BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25791_g6_i6 len=1842 path=[14171:0-144 14316:145-192 14364:193-198
14370:199-331 14503:332-356 14528:357-368 14540:369-393
40269:394-535 14707:536-550 40403:551-571 14743:572-611
14783:612-638 40465:639-728 40539:729-729 14901:730-752
14924:753-773 14945:774-850 15022:851-857 15029:858-905
15077:906-907 15079:908-1087 15259:1088-1088 15260:1089-1247
15419:1248-1248 15420:1249-1287 15459:1288-1297 15469:1298-1320
40766:1321-1324 15496:1325-1330 15502:1331-1349 40796:1350-1392
15564:1393-1449 15621:1450-1549 15721:1550-1551 15723:1552-1559
15731:1560-1588 40882:1589-1591 31038:1592-1625 40969:1626-1627
40971:1628-1628 31073:1629-1725 22244:1726-1727 28942:1728-1841]

Length=1842
                                                                      Score     E

ref|XP_010677176.1|  PREDICTED: uncharacterized protein LOC104892855    121   3e-25   
ref|XP_010685734.1|  PREDICTED: uncharacterized protein LOC104900...    115   1e-23   
ref|XP_010685733.1|  PREDICTED: uncharacterized protein LOC104900...    114   2e-23   
ref|XP_010666722.1|  PREDICTED: uncharacterized protein LOC104883856    114   2e-23   
ref|XP_009804894.1|  PREDICTED: uncharacterized protein LOC104250...    110   9e-23   
ref|XP_009804893.1|  PREDICTED: uncharacterized protein LOC104250...    111   3e-22   
ref|XP_009587673.1|  PREDICTED: uncharacterized protein LOC104085366    110   6e-22   
ref|XP_006364023.1|  PREDICTED: uncharacterized protein LOC102585...    109   1e-21   
ref|XP_006364024.1|  PREDICTED: uncharacterized protein LOC102585...    109   1e-21   
ref|XP_004234633.1|  PREDICTED: uncharacterized protein LOC101262187    109   1e-21   
ref|XP_011097137.1|  PREDICTED: uncharacterized protein LOC105176...    105   2e-20   
gb|KDP22662.1|  hypothetical protein JCGZ_02504                         105   2e-20   
ref|XP_011097136.1|  PREDICTED: uncharacterized protein LOC105176...    105   2e-20   
ref|XP_010108937.1|  E3 ubiquitin-protein ligase SINA-like 2            105   2e-20   
ref|XP_010660351.1|  PREDICTED: uncharacterized protein LOC100263...    105   3e-20   
ref|XP_010660347.1|  PREDICTED: uncharacterized protein LOC100263...    104   4e-20   
ref|XP_010660346.1|  PREDICTED: uncharacterized protein LOC100263...    104   4e-20   
emb|CBI33564.3|  unnamed protein product                                104   6e-20   
emb|CAN72428.1|  hypothetical protein VITISV_032233                     104   6e-20   Vitis vinifera
ref|XP_010645203.1|  PREDICTED: serine/threonine-protein phosphat...    100   8e-20   
gb|EYU41323.1|  hypothetical protein MIMGU_mgv1a003049mg                103   1e-19   
gb|KHN37849.1|  E3 ubiquitin-protein ligase SINA-like 10                102   2e-19   
gb|EPS61547.1|  hypothetical protein M569_13248                         100   2e-19   
ref|XP_006589372.1|  PREDICTED: uncharacterized protein LOC100782920    101   3e-19   
ref|XP_002305192.1|  hypothetical protein POPTR_0004s09080g             100   1e-18   Populus trichocarpa [western balsam poplar]
gb|KHG25342.1|  hypothetical protein F383_32011                         100   1e-18   
ref|XP_011002801.1|  PREDICTED: uncharacterized protein LOC105109...  99.8    1e-18   
ref|XP_011002799.1|  PREDICTED: uncharacterized protein LOC105109...  99.8    2e-18   
