb|KCW58378.1|  hypothetical protein EUGRSUZ_H01063                     173   2e-46   
emb|CBI20448.3|  unnamed protein product                                167   2e-46   
ref|XP_010064920.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   2e-46   
ref|XP_010064872.1|  PREDICTED: G-type lectin S-receptor-like ser...    174   2e-46   
ref|XP_006360148.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   2e-46   
ref|XP_006377798.1|  hypothetical protein POPTR_0011s12970g             173   2e-46   
ref|XP_006388693.1|  hypothetical protein POPTR_0118s002202g            164   2e-46   
gb|KCW69735.1|  hypothetical protein EUGRSUZ_F03116                     174   3e-46   
ref|XP_008226742.1|  PREDICTED: G-type lectin S-receptor-like ser...    173   3e-46   
ref|XP_002317537.2|  hypothetical protein POPTR_0011s12970g             173   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010644281.1|  PREDICTED: uncharacterized protein LOC100246941    176   3e-46   
emb|CBI20439.3|  unnamed protein product                                164   3e-46   
ref|XP_002317540.2|  hypothetical protein POPTR_0011s13130g             172   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_006360151.1|  PREDICTED: uncharacterized protein LOC102593298    175   4e-46   
ref|XP_007021200.1|  S-locus lectin protein kinase family protein       175   4e-46   
gb|EYU33574.1|  hypothetical protein MIMGU_mgv1a0256212mg               171   4e-46   
ref|XP_006389125.1|  hypothetical protein POPTR_0044s002002g            161   5e-46   
ref|XP_006377795.1|  hypothetical protein POPTR_0011s12910g             172   5e-46   
ref|XP_006370371.1|  S-locus protein kinase                             172   5e-46   
gb|KCW70068.1|  hypothetical protein EUGRSUZ_F03371                     172   6e-46   
ref|XP_006377805.1|  hypothetical protein POPTR_0011s130601g            163   6e-46   
ref|XP_011007884.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   6e-46   
emb|CBI20427.3|  unnamed protein product                                175   6e-46   
ref|XP_009377300.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   7e-46   
ref|XP_009377299.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   7e-46   
ref|XP_007021192.1|  Serine/threonine kinases,protein kinases,ATP...    172   7e-46   
ref|XP_010320277.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   7e-46   
ref|XP_008363599.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   9e-46   
ref|XP_009778629.1|  PREDICTED: uncharacterized protein LOC104227947    174   1e-45   
ref|XP_002315550.1|  hypothetical protein POPTR_0010s02670g             171   1e-45   Populus trichocarpa [western balsam poplar]
gb|KCW70069.1|  hypothetical protein EUGRSUZ_F03372                     171   1e-45   
ref|XP_011030933.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-45   
emb|CBI20454.3|  unnamed protein product                                162   1e-45   
ref|XP_006356865.1|  PREDICTED: uncharacterized protein LOC102592491    174   1e-45   
ref|XP_002315551.2|  hypothetical protein POPTR_0010s02660g             171   1e-45   Populus trichocarpa [western balsam poplar]
gb|KCW69728.1|  hypothetical protein EUGRSUZ_F03112                     171   1e-45   
ref|XP_010320275.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-45   
ref|XP_011030956.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-45   
ref|XP_010064867.1|  PREDICTED: G-type lectin S-receptor-like ser...    172   1e-45   
emb|CAN70179.1|  hypothetical protein VITISV_000004                     171   1e-45   Vitis vinifera
ref|XP_002315552.2|  hypothetical protein POPTR_0010s02630g             171   1e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011030932.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-45   
ref|XP_011030930.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   1e-45   
gb|EYU19178.1|  hypothetical protein MIMGU_mgv1a020642mg                171   1e-45   
ref|XP_006378116.1|  hypothetical protein POPTR_0010s02670g             171   1e-45   
ref|XP_006377796.1|  hypothetical protein POPTR_0011s12920g             171   1e-45   
ref|XP_010688827.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    171   2e-45   
ref|XP_011030931.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-45   
ref|XP_008355368.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   2e-45   
ref|XP_010064868.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-45   
ref|XP_011013157.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-45   
ref|XP_010313654.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-45   
ref|XP_004251482.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   2e-45   
ref|XP_007021195.1|  S-locus lectin protein kinase family protein...    172   3e-45   
ref|XP_007021188.1|  Serine/threonine kinases,protein kinases,ATP...    171   3e-45   
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg             171   3e-45   
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                   171   3e-45   
ref|XP_006350372.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   3e-45   
ref|XP_006475244.1|  PREDICTED: G-type lectin S-receptor-like ser...    171   3e-45   
gb|KCW61036.1|  hypothetical protein EUGRSUZ_H03801                     159   3e-45   
gb|KDP34760.1|  hypothetical protein JCGZ_10540                         169   4e-45   
gb|KCW58376.1|  hypothetical protein EUGRSUZ_H01060                     170   4e-45   
ref|XP_011000517.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   4e-45   
emb|CBI20443.3|  unnamed protein product                                159   4e-45   
ref|XP_006377802.1|  hypothetical protein POPTR_0011s13020g             160   4e-45   
ref|XP_006452080.1|  hypothetical protein CICLE_v10007464mg             170   5e-45   
ref|XP_008359301.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-45   
ref|XP_011030936.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-45   
ref|XP_008359300.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-45   
ref|XP_004231576.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   5e-45   
ref|XP_010064869.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-45   
ref|XP_011030935.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   5e-45   
ref|XP_011030919.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   5e-45   
ref|XP_008366279.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   5e-45   
emb|CBI20432.3|  unnamed protein product                                159   5e-45   
gb|ADG96406.1|  S-locus receptor kinase-like protein                    160   5e-45   
ref|XP_008355367.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   5e-45   
ref|XP_010064916.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    172   5e-45   
ref|XP_004487639.1|  PREDICTED: G-type lectin S-receptor-like ser...    170   6e-45   
gb|KDO74353.1|  hypothetical protein CISIN_1g003272mg                   169   7e-45   
ref|XP_007213634.1|  hypothetical protein PRUPE_ppa001824mg             169   7e-45   
ref|XP_006594797.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   7e-45   
ref|XP_002317547.2|  hypothetical protein POPTR_0011s13190g             169   8e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011015603.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   8e-45   
ref|XP_006594796.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   9e-45   
emb|CDP05837.1|  unnamed protein product                                169   9e-45   
gb|KHN36756.1|  G-type lectin S-receptor-like serine/threonine-pr...    169   9e-45   
ref|XP_010320284.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   9e-45   
ref|XP_008372832.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   9e-45   
ref|XP_002317545.2|  hypothetical protein POPTR_0011s13190g             169   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010647533.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   1e-44   
ref|XP_006370397.1|  hypothetical protein POPTR_0001s42230g             168   1e-44   
ref|XP_011030923.1|  PREDICTED: G-type lectin S-receptor-like ser...    169   1e-44   
ref|XP_002522177.1|  S-locus-specific glycoprotein S6 precursor, ...    169   1e-44   Ricinus communis
ref|XP_007133304.1|  hypothetical protein PHAVU_011G1684001g            163   1e-44   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                   167   1e-44   
ref|XP_011095777.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   1e-44   
ref|XP_010320283.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   1e-44   
ref|XP_007021201.1|  S-locus lectin protein kinase family protein...    168   1e-44   
ref|XP_006370367.1|  hypothetical protein POPTR_0001s42020g             168   2e-44   
gb|KDP38989.1|  hypothetical protein JCGZ_00746                         157   2e-44   
emb|CBI20460.3|  unnamed protein product                                167   2e-44   
gb|ADG96405.1|  S-locus receptor kinase                                 167   2e-44   
ref|XP_002317550.1|  hypothetical protein POPTR_0011s13250g             167   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011013015.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   2e-44   
gb|KDP30509.1|  hypothetical protein JCGZ_16689                         167   2e-44   
gb|EYU36706.1|  hypothetical protein MIMGU_mgv1a001937mg                167   2e-44   
ref|XP_010271902.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-44   
gb|KDP38979.1|  hypothetical protein JCGZ_00736                         168   2e-44   
ref|XP_011095279.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-44   
ref|XP_011016742.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-44   
ref|XP_006370573.1|  hypothetical protein POPTR_0001s43900g             165   2e-44   
ref|XP_011095278.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   3e-44   
ref|XP_007021189.1|  Serine/threonine kinases,protein kinases,ATP...    168   3e-44   
ref|XP_011002475.1|  PREDICTED: G-type lectin S-receptor-like ser...    168   3e-44   
ref|XP_011007878.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   3e-44   
gb|KDP34761.1|  hypothetical protein JCGZ_10541                         167   3e-44   
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881    169   3e-44   
ref|XP_010106348.1|  G-type lectin S-receptor-like serine/threoni...    167   3e-44   
emb|CBI20445.3|  unnamed protein product                                162   3e-44   
ref|XP_006388696.1|  hypothetical protein POPTR_0118s00250g             161   3e-44   
ref|XP_009361795.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   4e-44   
ref|XP_008366485.1|  PREDICTED: receptor-like serine/threonine-pr...    169   4e-44   
gb|EYU36707.1|  hypothetical protein MIMGU_mgv1a001407mg                167   4e-44   
ref|XP_009361859.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   4e-44   
ref|XP_006370395.1|  hypothetical protein POPTR_0001s42210g             167   5e-44   
emb|CBI25711.3|  unnamed protein product                                166   5e-44   
gb|KCW75379.1|  hypothetical protein EUGRSUZ_E041261                    155   6e-44   
ref|XP_007133116.1|  hypothetical protein PHAVU_011G152700g             166   6e-44   
ref|XP_008226747.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   6e-44   
ref|XP_004294087.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   6e-44   
ref|XP_006389128.1|  hypothetical protein POPTR_0044s00230g             161   6e-44   
ref|XP_008363596.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   7e-44   
gb|KCW67248.1|  hypothetical protein EUGRSUZ_F01042                     162   7e-44   
ref|XP_008367250.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   7e-44   
ref|XP_006360117.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   7e-44   
ref|XP_006370369.1|  hypothetical protein POPTR_0001s42040g             166   7e-44   
ref|XP_006452071.1|  hypothetical protein CICLE_v10007645mg             165   8e-44   
gb|KCW63316.1|  hypothetical protein EUGRSUZ_G00944                     160   9e-44   
ref|XP_002528887.1|  S-locus-specific glycoprotein S6 precursor, ...    166   9e-44   Ricinus communis
ref|XP_008226752.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   1e-43   
ref|XP_008226748.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   1e-43   
ref|XP_008386061.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   1e-43   
emb|CDX89260.1|  BnaA01g16330D                                          163   1e-43   
ref|XP_008226745.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   1e-43   
ref|XP_008226744.1|  PREDICTED: G-type lectin S-receptor-like ser...    166   1e-43   
ref|XP_007214643.1|  hypothetical protein PRUPE_ppa001761mg             166   1e-43   
emb|CBI20437.3|  unnamed protein product                                157   1e-43   
gb|KDO74381.1|  hypothetical protein CISIN_1g0393181mg                  158   1e-43   
ref|XP_007213637.1|  hypothetical protein PRUPE_ppa001795mg             165   1e-43   
ref|XP_007214693.1|  hypothetical protein PRUPE_ppa024127mg             164   1e-43   
ref|XP_008355366.1|  PREDICTED: G-type lectin S-receptor-like ser...    164   1e-43   
ref|XP_006370410.1|  hypothetical protein POPTR_0001s42330g             165   1e-43   
ref|XP_007025965.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...    157   1e-43   
ref|XP_006370409.1|  hypothetical protein POPTR_0001s42330g             165   1e-43   
gb|KDO74333.1|  hypothetical protein CISIN_1g003832mg                   165   1e-43   
ref|XP_011007883.1|  PREDICTED: cysteine-rich receptor-like prote...    157   2e-43   
ref|XP_006588108.1|  PREDICTED: uncharacterized protein LOC100776310    167   2e-43   
ref|XP_006388695.1|  hypothetical protein POPTR_0118s00240g             159   2e-43   
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595    167   2e-43   
ref|XP_006475243.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   2e-43   
ref|XP_006452099.1|  hypothetical protein CICLE_v10009316mg             157   2e-43   
ref|XP_011007882.1|  PREDICTED: cysteine-rich receptor-like prote...    157   2e-43   
gb|KHN35584.1|  G-type lectin S-receptor-like serine/threonine-pr...    165   2e-43   
gb|KDO74347.1|  hypothetical protein CISIN_1g003391mg                   164   2e-43   
ref|XP_004295782.1|  PREDICTED: G-type lectin S-receptor-like ser...    167   2e-43   
ref|XP_006370368.1|  hypothetical protein POPTR_0001s42030g             165   2e-43   
ref|XP_007214794.1|  hypothetical protein PRUPE_ppa014934mg             165   2e-43   
gb|KDO74352.1|  hypothetical protein CISIN_1g038934mg                   164   2e-43   
ref|XP_007021199.1|  S-locus lectin protein kinase family protein...    167   2e-43   
gb|KHG07104.1|  G-type lectin S-receptor-like serine/threonine-pr...    165   3e-43   
ref|XP_009361856.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   3e-43   
gb|KFK29236.1|  hypothetical protein AALP_AA7G107100                    165   3e-43   
ref|XP_006593151.1|  PREDICTED: G-type lectin S-receptor-like ser...    165   3e-43   
gb|EYU32317.1|  hypothetical protein MIMGU_mgv1a006448mg                161   3e-43   
ref|XP_006377815.1|  hypothetical protein POPTR_0011s13220g             165   3e-43   
ref|XP_006370370.1|  hypothetical protein POPTR_0001s42050g             165   3e-43   
emb|CAN73738.1|  hypothetical protein VITISV_036172                     163   3e-43   
ref|XP_006452078.1|  hypothetical protein CICLE_v10010587mg             164   3e-43   
ref|XP_010105620.1|  G-type lectin S-receptor-like serine/threoni...    164   3e-43   
ref|XP_010646880.1|  PREDICTED: receptor-like serine/threonine-pr...    165   3e-43   
ref|XP_011014044.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   4e-43   
gb|KDP38983.1|  hypothetical protein JCGZ_00740                         164   4e-43   
gb|KDP38984.1|  hypothetical protein JCGZ_00741                         164   4e-43   
ref|XP_010644297.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   4e-43   
emb|CDY29295.1|  BnaC01g19470D                                          161   4e-43   
gb|KCW70065.1|  hypothetical protein EUGRSUZ_F03369                     163   4e-43   
ref|XP_006377794.1|  hypothetical protein POPTR_0011s12900g             161   4e-43   
ref|XP_010644397.1|  PREDICTED: uncharacterized protein LOC100262430    166   4e-43   
gb|KFK29235.1|  hypothetical protein AALP_AA7G107100                    164   4e-43   
emb|CBI20459.3|  unnamed protein product                                162   4e-43   
ref|XP_007213580.1|  hypothetical protein PRUPE_ppa014995mg             162   4e-43   
gb|KEH33463.1|  receptor-like kinase                                    156   6e-43   
ref|XP_006370392.1|  hypothetical protein POPTR_0001s42180g             163   6e-43   
ref|XP_010644295.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   7e-43   
ref|XP_010644394.1|  PREDICTED: uncharacterized protein LOC100262308    166   7e-43   
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg             164   8e-43   
gb|KDP38994.1|  hypothetical protein JCGZ_00751                         163   8e-43   
emb|CBI20457.3|  unnamed protein product                                163   8e-43   
ref|XP_008386045.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   8e-43   
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                   164   8e-43   
ref|XP_010644396.1|  PREDICTED: uncharacterized protein LOC100260657    166   8e-43   
emb|CAN63413.1|  hypothetical protein VITISV_003688                     163   8e-43   
ref|XP_002534316.1|  S-locus-specific glycoprotein S6 precursor, ...    164   9e-43   
ref|XP_011029380.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   9e-43   
gb|KDO74363.1|  hypothetical protein CISIN_1g0467031mg                  155   1e-42   
ref|XP_007021194.1|  S-locus lectin protein kinase family protein...    162   1e-42   
gb|KDP38993.1|  hypothetical protein JCGZ_00750                         161   1e-42   
ref|XP_006582722.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-42   
ref|XP_008346088.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   1e-42   
ref|XP_011013016.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_008346134.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
gb|KDP38975.1|  hypothetical protein JCGZ_00732                         163   1e-42   
ref|XP_002528881.1|  conserved hypothetical protein                     165   1e-42   
ref|XP_011030939.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   1e-42   
ref|XP_010644290.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_009775183.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_009361851.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_010062923.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_010644294.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   1e-42   
ref|XP_011010160.1|  PREDICTED: cysteine-rich receptor-like prote...    162   1e-42   
ref|XP_009608601.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
ref|XP_010644298.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   1e-42   
emb|CBI20430.3|  unnamed protein product                                163   1e-42   
ref|XP_011007881.1|  PREDICTED: cysteine-rich receptor-like prote...    156   1e-42   
ref|XP_006452089.1|  hypothetical protein CICLE_v10008568mg             158   1e-42   
gb|KCW74979.1|  hypothetical protein EUGRSUZ_E03726                     154   2e-42   
ref|XP_008386049.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_009355543.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_006378085.1|  hypothetical protein POPTR_0010s01930g             162   2e-42   
ref|XP_009143278.1|  PREDICTED: G-type lectin S-receptor-like ser...    163   2e-42   
ref|XP_011013014.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_007148753.1|  hypothetical protein PHAVU_005G011200g             162   2e-42   
ref|XP_002283476.3|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_009355544.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
emb|CBI20422.3|  unnamed protein product                                151   2e-42   
ref|XP_006582220.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_010644293.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_007025963.1|  Cysteine-rich RLK 10, putative                     161   2e-42   
ref|XP_011030920.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_010644291.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   2e-42   
ref|XP_006413092.1|  hypothetical protein EUTSA_v10024431mg             162   2e-42   
ref|XP_006413093.1|  hypothetical protein EUTSA_v10024431mg             162   2e-42   
emb|CAN61538.1|  hypothetical protein VITISV_030742                     162   3e-42   
ref|XP_007021377.1|  S-locus lectin protein kinase family protein...    162   3e-42   
ref|XP_010644304.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   3e-42   
ref|XP_009611415.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   3e-42   
ref|XP_010644305.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   3e-42   
ref|XP_010058588.1|  PREDICTED: cysteine-rich receptor-like prote...    156   3e-42   
ref|XP_009361801.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   3e-42   
ref|XP_009611414.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   3e-42   
ref|XP_006360150.1|  PREDICTED: uncharacterized protein LOC102592629    164   3e-42   
emb|CBI20421.3|  unnamed protein product                                157   3e-42   
ref|XP_009377332.1|  PREDICTED: uncharacterized protein LOC103965953    163   3e-42   
ref|XP_006373139.1|  hypothetical protein POPTR_0017s090701g            157   3e-42   
ref|XP_007213399.1|  hypothetical protein PRUPE_ppa026218mg             162   4e-42   
ref|XP_007021380.1|  S-locus lectin protein kinase family protein       162   4e-42   
ref|XP_007213646.1|  hypothetical protein PRUPE_ppa001663mg             161   4e-42   
ref|XP_009361793.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   4e-42   
ref|XP_009361792.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   4e-42   
gb|KCW73356.1|  hypothetical protein EUGRSUZ_E01827                     150   4e-42   
ref|XP_006370627.1|  hypothetical protein POPTR_0001s44380g             161   4e-42   
ref|XP_008372181.1|  PREDICTED: G-type lectin S-receptor-like ser...    162   5e-42   
ref|XP_008441839.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   5e-42   
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   5e-42   
ref|XP_002528889.1|  ATP binding protein, putative                      163   5e-42   
emb|CDO99671.1|  unnamed protein product                                159   5e-42   
ref|XP_002316941.2|  hypothetical protein POPTR_0011s12870g             161   5e-42   
ref|XP_006388050.1|  hypothetical protein POPTR_0379s00200g             159   5e-42   
ref|XP_003607713.1|  Receptor protein kinase                            160   5e-42   
ref|XP_007214384.1|  hypothetical protein PRUPE_ppb001660mg             160   6e-42   
ref|XP_011012579.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   6e-42   
ref|XP_007021383.1|  S-locus lectin protein kinase family protein       161   6e-42   
ref|XP_007025952.1|  Cysteine-rich RLK 10                               157   6e-42   
gb|KDP20851.1|  hypothetical protein JCGZ_21322                         150   6e-42   
ref|XP_008232167.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    161   7e-42   
ref|XP_008441830.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   7e-42   
gb|AES89910.2|  S-locus lectin kinase family protein                    160   7e-42   
ref|XP_006475281.1|  PREDICTED: G-type lectin S-receptor-like ser...    154   7e-42   
ref|XP_006377897.1|  hypothetical protein POPTR_0011s15760g             161   7e-42   
gb|KDP36269.1|  hypothetical protein JCGZ_09834                         159   8e-42   
ref|XP_006582205.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   8e-42   
ref|XP_008226792.1|  PREDICTED: uncharacterized protein LOC103326355    163   8e-42   
ref|XP_007025957.1|  Cysteine-rich RLK 10, putative                     159   8e-42   
ref|XP_006388692.1|  hypothetical protein POPTR_0118s00210g             161   8e-42   
ref|XP_008454615.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   8e-42   
ref|XP_009361799.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   9e-42   
ref|XP_007022737.1|  Receptor kinase 3, putative                        159   9e-42   
ref|XP_006389134.1|  hypothetical protein POPTR_0044s002802g            154   9e-42   
ref|XP_006413094.1|  hypothetical protein EUTSA_v10027068mg             160   9e-42   
ref|XP_008454614.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   9e-42   
ref|XP_010060395.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   9e-42   
ref|XP_009361798.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   9e-42   
gb|KCW67093.1|  hypothetical protein EUGRSUZ_F00872                     160   1e-41   
ref|XP_008386047.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_009361761.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
gb|KCW67256.1|  hypothetical protein EUGRSUZ_F01050                     159   1e-41   
ref|XP_011030928.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_006582211.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_011012851.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_008386046.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_009361760.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
gb|KEH19659.1|  S-locus lectin kinase family protein                    160   1e-41   
ref|XP_004513950.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_004164064.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_004505470.1|  PREDICTED: uncharacterized protein LOC101500771    162   1e-41   
ref|XP_006582204.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
gb|KHN11179.1|  G-type lectin S-receptor-like serine/threonine-pr...    160   1e-41   
ref|XP_006389127.1|  hypothetical protein POPTR_0044s00210g             159   1e-41   
ref|XP_003598123.1|  Serine/threonine protein kinase                    155   1e-41   
ref|XP_011048295.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
gb|KDP38995.1|  hypothetical protein JCGZ_00752                         160   1e-41   
gb|KDP38976.1|  hypothetical protein JCGZ_00733                         159   1e-41   
ref|XP_004513949.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_006582212.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_010644308.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_006452087.1|  hypothetical protein CICLE_v10010517mg             149   1e-41   
ref|XP_004170625.1|  PREDICTED: receptor-like serine/threonine-pr...    160   1e-41   
ref|XP_010644279.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   1e-41   
ref|XP_007025876.1|  S-locus lectin protein kinase family protein       160   1e-41   
ref|XP_007021216.1|  Serine/threonine-protein kinase receptor, pu...    162   2e-41   
ref|XP_009355542.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-41   
ref|XP_007212629.1|  hypothetical protein PRUPE_ppa016146mg             158   2e-41   
ref|XP_007133047.1|  hypothetical protein PHAVU_011G147000g             160   2e-41   
ref|XP_007133108.1|  hypothetical protein PHAVU_011G152200g             160   2e-41   
ref|XP_010317517.1|  PREDICTED: uncharacterized protein LOC101252749    162   2e-41   
ref|XP_009345095.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-41   
ref|XP_009616770.1|  PREDICTED: receptor-like serine/threonine-pr...    160   2e-41   
ref|XP_007025953.1|  Cysteine-rich RLK 10                               158   2e-41   
gb|KEH19660.1|  S-locus lectin kinase family protein                    160   2e-41   
gb|KDP38970.1|  hypothetical protein JCGZ_00727                         159   2e-41   
ref|XP_008226333.1|  PREDICTED: G-type lectin S-receptor-like ser...    161   2e-41   
ref|XP_010644307.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-41   
ref|XP_010644306.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-41   
ref|XP_006343406.1|  PREDICTED: receptor-like serine/threonine-pr...    161   2e-41   
ref|XP_010065695.1|  PREDICTED: G-type lectin S-receptor-like ser...    160   2e-41   
gb|KCW50901.1|  hypothetical protein EUGRSUZ_J00545                     158   2e-41   
ref|XP_009773537.1|  PREDICTED: receptor-like serine/threonine-pr...    160   2e-41   
gb|KHN11180.1|  G-type lectin S-receptor-like serine/threonine-pr...    159   2e-41   
gb|KCW63313.1|  hypothetical protein EUGRSUZ_G00941                     158   2e-41   
ref|XP_002315527.2|  hypothetical protein POPTR_0010s01980g             159   2e-41   
ref|XP_007021132.1|  S-locus lectin protein kinase family protein...    155   2e-41   
ref|XP_010064434.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...    161   3e-41   
ref|XP_008441803.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   3e-41   
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...    159   3e-41   
gb|KHN38599.1|  G-type lectin S-receptor-like serine/threonine-pr...    159   3e-41   
ref|XP_007214410.1|  hypothetical protein PRUPE_ppa026351mg             159   3e-41   
ref|XP_006363513.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   3e-41   
ref|XP_009361790.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   3e-41   
ref|XP_006582198.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   4e-41   
gb|KDO74365.1|  hypothetical protein CISIN_1g043285mg                   155   4e-41   
gb|KCW63319.1|  hypothetical protein EUGRSUZ_G00950                     157   4e-41   
ref|XP_007212862.1|  hypothetical protein PRUPE_ppa021546mg             159   4e-41   
gb|KHN36766.1|  G-type lectin S-receptor-like serine/threonine-pr...    157   4e-41   
ref|XP_004154883.1|  PREDICTED: receptor-like serine/threonine-pr...    160   4e-41   
ref|XP_009361850.1|  PREDICTED: uncharacterized protein LOC103952043    160   4e-41   
ref|XP_007021185.1|  S-locus lectin protein kinase family protein...    158   4e-41   
ref|XP_011012090.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   4e-41   
ref|XP_006389132.1|  hypothetical protein POPTR_0044s002702g            148   4e-41   
gb|KHN19795.1|  G-type lectin S-receptor-like serine/threonine-pr...    157   4e-41   
ref|XP_006452108.1|  hypothetical protein CICLE_v10010282mg             158   4e-41   
ref|XP_004146866.1|  PREDICTED: receptor-like serine/threonine-pr...    159   4e-41   
ref|XP_011002459.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   4e-41   
ref|XP_009355548.1|  PREDICTED: G-type lectin S-receptor-like ser...    157   5e-41   
ref|XP_004509984.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   5e-41   
ref|XP_006475248.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   5e-41   
ref|XP_010034228.1|  PREDICTED: G-type lectin S-receptor-like ser...    159   5e-41   
ref|XP_003526125.2|  PREDICTED: G-type lectin S-receptor-like ser...    159   5e-41   
ref|XP_009377330.1|  PREDICTED: G-type lectin S-receptor-like ser...    153   5e-41   
ref|XP_008386060.1|  PREDICTED: G-type lectin S-receptor-like ser...    158   5e-41   
gb|KDO74376.1|  hypothetical protein CISIN_1g043384mg                   148   5e-41   
gb|KHN37219.1|  G-type lectin S-receptor-like serine/threonine-pr...    157   5e-41   
ref|XP_007214501.1|  hypothetical protein PRUPE_ppa018069mg             157   5e-41   
ref|XP_007021219.1|  S-locus lectin protein kinase family protein...    159   5e-41   
ref|XP_007214606.1|  hypothetical protein PRUPE_ppa001816mg             158   6e-41   
ref|XP_008372182.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    160   6e-41   
gb|KDO48493.1|  hypothetical protein CISIN_1g0460101mg                  150   6e-41   
gb|KCW50903.1|  hypothetical protein EUGRSUZ_J00550                     158   6e-41   



>ref|XP_010315042.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=359

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGF HQDH  NL  +AWKLY
Sbjct  205  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRGFIHQDHNLNLLGHAWKLY  264

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL DE L +SCN++QVLRSI VGLLCVQQ+P+DRPSM SVV ML+N++ L  AK
Sbjct  265  KEDRSLELADEQLTDSCNISQVLRSIQVGLLCVQQHPDDRPSMSSVVHMLANESLLPKAK  324

Query  237  KPGFFTGRAIEAHISTVEIT-DSVNEVTISLLNPR  136
            +PGFFT R I     +V  T  S NE TI++L+PR
Sbjct  325  EPGFFTERNIFDEAKSVSQTRSSNNEFTITMLDPR  359



>ref|XP_010320281.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase At4g27290 [Solanum lycopersicum]
Length=813

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  GMFS KSDVFSFGV VLEIVSGK+NRGFSHQDH  NL  +AWKLY
Sbjct  659  VVGTYGYMSPEYAVDGMFSVKSDVFSFGVMVLEIVSGKKNRGFSHQDHNLNLLGHAWKLY  718

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL DE L +SC  +Q+LRSI VGLLCVQQ+P DRPSM+SVVQML+N++ L  AK
Sbjct  719  KEDRSLELADEQLADSCKTSQILRSIQVGLLCVQQHPNDRPSMFSVVQMLANESLLPKAK  778

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT R + +   S  +IT S NEVTI+LL+PR
Sbjct  779  EPGFFTERNVYDEGKSGSQITSSKNEVTITLLDPR  813



>ref|XP_006356822.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Solanum tuberosum]
Length=808

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G FS KSDVFSFGV VLEIVSGK+NRGF HQDH  NL  +AWKLY
Sbjct  654  VVGTYGYMSPEYAVDGKFSVKSDVFSFGVLVLEIVSGKKNRGFVHQDHNLNLLGHAWKLY  713