ref|XP_011002798.1|  PREDICTED: uncharacterized protein LOC105109...  99.4    2e-18   
ref|XP_011002800.1|  PREDICTED: uncharacterized protein LOC105109...  99.4    2e-18   
ref|XP_011002802.1|  PREDICTED: uncharacterized protein LOC105109...  99.0    2e-18   
ref|XP_010528520.1|  PREDICTED: uncharacterized protein LOC104805598  98.6    2e-18   
ref|XP_004983646.1|  PREDICTED: uncharacterized protein LOC101776...  99.0    3e-18   
ref|XP_010644061.1|  PREDICTED: uncharacterized protein LOC104877474  96.7    4e-18   
emb|CAN74236.1|  hypothetical protein VITISV_004916                   98.2    6e-18   Vitis vinifera
ref|XP_010278746.1|  PREDICTED: uncharacterized protein LOC104612...  97.4    7e-18   
ref|XP_006482158.1|  PREDICTED: uncharacterized protein LOC102612380  97.4    7e-18   
ref|XP_010278747.1|  PREDICTED: uncharacterized protein LOC104612...  97.1    9e-18   
ref|XP_008229334.1|  PREDICTED: uncharacterized protein LOC103328702  97.4    9e-18   
ref|XP_010278748.1|  PREDICTED: uncharacterized protein LOC104612...  96.7    1e-17   
ref|XP_010278750.1|  PREDICTED: uncharacterized protein LOC104612...  96.7    1e-17   
ref|XP_006430659.1|  hypothetical protein CICLE_v10011294mg           97.1    1e-17   
ref|XP_010278749.1|  PREDICTED: uncharacterized protein LOC104612...  96.7    1e-17   
ref|XP_007011252.1|  RING/U-box and TRAF-like domains                 97.1    1e-17   
ref|XP_010278751.1|  PREDICTED: uncharacterized protein LOC104612...  96.3    1e-17   
ref|XP_002532643.1|  conserved hypothetical protein                   95.1    1e-17   Ricinus communis
gb|KDO63134.1|  hypothetical protein CISIN_1g043878mg                 96.3    2e-17   
ref|XP_010672819.1|  PREDICTED: protein PRRC2C-like                   96.7    2e-17   
ref|XP_010278752.1|  PREDICTED: uncharacterized protein LOC104612...  95.1    2e-17   
ref|XP_007215313.1|  hypothetical protein PRUPE_ppa003531mg           94.4    6e-17   
ref|XP_008365752.1|  PREDICTED: uncharacterized protein LOC103429377  94.4    8e-17   
ref|XP_004985207.1|  PREDICTED: suppressor protein SRP40-like iso...  89.0    3e-15   
gb|EMT07156.1|  hypothetical protein F775_24002                       85.1    9e-14   
gb|AFW81096.1|  hypothetical protein ZEAMMB73_569676                  85.1    1e-13   
ref|XP_007204431.1|  hypothetical protein PRUPE_ppa027095mg           82.0    1e-13   
ref|XP_008675708.1|  PREDICTED: uncharacterized protein LOC103651788  84.0    1e-13   
emb|CDP18389.1|  unnamed protein product                              80.9    2e-13   
ref|XP_008669357.1|  PREDICTED: uncharacterized protein LOC103646406  82.8    3e-13   
ref|XP_008649459.1|  PREDICTED: uncharacterized protein LOC103630154  81.3    4e-13   
ref|XP_002445178.1|  hypothetical protein SORBIDRAFT_07g005516        81.6    4e-13   Sorghum bicolor [broomcorn]
ref|XP_010236671.1|  PREDICTED: uncharacterized protein LOC104584197  81.6    8e-13   
ref|XP_002458043.1|  hypothetical protein SORBIDRAFT_03g026065        80.9    1e-12   Sorghum bicolor [broomcorn]
ref|XP_010646728.1|  PREDICTED: uncharacterized protein LOC104878295  77.8    1e-12   
ref|XP_008650421.1|  PREDICTED: uncharacterized protein LOC103631248  80.1    2e-12   
ref|XP_006470374.1|  PREDICTED: uncharacterized protein LOC102628...  79.7    3e-12   
ref|XP_006470370.1|  PREDICTED: uncharacterized protein LOC102628...  79.7    4e-12   
ref|XP_006470368.1|  PREDICTED: uncharacterized protein LOC102628...  79.7    4e-12   
ref|XP_006470369.1|  PREDICTED: uncharacterized protein LOC102628...  79.3    5e-12   
gb|EMS58266.1|  hypothetical protein TRIUR3_16719                     79.3    5e-12   
ref|XP_008678048.1|  PREDICTED: uncharacterized protein LOC103652839  78.6    5e-12   
ref|XP_002465098.1|  hypothetical protein SORBIDRAFT_01g032035        78.2    7e-12   Sorghum bicolor [broomcorn]
ref|XP_002455711.1|  hypothetical protein SORBIDRAFT_03g022135        79.0    8e-12   Sorghum bicolor [broomcorn]
ref|XP_010695530.1|  PREDICTED: uncharacterized protein LOC104908144  75.9    1e-11   
dbj|BAM64827.1|  hypothetical protein                                 78.2    2e-11   
emb|CAN77525.1|  hypothetical protein VITISV_041421                   77.0    2e-11   Vitis vinifera
emb|CAN64547.1|  hypothetical protein VITISV_026046                   77.0    2e-11   Vitis vinifera
ref|XP_002455322.1|  hypothetical protein SORBIDRAFT_03g008395        77.0    3e-11   Sorghum bicolor [broomcorn]
dbj|BAJ98466.1|  predicted protein                                    75.5    4e-11   
ref|XP_006490448.1|  PREDICTED: uncharacterized protein LOC102625...  75.9    6e-11   
gb|EMT33139.1|  hypothetical protein F775_04826                       75.9    6e-11   
ref|XP_006490446.1|  PREDICTED: uncharacterized protein LOC102625...  75.9    7e-11   
ref|XP_006490447.1|  PREDICTED: uncharacterized protein LOC102625...  75.5    7e-11   
ref|XP_006475686.1|  PREDICTED: uncharacterized protein LOC102608...  75.5    8e-11   
ref|XP_006490449.1|  PREDICTED: uncharacterized protein LOC102625...  75.5    8e-11   
ref|XP_006475682.1|  PREDICTED: uncharacterized protein LOC102608...  75.5    8e-11   
ref|XP_006475685.1|  PREDICTED: uncharacterized protein LOC102608...  75.1    8e-11   
ref|XP_006490444.1|  PREDICTED: uncharacterized protein LOC102625...  75.5    8e-11   
gb|EMS50409.1|  hypothetical protein TRIUR3_25471                     75.1    1e-10   
ref|XP_008664244.1|  PREDICTED: uncharacterized protein LOC103642847  73.9    1e-10   
ref|XP_010231407.1|  PREDICTED: uncharacterized protein LOC100825...  73.9    1e-10   
emb|CAN80690.1|  hypothetical protein VITISV_032424                   74.3    1e-10   Vitis vinifera
ref|XP_010231408.1|  PREDICTED: uncharacterized protein LOC100825...  73.6    1e-10   
gb|EMS63117.1|  hypothetical protein TRIUR3_21596                     73.2    2e-10   
ref|XP_010231404.1|  PREDICTED: uncharacterized protein LOC100825...  74.3    2e-10   
ref|XP_006489863.1|  PREDICTED: uncharacterized protein LOC102626...  74.3    2e-10   
dbj|BAD20055.1|  hypothetical protein                                 74.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006489859.1|  PREDICTED: uncharacterized protein LOC102626...  74.3    2e-10   
ref|XP_006489861.1|  PREDICTED: uncharacterized protein LOC102626...  73.9    2e-10   
ref|XP_006489864.1|  PREDICTED: uncharacterized protein LOC102626...  73.9    2e-10   
ref|XP_010646966.1|  PREDICTED: uncharacterized protein LOC104878391  73.9    3e-10   
ref|XP_010651563.1|  PREDICTED: uncharacterized protein LOC104879661  72.4    3e-10   
ref|XP_006489862.1|  PREDICTED: uncharacterized protein LOC102626...  73.6    3e-10   