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL  E L +SCN +QVLRSIHVGLLCVQQ+P+DRPSM+SVV ML+ND  L  AK
Sbjct  714  KEDRSLELAAEQLADSCNTSQVLRSIHVGLLCVQQHPDDRPSMFSVVHMLANDGLLPKAK  773

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT R + +   S ++   S NE TI+LL+PR
Sbjct  774  EPGFFTERNVYDEAKSGLQTRSSKNEFTITLLDPR  808



>ref|XP_009587205.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=808

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  654  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  713

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL+DE L +SC+++QVLRSI VGLLCVQQ+P+DRPSM SVV ML+N++ L  AK
Sbjct  714  KEDRSLELIDEQLADSCHVSQVLRSIQVGLLCVQQHPDDRPSMSSVVLMLANESLLPKAK  773

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT R I +   S  +IT + N+VTI+LL+PR
Sbjct  774  EPGFFTERNIFDEAKSGSQITSTNNDVTITLLDPR  808



>ref|XP_004238059.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Solanum lycopersicum]
Length=810

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  656  VVGTYGYMSPEYAVDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  715

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL+DE L +SCN++QVLRSI VGLLCVQQ+P+DRP+M+SVVQML+N++ L  AK
Sbjct  716  KEDRSLELVDEQLADSCNISQVLRSIQVGLLCVQQHPDDRPNMFSVVQMLANESLLPKAK  775

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFF  R + +   S  +   S N+VTI+LL+PR
Sbjct  776  EPGFFIQRDVFDEEKSGSQTGSSKNDVTITLLDPR  810



>ref|XP_010320274.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=810

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 123/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF HQ+H  NL  +AWKLY
Sbjct  656  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKRNRGFVHQNHNLNLLGHAWKLY  715

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL+DE + ESC+++QVLRSI VGLLCVQQ PEDRP+M SVVQML N++ LA AK
Sbjct  716  KEDRSLELIDEKIAESCHISQVLRSIQVGLLCVQQCPEDRPNMSSVVQMLGNESLLAEAK  775

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFF  R + ++  S ++   S NE+T+++L+PR
Sbjct  776  EPGFFMERTVHDSDNSGMQTGSSNNEMTMTMLDPR  810



>ref|XP_010320279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Solanum lycopersicum]
Length=814

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  660  VVGTYGYMSPEYAVDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  719

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL+DE L +SCN++QVLRSI VGLLCVQQ+P+DRP+M+SVVQML+N++ L  AK
Sbjct  720  KEDRSLELVDEQLADSCNISQVLRSIQVGLLCVQQHPDDRPNMFSVVQMLANESLLPKAK  779

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFF  R + +   S  +   S N+VTI+LL+PR
Sbjct  780  EPGFFIQRDVFDEEKSGSQTGSSKNDVTITLLDPR  814



>ref|XP_006356818.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=811

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS K+NRGF H+DH  NL  +AWKLY
Sbjct  657  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKKNRGFVHEDHNLNLLGHAWKLY  716

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS+EL+DE L ESC+++QVLRSI VGLLCVQQ PEDRP+M SVVQML N++ LA AK
Sbjct  717  KEDRSLELIDEKLAESCHISQVLRSIQVGLLCVQQCPEDRPNMSSVVQMLGNESLLAKAK  776

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFF  R + ++  S ++   S NE+T+++L+PR
Sbjct  777  EPGFFMERTLHDSDNSGMQTGSSKNEITMTMLDPR  811



>ref|XP_006356821.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Solanum tuberosum]
Length=747

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  593  VVGTYGYMSPEYAIDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  652

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ +S+EL+DE L +SCN++Q LRSI VGLLCVQQ+P+DRPSM+SVVQML+N++ L  AK
Sbjct  653  KEDKSLELVDEQLADSCNISQALRSIQVGLLCVQQHPDDRPSMFSVVQMLANESLLPKAK  712

Query  237  KPGFFTGRAIEA-HISTVEITDSVNEVTISLLNPR  136
            +PGFF  R +     S  +   S N+VTI+LL+PR
Sbjct  713  EPGFFIERDVFGEEKSGSQTGSSKNDVTITLLDPR  747



>ref|XP_006356820.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Solanum tuberosum]
Length=810

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/155 (62%), Positives = 120/155 (77%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  656  VVGTYGYMSPEYAIDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  715

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ +S+EL+DE L +SCN++Q LRSI VGLLCVQQ+P+DRPSM+SVVQML+N++ L  AK
Sbjct  716  KEDKSLELVDEQLADSCNISQALRSIQVGLLCVQQHPDDRPSMFSVVQMLANESLLPKAK  775

Query  237  KPGFFTGRAIEA-HISTVEITDSVNEVTISLLNPR  136
            +PGFF  R +     S  +   S N+VTI+LL+PR
Sbjct  776  EPGFFIERDVFGEEKSGSQTGSSKNDVTITLLDPR  810



>ref|XP_009777837.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana sylvestris]
Length=807

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  653  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  712

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS EL+DE L +SC+++QVLRSI VGLLCVQQ P+DRPSM SVV ML+ND+ L  AK
Sbjct  713  KEDRSFELIDEQLADSCHVSQVLRSIQVGLLCVQQRPDDRPSMSSVVLMLANDSLLPKAK  772

Query  237  KPGFFTGRAIEAHISTVEITDSV-NEVTISLLNPR  136
            +PGFFT R +     +   T S  NEVTI+L++PR
Sbjct  773  EPGFFTERNVLNKAKSGSQTASTNNEVTITLVDPR  807



>ref|XP_009777836.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana sylvestris]
Length=808

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  654  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  713

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++ RS EL+DE L +SC+++QVLRSI VGLLCVQQ P+DRPSM SVV ML+ND+ L  AK
Sbjct  714  KEDRSFELIDEQLADSCHVSQVLRSIQVGLLCVQQRPDDRPSMSSVVLMLANDSLLPKAK  773

Query  237  KPGFFTGRAIEAHISTVEITDSV-NEVTISLLNPR  136
            +PGFFT R +     +   T S  NEVTI+L++PR
Sbjct  774  EPGFFTERNVLNKAKSGSQTASTNNEVTITLVDPR  808



>ref|XP_009587208.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=808

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS K+NRGF HQDH  NL  +AWK
Sbjct  652  SHVVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKKNRGFVHQDHNLNLLGHAWK  711

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++ RS+EL+DE L +SC+++QVLRSI VGLLCVQQ PEDRP+M SVV ML N++ L  
Sbjct  712  LYKEDRSLELIDEELADSCHISQVLRSIQVGLLCVQQSPEDRPNMSSVVLMLGNESPLPE  771

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            AK+PG+FT R I +   S  +   S NEVTI+LL PR
Sbjct  772  AKEPGYFTERNIFDEAKSGSQTASSKNEVTITLLYPR  808



>ref|XP_009587207.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=852

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS K+NRGF HQDH  NL  +AWK
Sbjct  696  SHVVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKKNRGFVHQDHNLNLLGHAWK  755

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++ RS+EL+DE L +SC+++QVLRSI VGLLCVQQ PEDRP+M SVV ML N++ L  
Sbjct  756  LYKEDRSLELIDEELADSCHISQVLRSIQVGLLCVQQSPEDRPNMSSVVLMLGNESPLPE  815

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            AK+PG+FT R I +   S  +   S NEVTI+LL PR
Sbjct  816  AKEPGYFTERNIFDEAKSGSQTASSKNEVTITLLYPR  852



>emb|CDP05417.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 2/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA +G+FSTKSDVFSFGV VLEIV+GK+NRGF+H DHY +L  +AW L
Sbjct  512  RVVGTYGYMSPEYAVNGVFSTKSDVFSFGVFVLEIVTGKKNRGFTHPDHYHSLLGHAWLL  571

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            ++DGR  EL+D+H  +SC L++V+RSIHVGLLCVQQYP+DRPSM SVV ML  D  L   
Sbjct  572  FKDGRFQELIDDHFSQSCFLSEVIRSIHVGLLCVQQYPDDRPSMSSVVLMLVGDGALPFP  631

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PG+FT R       T +I  S N++TI+LL+ R
Sbjct  632  KEPGYFTER--NCFFETDKIFSSGNQLTITLLDAR  664



>ref|XP_006377797.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
 gb|ERP55594.1| hypothetical protein POPTR_0011s12930g [Populus trichocarpa]
Length=817

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIV+GKRNRGF HQDH  NL  +AWKL
Sbjct  661  RVVGTYGYMSPEYATDGIFSIKSDVFSFGVLVLEIVNGKRNRGFIHQDHKHNLLGHAWKL  720

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++ RS EL+++ L ++CNL++VLR IHVGLLCVQQ PEDRP+M +VV MLS++  L   
Sbjct  721  YKEERSFELINDSLKDTCNLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLSSNIALPDP  780

Query  240  KKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
            K+PGFFT R +  H S+    D  S NE+TI+LL  R
Sbjct  781  KEPGFFTERKLFDHESSSSKVDTCSANEITITLLTAR  817



>ref|XP_011030934.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=817

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIV+GKRNRGF HQDH  NL  +AWKL
Sbjct  661  RVVGTYGYMSPEYATDGIFSIKSDVFSFGVLVLEIVNGKRNRGFIHQDHKHNLLGHAWKL  720

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++ RS EL+++ L ++CNL++VLR IHVGLLCVQQ PEDRP+M +VV MLS++  L   
Sbjct  721  YKEERSFELINDSLKDTCNLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLSSNIALPDP  780

Query  240  KKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
            K+PGFFT R +  H S+    D  S NE+TI+LL  R
Sbjct  781  KEPGFFTERKLFDHESSSTKVDACSANEITITLLTAR  817



>ref|XP_009780423.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana sylvestris]
Length=808

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS K+NRGF  QDH  NL  +AWK
Sbjct  652  SHVVGTHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKKNRGFVPQDHNLNLLGHAWK  711

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++ RS+EL+DE L +SC+++QVLRSI VGLLCVQQ PEDRP+M SVV ML N++ L  
Sbjct  712  LYKEDRSLELIDEELADSCHISQVLRSIQVGLLCVQQRPEDRPNMSSVVLMLGNESPLPE  771

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            AK+PG+FT R I +   S  +   S NEVTI+LL PR
Sbjct  772  AKEPGYFTERNIFDEAKSGSQTASSKNEVTITLLYPR  808



>ref|XP_009591204.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=815

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDVFSFGV VLEI+SGKRNRGF H DH+ NL  + W 
Sbjct  663  TRVVGTYGYMSPEYAAEGNFSVKSDVFSFGVLVLEILSGKRNRGFFHPDHHHNLLGHVWI  722

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GRS+EL++ HL ES NL++V RS+HVGLLCVQ  PEDRPSM SV+ MLS+D  L +
Sbjct  723  LFREGRSLELINAHLRESSNLSEVQRSVHVGLLCVQHCPEDRPSMASVLLMLSSDIPLPL  782

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFTGR   +  S  +   SVNE++I++L  R
Sbjct  783  PKEPGFFTGR---SQSSKADSESSVNEISITMLEAR  815



>ref|XP_009591202.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=820

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 117/156 (75%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDVFSFGV VLEI+SGKRNRGF H DH+ NL  + W 
Sbjct  668  TRVVGTYGYMSPEYAAEGNFSVKSDVFSFGVLVLEILSGKRNRGFFHPDHHHNLLGHVWI  727

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GRS+EL++ HL ES NL++V RS+HVGLLCVQ  PEDRPSM SV+ MLS+D  L +
Sbjct  728  LFREGRSLELINAHLRESSNLSEVQRSVHVGLLCVQHCPEDRPSMASVLLMLSSDIPLPL  787

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFTGR   +  S  +   SVNE++I++L  R
Sbjct  788  PKEPGFFTGR---SQSSKADSESSVNEISITMLEAR  820



>ref|XP_009587211.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=667

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVS KRNRGF H DH  NL  +AWK
Sbjct  511  SHVVATHGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSCKRNRGFFHPDHNLNLLGHAWK  570

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++ RS+EL+DE L +SC+++QVLRSI VGLLCVQQ PE RP+M SVV ML N+  L+ 
Sbjct  571  LYKEDRSLELIDEQLADSCHISQVLRSIQVGLLCVQQCPEVRPNMSSVVMMLGNEIVLSE  630

Query  243  AKKPGFFTGRAIEA-HISTVEITDSVNEVTISLLNPR  136
            AK+PGFFT R +     S  +  +S NEVTI+ L+PR
Sbjct  631  AKEPGFFTERKVPGPENSGPQAGNSNNEVTITSLDPR  667



>ref|XP_010320278.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=810

 Score =   189 bits (479),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 118/155 (76%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AW LY
Sbjct  656  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWNLY  715

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++  S+EL+DE L +S +++QVLR IHVGLLCVQQ+P+DRP+M SVV ML+N++ L  AK
Sbjct  716  KEDMSLELIDEQLADSLHISQVLRLIHVGLLCVQQHPDDRPNMSSVVHMLANESLLPKAK  775

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT R I +   S  +   S NEVTI+LL+PR
Sbjct  776  EPGFFTERNIFDKEKSGSQTRSSRNEVTITLLDPR  810



>ref|XP_006360116.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=829

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 119/158 (75%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  + + L
Sbjct  672  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTYML  731

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+D  LV+SCN+++VLRSIHVGLLCVQQ PEDRPSM +V+ MLSN+  L  A
Sbjct  732  HKEGRSLELVDPKLVDSCNISEVLRSIHVGLLCVQQNPEDRPSMSTVIMMLSNEGILPSA  791

Query  240  KKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R I   +    + +   S+NEVTI+LL+ R
Sbjct  792  KHPGFFTERKIGDVDQFSWSTQTPSSINEVTITLLDAR  829



>ref|XP_009617833.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=779

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  + W L
Sbjct  623  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTWML  682

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D +LV+SC +++VLRSIHVGLLCVQQ PEDRP+M +V+ MLSN+  L   
Sbjct  683  HKEGRQLELVDPNLVDSCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNEGILPPP  742

Query  240  KKPGFFTGRAI-EAHIS-TVEITDSVNEVTISLLNPR  136
            K PGFFT R + +A  S + +   S+NEVTI+LLN R
Sbjct  743  KHPGFFTERNVKDAEFSWSTQTPSSINEVTITLLNAR  779



>ref|XP_009617832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=827

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  + W L
Sbjct  671  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTWML  730

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D +LV+SC +++VLRSIHVGLLCVQQ PEDRP+M +V+ MLSN+  L   
Sbjct  731  HKEGRQLELVDPNLVDSCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNEGILPPP  790

Query  240  KKPGFFTGRAI-EAHIS-TVEITDSVNEVTISLLNPR  136
            K PGFFT R + +A  S + +   S+NEVTI+LLN R
Sbjct  791  KHPGFFTERNVKDAEFSWSTQTPSSINEVTITLLNAR  827



>ref|XP_009800162.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana sylvestris]
Length=779

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  +AW L
Sbjct  623  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWML  682

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D ++V+SC +++VLRSIHVGLLCVQQ PEDRP+M +V+ MLSN++ L   
Sbjct  683  HKEGRQLELVDSNMVDSCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNESILPPP  742

Query  240  KKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R +   E   ST +   S+NEVTI+LLN R
Sbjct  743  KHPGFFTERNVKDTEFSWST-QTPSSINEVTITLLNAR  779



>ref|XP_009611412.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=828

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  +AW L
Sbjct  672  RVVGTYGYMSPEYAIDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWLL  731

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GR +EL+D +LV+SC +++VLRSIHVGLLCVQQ PEDRPSM +V+ MLSN+  L   
Sbjct  732  HEEGRQLELVDSNLVDSCYVSEVLRSIHVGLLCVQQNPEDRPSMSTVIMMLSNEGILPPP  791

Query  240  KKPGFFTGRA---IEAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R    +E   ST +   S+NE+TI+LLN R
Sbjct  792  KHPGFFTERNVKDVEFSWST-QTPSSINEITITLLNAR  828



>ref|XP_009800154.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana sylvestris]
Length=827

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 120/158 (76%), Gaps = 4/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  +AW L
Sbjct  671  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWML  730

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D ++V+SC +++VLRSIHVGLLCVQQ PEDRP+M +V+ MLSN++ L   
Sbjct  731  HKEGRQLELVDSNMVDSCYVSEVLRSIHVGLLCVQQNPEDRPNMSTVIMMLSNESILPPP  790

Query  240  KKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R +   E   ST +   S+NEVTI+LLN R
Sbjct  791  KHPGFFTERNVKDTEFSWST-QTPSSINEVTITLLNAR  827



>ref|XP_011073949.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Sesamum indicum]
Length=816

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AWKLY
Sbjct  661  VVGTYGYMSPEYAVEGLFSIKSDVFSFGVLVLEIVSGKRNRGFSHSDHSLNLLGHAWKLY  720

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GRS+EL+D  L       +V+RSI VGLLCVQQ PEDRP+M SVV ML N+ ++  AK
Sbjct  721  KEGRSLELVDASLDHKIYSPEVVRSIQVGLLCVQQNPEDRPTMSSVVLMLGNEGEIPQAK  780

Query  237  KPGFFTGRAIEA--HISTVEITDSVNEVTISLLNPR  136
            KPGFFT R + A  + S+ +  +S NEVTI++  PR
Sbjct  781  KPGFFTERDVLASQNSSSTDAANSRNEVTITMPEPR  816



>ref|XP_011002460.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Populus euphratica]
Length=833

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF+H  H  NL  +AWKL
Sbjct  677  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNRGFNHPGHQLNLLGHAWKL  736

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D  +VE+C+LT+V+RSIHVGLLCVQ  PEDRPSM +VV MLS +  L   
Sbjct  737  FKEGRPLELIDNLIVETCDLTEVMRSIHVGLLCVQHSPEDRPSMSTVVLMLSGEGTLPQP  796

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +   +  S+   + SVNEVTI+L++ R
Sbjct  797  KEPGFFTERKLIDTSSSSSKPESCSVNEVTITLIDAR  833



>ref|XP_006370400.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
 gb|ERP66969.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
Length=833

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF+H  H  NL  +AWKL
Sbjct  677  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNRGFNHPGHQLNLLGHAWKL  736

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D  +VE+C+LT+V+RSIHVGLLCVQ  PEDRPSM +VV MLS +  L   
Sbjct  737  FKEGRPLELIDNLIVETCDLTEVMRSIHVGLLCVQHSPEDRPSMSTVVLMLSGEGTLPQP  796

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +   +  S+   + SVNEVTI+L++ R
Sbjct  797  KEPGFFTERKLIDASSSSSKPESCSVNEVTITLIDAR  833



>ref|XP_006370399.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
 gb|ERP66968.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
Length=781

 Score =   185 bits (469),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF+H  H  NL  +AWKL
Sbjct  625  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNRGFNHPGHQLNLLGHAWKL  684

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D  +VE+C+LT+V+RSIHVGLLCVQ  PEDRPSM +VV MLS +  L   
Sbjct  685  FKEGRPLELIDNLIVETCDLTEVMRSIHVGLLCVQHSPEDRPSMSTVVLMLSGEGTLPQP  744

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +   +  S+   + SVNEVTI+L++ R
Sbjct  745  KEPGFFTERKLIDASSSSSKPESCSVNEVTITLIDAR  781



>ref|XP_006356819.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=833

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G+FS KSDVFSFGV +LEIVS KRNRGF HQDH  NL  +AWKLY
Sbjct  679  VVGTHGYMSPEYAVDGIFSVKSDVFSFGVLLLEIVSCKRNRGFVHQDHNLNLLGHAWKLY  738

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++  S+EL+DE L  S +++Q LR IHVGLLCVQQ P DRP+M SVV ML+N++ L  AK
Sbjct  739  KEDMSLELIDEQLNNSFHISQALRLIHVGLLCVQQNPADRPNMSSVVHMLANESLLPKAK  798

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT R I +   S  +   S NEVTI+LL+PR
Sbjct  799  EPGFFTERNIFDKEKSGSQTRSSKNEVTITLLDPR  833



>ref|XP_010042219.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=283

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEI+SGKRNRGF H DH+ NL  +AW+
Sbjct  131  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISGKRNRGFRHPDHHHNLLGHAWR  190

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS +LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  191  LFTEGRSTQLLDKLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  250

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  251  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  283



>gb|ABK96679.1| unknown [Populus trichocarpa x Populus deltoides]
Length=665

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY++PEYA  G++S KSDVFSFGV VLEIVSGKRN+GF H DH +NL  +AW+
Sbjct  509  NKVVGTYGYIAPEYAIDGLYSVKSDVFSFGVMVLEIVSGKRNKGFCHPDHKQNLLGHAWR  568

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS EL+ E +VESCN  +VLRSIH+GLLCVQ+ P DRPSM +VV ML ++++L  
Sbjct  569  LFIEGRSSELIVESIVESCNFYEVLRSIHIGLLCVQRSPRDRPSMSTVVMMLGSESELPQ  628

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + +A  S+ +   SVNE+T++ L  R
Sbjct  629  PKEPGFFTTRDVGKATSSSTQSKVSVNEITMTQLEAR  665



>ref|XP_006370396.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
 gb|ERP66965.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
Length=776

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G++S KSDVFSFGV V+EIVSG RNRGF H DH  NL  +AW 
Sbjct  619  NRVVGTYGYMSPEYAIDGLYSIKSDVFSFGVLVIEIVSGSRNRGFYHPDHNLNLLGHAWG  678

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS EL+ E + ESCNL +VLRSIHVGLLCVQ +P DRPSM SVV ML  +A L  
Sbjct  679  LFTEGRSCELITEPIEESCNLPEVLRSIHVGLLCVQCHPNDRPSMLSVVLMLCGEAKLPQ  738

Query  243  AKKPGFFTGRA-IEAHISTVEITD-SVNEVTISLLNPR  136
             K+PGFFT RA +EA+ S+ + T  SVN+ TI+LL  R
Sbjct  739  PKQPGFFTDRALVEANSSSRKNTSCSVNDSTITLLEAR  776



>ref|XP_011097955.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Sesamum indicum]
Length=817

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSG+RNRGFSH DH  NL  +AW L
Sbjct  661  RVVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGRRNRGFSHSDHNLNLLGHAWTL  720

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GR +EL+D  L +S   ++V+RSIHVGLLCVQQ PEDRP+M SVV ML N+     A
Sbjct  721  YKEGRQLELVDSCLGDSFYFSEVVRSIHVGLLCVQQNPEDRPTMSSVVLMLGNEGVFPEA  780

Query  240  KKPGFFTGRAIEAHIS--TVEITDSVNEVTISLLNPR  136
            K+PGFFT R + A  S  +     S NEVTI++  PR
Sbjct  781  KQPGFFTERDVLAAQSATSTHTASSANEVTITMPEPR  817



>gb|KDP38978.1| hypothetical protein JCGZ_00735 [Jatropha curcas]
Length=819

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 118/158 (75%), Gaps = 4/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+SG+RNRGF H DH  NL  +AW+L
Sbjct  663  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIISGRRNRGFYHPDHKHNLLGHAWRL  722

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y + +S+EL+DE L ESC L+QV+RSI VGLLCVQQ P+DRP+M +VV ML++D  L   
Sbjct  723  YLEEKSLELIDETLKESCILSQVMRSIQVGLLCVQQSPDDRPNMATVVLMLTSDIALPQP  782

Query  240  KKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +   E+  S V+ T S NE+TI+LL  R
Sbjct  783  KEPGFFTERKVFEQESSSSKVD-TCSANEITITLLAAR  819



>gb|KDP38990.1| hypothetical protein JCGZ_00747 [Jatropha curcas]
Length=181

 Score =   172 bits (435),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFGV +LEI+SGK++RGF H     NL  +AWK
Sbjct  24   NRVVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKKSRGFYHPSRGLNLIGHAWK  83

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G+ +EL+D +L ESCNLT+V+R I + LLCVQQ+PE+RPS+ SVV ML ++  L  
Sbjct  84   LWKEGKPLELIDVNLGESCNLTEVIRCIQISLLCVQQHPEERPSVASVVLMLGSENALPQ  143

Query  243  AKKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
             K+PG+F  R      ST    D  S NE+TISLL PR
Sbjct  144  PKQPGYFKDRGPAESDSTSGKQDSSSTNEMTISLLEPR  181



>gb|KDP38982.1| hypothetical protein JCGZ_00739 [Jatropha curcas]
Length=800

 Score =   183 bits (464),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G++STKSDV+SFGV VLEIVSGKRNRGFSH +H  NL  +AW+
Sbjct  643  NKVVGTYGYMSPEYAVDGLYSTKSDVYSFGVIVLEIVSGKRNRGFSHPEHNLNLLGHAWR  702

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS+E++D  +  SCNL +VLRSIH+GLLCVQ+ PEDRPSM SVV ML  +  L  
Sbjct  703  LHMEGRSVEMIDALIKNSCNLNEVLRSIHIGLLCVQRSPEDRPSMSSVVFMLGGEGALPE  762

Query  243  AKKPGFFTGRAIEA--HISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R I A  + S    + S N +T++LL  R
Sbjct  763  PKQPGFFTEREISAANYSSNNHDSSSANGLTVTLLEAR  800



>ref|XP_006356902.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X2 [Solanum tuberosum]
Length=247

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYAG G FS KSDVFSFGV VLEI+S KRNRGF H DH  NL  + W L
Sbjct  90   RVVGTYGYMSPEYAGEGKFSVKSDVFSFGVLVLEILSRKRNRGFFHPDHNHNLLGHVWIL  149

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ R +E++D  L +SCN ++V RS HV LLCVQQ PEDRPSM SVV ML +D  L + 
Sbjct  150  FKESRVMEVIDAQLRQSCNQSEVQRSAHVSLLCVQQCPEDRPSMASVVLMLGSDVTLPLP  209

Query  240  KKPGFFTGR--AIEAHISTVEITD-SVNEVTISLLNPR  136
            K+PGFF GR  + EA  S+ +  + SVNE++I+ L+ R
Sbjct  210  KEPGFFNGRSQSTEADTSSSKHGETSVNELSITQLDAR  247



>ref|XP_006356901.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X1 [Solanum tuberosum]
Length=249

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYAG G FS KSDVFSFGV VLEI+S KRNRGF H DH  NL  + W L
Sbjct  92   RVVGTYGYMSPEYAGEGKFSVKSDVFSFGVLVLEILSRKRNRGFFHPDHNHNLLGHVWIL  151

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ R +E++D  L +SCN ++V RS HV LLCVQQ PEDRPSM SVV ML +D  L + 
Sbjct  152  FKESRVMEVIDAQLRQSCNQSEVQRSAHVSLLCVQQCPEDRPSMASVVLMLGSDVTLPLP  211

Query  240  KKPGFFTGR--AIEAHISTVEITD-SVNEVTISLLNPR  136
            K+PGFF GR  + EA  S+ +  + SVNE++I+ L+ R
Sbjct  212  KEPGFFNGRSQSTEADTSSSKHGETSVNELSITQLDAR  249



>ref|XP_006370398.1| hypothetical protein POPTR_0001s42250g [Populus trichocarpa]
 gb|ERP66967.1| hypothetical protein POPTR_0001s42250g [Populus trichocarpa]
Length=776

 Score =   182 bits (463),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY++PEYA  G++S KSDVFSFGV VLEIVSGKRN+GF H DH +NL  +AW+
Sbjct  620  NKVVGTYGYIAPEYAIDGLYSVKSDVFSFGVMVLEIVSGKRNKGFCHPDHKQNLLGHAWR  679

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS EL+ E +VESCN  +VLRSIH+GLLCVQ+ P DRPSM +VV ML ++++L  
Sbjct  680  LFIEGRSSELIVESIVESCNFYEVLRSIHIGLLCVQRSPRDRPSMSTVVMMLGSESELPQ  739

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + +A  S+ +   SVNE+T++ L  R
Sbjct  740  PKEPGFFTTRDVGKATSSSTQSKVSVNEITMTQLEAR  776



>ref|XP_011015991.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1, partial [Populus euphratica]
Length=235

 Score =   173 bits (439),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+L
Sbjct  80   KVAGTYGYISPEYAIEGLYSVKSDVFSFGVLVLEIVSGYKNRGFSHPEHSLNLLGHAWRL  139

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +R+GR +EL+ + ++E+CNL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L   
Sbjct  140  FREGRPMELVRQSIIEACNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNTLPQP  199

Query  240  KKPGFFTGRAIEAHISTVEIT-DSVNEVTISLLNPR  136
            K PGFF  R      ST E T +S N+ +I+LL  R
Sbjct  200  KHPGFFIERDPAEASSTSEGTANSANKCSITLLQAR  235



>ref|XP_011029379.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSG++NRGF+H DH  NL  +AW+L
Sbjct  668  KVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFNHPDHQHNLLGHAWRL  727

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D+ L ESC L++VLR IHV LLCVQQ P+DRPSM +VV M  +D  L   
Sbjct  728  WMEERPLELIDDILGESCALSEVLRCIHVALLCVQQRPDDRPSMSTVVLMFGSDTMLPQP  787

Query  240  KKPGFFTGR-AIEAHISTVEITDSV-NEVTISLLNPR  136
            K+PGFFT R  +EA  S  +   S  NE+TISLL PR
Sbjct  788  KQPGFFTERNVVEAECSASKNDSSTKNEITISLLEPR  824



>emb|CDP05418.1| unnamed protein product [Coffea canephora]
Length=1104

 Score =   185 bits (469),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 120/166 (72%), Gaps = 4/166 (2%)
 Frame = -1

Query  621   ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
             EN     ++V   GYM PEY   G +STKSDV+SFGV VLEIV+G++NRGF+H  H  NL
Sbjct  939   ENEANTKRVVGTYGYMPPEYVVDGFYSTKSDVYSFGVLVLEIVTGRKNRGFTHASHNHNL  998

Query  441   PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
               +AW LY+DGR  EL+D+HL +SC L++VLRSIHVGLLCVQQ+P+DRPSM SVV ML++
Sbjct  999   LGHAWLLYKDGRFQELVDDHLSKSCYLSEVLRSIHVGLLCVQQFPDDRPSMSSVVLMLAS  1058