gb|AFW74449.1|  hypothetical protein ZEAMMB73_867294                  72.8    5e-10   
gb|EMT25344.1|  hypothetical protein F775_10136                       71.2    6e-10   
ref|XP_002444868.1|  hypothetical protein SORBIDRAFT_07g000630        71.2    7e-10   Sorghum bicolor [broomcorn]
emb|CAN76862.1|  hypothetical protein VITISV_001668                   70.5    8e-10   Vitis vinifera
ref|XP_010659348.1|  PREDICTED: uncharacterized protein LOC104881311  68.9    1e-09   
ref|XP_010649037.1|  PREDICTED: uncharacterized protein LOC104879128  70.5    1e-09   
gb|KDO39693.1|  hypothetical protein CISIN_1g021140mg                 69.7    1e-09   
ref|XP_002446780.1|  hypothetical protein SORBIDRAFT_06g022285        71.6    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002441202.1|  hypothetical protein SORBIDRAFT_09g022220        70.1    2e-09   Sorghum bicolor [broomcorn]
ref|XP_002441252.1|  hypothetical protein SORBIDRAFT_09g023175        71.2    2e-09   Sorghum bicolor [broomcorn]
ref|XP_007203458.1|  hypothetical protein PRUPE_ppa022162mg           69.3    2e-09   
ref|XP_010657156.1|  PREDICTED: uncharacterized protein LOC104880853  70.1    3e-09   
ref|XP_002456195.1|  hypothetical protein SORBIDRAFT_03g031960        70.1    3e-09   Sorghum bicolor [broomcorn]
ref|XP_002455608.1|  hypothetical protein SORBIDRAFT_03g013915        70.5    3e-09   Sorghum bicolor [broomcorn]
gb|KDO39699.1|  hypothetical protein CISIN_1g021140mg                 68.2    3e-09   
emb|CAN75849.1|  hypothetical protein VITISV_040636                   70.5    3e-09   Vitis vinifera
emb|CAN65618.1|  hypothetical protein VITISV_001359                   70.5    4e-09   Vitis vinifera
emb|CAN73205.1|  hypothetical protein VITISV_025946                   70.1    4e-09   Vitis vinifera
gb|EMS56314.1|  hypothetical protein TRIUR3_35199                     68.9    6e-09   
ref|XP_008240712.1|  PREDICTED: uncharacterized protein LOC103339208  67.0    6e-09   
ref|XP_002449327.1|  hypothetical protein SORBIDRAFT_05g008100        68.6    7e-09   Sorghum bicolor [broomcorn]
emb|CAN83476.1|  hypothetical protein VITISV_019328                   68.6    8e-09   Vitis vinifera
gb|EEC80882.1|  hypothetical protein OsI_23519                        68.9    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006475687.1|  PREDICTED: uncharacterized protein LOC102608...  68.2    1e-08   
gb|EMT09021.1|  hypothetical protein F775_30912                       67.8    1e-08   
gb|AAP54389.2|  Ulp1 protease family, C-terminal catalytic domain...  68.6    1e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010665511.1|  PREDICTED: uncharacterized protein LOC104882809  66.6    1e-08   
gb|EEC76309.1|  hypothetical protein OsI_13839                        68.2    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004290281.1|  PREDICTED: uncharacterized protein LOC101292173  67.0    2e-08   
ref|XP_010645331.1|  PREDICTED: uncharacterized protein LOC104877845  67.8    2e-08   
ref|XP_010648058.1|  PREDICTED: uncharacterized protein LOC104878867  67.8    2e-08   
gb|EMT31475.1|  hypothetical protein F775_01889                       66.6    3e-08   
ref|XP_004966769.1|  PREDICTED: uncharacterized protein LOC101766235  67.4    3e-08   
ref|XP_010665438.1|  PREDICTED: uncharacterized protein LOC104882773  64.3    3e-08   
dbj|BAD38572.1|  hypothetical protein                                 67.0    4e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KDO62590.1|  hypothetical protein CISIN_1g039418mg                 65.1    4e-08   
gb|AAT93957.1|  hypothetical protein                                  66.6    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010646184.1|  PREDICTED: uncharacterized protein LOC104878110  64.3    6e-08   
emb|CAN67356.1|  hypothetical protein VITISV_035313                   65.9    6e-08   Vitis vinifera
ref|XP_002316329.1|  hypothetical protein POPTR_0010s22160g           65.9    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002448620.1|  hypothetical protein SORBIDRAFT_06g030272        65.5    7e-08   Sorghum bicolor [broomcorn]
ref|XP_008666016.1|  PREDICTED: uncharacterized protein LOC103644616  64.7    7e-08   
ref|XP_007213382.1|  hypothetical protein PRUPE_ppa026444mg           63.9    8e-08   
ref|XP_010664913.1|  PREDICTED: uncharacterized protein LOC104882596  65.9    8e-08   
emb|CDM81972.1|  unnamed protein product                              65.9    9e-08   
emb|CBI20523.3|  unnamed protein product                              65.5    1e-07   
ref|XP_010644344.1|  PREDICTED: uncharacterized protein LOC100852586  65.5    1e-07   
ref|XP_008671132.1|  PREDICTED: uncharacterized protein LOC103648438  65.5    1e-07   
gb|EEE51994.1|  hypothetical protein OsJ_33682                        65.1    1e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CDM82590.1|  unnamed protein product                              65.1    2e-07   
emb|CAN65830.1|  hypothetical protein VITISV_038135                   64.7    2e-07   Vitis vinifera
ref|XP_008666669.1|  PREDICTED: uncharacterized protein LOC103645388  64.3    2e-07   
ref|XP_008666079.1|  PREDICTED: uncharacterized protein LOC103644692  64.7    2e-07   
ref|XP_008660743.1|  PREDICTED: uncharacterized protein LOC103639825  64.3    2e-07   
ref|XP_002458283.1|  hypothetical protein SORBIDRAFT_03g030645        64.7    2e-07   Sorghum bicolor [broomcorn]
emb|CDM82578.1|  unnamed protein product                              64.3    3e-07   
gb|AAQ06290.1|  hypothetical protein                                  64.3    3e-07   Zea mays [maize]
gb|EMS53718.1|  hypothetical protein TRIUR3_20643                     62.0    3e-07   
emb|CAH66455.1|  OSIGBa0145N07.11                                     64.3    3e-07   Oryza sativa [red rice]
gb|AAQ06288.1|  hypothetical protein                                  63.9    3e-07   Zea mays [maize]
ref|XP_008646992.1|  PREDICTED: uncharacterized protein LOC103628599  63.9    3e-07   
ref|XP_011027068.1|  PREDICTED: uncharacterized protein LOC105127453  63.5    3e-07   
gb|AAQ06285.1|  hypothetical protein                                  63.9    3e-07   Zea mays [maize]
ref|XP_008676407.1|  PREDICTED: uncharacterized protein LOC103652651  63.2    4e-07   
emb|CAN75116.1|  hypothetical protein VITISV_002419                   63.9    4e-07   Vitis vinifera
ref|XP_010658796.1|  PREDICTED: uncharacterized protein LOC104881203  60.5    4e-07   
gb|AAX95440.1|  hypothetical protein                                  63.9    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008650444.1|  PREDICTED: uncharacterized protein LOC103631282  62.4    4e-07   