Query  261   DADLAIAKKPGFFTGRAI----EAHISTVEITDSVNEVTISLLNPR  136
             D  L   K+PG+FT R +    E  +S+ +   S N++T+++L+ R
Sbjct  1059  DRALPFPKEPGYFTQRNLFFEPEKSLSSTKADSSSNQLTVTMLDAR  1104



>ref|XP_006377792.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
 gb|ERP55589.1| hypothetical protein POPTR_0011s12880g [Populus trichocarpa]
Length=750

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSG++NRGF+H DH  NL  +AW+L
Sbjct  594  KVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFNHPDHQHNLLGHAWRL  653

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D+ L ESC L++VLR IHV LLCVQQ P+DRPSM +VV M  +D  L   
Sbjct  654  WMEERPLELIDDILGESCALSEVLRCIHVALLCVQQRPDDRPSMSTVVLMFGSDTMLPQP  713

Query  240  KKPGFFTGRAIEAHISTVEITDSV--NEVTISLLNPR  136
            K+PGFFT R +    S+    DS   N++TISLL PR
Sbjct  714  KQPGFFTERNVVEAESSASKNDSSTKNQITISLLEPR  750



>ref|XP_009787421.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana sylvestris]
Length=808

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 116/155 (75%), Gaps = 3/155 (2%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGFSH     NL  +AW+LY
Sbjct  656  VVGTHGYMSPEYVVDGVFSIKSDVFSFGVLVLEIISGRRNRGFSHGSRNINLLGHAWRLY  715

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR++EL+D HL +SC  +++LR IHV LLCVQQ PEDRP M +VV +L+NDA L  AK
Sbjct  716  KEGRTLELIDVHLTDSCYFSELLRLIHVALLCVQQRPEDRPDMSAVVMILANDAVLPQAK  775

Query  237  KPGFFTG-RAIEAHISTVEITDSVNEVTISLLNPR  136
            +PGFFTG +  ++  S+ + T   NEVTI+ L+PR
Sbjct  776  EPGFFTGSKFTDSDYSSTKYT--TNEVTITQLDPR  808



>emb|CDP05414.1| unnamed protein product [Coffea canephora]
Length=966

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FSTKSDVFSFGV VLEIV+GK+NRGFSH DH+ NL  +AW L
Sbjct  808  RVVGTYGYMSPEYAVDGVFSTKSDVFSFGVLVLEIVTGKKNRGFSHPDHHHNLLGHAWLL  867

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            ++DGR  EL+D+H  +S  L++V+RSIHVGLLCVQQYP+DRPSM SVV ML  D +L   
Sbjct  868  FKDGRFQELIDDHFSQSYCLSEVIRSIHVGLLCVQQYPDDRPSMPSVVLMLVGDGELPFP  927

Query  240  KKPGFFTGRAI----EAHISTVEITDSVNEVTISLLNPR  136
            K+PG+FT R      +   S+  +  S N+++I++L  R
Sbjct  928  KEPGYFTERNFFFETDKIFSSGTVDSSGNQLSITVLEAR  966



>ref|XP_009607319.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=807

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 115/155 (74%), Gaps = 3/155 (2%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SGKRNRGFSH     NL  +AW+LY
Sbjct  655  VVGTHGYMSPEYVVDGVFSIKSDVFSFGVLVLEIISGKRNRGFSHGSRNINLLGHAWRLY  714

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR++EL+D HL +SC  +++LR IHV LLCVQQ PE+RP M +VV ML+NDA L  AK
Sbjct  715  KEGRTLELIDVHLTDSCYFSELLRLIHVALLCVQQRPENRPDMSTVVVMLANDAVLPQAK  774

Query  237  KPGFFTG-RAIEAHISTVEITDSVNEVTISLLNPR  136
            +PGFFTG +  ++  S+ + T   NEVT + L+PR
Sbjct  775  EPGFFTGSKFTDSDYSSTKYT--TNEVTFTQLDPR  807



>ref|XP_009605851.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=377

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 115/158 (73%), Gaps = 4/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH  NL  +AW L
Sbjct  221  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFIHPDHNLNLLGHAWML  280

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +R+GRS EL+D + VESC +++V RSIHVGLLCVQQ P+DRPSM SVV ML+N++ L   
Sbjct  281  HREGRSSELVDFNAVESCYISEVQRSIHVGLLCVQQNPDDRPSMSSVVLMLTNESILQQP  340

Query  240  KKPGFFTGRAIEAHIS---TVEITDSVNEVTISLLNPR  136
            K PGFF  R I AH +   +     SVN+VTI+ L+ R
Sbjct  341  KPPGFFMERNI-AHSTYSWSSHTPGSVNDVTITSLDAR  377



>ref|XP_011002465.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=822

 Score =   181 bits (458),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY++PEYA  G++S KSDVFSFGV VLEIVSGKRN+GF H DH +NL  +AW+
Sbjct  666  NKVVGTYGYIAPEYAIDGLYSVKSDVFSFGVMVLEIVSGKRNKGFCHPDHKQNLLGHAWR  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR+ EL+ E +VESCN  +VLRSIH+GLLCVQ+ P DRP M +VV ML ++++L  
Sbjct  726  LFTEGRASELIAESIVESCNFYEVLRSIHIGLLCVQRSPRDRPGMSTVVMMLGSESELPQ  785

Query  243  AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + +A  S+ +   S NEVT++ L  R
Sbjct  786  PKEPGFFTTRDVGKATSSSTQSKVSANEVTMTQLEAR  822



>ref|XP_006362969.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=871

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            E  +  +++V   GYMSPEYA  G+FS KSDVFSFGV +LEIVSGK+NR F H DH  NL
Sbjct  707  ETGDNTNRVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLILEIVSGKKNRRFIHPDHNLNL  766

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+R+GRS E++D +LVESC+ +++ RSIHVGLLCVQQ PEDRP+M SVV ML+N
Sbjct  767  IGHAWMLHREGRSSEIVDPNLVESCHTSELQRSIHVGLLCVQQSPEDRPNMSSVVLMLTN  826

Query  261  DADLAIAKKPGFFTGRAIE---AHISTVEITDSVNEVTISLLNPR  136
            +  L   K PGFFT R I+    +  + +   SVN+VTI+LL+ R
Sbjct  827  EGILPQPKPPGFFTERNIDDATGYSWSDQTPCSVNDVTITLLDAR  871



>emb|CBI20433.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V  SGYMSPEYA +G++STKSDVFSFGVSVLE+ SGKRNRGF + ++Y NL  YAW LY
Sbjct  1    MVPCSGYMSPEYAIAGLYSTKSDVFSFGVSVLEM-SGKRNRGFYNPNYYINLLGYAWTLY  59

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
             +GRS+EL+D  + ++CNL++VLRSIHVGLLCVQ+ P+DRPSM SV+ ML ++  L   K
Sbjct  60   MEGRSLELIDASMGDTCNLSEVLRSIHVGLLCVQRSPDDRPSMSSVILMLGSEGALPQPK  119

Query  237  KPGFF  223
            KPGFF
Sbjct  120  KPGFF  124



>emb|CAN70180.1| hypothetical protein VITISV_000005 [Vitis vinifera]
Length=229

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEIV+GKRNRGF H DH  NL  +AW 
Sbjct  72   TRVAGTLGYMSPEYATEGLYSTKSDVFSFGVLVLEIVTGKRNRGFFHPDHGYNLLGHAWT  131

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GRS+EL+D  + ++ NL++VLR+I++GLLCVQ++P DRPSM+SVV ML+++  L  
Sbjct  132  LYMEGRSLELIDPSMGDTSNLSEVLRTINMGLLCVQRFPNDRPSMHSVVLMLASECALPR  191

Query  243  AKKPGFFTGR-AIEAH-ISTVEITDSVNEVTISLLNPR  136
             ++P FFT R  +EA+ +    +  S NE +I+LL  R
Sbjct  192  PREPCFFTERNVVEANPVPGEHMLFSGNETSITLLEAR  229



>ref|XP_011002479.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=1180

 Score =   182 bits (461),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +KIV   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGF+H DH+ NL  +AW+
Sbjct  195  NKIVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGKKNRGFNHPDHHHNLLGHAWR  254

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            ++ +GR +EL++E   +SC L+++LR IHVGLLCVQ+ PEDRP+M SV+ MLS+   L  
Sbjct  255  VWNEGRPLELINEPEQDSCTLSEILRCIHVGLLCVQKRPEDRPNMSSVIVMLSSGISLPQ  314

Query  243  AKKPGFFTGRAIEAHISTVEITDS--VNEVTISLLNPR  136
             K+PGFFT R +    S+     S   NE+T+S L PR
Sbjct  315  PKQPGFFTERNLPEGESSSSNQKSFCTNEITVSFLGPR  352


 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             S+IV   GYMSPEYA  G+FS KSDVFSFGV VLEIVS K+NRGF H DH  NL  +AWK
Sbjct  1023  SRIVGTYGYMSPEYAVDGLFSIKSDVFSFGVLVLEIVSAKKNRGFFHPDHSHNLLGHAWK  1082

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ +GR +EL+++ + +S +L++V+R I VGLLCVQQ PEDRPSM +VV MLS++  L  
Sbjct  1083  LWNEGRPLELMNKKIDDSSSLSEVIRCIQVGLLCVQQRPEDRPSMSTVVVMLSSEISLPQ  1142

Query  243   AKKPGFFTGRAI-EAHISTVEITDSV-NEVTISLLNPR  136
              K+PGF+T R+  E   S+  I  +  N ++ ++  PR
Sbjct  1143  PKQPGFYTERSFSEQETSSSSIRSAFRNNISFTVFEPR  1180



>ref|XP_002525781.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus 
communis]
 gb|EEF36617.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus 
communis]
Length=868

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G++S KSDVFSFGV VLEIVSGKRNRGF H +H  NL  +AWKL
Sbjct  712  KVVGTHGYMSPEYAIDGLYSMKSDVFSFGVIVLEIVSGKRNRGFYHPEHQLNLLGHAWKL  771

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            ++DGRS E++D  ++ SCNL++VLRS+HVGLLCVQQ  EDRPSM + V MLS ++ L   
Sbjct  772  HKDGRSTEMIDGSMINSCNLSEVLRSVHVGLLCVQQSLEDRPSMSAAVYMLSGESALPEP  831

Query  240  KKPGFFTGR-AIEAH-ISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R   EA+  S+++  +S N +TI+L + R
Sbjct  832  KQPGFFTERDCTEANSSSSIKNFNSSNGLTITLPDAR  868



>ref|XP_002317549.1| hypothetical protein POPTR_0011s13240g [Populus trichocarpa]
 gb|EEE98161.1| hypothetical protein POPTR_0011s13240g [Populus trichocarpa]
Length=780

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++STKSDVFSFGV VLEI+SG +NRGFSH DH  NL  +AW+
Sbjct  623  NKVVGTYGYISPEYASDGLYSTKSDVFSFGVLVLEIISGNKNRGFSHPDHQLNLLGHAWR  682

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G+ +EL+ E ++ESCNL +VLRSIHVGLLCVQ+ P DRPSM  VV ML N+  L  
Sbjct  683  LFIEGKPLELISESIIESCNLFEVLRSIHVGLLCVQENPVDRPSMSYVVLMLGNEDALPQ  742

Query  243  AKKPGFFTGR-AIEAHISTVEITD-SVNEVTISLLNPR  136
             K+PGFFT R  IE   S+ +    S NE +ISLL  R
Sbjct  743  PKQPGFFTERDLIEVTYSSTQSKPYSANECSISLLEAR  780



>ref|XP_011030955.1| PREDICTED: uncharacterized protein LOC105130249 [Populus euphratica]
Length=1755

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             ++V   GY+SPEYA  G++S KSDVFSFGV VLEI++G RNRGF H DH+ NL  +AW+L
Sbjct  1599  RVVGTYGYISPEYAIDGLYSVKSDVFSFGVLVLEIMNGNRNRGFCHPDHHLNLLGHAWRL  1658

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
             + +GRS EL+ E + ESCNL++ LRSIHVGLLCVQ +P DRP M SVV MLS +  L   
Sbjct  1659  FTEGRSSELITEPIAESCNLSEALRSIHVGLLCVQCHPNDRPGMSSVVLMLSGEGKLPQP  1718

Query  240   KKPGFFTGRA-IEAHISTVEITD-SVNEVTISLLNPR  136
             K+PGFFT R  +EA+ S+++ T  SVN+ TI+LL  R
Sbjct  1719  KQPGFFTERTLVEANSSSIKNTSCSVNDSTITLLEAR  1755


 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 115/165 (70%), Gaps = 5/165 (3%)
 Frame = -1

Query  624  VENNN*QSK---IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDH  454
            VE N  +SK   +V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH
Sbjct  691  VEGNETESKTRKVVGTYGYISPEYAFHGLYSLKSDVFSFGVLVLEIVSGNRNRGFYHPDH  750

Query  453  YENLPSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQ  274
              NL  +AW L+ +GR +EL+ E  +E+CNL++VLR I +GLLCVQQ PEDRPS+  VV 
Sbjct  751  QLNLIGHAWTLFNEGRPLELIAEKTMETCNLSEVLRVIQLGLLCVQQSPEDRPSISYVVL  810

Query  273  MLSNDADLAIAKKPGFFTGRAI--EAHISTVEITDSVNEVTISLL  145
            ML N+ +L   K+PG+FT R +   +++ +     S N+ +ISL+
Sbjct  811  MLGNEDELPPPKQPGYFTARDVIESSNLPSQSKRYSTNDCSISLV  855



>ref|XP_011002473.1| PREDICTED: uncharacterized protein LOC105109448 [Populus euphratica]
Length=1666

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GYMSPEYA  G++S KSDVFSFGV V+EIVSG RNRGF H DH  NL  +AW 
Sbjct  1509  NRVVGTYGYMSPEYAIDGLYSIKSDVFSFGVLVIEIVSGSRNRGFYHPDHNLNLLGHAWG  1568

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ +GRS EL+ E + ESCNL +VLRSIHVGLLCVQ +P DRPSM SVV ML  +A L  
Sbjct  1569  LFTEGRSCELITETIKESCNLPEVLRSIHVGLLCVQCHPNDRPSMLSVVLMLCGEAKLPQ  1628

Query  243   AKKPGFFTGRA-IEAHISTVEITD-SVNEVTISLLNPR  136
              K+PGFFT RA +EA  S+ + T  SVN+ TI++L  R
Sbjct  1629  PKQPGFFTDRALLEASSSSKKNTSCSVNDSTITILEAR  1666


 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 2/155 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV +LEIVSG RNRGF H DH  NL  +AW+
Sbjct  668  NKVAGTYGYISPEYAKYGLYSLKSDVFSFGVLMLEIVSGYRNRGFCHPDHQLNLLGHAWR  727

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR +EL+   + E+C L +VLRSIH+GLLCVQ+  +DRP+M  VV ML N+ +L  
Sbjct  728  LFKEGRHVELVGGLIFETCKLPEVLRSIHIGLLCVQENAKDRPNMSQVVLMLGNEDELPQ  787

Query  243  AKKPGFFTGR-AIEA-HISTVEITDSVNEVTISLL  145
             K PGFFT R  IEA H  +     S N  ++SLL
Sbjct  788  PKHPGFFTERDLIEASHSLSQNKPCSANGCSVSLL  822



>emb|CAN77292.1| hypothetical protein VITISV_004596 [Vitis vinifera]
Length=149

 Score =   167 bits (422),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 7/155 (5%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V Y GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGF+H DH  NL  +AW L+
Sbjct  1    MVSYRGYMSPEYASEGLYSTKSDVFSFGVLVLEIVSGKRNRGFNHPDHDLNLLGHAWTLF  60

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
             + RS E +D  +   CNL++VLRSI++GLLCVQ++PEDRPSM+ VV ML  +  L   K
Sbjct  61   IEDRSSEFIDASMGNICNLSEVLRSINLGLLCVQRFPEDRPSMHYVVLMLGGEGALPQPK  120

Query  237  KPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
            +P FFT +  +EA+ S      S  + TI+LL  R
Sbjct  121  EPCFFTDKNMMEANSS------SGTQPTITLLEAR  149



>ref|XP_007099569.1| S-locus-specific glycoprotein S6, putative [Theobroma cacao]
 gb|EOY20462.1| S-locus-specific glycoprotein S6, putative [Theobroma cacao]
Length=168

 Score =   167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 111/152 (73%), Gaps = 2/152 (1%)
 Frame = -1

Query  585  SGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLYRDGR  406
            SGYMSPEYA  G+FS KSDVF FGV VLEIVSGK+NRGFSH DH  NL  +AW+L+ + R
Sbjct  17   SGYMSPEYAIDGVFSMKSDVFGFGVLVLEIVSGKKNRGFSHPDHDHNLLGHAWRLWTEKR  76

Query  405  SIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAKKPGF  226
             +EL+D+ L +    ++VLR IHVGLLCVQQ PEDRP+M S + ML +++ L   K+PGF
Sbjct  77   PMELIDDALGDFRLPSEVLRCIHVGLLCVQQRPEDRPNMSSAIVMLGSESALPQPKQPGF  136

Query  225  FTGRAI-EAH-ISTVEITDSVNEVTISLLNPR  136
            FTGR + EA   ++   + S NE T++LL PR
Sbjct  137  FTGRNLPEAESSTSNCKSSSANECTVTLLEPR  168



>ref|XP_008356167.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290, partial [Malus domestica]
Length=193

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 108/156 (69%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G +STKSDV+SFGV VLEIVSG RNRGFSH +H  NL  +AW L
Sbjct  38   KVVGTYGYMSPEYAIDGFYSTKSDVYSFGVLVLEIVSGXRNRGFSHPNHKLNLLGHAWML  97

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GR +ELLD  + +S  L +V+R+IHVGLLCVQ+ PEDRPSM + V MLS +  L   
Sbjct  98   HTEGRPLELLDTSVEDSITLLEVVRTIHVGLLCVQRNPEDRPSMSAAVLMLSGEGALPQP  157

Query  240  KKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             KPGF++ R + E   S      S NEVTIS+L  R
Sbjct  158  LKPGFYSERDLTELEASHSSKACSANEVTISVLEAR  193



>ref|XP_011015604.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=826

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  669  NKVAGTYGYISPEYANHGLYSLKSDVFSFGVLVLEIVSGNRNRGFIHPDHNLNLLGHAWR  728

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+ E LV +CNL++VLRSIHVGLLCVQ+ PEDRP+M +V  ML +D  L  
Sbjct  729  LFEENRPLELVAESLVIACNLSEVLRSIHVGLLCVQENPEDRPNMSNVALMLRDDDTLPQ  788

Query  243  AKKPGFFTGRAI-EA-HISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA H S++    SVNE +IS L PR
Sbjct  789  PKQPGFFTERDLTEARHSSSLSKPCSVNECSISELRPR  826



>ref|XP_011015606.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X4 [Populus euphratica]
Length=822

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  665  NKVAGTYGYISPEYANHGLYSLKSDVFSFGVLVLEIVSGNRNRGFIHPDHNLNLLGHAWR  724

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+ E LV +CNL++VLRSIHVGLLCVQ+ PEDRP+M +V  ML +D  L  
Sbjct  725  LFEENRPLELVAESLVIACNLSEVLRSIHVGLLCVQENPEDRPNMSNVALMLRDDDTLPQ  784

Query  243  AKKPGFFTGRAI-EA-HISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA H S++    SVNE +IS L PR
Sbjct  785  PKQPGFFTERDLTEARHSSSLSKPCSVNECSISELRPR  822



>ref|XP_011015605.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Populus euphratica]
Length=824

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  667  NKVAGTYGYISPEYANHGLYSLKSDVFSFGVLVLEIVSGNRNRGFIHPDHNLNLLGHAWR  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+ E LV +CNL++VLRSIHVGLLCVQ+ PEDRP+M +V  ML +D  L  
Sbjct  727  LFEENRPLELVAESLVIACNLSEVLRSIHVGLLCVQENPEDRPNMSNVALMLRDDDTLPQ  786

Query  243  AKKPGFFTGRAI-EA-HISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA H S++    SVNE +IS L PR
Sbjct  787  PKQPGFFTERDLTEARHSSSLSKPCSVNECSISELRPR  824



>ref|XP_010644282.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=1162

 Score =   180 bits (457),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GYMSPEYA  G+FS KSDV+SFGV VLEIVSGKRNRGF   DH+ NL  +AW+
Sbjct  1004  TRVVGTYGYMSPEYAVDGLFSVKSDVYSFGVLVLEIVSGKRNRGFCDPDHHLNLLGHAWR  1063

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             LYR GRSIEL D  + +SCN  +VL+SIHVGLLCVQQ P+DRPSM SVV ML ++  L  
Sbjct  1064  LYRKGRSIELTDASIQQSCNPLEVLQSIHVGLLCVQQSPDDRPSMSSVVMMLGSEIALPQ  1123

Query  243   AKKPGFFTG-RAIEAHISTVEITD--SVNEVTISLLNPR  136
              ++PGFF   R IEA  S+  I +  SVN++T++ L  R
Sbjct  1124  PREPGFFVARRMIEAADSSSGIYEPCSVNDITVTFLAAR  1162


 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 106/151 (70%), Gaps = 4/151 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW 
Sbjct  219  TKVVGTLGYISPEYASEGLYSVKSDVFSFGVMVLEIVSGKRNRGFSHPDHRLNLLGHAWT  278

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GR +EL+D  + ++   ++VLRSIHVGLLCVQ   +DRPSM SVV MLS++  L  
Sbjct  279  LYTEGRYLELMDAMVGDTFQPSEVLRSIHVGLLCVQHCADDRPSMSSVVLMLSSEVALPQ  338

Query  243  AKKPGFF----TGRAIEAHISTVEITDSVNE  163
             ++PGFF    + R   ++  T+    S+++
Sbjct  339  PREPGFFCDWNSSRNCRSYSDTITQAQSIDD  369



>ref|XP_010644302.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Vitis vinifera]
Length=773

 Score =   178 bits (451),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  620  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSFNLLGHAWTL  679

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  +L+QVLRSI+VGLLCVQ   +DRPSMYSVV MLS+D  L   
Sbjct  680  YMEGRSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQP  739

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFTGR  ++  S  +   S N VTI++L+ R
Sbjct  740  KEPGFFTGREAKSS-SGNQGPSSGNGVTITMLDGR  773



>ref|XP_004244166.2| PREDICTED: uncharacterized protein LOC101262029 [Solanum lycopersicum]
Length=2499

 Score =   181 bits (460),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  + + L
Sbjct  672  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHTYML  731

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+D  LV+SCN+++V RSIHVGLLCVQQ P DRPSM +V+ ML+N+  L  A
Sbjct  732  HKEGRSLELVDPKLVDSCNISEVQRSIHVGLLCVQQNPVDRPSMSTVIMMLTNEGILPSA  791

Query  240  KKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R I   +    + +   S+NEVTI+LL+ R
Sbjct  792  KHPGFFTERKIGEVDQFSWSTQTPSSINEVTITLLDAR  829


 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GY+SPEYA  G +S KSDVFSFG+ VLEIVSGK NR   H D+  NL  +AW 
Sbjct  2341  NRVVGTHGYLSPEYALYGKYSVKSDVFSFGILVLEIVSGKSNRKSCHPDYNLNLLGHAWN  2400

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             LY++GRS EL+DE L +SC+  +V+RSI VGLLCVQQ PEDRPSM S V ML+N+  L +
Sbjct  2401  LYKEGRSTELIDECLSDSCSTYEVVRSIGVGLLCVQQCPEDRPSMSSAVLMLNNEGLLPL  2460

Query  243   AKKPGFF  223
             AK+PGF+
Sbjct  2461  AKQPGFY  2467


 Score =   143 bits (360),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 103/146 (71%), Gaps = 5/146 (3%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             ++++   GY+SPEYA  G++S KSDV+SFG+ VLEIVSGK NR +S  +   +L  +AW+
Sbjct  1512  NRVIGTYGYLSPEYALYGLYSVKSDVYSFGILVLEIVSGKSNRRYSPSNLNHSLIGHAWE  1571

Query  423   LYRDGRSIELLDEHLVESCNLTQ-VLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
             L  +GRSIELLDEH+ +SC+  Q V+RSI VGLLCVQ+ P+DRPSM SVV ML+N+  L 
Sbjct  1572  LNNEGRSIELLDEHVGDSCSTPQEVVRSIGVGLLCVQERPDDRPSMSSVVLMLNNEGTLP  1631

Query  246   IAKKPGFFTGRAIEAHISTVEITDSV  169
              AK P F+    +E   S  E+  ++
Sbjct  1632  QAKLPAFY----MEGDASDTELLSTL  1653



>ref|XP_009769962.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana sylvestris]
Length=833

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDV+SFGV VLEI+SGKRNRGF H DH+ NL  + W 
Sbjct  681  TRVVGTYGYMSPEYAAEGKFSVKSDVYSFGVLVLEILSGKRNRGFFHPDHHHNLLGHVWI  740

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GRS+EL++ HL ES NL+QV RS HVGLLCVQ  PEDRP+M SV+ MLS+D  L +
Sbjct  741  LFREGRSLELINAHLRESSNLSQVQRSFHVGLLCVQHCPEDRPTMASVLLMLSSDIPLPL  800

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT        S+ +   SVNE++I++L+ R
Sbjct  801  PKEPGFFTK---AYSSSSTQGESSVNEISITMLDAR  833



>emb|CDP05413.1| unnamed protein product [Coffea canephora]
Length=1026

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GY+SPEYA  G FSTK DVFSFGV VLEIVSGK+NRGFSH DH+ NL  +AW L
Sbjct  666  RVVGTYGYISPEYAVDGYFSTKLDVFSFGVLVLEIVSGKKNRGFSHPDHHHNLLGHAWLL  725

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GR  EL+D+HL  SC+L +V+RSIHVGLLCVQQ P+DRPSM SVV ML+ D  L   
Sbjct  726  YKEGRCPELIDDHLSVSCHLYEVIRSIHVGLLCVQQSPDDRPSMSSVVFMLAGDGSLPFP  785

Query  240  KKPGFFTGRAI----EAHISTVEITDSVNEVTISLLNPR  136
            K+PG+FT R +    +   S  +   S N ++I+LL+ R
Sbjct  786  KEPGYFTERNLSFEPDKSSSGKKENSSGNALSITLLDAR  824



>ref|XP_009769963.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana sylvestris]
Length=826

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDV+SFGV VLEI+SGKRNRGF H DH+ NL  + W 
Sbjct  674  TRVVGTYGYMSPEYAAEGKFSVKSDVYSFGVLVLEILSGKRNRGFFHPDHHHNLLGHVWI  733

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GRS+EL++ HL ES NL+QV RS HVGLLCVQ  PEDRP+M SV+ MLS+D  L +
Sbjct  734  LFREGRSLELINAHLRESSNLSQVQRSFHVGLLCVQHCPEDRPTMASVLLMLSSDIPLPL  793

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT        S+ +   SVNE++I++L+ R
Sbjct  794  PKEPGFFTK---AYSSSSTQGESSVNEISITMLDAR  826



>ref|XP_010327263.1| PREDICTED: uncharacterized protein LOC101244232 [Solanum lycopersicum]
Length=1630

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 120/165 (73%), Gaps = 3/165 (2%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            E  +  +++V   GYMSPEYA  G+FS KSDVFSFGV +LEIVSGK+NR F H DH  NL
Sbjct  663  ETGDNTNRVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLILEIVSGKKNRRFIHPDHNLNL  722

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+R+GRS E++D +LVESC+ +++ RSIHVGLLCVQQ PEDRP+M SVV ML+N
Sbjct  723  IGHAWMLHREGRSSEIIDPNLVESCHTSELQRSIHVGLLCVQQSPEDRPNMSSVVLMLTN  782

Query  261  DADLAIAKKPGFFTGRAIE---AHISTVEITDSVNEVTISLLNPR  136
            +  L   K PGFFT R I+    +  + +   SVN+VT++LL+ R
Sbjct  783  EGILPQPKPPGFFTERNIDDATGYSWSDQTPCSVNDVTVTLLDAR  827


 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             +++   GYMSPEYA  G +S KSDVFS GV +LEIVSG++NR F H  H+ NL  +AW L
Sbjct  1473  RVIGTYGYMSPEYAVDGKYSVKSDVFSLGVLLLEIVSGRKNRKFHHLSHHHNLLGHAWLL  1532

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA-DLAI  244
               +G ++EL+DE L +S   +QVLR I V LLCVQ+ PEDRP+M S V  LSND  +L  
Sbjct  1533  LNEGNALELMDECLKDSYVESQVLRCIQVSLLCVQKLPEDRPTMASAVFWLSNDGVELPQ  1592

Query  243   AKKPGFFTGR--AIEAHISTVEITDSVNEVTISLLNPR  136
              K+PGFF  R    +++ ST E   + N++++++L  R
Sbjct  1593  PKQPGFFIERDSTNQSNESTDERCVTDNQLSLTILEAR  1630



>ref|XP_010644300.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Vitis vinifera]
Length=821

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  668  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSFNLLGHAWTL  727

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  +L+QVLRSI+VGLLCVQ   +DRPSMYSVV MLS+D  L   
Sbjct  728  YMEGRSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQP  787

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFTGR  ++  S  +   S N VTI++L+ R
Sbjct  788  KEPGFFTGREAKSS-SGNQGPSSGNGVTITMLDGR  821



>ref|XP_006370375.1| hypothetical protein POPTR_0001s42100g [Populus trichocarpa]
 gb|ERP66944.1| hypothetical protein POPTR_0001s42100g [Populus trichocarpa]
Length=771

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 114/151 (75%), Gaps = 2/151 (1%)
 Frame = -1

Query  582  GYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLYRDGRS  403
            GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+L+ + R 
Sbjct  621  GYISPEYANHGLYSLKSDVFSFGVLVLEIVSGNRNRGFIHPDHSLNLLGHAWRLFEENRP  680

Query  402  IELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAKKPGFF  223
            +EL++E LV +CNL++VLRSIHVGLLCVQ+ PEDRP+M +VV ML +D  L   K+PGFF
Sbjct  681  LELVEESLVIACNLSEVLRSIHVGLLCVQENPEDRPNMSNVVLMLRDDGTLPQPKQPGFF  740

Query  222  TGRAI-EA-HISTVEITDSVNEVTISLLNPR  136
            T R + EA + S++    SVNE +IS L PR
Sbjct  741  TERDLTEARYSSSLSKPCSVNECSISELRPR  771



>ref|XP_010644299.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Vitis vinifera]
Length=822

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  669  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSFNLLGHAWTL  728

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  +L+QVLRSI+VGLLCVQ   +DRPSMYSVV MLS+D  L   
Sbjct  729  YMEGRSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQP  788

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFTGR  ++  S  +   S N VTI++L+ R
Sbjct  789  KEPGFFTGREAKSS-SGNQGPSSGNGVTITMLDGR  822



>gb|KCW69725.1| hypothetical protein EUGRSUZ_F03110 [Eucalyptus grandis]
Length=144

 Score =   166 bits (419),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 107/147 (73%), Gaps = 3/147 (2%)
 Frame = -1

Query  576  MSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLYRDGRSIE  397
            MSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH+ NL  +AW+L+ +GRS++
Sbjct  1    MSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHHHNLLGHAWRLFTEGRSMQ  60

Query  396  LLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAKKPGFFTG  217
            LLD+ +  SC+ ++ LRSIH+GLLCVQ+   DRPSM +VV ML +D +L + K+PGFF  
Sbjct  61   LLDKLVQNSCSTSEALRSIHIGLLCVQRCLNDRPSMSTVVMMLGSDIELPLPKEPGFFNE  120

Query  216  RAIEAHISTVEITDSVNEVTISLLNPR  136
            R +   +         NE+T++LL  R
Sbjct  121  RNL---LQENPSQSQPNEITMTLLFAR  144



>ref|XP_002317544.2| hypothetical protein POPTR_0011s13180g [Populus trichocarpa]
 gb|EEE98156.2| hypothetical protein POPTR_0011s13180g [Populus trichocarpa]
Length=832

 Score =   177 bits (450),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GY+SPEYA  G++S KSDVFSFGV VLEIV+G RNR F H DH  NL  +AW+L
Sbjct  676  RVVGTYGYISPEYAIDGIYSVKSDVFSFGVLVLEIVNGNRNRRFCHPDHNLNLLGHAWRL  735

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GRS EL+ E + ESCNL++ LRSIHVGLLCVQ +P DRPSM SVV MLS +  L   
Sbjct  736  FTEGRSSELITEPIAESCNLSEALRSIHVGLLCVQCHPNDRPSMSSVVLMLSGEGKLPQP  795

Query  240  KKPGFFTGRA-IEAHISTVEIT-DSVNEVTISLLNPR  136
            K+PGFFT R  +EA+ S+ + T  SVN+ TI+LL  R
Sbjct  796  KQPGFFTERTLVEANSSSAKNTLCSVNDSTITLLEAR  832



>gb|EYU33576.1| hypothetical protein MIMGU_mgv1a003061mg [Erythranthe guttata]
Length=611

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 113/157 (72%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFSH D   NL  +AW L
Sbjct  455  RVVGTYGYMAPEYAVDGLFSVKSDVFSFGVLVLEIVSGKRNRGFSHNDSNLNLLGHAWTL  514

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRSI+LLD  + +S +  +V RSIHVGLLCVQQ  EDRP+M SVV ML N+   A A
Sbjct  515  YKEGRSIDLLDTTVGDSFHSAEVTRSIHVGLLCVQQNVEDRPNMSSVVLMLGNEGVFAQA  574

Query  240  KKPGFFTGRAIEAHISTVEIT--DSVNEVTISLLNPR  136
            K+PGFFT R + A  S+      +S N+VTI++L  R
Sbjct  575  KQPGFFTERDVLAARSSTSTNAPNSTNDVTITMLAGR  611



>emb|CBI20426.3| unnamed protein product [Vitis vinifera]
Length=1901

 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GYMSPEYA  G+FS KSDV+SFGV VLEIVSGKRNRGF   DH+ NL  +AW+
Sbjct  1743  TRVVGTYGYMSPEYAVDGLFSVKSDVYSFGVLVLEIVSGKRNRGFCDPDHHLNLLGHAWR  1802

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             LYR GRSIEL D  + +SCN  +VL+SIHVGLLCVQQ P+DRPSM SVV ML ++  L  
Sbjct  1803  LYRKGRSIELTDASIQQSCNPLEVLQSIHVGLLCVQQSPDDRPSMSSVVMMLGSEIALPQ  1862

Query  243   AKKPGFFTG-RAIEAHISTVEITD--SVNEVTISLLNPR  136
              ++PGFF   R IEA  S+  I +  SVN++T++ L  R
Sbjct  1863  PREPGFFVARRMIEAADSSSGIYEPCSVNDITVTFLAAR  1901


 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 4/146 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW 
Sbjct  533  TKVVGTLGYISPEYASEGLYSVKSDVFSFGVMVLEIVSGKRNRGFSHPDHRLNLLGHAWT  592

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GR +EL+D  + ++   ++VLRSIHVGLLCVQ   +DRPSM SVV MLS++  L  
Sbjct  593  LYTEGRYLELMDAMVGDTFQPSEVLRSIHVGLLCVQHCADDRPSMSSVVLMLSSEVALPQ  652

Query  243  AKKPGFF----TGRAIEAHISTVEIT  178
             ++PGFF    + R   ++  T  IT
Sbjct  653  PREPGFFCDWNSSRNCRSYSGTEAIT  678


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDH  454
             ++V   GYM PE A  G++S KSDVFSFGV VLEIV+GKRNRGFSH D 
Sbjct  1046  RLVGTFGYMPPENASEGLYSLKSDVFSFGVLVLEIVTGKRNRGFSHPDR  1094



>ref|XP_007021196.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12721.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=1098

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGFSH DH  NL  +AW+
Sbjct  118  NKVVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSGKKNRGFSHPDHDHNLLGHAWR  177

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+DE L + C  ++V R IHVGLLCVQQ PEDRP+M  V+ ML +++ L  
Sbjct  178  LWTERRPMELIDETLRDFCLPSEVQRCIHVGLLCVQQRPEDRPNMSFVIVMLGSESALPQ  237

Query  243  AKKPGFFTGRAI-EAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFTGR + EA  ST      S NE T++LL PR
Sbjct  238  PKQPGFFTGRNLPEAESSTSNCKLSSANECTVTLLEPR  275


 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +K+V   GYMSPEYA  G+FS KSDVF  GV VLEIVSGK+NRGFSH DH  NL  +AWK
Sbjct  1038  NKVVGTYGYMSPEYAIDGVFSMKSDVFGIGVLVLEIVSGKKNRGFSHPDHDHNLLGHAWK  1097

Query  423   L  421
             L
Sbjct  1098  L  1098



>ref|XP_009787422.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Nicotiana sylvestris]
Length=717

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSY---AW  427
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGFSH     NL  +   AW
Sbjct  562  VVGTHGYMSPEYVVDGVFSIKSDVFSFGVLVLEIISGRRNRGFSHGSRNINLLGHVRPAW  621

Query  426  KLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
            +LY++GR++EL+D HL +SC  +++LR IHV LLCVQQ PEDRP M +VV +L+NDA L 
Sbjct  622  RLYKEGRTLELIDVHLTDSCYFSELLRLIHVALLCVQQRPEDRPDMSAVVMILANDAVLP  681

Query  246  IAKKPGFFTG-RAIEAHISTVEITDSVNEVTISLLNPR  136
             AK+PGFFTG +  ++  S+ + T   NEVTI+ L+PR
Sbjct  682  QAKEPGFFTGSKFTDSDYSSTKYT--TNEVTITQLDPR  717



>ref|XP_009361788.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=225

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G +S KSDV+SFGV VLEIVSG RNRGFSH DH  NL  +AW L
Sbjct  70   KVVGTYGYMSPEYAIDGFYSIKSDVYSFGVLVLEIVSGSRNRGFSHPDHKLNLLGHAWML  129

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GR +ELLD  + +S  L +V+R+IHVGLLCVQQ PEDRPSM + V MLS +  L   
Sbjct  130  HTEGRPLELLDSSVEDSITLLEVVRTIHVGLLCVQQNPEDRPSMSATVLMLSGEGALPQP  189

Query  240  KKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             KPGF++ R + E          S NEVTIS+L  R
Sbjct  190  LKPGFYSERDLTELEAGHSSKACSANEVTISVLEAR  225



>emb|CBI20456.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  251  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSFNLLGHAWTL  310

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  +L+QVLRSI+VGLLCVQ   +DRPSMYSVV MLS+D  L   
Sbjct  311  YMEGRSMELIDTSVGDMHDLSQVLRSINVGLLCVQCSLDDRPSMYSVVLMLSSDGALPQP  370

Query  240  KKPGFFTGRAIEA  202
            K+PGFFTGR  ++
Sbjct  371  KEPGFFTGREAKS  383



>ref|XP_009787420.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana sylvestris]
Length=811

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSY---AW  427
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGFSH     NL  +   AW
Sbjct  656  VVGTHGYMSPEYVVDGVFSIKSDVFSFGVLVLEIISGRRNRGFSHGSRNINLLGHVRPAW  715

Query  426  KLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
            +LY++GR++EL+D HL +SC  +++LR IHV LLCVQQ PEDRP M +VV +L+NDA L 
Sbjct  716  RLYKEGRTLELIDVHLTDSCYFSELLRLIHVALLCVQQRPEDRPDMSAVVMILANDAVLP  775

Query  246  IAKKPGFFTG-RAIEAHISTVEITDSVNEVTISLLNPR  136
             AK+PGFFTG +  ++  S+ + T   NEVTI+ L+PR
Sbjct  776  QAKEPGFFTGSKFTDSDYSSTKYT--TNEVTITQLDPR  811



>ref|XP_010324340.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=829

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 115/158 (73%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NR F H DH+ NL  +AW L
Sbjct  672  RVVGTYGYMSPEYAVEGIFSVKSDVFSFGVLVLEIVSGKKNRRFVHPDHHLNLLGHAWML  731

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D +LV+S  +++VLRS+HVGLLCVQQ PEDRP+M +V+ MLSN+  L + 
Sbjct  732  HNEERMLELVDPYLVDSYYISEVLRSVHVGLLCVQQNPEDRPNMSTVIMMLSNEGILPLP  791

Query  240  KKPGFFTGRA---IEAHISTVEITDSVNEVTISLLNPR  136
            K PGFFT R    I+    + +   S+NE+TI+ LN R
Sbjct  792  KHPGFFTERKVKDIDQFSWSTQTPSSINEITITQLNAR  829



>emb|CDP05828.1| unnamed protein product [Coffea canephora]
Length=818

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 110/156 (71%), Gaps = 3/156 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++    GYMSPEYA  G FS KSDVFSFGV++LEIVSG++N  F H  H+ +L  +AWKL
Sbjct  665  RVAGTYGYMSPEYAMQGRFSVKSDVFSFGVTILEIVSGQKNNAFVHPGHHHSLLGHAWKL  724

Query  420  YRDGRSIELLDEHLVESCN-LTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            Y++GRS+EL+DE L   C  LT VLRSIHVGLLCVQQYPEDRP+M +VV ML N+  L  
Sbjct  725  YKEGRSLELVDESLGNYCTCLTDVLRSIHVGLLCVQQYPEDRPNMSAVVMMLGNEGALPQ  784

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            A +PGFF  R      S   +  S N++TI++L PR
Sbjct  785  AHQPGFFAER--NESCSAACVASSQNDMTITILEPR  818



>ref|XP_011030927.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++STKSDVFSFGV VLEIVSG +NRGFSH DH  NL  +AW+
Sbjct  667  NKVVGTYGYISPEYAFDGLYSTKSDVFSFGVLVLEIVSGNKNRGFSHPDHQLNLLGHAWR  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G+  E++ E ++ESCNL +VLRSIHVGLLCVQ+ P DRPSM  VV ML N+  L  
Sbjct  727  LFIEGKPSEVISESIIESCNLFEVLRSIHVGLLCVQENPTDRPSMSYVVLMLGNEDALPK  786

Query  243  AKKPGFFTGR-AIEAHISTVEITD-SVNEVTISLLNPR  136
             K+PGFFT R  IE   S+ +    S NE +ISLL  R
Sbjct  787  PKQPGFFTERDLIEVTYSSTQSKPYSANECSISLLEAR  824



>ref|XP_011002477.1| PREDICTED: uncharacterized protein LOC105109453 [Populus euphratica]
Length=1802

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  1645  NKVAGTYGYISPEYANHGLYSLKSDVFSFGVLVLEIVSGNRNRGFIHPDHNLNLLGHAWR  1704

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ + R +EL+ E LV +CNL++VLRSIHVGLLCVQ+ PEDRP+M +V  ML +D  L  
Sbjct  1705  LFEENRPLELVAESLVIACNLSEVLRSIHVGLLCVQENPEDRPNMSNVALMLRDDDTLPQ  1764

Query  243   AKKPGFFTGRAI-EA-HISTVEITDSVNEVTISLLNPR  136
              K+PGFFT R + EA H S++    SVNE +IS L PR
Sbjct  1765  PKQPGFFTERDLTEARHSSSLSKPCSVNECSISELRPR  1802


 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPE A  G++S KSD+FSFGV VLEIVSG +NRGFSH DH+ NL  +AW 
Sbjct  672  NKVVGTYGYISPECANYGLYSVKSDIFSFGVLVLEIVSGNKNRGFSHPDHHLNLLGHAWI  731

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++ RS+EL  + +  +CNL++VLRSIHVGLLCVQ+ PE RP+M +VV ML ND  L  
Sbjct  732  LFKENRSLELAADSIAITCNLSEVLRSIHVGLLCVQENPEMRPTMSNVVLMLGNDDVLPQ  791

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             ++PGFFT R +   +  S++    SVNE ++S L PR
Sbjct  792  PEQPGFFTEREVIGASCPSSLGKPCSVNECSVSELEPR  829



>ref|XP_010062920.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Eucalyptus grandis]
Length=820

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFS+GV VLE VSGKRNRGF H DH  NL  +AW+L
Sbjct  667  RVVGTYGYMSPEYAIDGVFSIKSDVFSYGVLVLETVSGKRNRGFCHPDHCHNLVGHAWRL  726

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + RS+EL+DE LVES N  +VLRSIHV LLCVQQ PEDRPSM +++ ML +D +L + 
Sbjct  727  FTEDRSMELVDE-LVESYNTAEVLRSIHVALLCVQQCPEDRPSMSALILMLGSDNELPLP  785

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGF+  R +    +   +  S NEVT++ L+PR
Sbjct  786  KEPGFYNERKLLPENTFGHLVHSPNEVTMTSLSPR  820



>ref|XP_006370372.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa]
 gb|ERP66941.1| hypothetical protein POPTR_0001s42070g [Populus trichocarpa]
Length=773

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 115/157 (73%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G+FS KSDVFSFGV VLEIV+GKRNRGF H DH  NL  +AW+L
Sbjct  617  RVVGTYGYMAPEYAIDGLFSIKSDVFSFGVLVLEIVNGKRNRGFCHPDHKHNLLGHAWRL  676

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++ +S EL+DE L  +C+L++V+R I VGLLCVQQ PEDRP+M +VV ML+++  L   
Sbjct  677  YKEQKSFELIDESLNNTCDLSEVMRVIQVGLLCVQQAPEDRPTMSTVVLMLTSNITLPEP  736

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +  +   S+   + S NE+TI+LL  R
Sbjct  737  KEPGFFTERKLFDQESSSSKVDSCSANEITITLLTAR  773



>gb|KDP38980.1| hypothetical protein JCGZ_00737 [Jatropha curcas]
Length=827

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G++S KSDVFSFGV VLEIVSGKRNRGFSH+DH  NL  +AW+
Sbjct  668  NKVVGTYGYMSPEYAIEGIYSVKSDVFSFGVIVLEIVSGKRNRGFSHEDHDLNLLGHAWQ  727

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GRSIEL+D  L  S NL++VLRS+HVGLLCVQ   EDRPSM +VV ML ++  L  
Sbjct  728  LHKEGRSIELIDTSLRNSYNLSEVLRSVHVGLLCVQGSIEDRPSMSAVVYMLGSEGALPE  787

Query  243  AKKPGFFTGR---AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K PGFFT R    +EA+ +T + T  S N +TI++L+ R
Sbjct  788  PKLPGFFTERDLIELEANSTTRKHTASSTNGLTITVLDAR  827



>ref|XP_010064917.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
 gb|KCW70071.1| hypothetical protein EUGRSUZ_F03374 [Eucalyptus grandis]
Length=837

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  685  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFRHPDHDHNLLGHAWR  744

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P DRPSM +VV ML +D +L +
Sbjct  745  LFTEGRSMQLLDKLVQNSCSTSEALRSIHIGLLCVQRCPNDRPSMSAVVMMLGSDIELPL  804

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            +K+PGFF  R +   +         NE+T++LL+ R
Sbjct  805  SKEPGFFNERNL---LQENPSQSQPNEITMTLLSAR  837



>ref|XP_002317551.2| hypothetical protein POPTR_0011s13260g [Populus trichocarpa]
 gb|EEE98163.2| hypothetical protein POPTR_0011s13260g [Populus trichocarpa]
Length=794

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF H  H  NL  +AWKL
Sbjct  638  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNRGFHHPGHQLNLLGHAWKL  697

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR++EL+D+ +VE+CN  +V RSIH+GLLCVQ  P DRPSM +VV ML  +  LA  
Sbjct  698  FKEGRALELVDDLIVETCNQNEVTRSIHIGLLCVQHSPGDRPSMSTVVLMLGGEGTLAQP  757

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             +PGF+T R +   +  S+ + + SVNEVT++L++ R
Sbjct  758  NEPGFYTERKLIDASSSSSKQESCSVNEVTVTLIDAR  794



>gb|KCW70067.1| hypothetical protein EUGRSUZ_F03370 [Eucalyptus grandis]
Length=864

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFS+GV VLE VSGKRNRGF H DH  NL  +AW+L
Sbjct  711  RVVGTYGYMSPEYAIDGVFSIKSDVFSYGVLVLETVSGKRNRGFCHPDHCHNLVGHAWRL  770

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + RS+EL+DE LVES N  +VLRSIHV LLCVQQ PEDRPSM +++ ML +D +L + 
Sbjct  771  FTEDRSMELVDE-LVESYNTAEVLRSIHVALLCVQQCPEDRPSMSALILMLGSDNELPLP  829

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGF+  R +    +   +  S NEVT++ L+PR
Sbjct  830  KEPGFYNERKLLPENTFGHLVHSPNEVTMTSLSPR  864



>ref|XP_009607317.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009607318.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=810

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 115/158 (73%), Gaps = 6/158 (4%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSY---AW  427
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SGKRNRGFSH     NL  +   AW
Sbjct  655  VVGTHGYMSPEYVVDGVFSIKSDVFSFGVLVLEIISGKRNRGFSHGSRNINLLGHVRPAW  714

Query  426  KLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
            +LY++GR++EL+D HL +SC  +++LR IHV LLCVQQ PE+RP M +VV ML+NDA L 
Sbjct  715  RLYKEGRTLELIDVHLTDSCYFSELLRLIHVALLCVQQRPENRPDMSTVVVMLANDAVLP  774

Query  246  IAKKPGFFTG-RAIEAHISTVEITDSVNEVTISLLNPR  136
             AK+PGFFTG +  ++  S+ + T   NEVT + L+PR
Sbjct  775  QAKEPGFFTGSKFTDSDYSSTKYT--TNEVTFTQLDPR  810



>gb|EYU33571.1| hypothetical protein MIMGU_mgv1a020014mg [Erythranthe guttata]
Length=808

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFSH+DH  NL  +AW 
Sbjct  651  SRVVGTYGYMSPEYAIDGVFSVKSDVFSFGVLVLEIVSGKRNRGFSHRDHRLNLLGHAWM  710

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+ RS+EL+D +L+ S  L +VLRSI VGLLCVQ+ PEDRP+M +VV MLSN+  L  
Sbjct  711  LHREERSLELVDSYLINSGYLREVLRSIEVGLLCVQERPEDRPNMSTVVFMLSNECVLPE  770

Query  243  AKKPGFFTGR  214
            AK PGFFTGR
Sbjct  771  AKHPGFFTGR  780



>emb|CBI20441.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 112/157 (71%), Gaps = 7/157 (4%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEI+SGKRNRGF+H DH  NL  +AW 
Sbjct  72   TRVAGTLGYMSPEYASEGLYSTKSDVFSFGVLVLEIISGKRNRGFNHPDHELNLLGHAWT  131

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GRS E +D  +V +CNL++VLRSI++GLLCVQ++P DRP+M+SVV +L ++  L  
Sbjct  132  LYIEGRSSEFIDASIVNTCNLSEVLRSINLGLLCVQRFPYDRPNMHSVVLLLGSEGALYQ  191

Query  243  AKKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             K+P FF  R  +EA+ S      S  + TI+ L  R
Sbjct  192  PKEPCFFIDRNMMEANSS------SSTQCTITQLEAR  222



>ref|XP_006370380.1| hypothetical protein POPTR_0001s42140g [Populus trichocarpa]
 gb|ERP66949.1| hypothetical protein POPTR_0001s42140g [Populus trichocarpa]
Length=821

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSD+FSFGV VLEIVSG +NRGFSH DH+ NL  +AW 
Sbjct  664  NKVAGTYGYISPEYANYGLYSVKSDIFSFGVLVLEIVSGNKNRGFSHPDHHLNLLGHAWI  723

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++ RS+EL  + +V +CNL++VLRSIHVGLLCVQ+ PE RP+M +VV ML ND  L  
Sbjct  724  LFKENRSLELAADSIVITCNLSEVLRSIHVGLLCVQENPEIRPTMSNVVLMLGNDDVLPQ  783

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +   ++ S++    SVNE ++S L PR
Sbjct  784  PKQPGFFTERDVIGASYSSSLSKPCSVNECSVSELEPR  821



>gb|KCW44740.1| hypothetical protein EUGRSUZ_L01708 [Eucalyptus grandis]
Length=688

 Score =   174 bits (442),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEI+SGKRNRGF H DH+ NL  +AW+
Sbjct  536  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISGKRNRGFHHPDHHHNLLGHAWR  595

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS +LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  596  LFTEGRSTQLLDKLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  655

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  656  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  688



>ref|XP_009355541.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Pyrus x bretschneideri]
Length=813

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF HQ+H +NL  +AWK
Sbjct  661  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHQNHSQNLVGHAWK  720

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  L  SC L++ LR IHV LLC Q +PEDRP+M SVV ML ++  LA 
Sbjct  721  LWNEGRPLELIDTCLASSCMLSEALRCIHVSLLCAQHHPEDRPNMASVVIMLGSEIALAH  780

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT   +E+H +  + + S NE++ISLL PR
Sbjct  781  PKQPGFFT--KMESHEAGNQ-SSSTNEISISLLEPR  813



>ref|XP_009355538.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
Length=825

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF HQ+H +NL  +AWK
Sbjct  673  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHQNHSQNLVGHAWK  732

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  L  SC L++ LR IHV LLC Q +PEDRP+M SVV ML ++  LA 
Sbjct  733  LWNEGRPLELIDTCLASSCMLSEALRCIHVSLLCAQHHPEDRPNMASVVIMLGSEIALAH  792

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT   +E+H +  + + S NE++ISLL PR
Sbjct  793  PKQPGFFT--KMESHEAGNQ-SSSTNEISISLLEPR  825



>ref|XP_011002478.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109454 
[Populus euphratica]
Length=1646

 Score =   177 bits (450),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 116/157 (74%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIV+GKRNRGF H +H  NL  +AW+L
Sbjct  661  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVNGKRNRGFFHPEHKHNLLGHAWRL  720

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++ +S EL+DE L  +C+L++VLR IHVGLLCVQQ PEDRP+M +VV ML+++  L   
Sbjct  721  YKEQKSFELIDESLNNTCDLSEVLRVIHVGLLCVQQAPEDRPTMSTVVLMLTSNITLPEP  780

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +  +   S+   + S NE+TI+LL  R
Sbjct  781  KEPGFFTERKLFDQESSSSKVDSCSANEITITLLTAR  817


 Score =   173 bits (439),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             S+IV   GYMSPEYA  G+FS KSDVFSFGV VLEIVSG++NRGF H +H  NL  +AW 
Sbjct  1489  SRIVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFRHAEHKLNLLGHAWM  1548

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+++GR ++L+DE +V+SC +++V RSI V LLCVQ+ PEDRP M +VV MLS+D  L  
Sbjct  1549  LHKEGRPLDLIDESIVDSCIISEVSRSIEVALLCVQKSPEDRPKMSTVVLMLSSDIVLPQ  1608

Query  243   AKKPGFFTGRAIEAHISTV---EITDSVNEVTISLLNPR  136
              K+PGFFT R + +  S+    EI+ SVNE+T +LL  R
Sbjct  1609  PKEPGFFTERDLSSDPSSTIKHEIS-SVNELTSTLLEAR  1646



>ref|XP_009355540.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
Length=824

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF HQ+H +NL  +AWK
Sbjct  672  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHQNHSQNLVGHAWK  731

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  L  SC L++ LR IHV LLC Q +PEDRP+M SVV ML ++  LA 
Sbjct  732  LWNEGRPLELIDTCLASSCMLSEALRCIHVSLLCAQHHPEDRPNMASVVIMLGSEIALAH  791

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT   +E+H +  + + S NE++ISLL PR
Sbjct  792  PKQPGFFT--KMESHEAGNQ-SSSTNEISISLLEPR  824



>ref|XP_002317548.1| hypothetical protein POPTR_0011s13230g [Populus trichocarpa]
 gb|EEE98160.1| hypothetical protein POPTR_0011s13230g [Populus trichocarpa]
Length=777

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K++   GY+SPEYA  G++STKSDVFSFGV VLEIVSG RNRGFSH DH  NL  +AW+
Sbjct  620  NKVMGTYGYISPEYAFDGLYSTKSDVFSFGVLVLEIVSGNRNRGFSHPDHQLNLLGHAWR  679

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G+ +EL+ E ++ESCNL +VLRSIH+GLLCVQ+ P DRP M  VV ML N+  L  
Sbjct  680  LFLEGKPLELVSESIIESCNLFEVLRSIHMGLLCVQENPVDRPGMSYVVLMLENEDALPQ  739

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +    + ST     S N+ +ISLL  R
Sbjct  740  PKQPGFFTERDLVEVTYSSTQSKPYSANDCSISLLEAR  777



>ref|XP_002317538.2| hypothetical protein POPTR_0011s13000g, partial [Populus trichocarpa]
 gb|EEE98150.2| hypothetical protein POPTR_0011s13000g, partial [Populus trichocarpa]
Length=655

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S  SDVFSFGV VLEIVSGKRNRGF H DH+ NL  +AWK
Sbjct  498  NKVAGTFGYISPEYANYGLYSLNSDVFSFGVLVLEIVSGKRNRGFCHPDHHLNLLGHAWK  557

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++ RS+EL  E  V +CNL++VLRSIHVGLLCVQ+ PEDRP+M +VV ML N+ +L  
Sbjct  558  LFKENRSVELAAESFVITCNLSEVLRSIHVGLLCVQEDPEDRPNMSNVVLMLGNEDELPH  617

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             ++PGFF  R +   A+ S+     S NE +IS L  R
Sbjct  618  PRQPGFFFERDLIEAAYSSSPSKPCSANECSISELEQR  655



>gb|KDP38981.1| hypothetical protein JCGZ_00738 [Jatropha curcas]
Length=691

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -1

Query  594  VKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLYR  415
            +  SGYMSPEYA  G++STKSDV+SFGV V EIVSGKRNRGFSH +H  NL  +AW+L+ 
Sbjct  537  ISCSGYMSPEYAVDGLYSTKSDVYSFGVIVPEIVSGKRNRGFSHPEHNLNLLGHAWRLHM  596

Query  414  DGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAKK  235
            +GRS E++D  +  SCNL +VLRSIH+GLLCVQ+ PEDRPSM SVV ML  +  L   K+
Sbjct  597  EGRSHEMIDALIENSCNLIEVLRSIHIGLLCVQRSPEDRPSMSSVVFMLGGEGALPEPKQ  656

Query  234  PGFFTGRAIEA--HISTVEITDSVNEVTISLLNPR  136
            PGFF  R I A  + S    + S N +T++LL  R
Sbjct  657  PGFFNEREISAANYSSNNHDSSSANGLTVTLLEAR  691



>ref|XP_008363600.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Malus domestica]
Length=191

 Score =   164 bits (416),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G FS KSDVFSFG+ +LE +SGKR+RGF   +H  NL  +AW+L
Sbjct  25   RVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSGKRSRGFYDPNHNHNLIGHAWRL  84

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+DE+L +SC+L++VLR IHV LLCVQQ PEDRP+M SVV ML  ++ L   
Sbjct  85   WKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGESALPQP  144

Query  240  KKPGFFTGR  214
            KKPG F G+
Sbjct  145  KKPGLFIGK  153



>ref|XP_010040971.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=814

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEI+SGKRNRGF H DH+ NL  +AW+
Sbjct  662  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISGKRNRGFHHPDHHHNLLGHAWR  721

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS +LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  722  LFTEGRSTQLLDKLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  781

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  782  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  814



>ref|XP_011030922.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=864

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+SGKRNRGF H  H  NL  +AWKL
Sbjct  708  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIISGKRNRGFHHSGHQLNLLGHAWKL  767

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR++EL+D+ +VE+CN  +V+RSIH+GLLCVQ  P DRPSM +VV MLS +  LA  
Sbjct  768  FKEGRALELVDDLIVETCNQNEVMRSIHIGLLCVQHSPGDRPSMSTVVLMLSGEGTLAQP  827