dbj|BAD61116.1|  hypothetical protein                                 63.2    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042045.2|  Os01g0152500                                     63.2    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80327.1|  hypothetical protein OsI_22377                        63.2    6e-07   Oryza sativa Indica Group [Indian rice]
gb|EMT15184.1|  hypothetical protein F775_03449                       60.8    6e-07   
emb|CAN80921.1|  hypothetical protein VITISV_005310                   63.2    6e-07   Vitis vinifera
gb|EEC78496.1|  hypothetical protein OsI_18409                        62.8    7e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_008675696.1|  PREDICTED: uncharacterized protein LOC103651774  62.0    8e-07   
ref|XP_008650342.1|  PREDICTED: uncharacterized protein LOC103631125  62.4    8e-07   
emb|CAE02207.2|  OSJNBa0095H06.14                                     62.0    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007203306.1|  hypothetical protein PRUPE_ppa025878mg           59.7    9e-07   
ref|XP_009371811.1|  PREDICTED: uncharacterized protein LOC103961030  61.2    1e-06   
ref|XP_010664984.1|  PREDICTED: uncharacterized protein LOC104882626  61.6    1e-06   
ref|XP_008671734.1|  PREDICTED: uncharacterized protein LOC103649186  61.2    1e-06   
ref|XP_008679344.1|  PREDICTED: uncharacterized protein LOC103654289  60.8    1e-06   
ref|XP_002454247.1|  hypothetical protein SORBIDRAFT_04g027467        62.0    1e-06   Sorghum bicolor [broomcorn]
ref|XP_008650472.1|  PREDICTED: uncharacterized protein LOC103631312  61.6    1e-06   
ref|NP_001142489.1|  uncharacterized protein LOC100274716             61.6    2e-06   Zea mays [maize]
ref|XP_007203250.1|  hypothetical protein PRUPE_ppa019521mg           60.5    2e-06   
emb|CAN63811.1|  hypothetical protein VITISV_016710                   61.2    2e-06   Vitis vinifera
ref|XP_007208659.1|  hypothetical protein PRUPE_ppa021415mg           58.5    3e-06   
gb|AAL77113.1|  hypothetical protein                                  60.1    3e-06   Hordeum vulgare subsp. vulgare [barley]
ref|NP_001064194.2|  Os10g0157000                                     60.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT23279.1|  hypothetical protein F775_07540                       60.5    4e-06   
ref|XP_008657800.1|  PREDICTED: uncharacterized protein LOC103637366  59.7    4e-06   
ref|XP_008675470.1|  PREDICTED: uncharacterized protein LOC103651...  59.7    4e-06   
ref|XP_008680581.1|  PREDICTED: uncharacterized protein LOC103655638  59.7    4e-06   
ref|XP_008657592.1|  PREDICTED: uncharacterized protein LOC103637107  59.3    4e-06   
dbj|BAD87923.1|  hypothetical protein                                 59.7    5e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CAN76545.1|  hypothetical protein VITISV_010419                   60.1    5e-06   Vitis vinifera
ref|XP_008677425.1|  PREDICTED: uncharacterized protein LOC100303...  60.1    6e-06   
ref|XP_008680144.1|  PREDICTED: uncharacterized protein LOC103655116  59.7    6e-06   
ref|XP_008677427.1|  PREDICTED: uncharacterized protein LOC100303...  59.7    6e-06   
ref|XP_008677426.1|  PREDICTED: uncharacterized protein LOC100303...  59.7    6e-06   
ref|XP_008664886.1|  PREDICTED: uncharacterized protein LOC103643467  58.2    7e-06   