Query  240  KKPGFFTGRA-IEAH-ISTVEITDSVNEVTISLLNPR  136
             +PGF+  R  I+A+  S+ + + SVNEV+++L++ R
Sbjct  828  NEPGFYIERKLIDANSSSSKQESCSVNEVSVTLIDAR  864



>ref|XP_002317541.2| hypothetical protein POPTR_0011s13150g [Populus trichocarpa]
 gb|EEE98153.2| hypothetical protein POPTR_0011s13150g [Populus trichocarpa]
Length=664

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+L
Sbjct  509  KVAGTYGYISPEYAIEGLYSVKSDVFSFGVLVLEIVSGYKNRGFSHPEHNLNLLGHAWRL  568

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +R+GRS+EL+ + ++E CNL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L   
Sbjct  569  FREGRSMELVRQSIIEVCNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNTLPQP  628

Query  240  KKPGFFTGRAIEAHISTVEIT-DSVNEVTISLLNPR  136
            K PGFF  R      ST E T DS N+ +I++L  R
Sbjct  629  KHPGFFIERDPAEASSTSEGTADSANKCSITVLQAR  664



>ref|XP_006377813.1| hypothetical protein POPTR_0011s13170g [Populus trichocarpa]
 gb|ERP55610.1| hypothetical protein POPTR_0011s13170g [Populus trichocarpa]
Length=751

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+L
Sbjct  596  KVAGTYGYISPEYAIEGLYSVKSDVFSFGVLVLEIVSGYKNRGFSHPEHSLNLLGHAWRL  655

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +RDGR +EL+ + ++E+CNL+QVLRSIHV LLCVQ   EDRP M  VV ML ND  L   
Sbjct  656  FRDGRPMELVRQSIIEACNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLINDNTLPQP  715

Query  240  KKPGFFTGRAIEAHISTVEITD-SVNEVTISLLNPR  136
            K PGFF  R      ST E T  S N+ +I+LL PR
Sbjct  716  KHPGFFIERDPAEASSTGESTAYSANKCSITLLQPR  751



>ref|XP_007021210.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12735.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=812

 Score =   174 bits (442),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 116/166 (70%), Gaps = 12/166 (7%)
 Frame = -1

Query  624  VENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYEN  445
            V N N   ++V   GYMSPEYA  G+FS KSDVFSFGV +LEI+ GKRNRGF H DHY N
Sbjct  656  VANTN---RVVGTYGYMSPEYAIDGLFSAKSDVFSFGVLLLEILCGKRNRGFHHSDHYLN  712

Query  444  LPSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLS  265
            L  +AW+L+ + R ++L+DE L+ +C +++VLR IHVGLLCVQQ PEDRP+M SVV ML 
Sbjct  713  LLGHAWRLWMNERPLDLIDEFLLNNCAVSEVLRCIHVGLLCVQQLPEDRPNMASVVLMLG  772

Query  264  NDADLAIAKKPGFFTGR---AIEAHISTVEITDSVNEVTISLLNPR  136
            +D  L   K+PGF+T R    IE+       + SVNE+T +L+  R
Sbjct  773  SDNSLPQPKQPGFYTERNPLGIESS------SYSVNEITSTLVKAR  812



>emb|CDP05835.1| unnamed protein product [Coffea canephora]
Length=803

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 110/157 (70%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM PEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AWK
Sbjct  647  NRVVGTHGYMPPEYAVDGIFSVKSDVFSFGVIVLEIVSGKRNRGFLHHDHQFNLLGHAWK  706

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++GR +EL+D HL +S N  QVLRSI VGLLCVQ  P+DRP M S + ML ND  L  
Sbjct  707  LYKEGRELELVDLHLGDSYNSLQVLRSIQVGLLCVQHGPDDRPDMSSAIFMLGNDGVLPE  766

Query  243  AKKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
            AK PGFF  R  +  H S+ + + S  E+T++LL  R
Sbjct  767  AKHPGFFMERNVVNEHSSSTQTSSSRGEITMTLLEAR  803



>ref|XP_006356899.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Solanum tuberosum]
Length=819

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYAG G FS KSDVFSFGV VLEI+S KRNRGF H DH  NL  + W L
Sbjct  662  RVVGTYGYMSPEYAGEGKFSVKSDVFSFGVLVLEILSRKRNRGFFHPDHNHNLLGHVWIL  721

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ R +E++D  L +SCN ++V RS HV LLCVQQ PEDRPSM SVV ML +D  L + 
Sbjct  722  FKESRVMEVIDAQLRQSCNQSEVQRSAHVSLLCVQQCPEDRPSMASVVLMLGSDGSLPLP  781

Query  240  KKPGFFTGR--AIEAHISTVEITD-SVNEVTISLLNPR  136
            K+PGFF GR  + EA  S+ +  + SVNE++I+ L+ R
Sbjct  782  KEPGFFNGRSQSTEADTSSSKHGETSVNELSITQLDAR  819



>ref|XP_004238057.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=799

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G FS KSDVFSFGV VLEI+SG+RNRGF+ +    NL  + WKLY
Sbjct  648  VVGTHGYMSPEYVVHGEFSVKSDVFSFGVLVLEIISGRRNRGFAGESQSINLLGHVWKLY  707

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR +EL+D HL++S  ++++LR IHV LLCVQQ PEDRP M +V+ ML+NDA L  AK
Sbjct  708  KEGRPLELIDGHLMDSRFISELLRLIHVALLCVQQCPEDRPDMPTVILMLTNDAILPQAK  767

Query  237  KPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT   + +  ST     S NE+T++LL PR
Sbjct  768  EPGFFTESKVTSECSTSMC--STNEITLTLLQPR  799



>ref|XP_006356900.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Solanum tuberosum]
Length=817

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYAG G FS KSDVFSFGV VLEI+S KRNRGF H DH  NL  + W L
Sbjct  660  RVVGTYGYMSPEYAGEGKFSVKSDVFSFGVLVLEILSRKRNRGFFHPDHNHNLLGHVWIL  719

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ R +E++D  L +SCN ++V RS HV LLCVQQ PEDRPSM SVV ML +D  L + 
Sbjct  720  FKESRVMEVIDAQLRQSCNQSEVQRSAHVSLLCVQQCPEDRPSMASVVLMLGSDGSLPLP  779

Query  240  KKPGFFTGR--AIEAHISTVEITD-SVNEVTISLLNPR  136
            K+PGFF GR  + EA  S+ +  + SVNE++I+ L+ R
Sbjct  780  KEPGFFNGRSQSTEADTSSSKHGETSVNELSITQLDAR  817



>ref|XP_002316947.1| hypothetical protein POPTR_0011s12950g [Populus trichocarpa]
 gb|EEE97559.1| hypothetical protein POPTR_0011s12950g [Populus trichocarpa]
Length=768

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 112/156 (72%), Gaps = 4/156 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRN GF+H +H  NL  + WKL
Sbjct  616  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNWGFTHPEHELNLLGHVWKL  675

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+EL+DE  VESC + +VLRSIHVGLLCVQ  PE RPSM +VV ML  +  L   
Sbjct  676  YKEGRSLELIDELKVESCYVPEVLRSIHVGLLCVQHSPEHRPSMSTVVLMLEGNGLLPQP  735

Query  240  KKPGFFTGRA-IEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT R  IE +   +    S NEVTI++L+ R
Sbjct  736  NEPGFFTERRLIEENKKDLS---STNEVTITVLDGR  768



>gb|EYU33573.1| hypothetical protein MIMGU_mgv1a024422mg, partial [Erythranthe 
guttata]
Length=765

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 116/162 (72%), Gaps = 6/162 (4%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFSH+DH  NL  +AW 
Sbjct  604  SRVVGTYGYMSPEYAIDGVFSVKSDVFSFGVLVLEIVSGKRNRGFSHRDHRLNLLGHAWM  663

Query  423  LYRDGRSIELL-DEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
            L+R+ R++EL    +LV S  L +V+RSI VGLLCVQ+ PEDRP+M +VV MLSN+  L 
Sbjct  664  LHREERTVELAGSSYLVNSGYLREVIRSIEVGLLCVQESPEDRPNMSTVVSMLSNEGVLP  723

Query  246  IAKKPGFFTGRAIE-----AHISTVEITDSVNEVTISLLNPR  136
             AK PGFFTGR +         +T     SVNE+TI+LL+ R
Sbjct  724  EAKHPGFFTGREMSIVETSTSSNTATTATSVNEITITLLDGR  765



>ref|XP_006370376.1| hypothetical protein POPTR_0001s42110g [Populus trichocarpa]
 gb|ERP66945.1| hypothetical protein POPTR_0001s42110g [Populus trichocarpa]
Length=811

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSD+FSFGV VLEIVSG +NRGFSH DH+ NL  +AW 
Sbjct  645  NKVAGTYGYISPEYANYGLYSVKSDIFSFGVLVLEIVSGNKNRGFSHPDHHLNLLGHAWI  704

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++ RS+EL  + +  +CNL++VLRSIHVGLLCVQ+ PE RP+M +VV ML ND  L  
Sbjct  705  LFKENRSLELAADSIAITCNLSEVLRSIHVGLLCVQENPEIRPTMSNVVLMLGNDDVLPQ  764

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +   ++ S++    SVNE ++S L PR
Sbjct  765  PKQPGFFTERDVIGASYSSSLSKPCSVNECSVSELEPR  802



>emb|CBI14789.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEIV+GKRNRGF H DH  NL  +AW 
Sbjct  91   TRVAGTLGYMSPEYATEGLYSTKSDVFSFGVLVLEIVTGKRNRGFFHPDHGYNLLGHAWT  150

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GRS+EL+D  + ++ NL++VLR+I++GLLCVQ++P DRPSM+SVV ML+++  L  
Sbjct  151  LYMEGRSLELIDPSMGDTSNLSEVLRTINMGLLCVQRFPNDRPSMHSVVLMLASECALPR  210

Query  243  AKKPGFFTGRAI  208
             ++P FFT R +
Sbjct  211  PREPCFFTERNV  222



>ref|XP_006356864.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=862

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 111/157 (71%), Gaps = 7/157 (4%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGF H+ H  NL  + WKLY
Sbjct  710  VVGTHGYMSPEYLIHGVFSIKSDVFSFGVLVLEIISGRRNRGFFHESHSINLLGHVWKLY  769

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR +EL+D H+ +SC  T++LR IHV LLCVQ  PEDRP M  VV ML+NDA L  AK
Sbjct  770  KEGRPLELIDVHITDSCYFTELLRIIHVALLCVQHSPEDRPDMSEVVVMLANDAILPEAK  829

Query  237  KPGFFTGRAIEAHISTVEITDSV---NEVTISLLNPR  136
            +PGF+T    E+     E + S+   NE+TI+ L+PR
Sbjct  830  EPGFYT----ESKFPDSEYSTSMYSKNEITITQLDPR  862



>gb|KCW58378.1| hypothetical protein EUGRSUZ_H01063 [Eucalyptus grandis]
Length=674

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEI+SGKRNRGF H DH  NL  +AW+
Sbjct  522  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISGKRNRGFHHPDHDHNLLGHAWR  581

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS +LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  582  LFTEGRSTQLLDKLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  641

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  642  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  674



>emb|CBI20448.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G++STKSDVFSFGV +LEIVSGKRNR FSH DH  NL  +AW 
Sbjct  194  TRVVGTLGYMSPEYASEGLYSTKSDVFSFGVLLLEIVSGKRNRRFSHPDHDLNLLGHAWT  253

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +G S+E +D  +V +CNL +VLRSI+VGLLCVQ++P+DRPSM+SV+ ML ++     
Sbjct  254  LYIEGGSLEFIDTSIVNTCNLIEVLRSINVGLLCVQRFPDDRPSMHSVILMLGSEGAPPR  313

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+P FFT R +    S+  I     + TI+LL  R
Sbjct  314  PKEPCFFTDRNMMEANSSSGI-----QPTITLLEAR  344



>ref|XP_010064920.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
 gb|KCW70074.1| hypothetical protein EUGRSUZ_F03379 [Eucalyptus grandis]
Length=815

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  663  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHRHNLLGHAWR  722

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P DRPSM +VV ML +D +L +
Sbjct  723  LFTEGRSMKLLDKLVENSCSTSEALRSIHIGLLCVQRCPNDRPSMSTVVMMLGSDIELPL  782

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  783  PKEPGFFIERNLLQESTS---QSQPNEMTMTVLSAR  815



>ref|XP_010064872.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=818

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  666  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHDHNLLGHAWR  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  726  LFTEGRSMQLLDQLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  785

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L  R
Sbjct  786  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLYAR  818



>ref|XP_006360148.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=813

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 114/156 (73%), Gaps = 2/156 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GY+SPEYA  G +S KSDVFSFG+ +LEIVSGK NR FSH DH  NL  +AWK
Sbjct  660  NRVVGTYGYLSPEYALHGRYSVKSDVFSFGILILEIVSGKSNRRFSHPDHNLNLLGHAWK  719

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++GRS ELLDE+L +SC+ T+V RSI VGLLCVQQ PEDRP+M S V MLSN+ +L  
Sbjct  720  LYKEGRSTELLDEYLGDSCSTTEVERSICVGLLCVQQSPEDRPNMSSAVMMLSNEGELPQ  779

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            AK+PGF+  R  +A    +   ++V+E  I++L  R
Sbjct  780  AKRPGFYIER--DAPDGELYAQNTVSETPITILAAR  813



>ref|XP_006377798.1| hypothetical protein POPTR_0011s12970g [Populus trichocarpa]
 gb|ERP55595.1| hypothetical protein POPTR_0011s12970g [Populus trichocarpa]
Length=820

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+
Sbjct  663  NKVVGTYGYISPEYATEGLYSLKSDVFSFGVLVLEIVSGYKNRGFSHPEHNLNLLGHAWR  722

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GR +EL+ + ++E+CNL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L  
Sbjct  723  LFREGRPMELVRQSIIEACNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNTLPQ  782

Query  243  AKKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
             K PGFF  R      ST E T   S N+ +I+LL  R
Sbjct  783  PKHPGFFIERDPAEASSTSEGTANYSANKCSITLLQAR  820



>ref|XP_006388693.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
 gb|ERP47607.1| hypothetical protein POPTR_0118s002202g, partial [Populus trichocarpa]
Length=219

 Score =   164 bits (414),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDVFSFGV VLEIVSGK+NRGF H D   NL  +AW 
Sbjct  62   NRVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIVSGKKNRGFCHPDQNLNLLGHAWI  121

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G  ++L+DE L +S NL ++LR IHV LLCVQQ PEDRP+M +VV ML ++  L  
Sbjct  122  LWTEGTPLDLIDEGLSDSRNLAELLRCIHVALLCVQQRPEDRPTMSTVVVMLGSENPLPQ  181

Query  243  AKKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
             K+PGFF G+      S+    +  SVNEV+++LL  R
Sbjct  182  PKQPGFFMGKNPSEKDSSSNNHEAHSVNEVSLTLLEAR  219



>gb|KCW69735.1| hypothetical protein EUGRSUZ_F03116 [Eucalyptus grandis]
Length=857

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  705  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHDHNLLGHAWR  764

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  765  LFTEGRSMQLLDQLVENSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  824

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L  R
Sbjct  825  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLYAR  857



>ref|XP_008226742.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Prunus mume]
Length=820

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            EN N   ++V   GYMSPEY   G+FS KSDV+SFGV VLEIVSGK+NRGF H DH  NL
Sbjct  660  ENTN---RVVGTYGYMSPEYVVDGIFSIKSDVYSFGVMVLEIVSGKKNRGFYHPDHQLNL  716

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+ +GR +E+LDE L  SC L  V R IH+ LLCVQQ PEDRP+M SVV ML  
Sbjct  717  LGHAWTLWIEGRPLEVLDEVLDGSCPLPDVSRCIHIALLCVQQQPEDRPNMASVVLMLGG  776

Query  261  DADLAIAKKPGFFTGR-AIEAHISTVEI-TDSVNEVTISLLNPR  136
            +  L   K+PGFFT R  +EA  S++   + S+NE+T++LL  R
Sbjct  777  EGSLPAPKQPGFFTDRNPVEADSSSINRESHSINEMTVTLLEAR  820



>ref|XP_002317537.2| hypothetical protein POPTR_0011s12970g [Populus trichocarpa]
 gb|EEE98149.2| hypothetical protein POPTR_0011s12970g [Populus trichocarpa]
Length=835

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+
Sbjct  678  NKVVGTYGYISPEYATEGLYSLKSDVFSFGVLVLEIVSGYKNRGFSHPEHNLNLLGHAWR  737

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+R+GR +EL+ + ++E+CNL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L  
Sbjct  738  LFREGRPMELVRQSIIEACNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNTLPQ  797

Query  243  AKKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
             K PGFF  R      ST E T   S N+ +I+LL  R
Sbjct  798  PKHPGFFIERDPAEASSTSEGTANYSANKCSITLLQAR  835



>ref|XP_010644281.1| PREDICTED: uncharacterized protein LOC100246941 [Vitis vinifera]
Length=1583

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  1430  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTL  1489

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
             Y +GRS+EL+D  + +  +L+QVL SI+VGLLCVQ  P+DRPSM SVV MLS+D+ L   
Sbjct  1490  YMEGRSMELIDSSVGDMHDLSQVLCSINVGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQP  1549

Query  240   KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFTGR  ++  S  +   S N VTI++L+ R
Sbjct  1550  KEPGFFTGRKAQSS-SGNQGPFSGNGVTITMLDGR  1583


 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  658  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTL  717

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  NL+QVLR I+VGLLCVQ  P++RPSM SVV MLS+D+ L   
Sbjct  718  YMEGRSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQP  777

Query  240  KKPGFFTGRA  211
            K+PGFFTGR 
Sbjct  778  KEPGFFTGRG  787



>emb|CBI20439.3| unnamed protein product [Vitis vinifera]
Length=233

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDV+SFGV VLEI+SGKRNRGFSH DH  NL  +AW 
Sbjct  83   TRVAGTLGYMSPEYASEGLYSTKSDVYSFGVLVLEILSGKRNRGFSHPDHDLNLLGHAWT  142

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +G S E +D  +  + NL++VLRSI+VGLLCVQ++P+DRPSM+SVV MLS++  L  
Sbjct  143  LYIEGGSSEFIDASIANTYNLSEVLRSINVGLLCVQRFPDDRPSMHSVVLMLSSEGALPR  202

Query  243  AKKPGFFTGRAI  208
             K+P FFT R++
Sbjct  203  PKEPCFFTDRSM  214



>ref|XP_002317540.2| hypothetical protein POPTR_0011s13130g [Populus trichocarpa]
 gb|EEE98152.2| hypothetical protein POPTR_0011s13130g [Populus trichocarpa]
Length=666

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 113/160 (71%), Gaps = 4/160 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEI+SG RNRGF H DH  NL  +AWK
Sbjct  507  NKVVGTYGYISPEYAIDGLYSPKSDVFSFGVLVLEILSGNRNRGFCHPDHNLNLLGHAWK  566

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+ E +VE+CNL++ LR IHVGLLCVQ+ PEDRP+M  VV ML N+  L  
Sbjct  567  LFTEGRPLELVSESIVETCNLSEALRLIHVGLLCVQENPEDRPTMSYVVLMLGNEDALPR  626

Query  243  AKKPGFFTGR-AIEAHISTVEITD---SVNEVTISLLNPR  136
             K+PGF+T R  IEA  ++        S NE +IS++  R
Sbjct  627  PKQPGFYTERDLIEAAYTSNSSQSKPYSANECSISMIEAR  666



>ref|XP_006360151.1| PREDICTED: uncharacterized protein LOC102593298 [Solanum tuberosum]
Length=1637

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 120/157 (76%), Gaps = 2/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            ++++   GY+SPEYA  G++S KSDVFSFG+ VLEIVSGK NR FSH DHY NL  +AWK
Sbjct  675  NRVIGTYGYLSPEYALHGLYSVKSDVFSFGILVLEIVSGKSNRRFSHPDHYLNLLGHAWK  734

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            +Y++GRS+ELLDE L +SC+ ++V+RSI VGLLCVQQ PEDRPSM SVV ML+N+  L  
Sbjct  735  IYKEGRSMELLDERLSDSCSRSEVVRSICVGLLCVQQCPEDRPSMSSVVVMLNNEGVLPQ  794

Query  243  AKKPGFFTGR-AIEAHISTVEITD-SVNEVTISLLNP  139
            AK+PGF+  R + E   S+ +  + +V++  I++L+P
Sbjct  795  AKQPGFYIERNSNEEEFSSNQNANVTVSDTPITILDP  831


 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             +++   GYMSPEYA  G FS KSDVFS GV +LEIVSG++NR F H DH+ +L  +AW L
Sbjct  1481  RVIGTYGYMSPEYAVDGKFSVKSDVFSLGVLLLEIVSGRKNRTFHHPDHHHSLIGHAWLL  1540

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN-DADLAI  244
             + +G+++EL+D+ L ES   +QVLR +HV LLCVQ+  ++RP+M SVV MLS+ +  L  
Sbjct  1541  WNEGKALELIDDCLKESFVESQVLRCVHVALLCVQRLTDERPTMSSVVFMLSHEEVALPQ  1600

Query  243   AKKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
              K+PGFF  R+I E   S  +   S N +T+++L PR
Sbjct  1601  PKEPGFFIERSIAETDHSNEKRCISDNVLTLTILQPR  1637



>ref|XP_007021200.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY12725.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=1735

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +K+V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGFSH DH  NL  +AW+
Sbjct  1578  NKVVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSGKKNRGFSHPDHDHNLLGHAWR  1637

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ + R +EL+D+   + C  +++LR IHVGLLCVQQ PEDRP+M SV+ ML +++ L  
Sbjct  1638  LWTEKRPMELIDDAFGDFCLPSEMLRCIHVGLLCVQQRPEDRPNMSSVIVMLGSESALPQ  1697

Query  243   AKKPGFFTGRAI-EAH-ISTVEITDSVNEVTISLLNPR  136
              K+PGFFTGR + EA   ++   + S NE T++LL PR
Sbjct  1698  PKQPGFFTGRNLPEAESSTSNCKSSSANECTVTLLEPR  1735


 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G+FS KSDVF FGV VLEIVSGK+NRGFSH DH  NL  +AWK
Sbjct  658  NKVVGTYGYMSPEYAIDGVFSMKSDVFGFGVLVLEIVSGKKNRGFSHPDHDHNLLGHAWK  717

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+D+ L   C  ++V R IHVGLLCVQQ PEDRP M SV+ ML ++  L  
Sbjct  718  LWTESRPMELIDDALRNFCLPSEVQRCIHVGLLCVQQRPEDRPHMSSVIVMLGSENALPQ  777

Query  243  AKKPGFFTGRAI-EAHI-STVEITDSVNEVTISLLNPR  136
             K+PGFFTGR + EA   S+   + S NE TI+LL  R
Sbjct  778  PKQPGFFTGRNMPEAECSSSNSKSSSANECTITLLKAR  815



>gb|EYU33574.1| hypothetical protein MIMGU_mgv1a0256212mg, partial [Erythranthe 
guttata]
Length=628

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 110/157 (70%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFSH D   NL  +AW L
Sbjct  472  RVVGTYGYMSPEYAIDGLFSIKSDVFSFGVLVLEIVSGKRNRGFSHSDSNLNLLGHAWTL  531

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRSI+L+D  + +S  L +V RSIHV LLCVQQ  EDRP+M SVV ML N+  LA A
Sbjct  532  YKEGRSIDLVDSSIGDSFYLAEVTRSIHVALLCVQQNVEDRPNMSSVVLMLGNEGVLAQA  591

Query  240  KKPGFFTGRAIEAHISTVEIT--DSVNEVTISLLNPR  136
            K+PGFF  R + A  S+       S N+VTI++   R
Sbjct  592  KQPGFFMERDVLAGQSSTSTNPASSTNDVTITMPEGR  628



>ref|XP_006389125.1| hypothetical protein POPTR_0044s002002g, partial [Populus trichocarpa]
 gb|ERP48039.1| hypothetical protein POPTR_0044s002002g, partial [Populus trichocarpa]
Length=174

 Score =   161 bits (408),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIV+G RNRGFSH DH+ NL  +AW 
Sbjct  17   NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWI  76

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL     VE+  L++VLRSIHVGLLCVQ+  EDRP++  VV ML N+ +L  
Sbjct  77   LFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLMLGNEDELPQ  136

Query  243  AKKPGFFTGRAIE--AHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R ++  ++ S+     S N  +IS+L  R
Sbjct  137  PKQPGFFTERDLDEASYSSSQNKPPSANGCSISMLEAR  174



>ref|XP_006377795.1| hypothetical protein POPTR_0011s12910g [Populus trichocarpa]
 gb|ERP55592.1| hypothetical protein POPTR_0011s12910g [Populus trichocarpa]
Length=775

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 109/158 (69%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S+IV   GYMSPEYA +G FS KSD FSFGV VLEIVSGK+NRGF H D   NL  +AW 
Sbjct  618  SRIVGTYGYMSPEYASNGYFSVKSDAFSFGVLVLEIVSGKKNRGFRHLDPNLNLLGHAWM  677

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+  G   EL+DE L+ESCNL++VLR IHV LLCVQQ PEDRP+M +VV +L ++  L  
Sbjct  678  LWIKGTPFELIDEFLIESCNLSEVLRCIHVALLCVQQRPEDRPNMSAVVLILGSEIPLPQ  737

Query  243  AKKPGFFTGRAIEAH--ISTVEITDSVNEVTISLLNPR  136
             K+PGFF G     H   S   +T S +EV++  L+PR
Sbjct  738  PKQPGFFMGENPHEHSTSSNSHVTYSGDEVSLISLDPR  775



>ref|XP_006370371.1| S-locus protein kinase [Populus trichocarpa]
 gb|ERP66940.1| S-locus protein kinase [Populus trichocarpa]
Length=831

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 116/159 (73%), Gaps = 4/159 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S+IV   GYMSPEYA  G+FS KSDVFSFGV VLEIVSG++NRGF H +H  NL  +AW 
Sbjct  674  SRIVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGRKNRGFRHAEHKLNLLGHAWM  733

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR ++L+DE +V++C +++VLRSI V LLCVQ+ PEDRP M  VV MLS+D  L  
Sbjct  734  LHKEGRPLDLIDESIVDTCIISEVLRSIEVALLCVQKSPEDRPKMSIVVLMLSSDIVLPQ  793

Query  243  AKKPGFFTGRAIEAHISTV---EITDSVNEVTISLLNPR  136
             K+PGFFT R +    S+    EI+ SVNE+T +LL  R
Sbjct  794  PKEPGFFTERDLSNDSSSTIKHEIS-SVNELTSTLLEAR  831



>gb|KCW70068.1| hypothetical protein EUGRSUZ_F03371 [Eucalyptus grandis]
Length=759

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS K DVFS+GV VLE VSGKRNRGF H DH  NL  +AW+L
Sbjct  606  RVVGTYGYMSPEYAIDGVFSVKLDVFSYGVLVLETVSGKRNRGFRHPDHCHNLVGHAWRL  665

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + RS+E LDE LVES N  +VLRSIHV LLCVQQ PEDRPSM +V+ ML +  +L + 
Sbjct  666  FTEDRSMEQLDE-LVESYNAAEVLRSIHVALLCVQQCPEDRPSMSAVILMLGSADELPLP  724

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGF+  R +    +      S NE+T++LL+PR
Sbjct  725  KEPGFYNERKLPPEHTFSHPVHSPNEITMTLLSPR  759



>ref|XP_006377805.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
 gb|ERP55602.1| hypothetical protein POPTR_0011s130601g, partial [Populus trichocarpa]
Length=230

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            ++IV   GY+SPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGF H DH  NL  +AWK
Sbjct  73   NRIVGTYGYISPEYAVDGLFSIKSDVFSFGVLVLEIVSGKKNRGFYHPDHNHNLLGHAWK  132

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  + +S +L+++LR I VGLLCVQQ P+DRPSM +VV MLS++  L  
Sbjct  133  LWNEGRPLELMDITIDDSSSLSEILRHIQVGLLCVQQRPDDRPSMSTVVVMLSSEISLPQ  192

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGF+T R        S+   + S N+++ ++  PR
Sbjct  193  PKQPGFYTERNFPEPETSSSSIRSASRNDISFTVFEPR  230



>ref|XP_011007884.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X4 [Populus euphratica]
Length=181

 Score =   161 bits (408),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            ++IV   GYM+PEYA +G+FS KSDVFSFGV +LEI+SGK+N GF   +  E+L ++AWK
Sbjct  24   NRIVGTYGYMAPEYAMAGLFSVKSDVFSFGVLLLEIISGKKNVGFHLSEEGESLLTFAWK  83

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA-DLA  247
            L+ DG+ +EL+D  L +S   T+VLR IH+GLLCVQ+ P DRP+M SV+ ML++D   L 
Sbjct  84   LWSDGQGLELMDTMLEKSSVATEVLRCIHIGLLCVQEDPADRPTMSSVLHMLASDTIALP  143

Query  246  IAKKPGFFTGR--AIEAHISTVEITDSVNEVTISLLNPR  136
            I K+P F  GR  A+E   S  ++  S NE+T+S+L+P+
Sbjct  144  IPKQPAFSIGRFVAMEGQSSNQKVC-SANELTLSVLSPQ  181



>emb|CBI20427.3| unnamed protein product [Vitis vinifera]
Length=2646

 Score =   175 bits (443),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  2493  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTL  2552

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
             Y +GRS+EL+D  + +  +L+QVL SI+VGLLCVQ  P+DRPSM SVV MLS+D+ L   
Sbjct  2553  YMEGRSMELIDSSVGDMHDLSQVLCSINVGLLCVQCSPDDRPSMSSVVLMLSSDSSLPQP  2612

Query  240   KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFTGR  ++  S  +   S N VTI++L+ R
Sbjct  2613  KEPGFFTGRKAQSS-SGNQGPFSGNGVTITMLDGR  2646


 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             ++V   GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  1719  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFSHPDHSLNLLGHAWTL  1778

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
             Y +GRS+EL+D  + +  NL+QVLR I+VGLLCVQ  P++RPSM SVV MLS+D+ L   
Sbjct  1779  YMEGRSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQP  1838

Query  240   KKPGFFTGRA  211
             K+PGFFTGR 
Sbjct  1839  KEPGFFTGRG  1848



>ref|XP_009377300.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
 ref|XP_009377328.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Pyrus x bretschneideri]
Length=826

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            EN N   ++V   GYMSPEY   G+FS KSDV+SFGV +LEI+SGK+NRGF H DH  NL
Sbjct  664  ENTN---RVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMILEILSGKKNRGFHHPDHQLNL  720

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+ +GR  E++DE LV SC   +V R IH+ LLCVQQ PEDRP+M SVV ML  
Sbjct  721  LGHAWMLWIEGRPTEIMDEKLVGSCAQPEVSRCIHIALLCVQQQPEDRPNMASVVLMLGG  780

Query  261  DADLAIAKKPGFFTGR-AIEAHISTVEI--TDSVNEVTISLLNPR  136
            +  L I K+PGFFT R ++EA  S+     + S+NE++++LL  R
Sbjct  781  EGSLPIPKQPGFFTERNSVEAKASSPSKYESHSINEMSLTLLEAR  825



>ref|XP_009377299.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009377326.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Pyrus x bretschneideri]
Length=849

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 88/165 (53%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            EN N   ++V   GYMSPEY   G+FS KSDV+SFGV +LEI+SGK+NRGF H DH  NL
Sbjct  687  ENTN---RVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMILEILSGKKNRGFHHPDHQLNL  743

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+ +GR  E++DE LV SC   +V R IH+ LLCVQQ PEDRP+M SVV ML  
Sbjct  744  LGHAWMLWIEGRPTEIMDEKLVGSCAQPEVSRCIHIALLCVQQQPEDRPNMASVVLMLGG  803

Query  261  DADLAIAKKPGFFTGR-AIEAHISTVEI--TDSVNEVTISLLNPR  136
            +  L I K+PGFFT R ++EA  S+     + S+NE++++LL  R
Sbjct  804  EGSLPIPKQPGFFTERNSVEAKASSPSKYESHSINEMSLTLLEAR  848



>ref|XP_007021192.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
 gb|EOY12717.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
Length=845

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G++S KSDVFSFGV VLEIVSGKRNRGFSH DH+ NL  +AWKLY
Sbjct  690  VVGTYGYMSPEYAIDGLYSIKSDVFSFGVLVLEIVSGKRNRGFSHPDHHHNLLGHAWKLY  749

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
             +G+ ++L+   + ++CNL++VLRSIH+GLLCVQ+ PEDRP M +VV ML  ++ L   K
Sbjct  750  AEGKPLQLIAAPIRDTCNLSEVLRSIHIGLLCVQRNPEDRPRMSTVVLMLGGESPLPQPK  809

Query  237  KPGFFTGRAI-EAHISTV-EITDSVNEVTISLLNPR  136
            +PGFF  R + EA  S+  +   S +E+TI+L+  R
Sbjct  810  QPGFFNERDLSEAKSSSSNQKPCSYDELTITLMEGR  845



>ref|XP_010320277.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Solanum lycopersicum]
Length=757

 Score =   171 bits (434),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 110/158 (70%), Gaps = 6/158 (4%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  GMFS KSDVFSFGV VLE VS K+NR F  Q+   NL  YAWK
Sbjct  604  SHVVGTQGYMSPEYAVEGMFSVKSDVFSFGVLVLETVSCKKNRSFFDQNQSLNLLGYAWK  663

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSND--ADL  250
            LY++ RS+EL+DE L  SC+++QVLRSI VGLLCVQQ PEDRP+M SV+ ML N   + L
Sbjct  664  LYKEDRSLELIDEQLAGSCHISQVLRSIQVGLLCVQQCPEDRPNMSSVIMMLGNSHGSRL  723

Query  249  AIAKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
              AK+PGFF     E  +   + + S NE+TI+ + PR
Sbjct  724  PEAKEPGFFP----EREVLEADKSGSQNELTITSIYPR  757



>ref|XP_008363599.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=303

 Score =   165 bits (417),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 112/167 (67%), Gaps = 12/167 (7%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G FS KSDVFSFG+ +LE +SGKR+RGF   +H  NL  +AW+L
Sbjct  137  RVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSGKRSRGFYDPNHNLNLIGHAWRL  196

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+DE+L +SC+L++VLR IHV LLCVQ  PEDRP+M SVV ML  ++ L   
Sbjct  197  WKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQHLPEDRPTMSSVVLMLGGESALPQP  256

Query  240  KKPGFFTGRAIEAHI------------STVEITDSVNEVTISLLNPR  136
            KKPGFF G+   +                ++ T S  E +IS+L PR
Sbjct  257  KKPGFFIGKYSSSEAESSSKNETFSLSGVMKETFSTTESSISVLEPR  303



>ref|XP_009778629.1| PREDICTED: uncharacterized protein LOC104227947 [Nicotiana sylvestris]
Length=1645

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV +LEIVSGK+NR F H DH  NL  + W L
Sbjct  669  RVVGTYGYMSPEYAVDGIFSVKSDVFSFGVLILEIVSGKKNRRFIHPDHNLNLLGHTWML  728

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +R+GRS EL+D + VESC  ++V RSIHVGLLCVQQ PEDRPSM SVV ML+N++ L   
Sbjct  729  HREGRSSELVDFNAVESCYTSEVQRSIHVGLLCVQQSPEDRPSMSSVVLMLTNESILQQP  788

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            K PGFF  R I   A+  +     SVN+VTI+ L+ R
Sbjct  789  KPPGFFMERNIADSAYSWSSHTPGSVNDVTITSLDAR  825


 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             +++   GYM+PEYA  G FS KSDVFS GV +LEIVSG++NR F H  H+ NL  +AW L
Sbjct  1489  RVIGTYGYMAPEYAVDGKFSVKSDVFSLGVLLLEIVSGRKNRKFHHLIHHHNLLGHAWLL  1548

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA-DLAI  244
             + +G+++ELLDE L ES   +QV+R I V LLCVQ++PEDRP+M SVV  LSN+   L  
Sbjct  1549  WNEGKALELLDECLKESYIESQVIRCIQVSLLCVQKFPEDRPTMESVVFWLSNEGVKLPQ  1608

Query  243   AKKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
              K+PGFF  R + E+  ST E   + N V++++L  R
Sbjct  1609  PKQPGFFIERYSTESTESTDERCITENTVSLTILEAR  1645



>ref|XP_002315550.1| hypothetical protein POPTR_0010s02670g [Populus trichocarpa]
 gb|EEF01721.1| hypothetical protein POPTR_0010s02670g [Populus trichocarpa]
Length=779

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  622  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFSHPDHHLNLIGHAWI  681

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL+ E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  VV ML N+ +L  
Sbjct  682  LFKQGRSLELVGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVVLMLGNEDELPQ  741

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  742  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  779



>gb|KCW70069.1| hypothetical protein EUGRSUZ_F03372 [Eucalyptus grandis]
Length=806

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVS KRNRGF H DH  NL  +AW+
Sbjct  654  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSRKRNRGFHHPDHDHNLLGHAWR  713

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  714  LFTEGRSMQLLDQLVANSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  773

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L  R
Sbjct  774  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLYAR  806



>ref|XP_011030933.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X4 [Populus euphratica]
Length=768

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G FS KSDVFSFGV VLE VSGKRN GF+H +H  NL  + WKL
Sbjct  616  RVVGTYGYMSPEYAIDGFFSIKSDVFSFGVLVLETVSGKRNWGFTHPEHELNLLGHVWKL  675

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+EL+DE  VESC + +VLRSIHVGLLCVQ  PE RPSM +VV ML  +  L   
Sbjct  676  YKEGRSLELIDELNVESCYVPEVLRSIHVGLLCVQHSPEHRPSMSTVVLMLEGNGLLPQP  735

Query  240  KKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT R  IE +   +    S NEVTI++L+ R
Sbjct  736  NEPGFFTERKVIEENKKDLS---STNEVTITVLDGR  768



>emb|CBI20454.3| unnamed protein product [Vitis vinifera]
Length=230

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEI+SGKRNRGFSH DH  NL  +AW 
Sbjct  80   TRVAGTLGYMSPEYASEGLYSTKSDVFSFGVLVLEIISGKRNRGFSHPDHDLNLLGHAWT  139

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +G   + +D  ++ + NL++VLRSI+VGLLCVQ++P+DRPSM+SVV ML ++  L  
Sbjct  140  LYIEGGFSQFIDASIMNTYNLSEVLRSINVGLLCVQRFPDDRPSMHSVVLMLGSEGTLPR  199

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEV  160
             K+P FFT R +    S+  I  ++ ++
Sbjct  200  PKEPCFFTDRNMMEANSSSSIQPTITQL  227



>ref|XP_006356865.1| PREDICTED: uncharacterized protein LOC102592491 [Solanum tuberosum]
Length=1670

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGF+ + H  NL  + WKLY
Sbjct  648  VVGTHGYMSPEYVVHGVFSVKSDVFSFGVLVLEIISGRRNRGFARESHSINLLGHVWKLY  707

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR +EL+D  L++S  ++++LR IHV LLCVQQ PEDRP M +V+ ML+NDA L  AK
Sbjct  708  KEGRPLELIDGDLMDSSYISELLRLIHVALLCVQQCPEDRPDMATVILMLTNDAILPQAK  767

Query  237  KPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            +PGFFT   + +  ST     S NE+T++ L PR
Sbjct  768  EPGFFTESKVTSGCSTS--MSSTNEITVTQLEPR  799


 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 111/154 (72%), Gaps = 2/154 (1%)
 Frame = -1

Query  597   IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
             +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGF+ + H  NL  + WKLY
Sbjct  1519  VVGTHGYMSPEYVVHGVFSVKSDVFSFGVLVLEIISGRRNRGFARESHSINLLGHVWKLY  1578

Query  417   RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
             ++GR +EL+D HL++S  ++++LR IHV LLCVQQ PEDRP M +V+ ML+NDA L  AK
Sbjct  1579  KEGRPLELIDGHLMDSRYISELLRLIHVALLCVQQCPEDRPDMPTVILMLTNDAILPQAK  1638

Query  237   KPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT   + +  S      S NE+T++ L PR
Sbjct  1639  EPGFFTESKVTSECSISMC--STNEITVTQLEPR  1670



>ref|XP_002315551.2| hypothetical protein POPTR_0010s02660g [Populus trichocarpa]
 gb|EEF01722.2| hypothetical protein POPTR_0010s02660g [Populus trichocarpa]
Length=776

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  619  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFSHPDHHLNLIGHAWI  678

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL+ E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  VV ML N+ +L  
Sbjct  679  LFKQGRSLELVGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVVLMLGNEDELPQ  738

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  739  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  776



>gb|KCW69728.1| hypothetical protein EUGRSUZ_F03112 [Eucalyptus grandis]
Length=807

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  655  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFYHPDHDHNLLGHAWR  714

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P DRPSM  VV ML +D  L +
Sbjct  715  LFTEGRSMQLLDKLVQNSCSTSEALRSIHIGLLCVQRCPNDRPSMSVVVMMLGSDIKLPL  774

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  775  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  807



>ref|XP_010320275.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Solanum lycopersicum]
Length=804

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 110/158 (70%), Gaps = 6/158 (4%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S +V   GYMSPEYA  GMFS KSDVFSFGV VLE VS K+NR F  Q+   NL  YAWK
Sbjct  651  SHVVGTQGYMSPEYAVEGMFSVKSDVFSFGVLVLETVSCKKNRSFFDQNQSLNLLGYAWK  710

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSND--ADL  250
            LY++ RS+EL+DE L  SC+++QVLRSI VGLLCVQQ PEDRP+M SV+ ML N   + L
Sbjct  711  LYKEDRSLELIDEQLAGSCHISQVLRSIQVGLLCVQQCPEDRPNMSSVIMMLGNSHGSRL  770

Query  249  AIAKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
              AK+PGFF     E  +   + + S NE+TI+ + PR
Sbjct  771  PEAKEPGFFP----EREVLEADKSGSQNELTITSIYPR  804



>ref|XP_011030956.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=715

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 109/156 (70%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGFSH +H  NL  +AW+L
Sbjct  560  KVAGTYGYISPEYAIEGLYSVKSDVFSFGVLVLEIVSGYKNRGFSHPEHSLNLLGHAWRL  619

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +R+GR +EL+ + ++E+CNL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L   
Sbjct  620  FREGRPMELVRQSIIEACNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNILPQP  679

Query  240  KKPGFFTGRAIEAHISTVEIT-DSVNEVTISLLNPR  136
            K PGFF  R      ST E T  S N+ +I+LL  R
Sbjct  680  KHPGFFIERDPAEASSTGESTAHSANKCSITLLQAR  715



>ref|XP_010064867.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=849

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH+ NL  +AW+
Sbjct  697  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHHHNLLGHAWR  756

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+   DRPSM +VV ML +D +L +
Sbjct  757  LFTEGRSMQLLDKLVQNSCSTSEALRSIHIGLLCVQRCLNDRPSMSTVVMMLGSDIELPL  816

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +   +         NE+T++LL  R
Sbjct  817  PKEPGFFNERNL---LQENPSQSQPNEITMTLLFAR  849



>emb|CAN70179.1| hypothetical protein VITISV_000004 [Vitis vinifera]
Length=776

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 113/155 (73%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++STKSDVFSFGV  LEIVSGKRNRGFSH DH  NL  +AW L
Sbjct  623  RVVGTYGYMSPEYAIDGLYSTKSDVFSFGVLXLEIVSGKRNRGFSHPDHSLNLLGHAWTL  682

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +GRS+EL+D  + +  NL+QVLR I+VGLLCVQ  P++RPSM SVV MLS+D+ L   
Sbjct  683  YMEGRSMELIDSSVGDIHNLSQVLRLINVGLLCVQCGPDERPSMSSVVLMLSSDSTLPQP  742

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFTGR   +  S  +   S N +TI++ + R
Sbjct  743  KEPGFFTGRGSTSS-SGNQGPFSGNGITITMFDGR  776



>ref|XP_002315552.2| hypothetical protein POPTR_0010s02630g [Populus trichocarpa]
 gb|EEF01723.2| hypothetical protein POPTR_0010s02630g [Populus trichocarpa]
Length=823

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  666  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFSHPDHHLNLIGHAWI  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL+ E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  VV ML N+ +L  
Sbjct  726  LFKQGRSLELVGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVVLMLGNEDELPQ  785

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  786  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  823



>ref|XP_011030932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Populus euphratica]
Length=816

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G FS KSDVFSFGV VLE VSGKRN GF+H +H  NL  + WKL
Sbjct  664  RVVGTYGYMSPEYAIDGFFSIKSDVFSFGVLVLETVSGKRNWGFTHPEHELNLLGHVWKL  723

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+EL+DE  VESC + +VLRSIHVGLLCVQ  PE RPSM +VV ML  +  L   
Sbjct  724  YKEGRSLELIDELNVESCYVPEVLRSIHVGLLCVQHSPEHRPSMSTVVLMLEGNGLLPQP  783

Query  240  KKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT R  IE +   +    S NEVTI++L+ R
Sbjct  784  NEPGFFTERKVIEENKKDLS---STNEVTITVLDGR  816



>ref|XP_011030930.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Populus euphratica]
Length=819

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G FS KSDVFSFGV VLE VSGKRN GF+H +H  NL  + WKL
Sbjct  667  RVVGTYGYMSPEYAIDGFFSIKSDVFSFGVLVLETVSGKRNWGFTHPEHELNLLGHVWKL  726

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+EL+DE  VESC + +VLRSIHVGLLCVQ  PE RPSM +VV ML  +  L   
Sbjct  727  YKEGRSLELIDELNVESCYVPEVLRSIHVGLLCVQHSPEHRPSMSTVVLMLEGNGLLPQP  786

Query  240  KKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT R  IE +   +    S NEVTI++L+ R
Sbjct  787  NEPGFFTERKVIEENKKDLS---STNEVTITVLDGR  819



>gb|EYU19178.1| hypothetical protein MIMGU_mgv1a020642mg [Erythranthe guttata]
Length=820

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDV+SFGV VLEIVSG+RNRGF H+DH+ NL  +AW 
Sbjct  662  NRVVGTYGYMSPEYAVDGLFSLKSDVYSFGVLVLEIVSGRRNRGFHHRDHHHNLLGHAWI  721

Query  423  LYRDGRSIELLDEH-LVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
            LY++GRS+EL+D + +V+S  ++++LR IHV LLCVQQ PEDRPSM SVV ML +D  L 
Sbjct  722  LYKEGRSLELVDNNIIVDSIYVSELLRLIHVALLCVQQSPEDRPSMSSVVLMLGSDGVLP  781

Query  246  IAKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             AK+PGFF  R +    + ++  +T S NE TI+LL  R
Sbjct  782  KAKQPGFFAERNVFGTENTTSTVVTSSSNEFTITLLEAR  820



>ref|XP_006378116.1| hypothetical protein POPTR_0010s02670g [Populus trichocarpa]
 gb|ERP55913.1| hypothetical protein POPTR_0010s02670g [Populus trichocarpa]
Length=824

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  667  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFSHPDHHLNLIGHAWI  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL+ E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  VV ML N+ +L  
Sbjct  727  LFKQGRSLELVGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVVLMLGNEDELPQ  786

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  787  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  824



>ref|XP_006377796.1| hypothetical protein POPTR_0011s12920g [Populus trichocarpa]
 gb|ERP55593.1| hypothetical protein POPTR_0011s12920g [Populus trichocarpa]
Length=806

 Score =   171 bits (433),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S+IV   GYMSPEYA +G FS KSD FSFGV VLEIVSGK+NRGF H D   NL  +AW 
Sbjct  649  SRIVGTYGYMSPEYASNGYFSVKSDAFSFGVLVLEIVSGKKNRGFRHLDPNLNLLGHAWM  708

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+  G   EL+DE L+ESCNL++VLR IHV LLCVQQ PEDRP+M +VV +L ++  L  
Sbjct  709  LWIKGTPFELIDEFLIESCNLSEVLRCIHVALLCVQQRPEDRPNMSAVVLILGSEIPLPQ  768

Query  243  AKKPGFFTGRAIEAH--ISTVEITDSVNEVTISLLNPR  136
             K+PGFF G     H   S   +T S  EV++  L+PR
Sbjct  769  PKQPGFFMGENPHEHSTSSNRHVTYSGEEVSLISLDPR  806



>ref|XP_010688827.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase At4g27290 [Beta vulgaris subsp. 
vulgaris]
Length=823

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 4/160 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G+FS KSDVFSFGV VLE +S KRNRGF+H DHY NL  +AW+
Sbjct  664  NKVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLETISSKRNRGFNHPDHYHNLLGHAWR  723

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G ++EL+D  +V SCN +QVLR IH+GLLCVQ+ P++RPSM SV+ ML +D +L  
Sbjct  724  LFKEGLALELVDPSIVASCNASQVLRCIHIGLLCVQRSPDERPSMPSVIVMLDSDVELPQ  783

Query  243  AKKPGFFTGRAIEAHIS----TVEITDSVNEVTISLLNPR  136
             K P FF  R +    S    TV  +   NE++I++++ R
Sbjct  784  PKTPAFFIIRELLDKDSLTSATVSESHCSNEMSITVVSGR  823



>ref|XP_011030931.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=818

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G FS KSDVFSFGV VLE VSGKRN GF+H +H  NL  + WKL
Sbjct  666  RVVGTYGYMSPEYAIDGFFSIKSDVFSFGVLVLETVSGKRNWGFTHPEHELNLLGHVWKL  725

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+EL+DE  VESC + +VLRSIHVGLLCVQ  PE RPSM +VV ML  +  L   
Sbjct  726  YKEGRSLELIDELNVESCYVPEVLRSIHVGLLCVQHSPEHRPSMSTVVLMLEGNGLLPQP  785

Query  240  KKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFFT R  IE +   +    S NEVTI++L+ R
Sbjct  786  NEPGFFTERKVIEENKKDLS---STNEVTITVLDGR  818



>ref|XP_008355368.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X3 [Malus domestica]
Length=303

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G FS KSDVFSFG+ +LE +SGKR+RGF   +H  NL  +AW+L
Sbjct  137  RVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSGKRSRGFYDPNHNXNLIGHAWRL  196

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+DE+L +SC+L++VLR IHV LLCVQQ PEDRP+M SVV ML  ++ L   
Sbjct  197  WKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGESALPQP  256

Query  240  KKPGFFTGR  214
            KKPG F G+
Sbjct  257  KKPGLFIGK  265



>ref|XP_010064868.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=835

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  683  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFYHPDHDHNLLGHAWR  742

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P DRPSM  VV ML +D  L +
Sbjct  743  LFTEGRSMQLLDKLVQNSCSTSEALRSIHIGLLCVQRCPNDRPSMSVVVMMLGSDIKLPL  802

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T+++L+ R
Sbjct  803  PKEPGFFNERNLLQENTS---QSQPNEMTMTVLSAR  835



>ref|XP_011013157.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  667  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGCRNRGFSHPDHHLNLIGHAWI  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL+ E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  V+ ML N+ +L  
Sbjct  727  LFKQGRSLELVGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVILMLGNEDELPQ  786

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  787  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  824



>ref|XP_010313654.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Solanum lycopersicum]
Length=830

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 112/161 (70%), Gaps = 10/161 (6%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GY+SPEYA  G++S KSDVFSFGV VLEIVSGK NR FSH DH  NL  +AW L
Sbjct  674  RVVGTYGYLSPEYAVHGVYSVKSDVFSFGVLVLEIVSGKGNRKFSHPDHNLNLLGHAWTL  733

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+ELL +  +  C+  +V+RSIHVGLLCVQ  PEDRPSM SVV ML+N+  L  A
Sbjct  734  YKEGRSMELLGDFPIGVCSTPEVIRSIHVGLLCVQHRPEDRPSMSSVVMMLNNEGVLPPA  793

Query  240  KKPGFFTGRAIEAHISTVEITDS------VNEVTISLLNPR  136
            K+P FF    +E +    E + S      VNE+TI+ L+PR
Sbjct  794  KQPAFF----VETNTPDSEFSSSQHAHSTVNEITITTLDPR  830



>ref|XP_004251482.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Solanum lycopersicum]
Length=829

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 112/161 (70%), Gaps = 10/161 (6%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GY+SPEYA  G++S KSDVFSFGV VLEIVSGK NR FSH DH  NL  +AW L
Sbjct  673  RVVGTYGYLSPEYAVHGVYSVKSDVFSFGVLVLEIVSGKGNRKFSHPDHNLNLLGHAWTL  732

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GRS+ELL +  +  C+  +V+RSIHVGLLCVQ  PEDRPSM SVV ML+N+  L  A
Sbjct  733  YKEGRSMELLGDFPIGVCSTPEVIRSIHVGLLCVQHRPEDRPSMSSVVMMLNNEGVLPPA  792

Query  240  KKPGFFTGRAIEAHISTVEITDS------VNEVTISLLNPR  136
            K+P FF    +E +    E + S      VNE+TI+ L+PR
Sbjct  793  KQPAFF----VETNTPDSEFSSSQHAHSTVNEITITTLDPR  829



>ref|XP_007021195.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12720.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=1121

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 117/162 (72%), Gaps = 2/162 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGF H DH  NL  +AW+
Sbjct  664  NKVVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSGKKNRGFFHPDHDHNLLGHAWR  723

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+D+ L + C  ++V R IHVGLLCVQQ PEDRP+M SV+ MLS+++ L  
Sbjct  724  LWTERRPMELIDDALRDFCLPSEVQRCIHVGLLCVQQRPEDRPNMSSVILMLSSESALPQ  783

Query  243  AKKPGFFTGRAI-EAH-ISTVEITDSVNEVTISLLNPR*K*M  124
             K+PGFFTGR + EA   S+   + S NE TI+LL  R K M
Sbjct  784  PKQPGFFTGRNLPEAESSSSNSKSSSANECTITLLKARLKEM  825



>ref|XP_007021188.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
 gb|EOY12713.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
Length=865

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYM+PEYA  G++S KSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AW+L
Sbjct  709  KVVGTYGYMAPEYAIDGLYSIKSDVFSFGVLVLEIVSGKRNRGFCHPDHQLNLLGHAWRL  768

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y  G S EL+   + E+CNL++VLRSI VGLLCVQQ P+DRPSM +VVQML +   L   
Sbjct  769  YSVGDSFELIASPIKETCNLSEVLRSIDVGLLCVQQSPKDRPSMCNVVQMLGSQGPLPQP  828

Query  240  KKPGFFTGRAIE--AHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +   +  ST     S N+ TI+ L  R
Sbjct  829  KQPGFFTERDLVEFSSPSTKHKLFSSNDFTITQLEAR  865



>ref|XP_006452072.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65312.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=836

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+ GK+NRGF+H DH  NL  +AW+L
Sbjct  680  RVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHAWRL  739

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D+ L  SC+ ++ LR I VGLLCVQQ PEDRP+M SVV MLS +  L   
Sbjct  740  WIEERPLELIDQSLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQP  799

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            ++PGFFTGR +      S+ + + S NE+T+S+L  R
Sbjct  800  QQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  836



>gb|KDO74340.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=836

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+ GK+NRGF+H DH  NL  +AW+L
Sbjct  680  RVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHAWRL  739

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D+ L  SC+ ++ LR I VGLLCVQQ PEDRP+M SVV MLS +  L   
Sbjct  740  WIEERPLELIDQSLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQP  799

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            ++PGFFTGR +      S+ + + S NE+T+S+L  R
Sbjct  800  QQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  836



>ref|XP_006350372.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=834

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDVFSFGV +LEI+SG RNRGF H DH+ NL  + W 
Sbjct  675  TRVVGTYGYMSPEYAEEGKFSVKSDVFSFGVVILEILSGTRNRGFIHPDHHHNLLGHVWI  734

Query  423  LYRDGRSIELLDEHLVESC-NLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLA  247
             +++GR +E+++ HL E C NL +V RS+HVGLLCVQQ PEDRPSM SVV MLS+D  L 
Sbjct  735  HFKEGRVMEVINTHLKELCNNLCEVQRSVHVGLLCVQQCPEDRPSMSSVVLMLSSDVPLP  794

Query  246  IAKKPGFFTGRAI--EAHISTVEITD-SVNEVTISLLNPR  136
              K+PGFFT R+   E + S+ ++ + S N+++I+LL+ R
Sbjct  795  SPKEPGFFTSRSRFGEVNSSSSKLGEHSGNQLSITLLDAR  834



>ref|XP_006475244.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Citrus sinensis]
Length=841

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 112/157 (71%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+ GK+NRGF+H DH  NL  +AW+L
Sbjct  685  RVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHAWRL  744

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + R +EL+D+ L  SC+ ++ LR I VGLLCVQQ PEDRP+M SVV MLS +  L   
Sbjct  745  WIEERPLELIDQSLDNSCSFSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQP  804

Query  240  KKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            ++PGFFTGR +      S+ + + S NE+T+S+L  R
Sbjct  805  QQPGFFTGRNLPESESSSSRQYSASTNEITLSVLEAR  841



>gb|KCW61036.1| hypothetical protein EUGRSUZ_H03801, partial [Eucalyptus grandis]
Length=162

 Score =   159 bits (402),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +I+  SGYM+PEYA  G+FS KSDVFSFGV +LEI+ G++N  F  Q+H E+L + AWKL
Sbjct  5    RIISVSGYMAPEYAMQGLFSIKSDVFSFGVLLLEIICGRKNNSFHLQEHGESLLTLAWKL  64

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQML-SNDADLAI  244
            + +GRS+EL D  + ESC+  QV++ IH+GLLCVQ+ P DRP+M  +V ML +N   L  
Sbjct  65   WSEGRSLELTDPSIKESCDAIQVVKCIHIGLLCVQEDPIDRPTMLPMVHMLGANTIPLTR  124

Query  243  AKKPGFFTGRAIEA--HISTVEITDSVNEVTISLLNPR  136
               P F  GR +     IS +  T  VNEVT+S ++PR
Sbjct  125  PSLPAFSVGRNVRTLNPISLIHKTSIVNEVTLSDVSPR  162



>gb|KDP34760.1| hypothetical protein JCGZ_10540 [Jatropha curcas]
Length=655

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G+FS KSDVFSFGV +LEIVSGK+NRGF HQ+H  NL  +AWK
Sbjct  499  NRVAGTYGYMSPEYAVDGLFSMKSDVFSFGVLILEIVSGKKNRGFFHQEHNHNLLGHAWK  558

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + RS+EL+D  L ES  +++VLR I VGLLCVQQ PEDRPSM SVV MLS+ + L  
Sbjct  559  LWIEERSMELVDRKL-ESLAMSEVLRCIQVGLLCVQQRPEDRPSMASVVVMLSSKSLLPK  617

Query  243  AKKPGFFTGR-AIEAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R   EA   ST   T SVNE++ + L PR
Sbjct  618  PKQPGFFTERNKPEAESSSTNHGTSSVNEMSTTKLLPR  655



>gb|KCW58376.1| hypothetical protein EUGRSUZ_H01060 [Eucalyptus grandis]
Length=815

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 116/157 (74%), Gaps = 5/157 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEI+SGKRNRGF H DH  NL  +AW+
Sbjct  663  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIISGKRNRGFRHPDHDHNLLGHAWR  722

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS +LLD+ +  SC+ +  LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  723  LFTEGRSPQLLDKLVENSCSTSDALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  782

Query  243  AKKPGFFTGRAIEAHISTVEITDS-VNEVTISLLNPR  136
             K+PGFF     E+++     + S  NE+T+++L+ R
Sbjct  783  PKEPGFFN----ESNLLQENTSQSQPNEMTMTVLSAR  815