ref|XP_010647228.1|  PREDICTED: uncharacterized protein LOC100253832  59.7    7e-06   
ref|XP_008677424.1|  PREDICTED: uncharacterized protein LOC100303...  59.7    7e-06   
gb|EEC73277.1|  hypothetical protein OsI_07420                        59.3    7e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008677422.1|  PREDICTED: uncharacterized protein LOC100303...  59.7    7e-06   
ref|XP_002448621.1|  hypothetical protein SORBIDRAFT_06g030277        59.7    8e-06   Sorghum bicolor [broomcorn]
emb|CDM82585.1|  unnamed protein product                              59.3    8e-06   
ref|XP_008653599.1|  PREDICTED: uncharacterized protein LOC103633661  58.5    9e-06   
ref|XP_008677429.1|  PREDICTED: uncharacterized protein LOC100303...  58.9    1e-05   
ref|XP_008657323.1|  PREDICTED: uncharacterized protein LOC103636778  58.2    1e-05   
ref|XP_007220163.1|  hypothetical protein PRUPE_ppa017411mg           57.8    1e-05   
gb|AAL75744.1|AC091724_17  Hypothetical protein                       58.2    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439847.1|  hypothetical protein SORBIDRAFT_09g021200        58.5    1e-05   Sorghum bicolor [broomcorn]
ref|XP_008677430.1|  PREDICTED: uncharacterized protein LOC100303...  58.5    2e-05   
ref|XP_008677431.1|  PREDICTED: uncharacterized protein LOC100303...  58.2    2e-05   
ref|XP_008657316.1|  PREDICTED: uncharacterized protein LOC103636772  57.8    2e-05   
gb|EMT08151.1|  E3 ubiquitin-protein ligase SINA-like protein 4       58.5    2e-05   
ref|XP_008677428.1|  PREDICTED: uncharacterized protein LOC100303...  58.2    2e-05   
ref|XP_002457499.1|  hypothetical protein SORBIDRAFT_03g008346        57.8    2e-05   Sorghum bicolor [broomcorn]
gb|EMT15864.1|  hypothetical protein F775_02762                       56.6    2e-05   
ref|XP_008653589.1|  PREDICTED: uncharacterized protein LOC100278068  58.2    2e-05   
gb|KDO39692.1|  hypothetical protein CISIN_1g047588mg                 57.4    3e-05   
ref|XP_004305674.1|  PREDICTED: uncharacterized protein LOC101308491  57.8    3e-05   
ref|XP_008661971.1|  PREDICTED: uncharacterized protein LOC103640583  55.8    3e-05   
emb|CDM80369.1|  unnamed protein product                              57.4    3e-05   
ref|XP_007226785.1|  hypothetical protein PRUPE_ppa017990mg           56.6    4e-05   
emb|CDP20833.1|  unnamed protein product                              56.6    5e-05   
ref|XP_010238936.1|  PREDICTED: uncharacterized protein LOC104584864  54.7    5e-05   
ref|XP_006471547.1|  PREDICTED: uncharacterized protein LOC102624571  56.6    6e-05   
emb|CDM80114.1|  unnamed protein product                              56.6    6e-05   
ref|XP_004971707.1|  PREDICTED: uncharacterized protein LOC101782728  56.6    6e-05   
emb|CBI37409.3|  unnamed protein product                              56.2    8e-05   
ref|XP_002445567.1|  hypothetical protein SORBIDRAFT_07g021695        55.8    1e-04   Sorghum bicolor [broomcorn]
gb|EMT25385.1|  hypothetical protein F775_25105                       55.5    2e-04   
dbj|BAD45718.1|  hypothetical protein                                 55.1    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010651673.1|  PREDICTED: uncharacterized protein LOC104879677  53.1    2e-04   
emb|CAN71714.1|  hypothetical protein VITISV_036352                   55.1    2e-04   Vitis vinifera