>ref|XP_011000517.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGFSH DH+ NL  +AW 
Sbjct  667  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGCRNRGFSHPDHHLNLIGHAWI  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L++ GRS+EL  E  VE+  L++VLRSIHVGLLCVQ+  EDRP+M  V+ ML N+ +L  
Sbjct  727  LFKQGRSLELAGESKVETPYLSEVLRSIHVGLLCVQENTEDRPNMSYVILMLGNEDELPQ  786

Query  243  AKKPGFFTGR-AIEAHISTVEIT-DSVNEVTISLLNPR  136
             K+PGFFT R  IEA  S+ +    S NE +ISLL  R
Sbjct  787  PKQPGFFTERDLIEACYSSSQCKPPSANECSISLLEAR  824



>emb|CBI20443.3| unnamed protein product [Vitis vinifera]
Length=174

 Score =   159 bits (402),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEIVSGKRN GF+H D   NL  +AW 
Sbjct  24   TRVAGTLGYMSPEYASEGLYSTKSDVFSFGVLVLEIVSGKRNIGFNHPDRNINLLGHAWT  83

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++ RS E +D  L  +CNL++V+  I++GLLCVQ++P DRPSM+SVV MLS++  L  
Sbjct  84   LYKEDRSSEFIDASLGNTCNLSEVIPIINLGLLCVQRFPNDRPSMHSVVLMLSSEGALPQ  143

Query  243  AKKPGFFTGRAI  208
             K+P FFT R++
Sbjct  144  PKEPCFFTDRSM  155



>ref|XP_006377802.1| hypothetical protein POPTR_0011s13020g [Populus trichocarpa]
 gb|ERP55599.1| hypothetical protein POPTR_0011s13020g [Populus trichocarpa]
Length=220

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIV G RNRGFSH DH+ NL  +AW+
Sbjct  63   NKVVGTYGYISPEYAKFGLYSLKSDVFSFGVLVLEIVCGNRNRGFSHPDHHMNLLGHAWR  122

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL  E +  +C  ++VLRSIHV LLCVQ  PEDRP+M   V ML N+  L  
Sbjct  123  LFMEGRPLELAAESIAITCYSSEVLRSIHVALLCVQDRPEDRPNMSCAVLMLGNNDALPQ  182

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K PGFFT R +   ++ S++    S NE +IS+L  R
Sbjct  183  PKHPGFFTERDLFEASYSSSMSKPSSANECSISVLEAR  220



>ref|XP_006452080.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
 gb|ESR65320.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
Length=822

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  665  NRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGKRNRGFYHADHRHNLLGHAWQ  724

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+   R  EL+D+ L +SC+L++ +R I VGLLCVQQ PEDRP+M SVV MLS +  L  
Sbjct  725  LWIQDRPAELIDKSLYDSCSLSEAIRCIQVGLLCVQQIPEDRPNMLSVVLMLSGERSLPQ  784

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +      S+ +   S NE++ S+L  R
Sbjct  785  PKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR  822



>ref|XP_008359301.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Malus domestica]
Length=808

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF H +H +NL  +AWK
Sbjct  656  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHPNHSQNLVGHAWK  715

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  L  SC L++ LR IHV LLCVQ  PEDRP+M SVV ML ++  L  
Sbjct  716  LWNEGRPLELIDTCLAGSCMLSEALRCIHVSLLCVQHNPEDRPNMASVVIMLGSEIALTH  775

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT   +E+H +  + + S NE++I+LL PR
Sbjct  776  PKQPGFFT--KMESHEAGNQ-SSSTNEISITLLEPR  808



>ref|XP_011030936.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=805

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S+IV   GYMSPEYA +G FS KSD FSFGV VLEIVSGK+NRGF H D   NL  +AW 
Sbjct  648  SRIVGTYGYMSPEYASNGYFSVKSDAFSFGVLVLEIVSGKKNRGFRHLDPNLNLLGHAWM  707

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+  G   EL+DE L+ESCNL++VLR IHV LLCVQQ PEDRP+M +VV +L ++  L  
Sbjct  708  LWIKGTPFELIDECLIESCNLSEVLRCIHVALLCVQQRPEDRPNMSAVVLILGSEIPLPQ  767

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF G     ++  S   +T S +EV++  L+PR
Sbjct  768  PKQPGFFMGENPHEQSTSSNKHVTYSGDEVSLISLDPR  805



>ref|XP_008359300.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Malus domestica]
Length=809

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF H +H +NL  +AWK
Sbjct  657  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHPNHSQNLVGHAWK  716

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GR +EL+D  L  SC L++ LR IHV LLCVQ  PEDRP+M SVV ML ++  L  
Sbjct  717  LWNEGRPLELIDTCLAGSCMLSEALRCIHVSLLCVQHNPEDRPNMASVVIMLGSEIALTH  776

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT   +E+H +  + + S NE++I+LL PR
Sbjct  777  PKQPGFFT--KMESHEAGNQ-SSSTNEISITLLEPR  809



>ref|XP_004231576.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=842

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 113/160 (71%), Gaps = 5/160 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G FS KSDVFSFGV VLEI+S KRNRGF H DH  NL  + + L
Sbjct  683  RVVGTYGYMSPEYAEEGKFSVKSDVFSFGVLVLEILSRKRNRGFFHPDHNHNLLGHVYIL  742

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ R +E++DE L +SCN  +V RS HVGLLCVQQ PEDRPSM SVV ML +D  L + 
Sbjct  743  FKESRVMEVIDEQLRQSCNQYEVERSAHVGLLCVQQCPEDRPSMASVVLMLGSDVALPLP  802

Query  240  KKPGFFTGR----AIEAHISTVEITD-SVNEVTISLLNPR  136
            K+PGFF GR    A EA  S+ +  + S+NE++I+ L+ R
Sbjct  803  KEPGFFNGRSQSTATEADTSSSKHGETSINELSITQLDAR  842



>ref|XP_010064869.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
 gb|KCW69732.1| hypothetical protein EUGRSUZ_F03113 [Eucalyptus grandis]
Length=814

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 112/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  662  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSGKRNRGFHHPDHDHNLLGHAWR  721

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G S++LLD+ +  SC+ ++ LRSIH+ LLCVQ+ P DRPSM +VV ML +D +L +
Sbjct  722  LFTEGSSMQLLDKLVPNSCSTSEALRSIHIALLCVQRCPNDRPSMSAVVMMLGSDIELPL  781

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R +    ++       NE+T++LL  R
Sbjct  782  PKEPGFFNERNLLQENTS---PSQPNEITMTLLFAR  814



>ref|XP_011030935.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Populus euphratica]
Length=808

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S+IV   GYMSPEYA +G FS KSD FSFGV VLEIVSGK+NRGF H D   NL  +AW 
Sbjct  651  SRIVGTYGYMSPEYASNGYFSVKSDAFSFGVLVLEIVSGKKNRGFRHLDPNLNLLGHAWM  710

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+  G   EL+DE L+ESCNL++VLR IHV LLCVQQ PEDRP+M +VV +L ++  L  
Sbjct  711  LWIKGTPFELIDECLIESCNLSEVLRCIHVALLCVQQRPEDRPNMSAVVLILGSEIPLPQ  770

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF G     ++  S   +T S +EV++  L+PR
Sbjct  771  PKQPGFFMGENPHEQSTSSNKHVTYSGDEVSLISLDPR  808



>ref|XP_011030919.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Populus euphratica]
Length=353

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 115/168 (68%), Gaps = 2/168 (1%)
 Frame = -1

Query  633  FLVVENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDH  454
            F+  +     S++V   GYM+PEYA  G+FS KSDVFSFGV +LEI+SGK+++GF H DH
Sbjct  186  FVADQTEGDTSRVVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKKSKGFYHPDH  245

Query  453  YENLPSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQ  274
              +L  + W+L+  G++ E +D    ESCN ++VLR IH+ LLCVQQ+P+DRPSM SVV+
Sbjct  246  SLSLVGHTWRLWNQGKASEFIDALRDESCNPSEVLRCIHISLLCVQQHPDDRPSMASVVR  305

Query  273  MLSNDADLAIAKKPGFFTGRA-IEAHISTVEIT-DSVNEVTISLLNPR  136
            ML  ++ L   K+P F   R  +E+  S+ ++   S NE+T+S+L PR
Sbjct  306  MLGGESALPKPKEPAFLNDRGPLESTSSSNKVGLSSTNEITVSVLEPR  353



>ref|XP_008366279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=827

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 114/165 (69%), Gaps = 6/165 (4%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            EN N   ++V   GYMSPEY   G+FS KSDV+SFGV VLEI+SGK+NRGF H DH  NL
Sbjct  665  ENTN---RVVGTYGYMSPEYVVDGLFSVKSDVYSFGVMVLEILSGKKNRGFHHPDHQLNL  721

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+ +GR  E++DE L  SC   +V R IH+ LLCVQQ PEDRP+M SVV ML  
Sbjct  722  LGHAWILWIEGRPTEIMDEKLDGSCAPPEVSRCIHIALLCVQQQPEDRPNMASVVLMLGG  781

Query  261  DADLAIAKKPGFFTGR-AIEAHIS--TVEITDSVNEVTISLLNPR  136
            +  L I K+PGFFT R ++EA+ S  T   + S+NE++++LL  R
Sbjct  782  EGSLPIPKQPGFFTERNSVEANASSPTKYESHSINEMSLTLLEAR  826



>emb|CBI20432.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 2/156 (1%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEYA  G++S KSDVF+F V VLEIVSGKRNRGF H DHY NL  +AW LY
Sbjct  17   VVGTYGYMSPEYAIHGVYSIKSDVFNFSVLVLEIVSGKRNRGFRHPDHYLNLLGHAWTLY  76

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
             + R +EL+D+ +  +CNL +VLRSI+VGLLCVQ+  +DRPSM S+VQML ++  L   K
Sbjct  77   MEDRYLELIDKSIGVTCNLPEVLRSINVGLLCVQRSLDDRPSMSSMVQMLGSEGALPQPK  136

Query  237  KPGFFTGRAI-EAHISTVEITD-SVNEVTISLLNPR  136
            +PGFFT   I EA+ S+ +    S N+ +++ L  R
Sbjct  137  EPGFFTETNIHEANSSSSKHAPFSGNKSSLTFLEAR  172



>gb|ADG96406.1| S-locus receptor kinase-like protein, partial [Olea europaea]
Length=209

 Score =   160 bits (404),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV V+EIV+GK+NRGF H ++  NL ++AW+L
Sbjct  51   RVVGTYGYMSPEYAMDGLFSMKSDVFSFGVLVVEIVTGKKNRGFYHTNNQLNLLAHAWRL  110

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSND-ADLAI  244
            +R+GR +EL+D    ES + ++VLR I VGLLCVQ+  EDRP+M +VV MLS+D A ++ 
Sbjct  111  WREGRGMELMDSAAGESYSPSEVLRCIQVGLLCVQEQAEDRPNMDTVVLMLSSDTASMSQ  170

Query  243  AKKPGFFTGRA---IEAHISTVEITDSVNEVTISLLNPR  136
             K PGF  GR     E+  S  + + +VN+VT+++L+ R
Sbjct  171  PKNPGFCMGRRPADTESSSSKQDESCTVNQVTVTILDGR  209



>ref|XP_008355367.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 isoform X2 [Malus domestica]
Length=357

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEYA  G FS KSDVFSFG+ +LE +SGKR+RGF   +H  NL  +AW+L
Sbjct  191  RVVGTYGYMAPEYAIDGHFSIKSDVFSFGILLLETLSGKRSRGFYDPNHNXNLIGHAWRL  250

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GRS+EL+DE+L +SC+L++VLR IHV LLCVQQ PEDRP+M SVV ML  ++ L   
Sbjct  251  WKEGRSLELIDEYLTDSCSLSEVLRCIHVSLLCVQQLPEDRPTMSSVVLMLGGESALPQP  310

Query  240  KKPGFFTGR  214
            KKPG F G+
Sbjct  311  KKPGLFIGK  319



>ref|XP_010064916.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104452086 
[Eucalyptus grandis]
Length=1670

 Score =   172 bits (435),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 1/155 (1%)
 Frame = -1

Query  600   KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
             ++V   GYMSPEYA  G+FS K DVFS+GV VLE VSGKRNRGF H DH  NL  +AW+L
Sbjct  1517  RVVGTYGYMSPEYAIDGVFSVKLDVFSYGVLVLETVSGKRNRGFRHPDHCHNLVGHAWRL  1576

Query  420   YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
             + + RS+E LDE LVES N  +VLRSIHV LLCVQQ PEDRPSM +V+ ML +  +L + 
Sbjct  1577  FTEDRSMEQLDE-LVESYNAAEVLRSIHVALLCVQQCPEDRPSMSAVILMLGSADELPLP  1635

Query  240   KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGF+  R +    +      S NE+T++LL+PR
Sbjct  1636  KEPGFYNERKLPPEHTFSHPVHSPNEITMTLLSPR  1670


 Score =   171 bits (432),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FSTKSDVFS+GV VLEIVS KRNRGF H DH  NL  +AW+
Sbjct  655  NRVVGTYGYMSPEYALDGVFSTKSDVFSYGVLVLEIVSRKRNRGFHHPDHDHNLLGHAWR  714

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS++LLD+ +  SC+ ++ LRSIH+GLLCVQ+ P+DRPSM +VV ML +D +L +
Sbjct  715  LFTEGRSMQLLDQLVANSCSTSEALRSIHIGLLCVQRCPDDRPSMSTVVMMLGSDIELPL  774

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLL  145
             K+PGFF  R +    ++       NE+T+++L
Sbjct  775  PKEPGFFNERNLLQENTS---QSQPNEMTMTVL  804



>ref|XP_004487639.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Cicer arietinum]
Length=834

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +IV   GYM+PEYA  G+FS KSDVFSFGV ++EI+SGKR+RG+ +QD   NL  YAWKL
Sbjct  679  RIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLMEIISGKRSRGYYNQDQIHNLIGYAWKL  738

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR+I+L+D+ + ++C ++QVL  IHV LLCVQQ PEDRP M SV+ ML +D +L   
Sbjct  739  WKEGRAIKLIDKSIEDTCFMSQVLHCIHVSLLCVQQNPEDRPGMSSVILMLVSDFELPEP  798

Query  240  KKPGFFTGRAIEAHISTVE-ITDSVNEVTISLLNPR  136
            K+PGFF+  + E   ST + +  S NE+TI+LL  R
Sbjct  799  KQPGFFSKDSSETESSTSKHLLSSTNEITITLLEAR  834



>gb|KDO74353.1| hypothetical protein CISIN_1g003272mg [Citrus sinensis]
Length=834

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  677  NRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGKRNRGFYHADHRHNLLGHAWQ  736

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+   R  EL+D+ L +SC+L++ +R I VGLLCVQQ PEDRP+M SVV MLS +  L  
Sbjct  737  LWIQDRPAELIDKSLYDSCSLSEAIRCIQVGLLCVQQIPEDRPNMLSVVLMLSGERSLPQ  796

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +      S+ +   S NE++ S+L  R
Sbjct  797  PKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR  834



>ref|XP_007213634.1| hypothetical protein PRUPE_ppa001824mg [Prunus persica]
 gb|EMJ14833.1| hypothetical protein PRUPE_ppa001824mg [Prunus persica]
Length=760

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = -1

Query  621  ENNN*QSKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENL  442
            EN N   ++V   GYMSPEY   G+FS KSDV+SFGV VLEIVSGK+NRGF H +H  NL
Sbjct  600  ENTN---RVVGTYGYMSPEYVVDGLFSIKSDVYSFGVMVLEIVSGKKNRGFYHPEHKLNL  656

Query  441  PSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSN  262
              +AW L+ +GR +E+LD+ L  SC L  V R IH+ LLCVQQ PEDRP+M SVV ML  
Sbjct  657  LGHAWTLWIEGRPLEVLDKMLDGSCPLPDVSRCIHIALLCVQQQPEDRPNMASVVLMLGG  716

Query  261  DADLAIAKKPGFFTGR-AIEAHISTVEI-TDSVNEVTISLLNPR  136
            +  L   K+PGFFT R  +EA  S+ +  + S+NE++++LL  R
Sbjct  717  EGSLPAPKQPGFFTDRNPVEADSSSTKRESHSINEMSVTLLEAR  760



>ref|XP_006594797.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Glycine max]
Length=809

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +IV   GYM+PEYA  G+FS KSDVFSFGV +LEI+SGKR+RG+ +Q+H +NL  +AWKL
Sbjct  654  RIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLIGHAWKL  713

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D+ + +S +L+Q+L  IHV LLCVQQ PEDRP M SV+ ML ++ +L   
Sbjct  714  WKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQNPEDRPGMSSVLLMLVSELELPEP  773

Query  240  KKPGFFTGRAIEAHISTV-EITDSVNEVTISLLNPR  136
            K+PGFF   + EA  ST  +   S NE+TI+LL  R
Sbjct  774  KQPGFFGKYSGEADSSTSKQQLSSTNEITITLLEAR  809



>ref|XP_002317547.2| hypothetical protein POPTR_0011s13190g [Populus trichocarpa]
 gb|EEE98159.2| hypothetical protein POPTR_0011s13190g [Populus trichocarpa]
Length=775

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 5/168 (3%)
 Frame = -1

Query  624  VENNN*QSK---IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDH  454
            VE N  +SK   +V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH
Sbjct  608  VEGNETESKTRKVVGTYGYISPEYAFHGLYSLKSDVFSFGVLVLEIVSGNRNRGFYHPDH  667

Query  453  YENLPSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQ  274
              NL  +AW L+ +GR +EL+ E  +E+CNL++VLR I VGLLCVQ+ PEDRPS+  VV 
Sbjct  668  QLNLLGHAWTLFNEGRPLELIAESTIETCNLSEVLRVIQVGLLCVQESPEDRPSISYVVL  727

Query  273  MLSNDADLAIAKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            ML N+ +L   K+PG+FT R +   +++ +     S N+ +ISL+  R
Sbjct  728  MLGNEDELPQPKQPGYFTARDVIESSNLPSHSKRYSTNDCSISLVEAR  775



>ref|XP_011015603.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Populus euphratica]
Length=827

 Score =   169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPE A  G++S KSD+FSFGV VLEIVSG +NRGFSH DH+ NL  +AW 
Sbjct  670  NKVVGTYGYISPECANYGLYSVKSDIFSFGVLVLEIVSGNKNRGFSHPDHHLNLLGHAWI  729

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++ RS+EL  + +  +CNL++VLRSIHVGLLCVQ+ PE RP+M +VV ML ND  L  
Sbjct  730  LFKENRSLELAADSIAITCNLSEVLRSIHVGLLCVQENPEMRPTMSNVVLMLGNDDVLPQ  789

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             ++PGFFT R +   +  S++    SVNE ++S L PR
Sbjct  790  PEQPGFFTEREVIGASCPSSLGKPCSVNECSVSELEPR  827



>ref|XP_006594796.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Glycine max]
Length=833

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +IV   GYM+PEYA  G+FS KSDVFSFGV +LEI+SGKR+RG+ +Q+H +NL  +AWKL
Sbjct  678  RIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLIGHAWKL  737

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D+ + +S +L+Q+L  IHV LLCVQQ PEDRP M SV+ ML ++ +L   
Sbjct  738  WKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQNPEDRPGMSSVLLMLVSELELPEP  797

Query  240  KKPGFFTGRAIEAHISTV-EITDSVNEVTISLLNPR  136
            K+PGFF   + EA  ST  +   S NE+TI+LL  R
Sbjct  798  KQPGFFGKYSGEADSSTSKQQLSSTNEITITLLEAR  833



>emb|CDP05837.1| unnamed protein product [Coffea canephora]
Length=849

 Score =   169 bits (429),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 12/156 (8%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +IV   GYMSPEYAG G+FS KSDV+SFGV VLE +SGKRNR F HQ  + NL  +AWKL
Sbjct  705  RIVGTHGYMSPEYAGDGLFSVKSDVYSFGVLVLETISGKRNRPFLHQGCHLNLLGHAWKL  764

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++GR +EL++ H+V SC+  +VLRSIHVGLLCVQQ P DRP M +V+ ML N+  L  A
Sbjct  765  YKEGRELELVNSHIVNSCHPLEVLRSIHVGLLCVQQCPYDRPDMSTVIFMLGNEVVLPEA  824

Query  240  KKPGFFTGRAIEAHISTVEITDSVN-EVTISLLNPR  136
            K+PGFF    IE++I        VN E++I+LL  R
Sbjct  825  KQPGFF----IESNI-------VVNAEMSITLLEAR  849



>gb|KHN36756.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=833

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 115/156 (74%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            +IV   GYM+PEYA  G+FS KSDVFSFGV +LEI+SGKR+RG+ +Q+H +NL  +AWKL
Sbjct  678  RIVGTYGYMAPEYATDGLFSVKSDVFSFGVLLLEIISGKRSRGYYNQNHSQNLIGHAWKL  737

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++GR +EL+D+ + +S +L+Q+L  IHV LLCVQQ PEDRP M SV+ ML ++ +L   
Sbjct  738  WKEGRPLELIDKSIEDSSSLSQMLHCIHVSLLCVQQNPEDRPGMSSVLLMLVSELELPEP  797

Query  240  KKPGFFTGRAIEAHISTV-EITDSVNEVTISLLNPR  136
            K+PGFF   + EA  ST  +   S NE+TI+LL  R
Sbjct  798  KQPGFFGKYSGEADSSTSKQQLSSTNEITITLLEAR  833



>ref|XP_010320284.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Solanum lycopersicum]
Length=794

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGF H  H  NL  + WKLY
Sbjct  642  VVGTHGYMSPEYLIHGVFSIKSDVFSFGVLVLEIISGRRNRGFFHGSHSINLLGHVWKLY  701

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR +EL+D H+ +SC  T++LR IHV LLC Q  PEDRP M  VV ML+NDA L  +K
Sbjct  702  KEGRPLELIDLHITDSCYFTELLRLIHVALLCAQHSPEDRPDMSEVVVMLANDAILPESK  761

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGF+T     ++  ST     S NE+TI+ L+PR
Sbjct  762  EPGFYTESIFPDSEYSTTMY--SKNEITITQLDPR  794



>ref|XP_008372832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Malus domestica]
Length=797

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDVFSFGV +LE++  K+NRGF H DH+ NL  +AW 
Sbjct  643  NRVVGTYGYMSPEYAVDGIFSMKSDVFSFGVILLEMLCRKKNRGFCHPDHHLNLLGHAWM  702

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+   + +EL+D+ L +SCN+ +V+R +HVGLLCVQ+ PEDRPSM SVV MLS+D  L  
Sbjct  703  LWXQDKQLELIDKTLSDSCNIYEVVRCLHVGLLCVQRVPEDRPSMSSVVLMLSSDVALPS  762

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGF+T R++    S+     S N+V+I L+ PR
Sbjct  763  PKQPGFYTERSVSESPSSKRXC-SENDVSIXLIEPR  797



>ref|XP_002317545.2| hypothetical protein POPTR_0011s13190g [Populus trichocarpa]
 gb|EEE98157.2| hypothetical protein POPTR_0011s13190g [Populus trichocarpa]
Length=822

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 116/168 (69%), Gaps = 5/168 (3%)
 Frame = -1

Query  624  VENNN*QSK---IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDH  454
            VE N  +SK   +V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH
Sbjct  655  VEGNETESKTRKVVGTYGYISPEYAFHGLYSLKSDVFSFGVLVLEIVSGNRNRGFYHPDH  714

Query  453  YENLPSYAWKLYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQ  274
              NL  +AW L+ +GR +EL+ E  +E+CNL++VLR I VGLLCVQ+ PEDRPS+  VV 
Sbjct  715  QLNLLGHAWTLFNEGRPLELIAESTIETCNLSEVLRVIQVGLLCVQESPEDRPSISYVVL  774

Query  273  MLSNDADLAIAKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
            ML N+ +L   K+PG+FT R +   +++ +     S N+ +ISL+  R
Sbjct  775  MLGNEDELPQPKQPGYFTARDVIESSNLPSHSKRYSTNDCSISLVEAR  822



>ref|XP_010647533.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=824

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 117/158 (74%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV VLEIV+GKRNRGF H DH  NL  +AW 
Sbjct  667  TRVAGTLGYMSPEYATEGLYSTKSDVFSFGVLVLEIVTGKRNRGFFHPDHGYNLLGHAWT  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +GRS+EL+D  + ++ NL++VLR+I++GLLCVQ++P DRPSM+SVV ML+++  L  
Sbjct  727  LYMEGRSLELIDPSMGDTSNLSEVLRTINMGLLCVQRFPNDRPSMHSVVLMLASECALPR  786

Query  243  AKKPGFFTGR-AIEAH-ISTVEITDSVNEVTISLLNPR  136
             ++P FFT R  +EA+ +    +  S NE +I+LL  R
Sbjct  787  PREPCFFTERNVVEANPVPGEHMLFSGNETSITLLEAR  824



>ref|XP_006370397.1| hypothetical protein POPTR_0001s42230g [Populus trichocarpa]
 gb|ERP66966.1| hypothetical protein POPTR_0001s42230g [Populus trichocarpa]
Length=777

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  620  NKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFCHPDHQLNLLGHAWR  679

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR +EL+   + E+C L++VLRSIH+GLLCVQ+  +DRP+M  VV ML N+ +L  
Sbjct  680  LFKEGRHVELVGGLIFETCKLSEVLRSIHIGLLCVQENAKDRPNMSQVVLMLGNEDELPQ  739

Query  243  AKKPGFFTGR-AIEA-HISTVEITDSVNEVTISLLNPR  136
             K PGFFTGR  IEA H  +     S N  ++SLL  R
Sbjct  740  PKHPGFFTGRDLIEASHSLSQNKPCSANGCSVSLLEAR  777



>ref|XP_011030923.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=822

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 108/156 (69%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG +NRGF H +H  NL  +AW+L
Sbjct  667  KVAGTYGYISPEYAIEGLYSVKSDVFSFGVLVLEIVSGYKNRGFRHPEHNLNLLGHAWRL  726

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +RDGR +EL+ + +VE+ NL+QVLRSIHV LLCVQ   EDRP M  VV MLSND  L   
Sbjct  727  FRDGRPMELVRQSIVEASNLSQVLRSIHVALLCVQDNREDRPDMSYVVLMLSNDNTLPQP  786

Query  240  KKPGFFTGRAIEAHISTVEIT-DSVNEVTISLLNPR  136
            K PGFF  R      ST E T +S N+ +I+LL  R
Sbjct  787  KHPGFFIERDPAEASSTSEGTANSANKCSITLLQAR  822



>ref|XP_002522177.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
 gb|EEF40218.1| S-locus-specific glycoprotein S6 precursor, putative [Ricinus 
communis]
Length=838

 Score =   169 bits (428),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GYMSPEYA  G++S KSDVFSFGV VLEIVSG++NRGF H +H+ NL  +AW+
Sbjct  681  NKVVGTYGYMSPEYAIKGLYSAKSDVFSFGVMVLEIVSGQKNRGFCHPEHHHNLLGHAWR  740

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY++GR  EL+   + ++CNL++ LRS H+GLLCVQ+ PEDRPSM +VV ML  +  L  
Sbjct  741  LYKEGRCCELIAASVRDTCNLSEALRSAHIGLLCVQRSPEDRPSMSAVVLMLGGEGPLPE  800

Query  243  AKKPGFFTGRAIEAHIST--VEITDSVNEVTISLLNPR  136
             K+PGFFT   I    ST   +   S+N +TI+ L  R
Sbjct  801  PKQPGFFTEGEISEASSTSGSQKPCSLNVLTITTLAAR  838



>ref|XP_007133304.1| hypothetical protein PHAVU_011G1684001g, partial [Phaseolus vulgaris]
 gb|ESW05298.1| hypothetical protein PHAVU_011G1684001g, partial [Phaseolus vulgaris]
Length=353

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S IV   GYM+PEYA  G+FSTKSDVFSFGV +LEI+SGK+NR F+ QD+  NL  +AW 
Sbjct  196  SIIVGTHGYMAPEYAIDGLFSTKSDVFSFGVLLLEILSGKKNRVFTFQDNNHNLIDHAWN  255

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G   +L+D  L  S N+ QV+R I +GLLC+QQ+P DRP+M SVV ML+++  L  
Sbjct  256  LWKEGTPEQLIDACLENSYNVLQVVRCIQIGLLCLQQHPNDRPNMTSVVVMLTSENSLPE  315

Query  243  AKKPGFFTGRAIE--AHISTVEITDSVNEVTISLLNPR  136
             K+PGF   RA +   + S  + + SVNEV+ISLLN R
Sbjct  316  PKEPGFLIRRASKDGENSSNRQTSSSVNEVSISLLNAR  353



>gb|KDO74350.1| hypothetical protein CISIN_1g005933mg [Citrus sinensis]
Length=669

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 109/157 (69%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIV GKRNRGF H DH+ NL  +AW+L
Sbjct  513  RVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVCGKRNRGFYHADHHHNLLGHAWRL  572

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + + RS+EL+D+ L  S +L++ LR I VGLLCVQQ PEDRP+M SVV MLS +  L   
Sbjct  573  WTEDRSLELIDKSLDGSYSLSEALRCIQVGLLCVQQRPEDRPNMSSVVLMLSGERSLPQP  632

Query  240  KKPGFFTGRAIEAHISTVEITD--SVNEVTISLLNPR  136
            K+PGFFT R +    S+         NE+TISL+  R
Sbjct  633  KQPGFFTERNLPESESSSSKRKLPLSNEITISLIEGR  669



>ref|XP_011095777.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Sesamum indicum]
Length=772

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 112/155 (72%), Gaps = 1/155 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGFS  D++ NL  +AW L
Sbjct  619  RVVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGKRNRGFSDSDYHLNLLGHAWTL  678

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y++ RS+EL+D  L +S  L +VLRSIHVGLLCVQ+ P+DRPSM SVV ML N+  L  A
Sbjct  679  YKEERSLELVDASLGKSFCLPEVLRSIHVGLLCVQKKPDDRPSMSSVVLMLGNEGVLPPA  738

Query  240  KKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             +PGFF  R + A  ST   T S NE+TI++   R
Sbjct  739  NQPGFFLEREVIAQSSTTTTT-STNELTITMPEGR  772



>ref|XP_010320283.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Solanum lycopersicum]
Length=818

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = -1

Query  597  IVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLY  418
            +V   GYMSPEY   G+FS KSDVFSFGV VLEI+SG+RNRGF H  H  NL  + WKLY
Sbjct  666  VVGTHGYMSPEYLIHGVFSIKSDVFSFGVLVLEIISGRRNRGFFHGSHSINLLGHVWKLY  725

Query  417  RDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIAK  238
            ++GR +EL+D H+ +SC  T++LR IHV LLC Q  PEDRP M  VV ML+NDA L  +K
Sbjct  726  KEGRPLELIDLHITDSCYFTELLRLIHVALLCAQHSPEDRPDMSEVVVMLANDAILPESK  785

Query  237  KPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            +PGF+T     ++  ST     S NE+TI+ L+PR
Sbjct  786  EPGFYTESIFPDSEYSTTMY--SKNEITITQLDPR  818



>ref|XP_007021201.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY12726.1| S-locus lectin protein kinase family protein, putative [Theobroma 
cacao]
Length=823

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 115/158 (73%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGFSH DH  NL  +AW+
Sbjct  666  NRLVGTYGYMSPEYAIDGVFSMKSDVFSFGVLVLEIVSGKKNRGFSHPDHEHNLLGHAWR  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+D+ L +    ++VLR IHVGLLCVQQ PEDRP+M SV+ ML +++ L  
Sbjct  726  LWTEKRPMELIDDALGDFRLPSEVLRCIHVGLLCVQQRPEDRPNMSSVILMLGSESALPQ  785

Query  243  AKKPGFFTGRAI-EAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA   ++   + S NE T++LL PR
Sbjct  786  PKQPGFFTERNLPEAESSTSNCKSSSANECTVTLLEPR  823



>ref|XP_006370367.1| hypothetical protein POPTR_0001s42020g [Populus trichocarpa]
 gb|ERP66936.1| hypothetical protein POPTR_0001s42020g [Populus trichocarpa]
Length=831

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +KIV   GYMSPEYA  G FS KSDVFSFGV VLEIVSGK+NRGF+H DH+ NL  +AW+
Sbjct  667  NKIVGTYGYMSPEYAVDGFFSVKSDVFSFGVLVLEIVSGKKNRGFNHPDHHHNLLGHAWR  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G  +EL++E   +SC L++++R IHVGLLCVQ+ PEDRP+M SV+ MLS+   L  
Sbjct  727  LWNEGMPLELINEPEQDSCTLSEIIRCIHVGLLCVQKRPEDRPNMSSVIVMLSSGISLPQ  786

Query  243  AKKPGFFTGRAI  208
             K+PGFFT R +
Sbjct  787  PKQPGFFTERNL  798



>gb|KDP38989.1| hypothetical protein JCGZ_00746 [Jatropha curcas]
Length=172

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYM+PEY   G+FS KSDVFSFG+ +L+  +GKR+RGF H DH  NL  YAW+L
Sbjct  16   RVVGTYGYMAPEYGSDGLFSVKSDVFSFGILMLKTTTGKRSRGFYHTDHSVNLIGYAWRL  75

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +G  +EL++  L+ESC+L +V R IH+ LLCVQQ+ EDRPSM SVV ML +   L   
Sbjct  76   WNEGNVLELVESFLMESCSLLEVKRCIHISLLCVQQHAEDRPSMASVVLMLGSKNQLPQP  135

Query  240  KKPGFFT-GRAIEAHISTVEI-TDSVNEVTISLLNPR  136
            K+PGFF   R +E    T    + S NE+++S L  R
Sbjct  136  KRPGFFIESRPLETQSPTSNPGSSSENEISLSALQGR  172



>emb|CBI20460.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 114/157 (73%), Gaps = 2/157 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G++S KSDVFSFGV VLEIV+GKRNRGF+H DH  NL  +AW L
Sbjct  501  RVVGTYGYMSPEYAIDGVYSIKSDVFSFGVLVLEIVTGKRNRGFNHPDHALNLLGHAWTL  560

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            Y +G+ +EL+D  + +SCN ++VLR+++VGLLCVQ+ P+DRPSM SVV MLS+++ L   
Sbjct  561  YMEGKPLELIDASMGDSCNQSEVLRALNVGLLCVQRSPDDRPSMSSVVLMLSSESALHQP  620

Query  240  KKPGFFTGRAIEAHISTV--EITDSVNEVTISLLNPR  136
            K+PGFFT R +    S+       S NE TI+L+  R
Sbjct  621  KEPGFFTERNMLEGSSSASKHAIFSGNEHTITLIEGR  657



>gb|ADG96405.1| S-locus receptor kinase, partial [Olea europaea]
Length=688

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEY   G FS KSD+FSFGV +LEI+SG++NRGF HQDH+ NL  +AW L
Sbjct  531  RVVGTYGYMSPEYVVDGHFSVKSDIFSFGVLILEIISGQKNRGFFHQDHHHNLLGHAWIL  590

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GRS+EL+D HL +SC L++VLRS+HV LLCVQ+ PEDRP+M +VV ML++   L   
Sbjct  591  HNEGRSLELIDSHLAQSCYLSEVLRSMHVALLCVQRNPEDRPNMSNVVLMLASAGALPKP  650

Query  240  KKPGFFTGR----AIEAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R      E   S   ++ S NE++ + +  R
Sbjct  651  KEPGFFTERNSFLGFETSSSKPTVS-SANELSFTEMEGR  688



>ref|XP_002317550.1| hypothetical protein POPTR_0011s13250g [Populus trichocarpa]
 gb|EEE98162.1| hypothetical protein POPTR_0011s13250g [Populus trichocarpa]
Length=775

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+V   GY+SPEYA  G++S KSDVFSFGV VLEIVSGKRN+GF H D+  +L  YAW+
Sbjct  619  NKVVGTYGYISPEYAIDGLYSVKSDVFSFGVMVLEIVSGKRNKGFCHPDYKLDLLGYAWR  678

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +GRS EL+ E +VESCNL + LRSI +GLLCVQ+ P DRPSM SVV ML ++++L  
Sbjct  679  LFTEGRSSELIAESIVESCNLYEALRSIQIGLLCVQRSPRDRPSMSSVVMMLGSESELPQ  738

Query  243  AKKPGFF-TGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF T  + +A  S+++   S NE+T++ L  R
Sbjct  739  PKEPGFFNTKDSGKASSSSIQSKISANEITMTQLEAR  775



>ref|XP_011013015.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=824

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 111/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  667  NKVAGTYGYISPEYAIDGLYSIKSDVFSFGVLVLEIVSGNRNRGFCHPDHDLNLLGHAWR  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR  EL+ E + ES NL++VLRSIHVGLLCVQ  P DRP+M SVV ML  +  L  
Sbjct  727  LFQEGRHFELIPESVAESYNLSEVLRSIHVGLLCVQCSPNDRPNMSSVVLMLCGEGALPP  786

Query  243  AKKPGFFTGRAI-EAHISTVEITD-SVNEVTISLLNPR  136
             K+PGFF  R + EA+  + + T  SVN+ TI+ L  R
Sbjct  787  PKQPGFFNERDLAEANTCSRQNTSCSVNQFTITQLEAR  824



>gb|KDP30509.1| hypothetical protein JCGZ_16689 [Jatropha curcas]
Length=789

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/158 (54%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSD+FSFGV VLEIVSG +NRGF   DH  NL  +AW+
Sbjct  632  NRVVGTFGYMAPEYAVDGLFSVKSDIFSFGVLVLEIVSGSKNRGFHSHDHLHNLVGHAWR  691

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+D  L ES  L++++R IHVGLLCVQQ PEDRP+M +VV ML  ++ L  
Sbjct  692  LWMEERPLELMDNMLGESATLSEIIRCIHVGLLCVQQRPEDRPNMSTVVLMLGGESSLPQ  751

Query  243  AKKPGFFTGRAI-EAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA   S+   + S NE+T + LNPR
Sbjct  752  PKQPGFFTERNVPEAESSSSYYKSTSTNEITFTELNPR  789



>gb|EYU36706.1| hypothetical protein MIMGU_mgv1a001937mg [Erythranthe guttata]
Length=736

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK NRGF+H +H  NL  +AW+L
Sbjct  581  RVVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGKTNRGFTHSEHSLNLLGHAWQL  640

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA---DL  250
             ++ RS+EL+D  L       +V RSI VGLLCVQQ PEDRP+M SVV ML N+A   ++
Sbjct  641  EKERRSLELVDPALDIDFQTAEVSRSIQVGLLCVQQNPEDRPNMSSVVFMLRNEAGSGEI  700

Query  249  AIAKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
              AK+PGFFT R I+   S     +S+NE+TI++L PR
Sbjct  701  PQAKEPGFFTRRDIQN--SNNAKPNSINEITITMLEPR  736



>ref|XP_010271902.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Nelumbo nucifera]
Length=749

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM PEY   G+FS KSDVFS+GV VLEIVSG +NRGF H +H+ N   +AW+
Sbjct  591  NRVVGTYGYMPPEYVIDGLFSMKSDVFSYGVLVLEIVSGMKNRGFYHPEHHLNFIGHAWR  650

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQML-SNDADLA  247
            L+ +G  +EL+D  L +SC L++VLR IHVGLLCVQQ PEDRP+M SV+ ML S  A L 
Sbjct  651  LWNEGDPLELIDASLRDSCTLSEVLRCIHVGLLCVQQNPEDRPTMSSVILMLGSETASLP  710

Query  246  IAKKPGFFTGR--AIEAHISTVEITDSVNEVTISLLNPR  136
              K+PGFFT R    +  +S+ +   + NE+T++LL+ R
Sbjct  711  QPKQPGFFTERNPVKDECLSSKQECSTTNEITVTLLDGR  749



>gb|KDP38979.1| hypothetical protein JCGZ_00736 [Jatropha curcas]
Length=824

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            SK+V   GYMSPEYA  G++S KSDVFSFGV +LEIVSGKRNRGF+H+DH+ NL  +AW+
Sbjct  667  SKVVGTYGYMSPEYAIDGVYSVKSDVFSFGVIMLEIVSGKRNRGFTHEDHHLNLLGHAWR  726

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GRSIEL+D  L  SCNL++VLRSIH+GLLCVQ+  + RPSM +VV ML  D  L  
Sbjct  727  LHKEGRSIELIDPSLRGSCNLSEVLRSIHIGLLCVQRSLKHRPSMSAVVLMLCGDDSLPE  786

Query  243  AKKPGFFTGRAI  208
             + PGFF  R +
Sbjct  787  PQLPGFFAERDL  798



>ref|XP_011095279.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Sesamum indicum]
Length=788

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDV+SFGV VLEIVSG++NRGF H+DH  NL  +AW  
Sbjct  633  RVVGTYGYMSPEYAIDGLFSVKSDVYSFGVLVLEIVSGQKNRGFRHKDHQHNLLGHAWMQ  692

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ RS++L+D +LV S   ++V+RSIHV LLCVQQ PEDRPSM SVV ML ++  L   
Sbjct  693  HKERRSMDLVDVNLVGSFTFSEVVRSIHVALLCVQQSPEDRPSMSSVVLMLGSEGTLPQP  752

Query  240  KKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +  A  +T     S N VTI+LL+ R
Sbjct  753  KQPGFFTERDVFAAESTTSTKASSSNNVTITLLDAR  788



>ref|XP_011016742.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Populus euphratica]
Length=350

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 113/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSDVFSFG+ +LEIV+GK++RGF H D+  +L  YAWK
Sbjct  193  NRVVGTYGYMAPEYATDGLFSVKSDVFSFGIMLLEIVTGKKSRGFYHPDNNLSLIGYAWK  252

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G+ +EL+     ES NL++V++  H+ LLCVQQYPEDRPSM SVV ML  +  L  
Sbjct  253  LWKEGKPLELVGGLADESWNLSEVMKCFHISLLCVQQYPEDRPSMASVVLMLGGEKTLPK  312

Query  243  AKKPGFFTGRA-IEAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R  +EA+  S+   + S NE++ S+L PR
Sbjct  313  PKEPGFFKDRGPVEAYSSSSKVESSSTNEISTSVLEPR  350



>ref|XP_006370573.1| hypothetical protein POPTR_0001s43900g [Populus trichocarpa]
 gb|ERP67142.1| hypothetical protein POPTR_0001s43900g [Populus trichocarpa]
Length=490

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 114/158 (72%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S++V   GYM+PEYA  G+FS KSDVFSFG+ +LEIV+GK++RGF H D+  +L  YAW+
Sbjct  333  SRVVGTYGYMAPEYATDGLFSVKSDVFSFGIMLLEIVTGKKSRGFYHPDNSLSLIGYAWR  392

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G+ +EL+D    ES NL++V++ IH+ LLCVQQYPEDRPSM SVV ML  +  L  
Sbjct  393  LWKEGKPLELVDGLAEESWNLSEVMKCIHISLLCVQQYPEDRPSMASVVLMLGGERTLPK  452

Query  243  AKKPGFFTGRA-IEAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R   EA+  S+   + S NE++ S+L PR
Sbjct  453  PKEPGFFKDRGPAEAYSSSSKVESSSTNEISTSVLEPR  490



>ref|XP_011095278.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Sesamum indicum]
Length=756

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDV+SFGV VLEIVSG++NRGF H+DH  NL  +AW  
Sbjct  601  RVVGTYGYMSPEYAIDGLFSVKSDVYSFGVLVLEIVSGQKNRGFRHKDHQHNLLGHAWMQ  660

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            +++ RS++L+D +LV S   ++V+RSIHV LLCVQQ PEDRPSM SVV ML ++  L   
Sbjct  661  HKERRSMDLVDVNLVGSFTFSEVVRSIHVALLCVQQSPEDRPSMSSVVLMLGSEGTLPQP  720

Query  240  KKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
            K+PGFFT R +  A  +T     S N VTI+LL+ R
Sbjct  721  KQPGFFTERDVFAAESTTSTKASSSNNVTITLLDAR  756



>ref|XP_007021189.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding [Theobroma cacao]
 gb|EOY12714.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding [Theobroma cacao]
Length=834

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 114/158 (72%), Gaps = 3/158 (2%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYM+PEYA  G++STKSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AW+L
Sbjct  677  KVVGTYGYMAPEYAIDGLYSTKSDVFSFGVLVLEIVSGKRNRGFCHSDHQLNLLGHAWRL  736

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +G+S+EL+   + E+ N  +VLRSIHVGLLCVQ+ PEDRP+M +VV M+ +   L+  
Sbjct  737  FGEGKSLELIASPIRETSNPCEVLRSIHVGLLCVQRSPEDRPNMVNVVLMMGSQGPLSPP  796

Query  240  KKPGFFTGR-AIEAHISTVEITD--SVNEVTISLLNPR  136
            K+PGFFT R  +EA  S++      S N++TI+ L  R
Sbjct  797  KQPGFFTERDPVEASSSSMHHHKPLSYNDLTITELKAR  834



>ref|XP_011002475.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=832

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 109/157 (69%), Gaps = 1/157 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +K+    GY+SPEYA  G++S KSDVFSFGV +LEIVSG RNRGF H DH  NL  +AW+
Sbjct  633  NKVAGTYGYISPEYANYGVYSLKSDVFSFGVLMLEIVSGNRNRGFCHPDHSLNLLGHAWR  692

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR IEL+   ++ES N +QVLRSIHVGLLCVQ+  EDRP+M  VV ML N+  L  
Sbjct  693  LFQEGRPIELVSGSIIESFNRSQVLRSIHVGLLCVQENREDRPNMSCVVLMLGNEDALPR  752

Query  243  AKKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
             K PGFF  R AIE  +       S NE +ISLL+ R
Sbjct  753  PKHPGFFIERDAIEESLPKQSKPLSENECSISLLDAR  789



>ref|XP_011007878.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Populus euphratica]
 ref|XP_011007879.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 isoform X1 [Populus euphratica]
Length=403

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 115/159 (72%), Gaps = 4/159 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            ++IV   GYM+PEYA +G+FS KSDVFSFGV +LEI+SGK+N GF   +  E+L ++AWK
Sbjct  246  NRIVGTYGYMAPEYAMAGLFSVKSDVFSFGVLLLEIISGKKNVGFHLSEEGESLLTFAWK  305

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA-DLA  247
            L+ DG+ +EL+D  L +S   T+VLR IH+GLLCVQ+ P DRP+M SV+ ML++D   L 
Sbjct  306  LWSDGQGLELMDSMLEKSSAATEVLRCIHIGLLCVQEDPADRPTMSSVLHMLASDTIALP  365

Query  246  IAKKPGFFTGR--AIEAHISTVEITDSVNEVTISLLNPR  136
            I K+P F  GR  A+E   S  ++  S NE+TIS+L+PR
Sbjct  366  IPKQPAFSIGRFVAMEGQSSNQKVC-SGNELTISVLSPR  403



>gb|KDP34761.1| hypothetical protein JCGZ_10541 [Jatropha curcas]
Length=823

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEYA  G+FS KSD+FSFGV VLEIVSG++NRGF   DH  NL  +AW+
Sbjct  666  NRVVGTFGYMAPEYAVDGLFSVKSDIFSFGVLVLEIVSGRKNRGFHSHDHLHNLVGHAWR  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ + R +EL+D  L ES  L++++R IHVGLLC QQ PEDRP+M +VV ML  ++ L  
Sbjct  726  LWMEERPLELMDNMLGESATLSEIIRCIHVGLLCAQQRPEDRPNMSTVVLMLGGESSLPQ  785

Query  243  AKKPGFFTGRAI-EAH-ISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R + EA   S+   + S NE+T + LNPR
Sbjct  786  PKQPGFFTERNVPEAESSSSYYKSTSTNEITFTELNPR  823



>ref|XP_006475274.1| PREDICTED: uncharacterized protein LOC102626881 [Citrus sinensis]
Length=1681

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGKRNRGF H DH  NL  +AW+
Sbjct  683  NRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIVSGKRNRGFYHADHRHNLLGHAWQ  742

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+   R  EL+D+ L +SC+L++ +R I VGLLCVQQ PEDRP+M SVV MLS +  L  
Sbjct  743  LWIQDRPAELIDKSLYDSCSLSEAIRCIQVGLLCVQQIPEDRPNMLSVVLMLSGERSLPQ  802

Query  243  AKKPGFFTGRAI--EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +      S+ +   S NE++ S+L  R
Sbjct  803  PKQPGFFTERNLPESESSSSKQNLSSTNEISFSMLEAR  840


 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 112/158 (71%), Gaps = 2/158 (1%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GYM PEYA  G+FS KSDVFSFGV VLE+V G RNRGF H DH+ NL  +AW+
Sbjct  1524  NRVVGTYGYMPPEYAIDGLFSVKSDVFSFGVLVLELVYGTRNRGFHHVDHHHNLLGHAWR  1583

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ + R +EL+D+ L ++ +L++ LR I VGLLCVQQ PEDRP+M SVV MLS +  L  
Sbjct  1584  LWTEDRPVELIDKSLEDTYSLSEALRCIQVGLLCVQQRPEDRPNMASVVLMLSGERSLPQ  1643

Query  243   AKKPGFFTGRAI-EAHISTVEIT-DSVNEVTISLLNPR  136
              K+PGFFT R + E+  S+   T  S N++T+SL+  R
Sbjct  1644  PKQPGFFTERNLPESESSSSNQTFHSSNQITVSLIEGR  1681



>ref|XP_010106348.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
 gb|EXC10161.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Morus notabilis]
Length=751

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S++V   GYMSPEY   G+FS KSDVFSFGV V EIVSGK+NRGF H  H  NL  +AW 
Sbjct  593  SRVVGTYGYMSPEYTIDGIFSLKSDVFSFGVLVPEIVSGKKNRGFRHAHHKLNLLGHAWM  652

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++G+S+EL+D+ + +SCN  Q LRSIHV LLCVQ+ P DRPSM +VV MLS++  L  
Sbjct  653  LHKEGKSLELIDKFVKDSCNEAQALRSIHVALLCVQRSPGDRPSMSNVVLMLSSEIALPT  712

Query  243  AKKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
             K+PGFFT R +   ++  +  E   ++N VTI++L  R
Sbjct  713  PKEPGFFTERHLSDTDSSSTKHEQPSTINRVTITVLEAR  751



>emb|CBI20445.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 109/156 (70%), Gaps = 5/156 (3%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++    GYMSPEYA  G++STKSDVFSFGV +L+IVSGKRNRGFSH  H  NL  +AW 
Sbjct  224  TRVAGTLGYMSPEYASEGLYSTKSDVFSFGVLLLKIVSGKRNRGFSHPGHDLNLLGHAWT  283

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            LY +G S+E +D   V +CNL +VLRSI+VGLLC+Q++P+DRPSM+SV+ ML ++  L  
Sbjct  284  LYIEGGSLEFIDTSKVNTCNLFEVLRSINVGLLCIQRFPDDRPSMHSVILMLGSEGALPR  343

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+P FFT R +    S   I     + TI+LL  R
Sbjct  344  PKEPCFFTDRNMMDANSFSGI-----QPTITLLEAR  374



>ref|XP_006388696.1| hypothetical protein POPTR_0118s00250g [Populus trichocarpa]
 gb|ERP47610.1| hypothetical protein POPTR_0118s00250g [Populus trichocarpa]
Length=336

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 3/159 (2%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYMSPEYA  G FS KSDVFSFGV VLEI SGK+NRGF H D   NL  +AW 
Sbjct  178  NRVVGTYGYMSPEYALDGHFSVKSDVFSFGVLVLEIASGKKNRGFCHPDQNLNLLGHAWI  237

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+ +G  ++L+DE L +S NL ++LR IHV LLCVQQ PEDRP+M +VV ML ++  L  
Sbjct  238  LWTEGTPLDLIDEGLSDSRNLAELLRCIHVALLCVQQRPEDRPTMSTVVVMLGSENPLPQ  297

Query  243  AKKPGFFTGR---AIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF G+     ++  S      S NEV+++LL  R
Sbjct  298  PKQPGFFMGKNPSEKDSSSSNKHEAHSANEVSLTLLEAR  336



>ref|XP_009361795.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=714

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G +S KSDV+SFGV VLEIVSG RNRGFSH DH  NL  +AW L
Sbjct  559  KVVGTYGYMSPEYAIDGFYSIKSDVYSFGVMVLEIVSGSRNRGFSHPDHNLNLLGHAWML  618

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GR +ELLD  + +S  L +V+R+IHVGLLCVQ+ PEDRPSM + V ML ++  L   
Sbjct  619  HTEGRPLELLDASIKDSVTLHEVVRTIHVGLLCVQRNPEDRPSMSATVLMLGSEGALPPP  678

Query  240  KKPGFFTGRAI-EAHISTVEITDSVNEVTISLLNPR  136
             KPGF++ R + E          S NEVTISL+ PR
Sbjct  679  LKPGFYSERDLTELEPGHSSKACSANEVTISLVEPR  714



>ref|XP_008366485.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-6 
[Malus domestica]
Length=1640

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -1

Query  603   SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
             +++V   GYM+PEYA  G+FS KSDVFSFG+ VLE++SG +N+GF H +H +NL  +AWK
Sbjct  1488  NRVVGTYGYMAPEYALDGLFSVKSDVFSFGILVLEVISGIKNKGFYHPNHSQNLVGHAWK  1547

Query  423   LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
             L+ +GR +EL+D  L  SC L++ LR IHV LLCVQ  PEDRP+M SVV ML ++  L  
Sbjct  1548  LWNEGRPLELIDTCLAGSCMLSEALRCIHVSLLCVQHNPEDRPNMASVVIMLGSEIALTH  1607

Query  243   AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
              K+PGFFT   +E+H +  + + S NE++I+LL PR
Sbjct  1608  PKQPGFFT--KMESHEAGNQ-SSSTNEISITLLEPR  1640


 Score =   148 bits (374),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            +++V   GYM+PEY   G+FS +SDVFSFGV  LE++SG++N+ F H     NL  +AW+
Sbjct  667  NRVVGTYGYMAPEYVIDGLFSVRSDVFSFGVLGLELISGRKNKEFYHPTS-PNLIGHAWR  725

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+  GR  EL+D  L  SC L++VLR IHV LLCVQ +PEDRPSM SVV ML  +  LA 
Sbjct  726  LWNQGRHSELMDTCLGSSCVLSEVLRCIHVSLLCVQHHPEDRPSMASVVIMLGTEIALAP  785

Query  243  AKKPGFFTGRAIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R  E+H        S NE++I++L+PR
Sbjct  786  PKQPGFFMER--ESHEGG---PCSGNELSITVLDPR  816



>gb|EYU36707.1| hypothetical protein MIMGU_mgv1a001407mg [Erythranthe guttata]
Length=825

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 111/159 (70%), Gaps = 4/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEIVSGK+NRGF+H +H  NL  +AW+L
Sbjct  667  RVVGTYGYMSPEYAVDGLFSVKSDVFSFGVLVLEIVSGKKNRGFTHSEHGLNLLGHAWQL  726

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDA---DL  250
             ++GRS+E+ D  L       +VLRSI VGLLCVQQ PEDRP+M SVV ML N+A   ++
Sbjct  727  EKEGRSLEVADPTLDIDFQTAEVLRSIQVGLLCVQQNPEDRPNMSSVVFMLRNEAESGEI  786

Query  249  AIAKKPGFFTGR-AIEAHISTVEITDSVNEVTISLLNPR  136
              A++PGFFT R  I    S     +S NE+TI++  PR
Sbjct  787  PQARQPGFFTQRDVITRQNSNSMKANSTNEITITMPEPR  825



>ref|XP_009361859.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Pyrus x bretschneideri]
Length=516

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            K+V   GYMSPEYA  G +S KSDV+SFGV VLEIVSG RNRGFSH DH  NL  +AW L
Sbjct  362  KVVGTYGYMSPEYAIDGFYSIKSDVYSFGVLVLEIVSGSRNRGFSHPDHKLNLLGHAWML  421

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAIA  241
            + +GR +ELLD  + +S  L +V+R+IHVGLLCVQ+ PEDRPSM + V MLS +  L   
Sbjct  422  HTEGRPLELLDSSVEDSITLLEVVRTIHVGLLCVQRNPEDRPSMSATVLMLSGEGALPQP  481

Query  240  KKPGFFTGR-AIEAHISTVEITDSVNEVTISLL  145
             KPGF++ R A E          S NEVTIS+L
Sbjct  482  LKPGFYSERDATELKAGHSSKACSANEVTISVL  514



>ref|XP_006370395.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
 gb|ERP66964.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
Length=828

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 108/158 (68%), Gaps = 2/158 (1%)
 Frame = -1

Query  603  SKIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWK  424
            S++V   GY+SPEYA  G++S KSDVFSFGV VLEIVSG RNRGF H DH  NL  +AW+
Sbjct  671  SRVVGTYGYISPEYAIDGLYSIKSDVFSFGVLVLEIVSGNRNRGFCHPDHDLNLLGHAWR  730

Query  423  LYRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI  244
            L+++GR  EL+   + ES NL++VLRSIHVGLLCVQ  P DRPSM SVV ML  +  L  
Sbjct  731  LFQEGRHFELIPGPVEESYNLSEVLRSIHVGLLCVQCSPNDRPSMSSVVLMLCGEGALPQ  790

Query  243  AKKPGFFTGR--AIEAHISTVEITDSVNEVTISLLNPR  136
             K+PGFF  R  A   H S    + SVN+ TI+ L  R
Sbjct  791  PKQPGFFNERDLAEANHSSRQNTSCSVNQFTITQLEAR  828



>emb|CBI25711.3| unnamed protein product [Vitis vinifera]
Length=619

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 113/159 (71%), Gaps = 4/159 (3%)
 Frame = -1

Query  600  KIVKYSGYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKL  421
            ++V   GYMSPEYA  G+FS KSDVFSFGV VLEI+SGK+NRGF H +   NL  +AW+L
Sbjct  461  RVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIISGKKNRGFYHLNDEHNLLGHAWRL  520

Query  420  YRDGRSIELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSND-ADLAI  244
            +R+G+ +EL+D  + ESC    VLR I VGLLCVQ++ EDRP M SVV MLS++ A L +
Sbjct  521  WREGKGLELMDSSVSESCAPYDVLRCIQVGLLCVQEHAEDRPVMSSVVLMLSSETATLPL  580

Query  243  AKKPGFFTGRAI---EAHISTVEITDSVNEVTISLLNPR  136
             K PGF  GR +   ++  S  E T +VN+VT+++++ R
Sbjct  581  PKNPGFCLGRKLVETDSSSSKQEETFTVNQVTVTVMDAR  619



>gb|KCW75379.1| hypothetical protein EUGRSUZ_E041261, partial [Eucalyptus grandis]
Length=150

 Score =   155 bits (393),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -1

Query  582  GYMSPEYAGSGMFSTKSDVFSFGVSVLEIVSGKRNRGFSHQDHYENLPSYAWKLYRDGRS  403
            GYM+PEYA  G+FS KSDVFSFGV +LEI+SGKRN GF   +  + L +YAWKL+ +G+ 
Sbjct  1    GYMAPEYAMGGLFSVKSDVFSFGVILLEIISGKRNSGFYLTEQAQTLLAYAWKLWTEGKE  60

Query  402  IELLDEHLVESCNLTQVLRSIHVGLLCVQQYPEDRPSMYSVVQMLSNDADLAI-AKKPGF  226
            +EL+D  L ES    +++R IHVGLLCVQ+ PEDRP+M  VV +L          KKP F
Sbjct  61   LELVDPSLAESGQAAEIVRCIHVGLLCVQEDPEDRPTMSEVVTLLGGQKGTPPQPKKPAF  120

Query  225  FTGRAIEAHISTVEITDSVNEVTISLLNPR  136
            + GRA +    ++    S N++T+S ++PR
Sbjct  121  WVGRAAQELDQSLAPNLSANDITVSSISPR  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906157394839