gb|EMS56031.1|  hypothetical protein TRIUR3_17933                     55.1    2e-04   
ref|XP_006471548.1|  PREDICTED: uncharacterized protein LOC102624847  54.7    2e-04   
ref|XP_010645948.1|  PREDICTED: uncharacterized protein LOC100853025  54.3    3e-04   
ref|NP_001046962.2|  Os02g0517900                                     53.1    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002454270.1|  hypothetical protein SORBIDRAFT_04g027776        54.3    3e-04   Sorghum bicolor [broomcorn]
emb|CAN68470.1|  hypothetical protein VITISV_028193                   53.9    3e-04   Vitis vinifera
gb|EMS61417.1|  hypothetical protein TRIUR3_05443                     53.9    4e-04   
ref|XP_002453254.1|  hypothetical protein SORBIDRAFT_04g002605        53.9    4e-04   Sorghum bicolor [broomcorn]
ref|XP_008666045.1|  PREDICTED: uncharacterized protein LOC103644648  53.5    4e-04   
ref|XP_002462213.1|  hypothetical protein SORBIDRAFT_02g021835        53.1    4e-04   Sorghum bicolor [broomcorn]
ref|XP_008677432.1|  PREDICTED: uncharacterized protein LOC100303...  53.5    5e-04   
ref|XP_008657292.1|  PREDICTED: uncharacterized protein LOC103636730  52.8    5e-04   
ref|XP_008666067.1|  PREDICTED: uncharacterized protein LOC103644673  52.8    5e-04   
ref|XP_002446775.1|  hypothetical protein SORBIDRAFT_06g022210        50.1    5e-04   Sorghum bicolor [broomcorn]
ref|XP_008666601.1|  PREDICTED: uncharacterized protein LOC103645303  52.8    6e-04   
ref|XP_004977885.1|  PREDICTED: uncharacterized protein LOC101767538  52.8    7e-04   
ref|XP_006437290.1|  hypothetical protein CICLE_v10033783mg           52.0    7e-04   
emb|CAN83855.1|  hypothetical protein VITISV_031104                   51.6    7e-04   Vitis vinifera
ref|XP_006480687.1|  PREDICTED: uncharacterized protein LOC102627763  52.4    7e-04   
ref|XP_008660749.1|  PREDICTED: uncharacterized protein LOC103639833  52.8    7e-04   
ref|XP_008671574.1|  PREDICTED: uncharacterized protein LOC103648993  50.4    7e-04   
ref|XP_006484196.1|  PREDICTED: uncharacterized protein LOC102607...  52.4    8e-04   
ref|XP_004987129.1|  PREDICTED: uncharacterized protein LOC101762724  52.4    8e-04   
ref|XP_006484194.1|  PREDICTED: uncharacterized protein LOC102607...  52.4    8e-04   
ref|XP_008675725.1|  PREDICTED: uncharacterized protein LOC103651814  52.0    0.001   
gb|KDO38047.1|  hypothetical protein CISIN_1g014153mg                 52.0    0.001   



>ref|XP_010677176.1| PREDICTED: uncharacterized protein LOC104892855 [Beta vulgaris 
subsp. vulgaris]
Length=833

 Score =   121 bits (303),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 109/242 (45%), Gaps = 6/242 (2%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             +S +QR+ V  IG G  L L    L  +L  WL+ NF+P    + + + + + I  E V 
Sbjct  1     MSFEQRQAVKDIGFGVFLELGFGVLNNKLSLWLIENFDPYSRTLYVRDEK-ITIDREDVQ  59

Query  956   AVLGLPNG----SVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVW  789
               LGLP G       M + D          WR      KG      +    L+L  G   
Sbjct  60    VTLGLPMGPKVVKEAMKDDDNDEFRILFEQWRSIWGLEKGCPKTTKMPERILTLGAGDD-  118

Query  788   FKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNT  609
             FKR F V V S+ +    N     K +    D   I  +DWC Y +  L++    W +N 
Sbjct  119   FKRSFVVFVVSSCLHGQKNQSCTYKILFSLMDTSEISRMDWCQYTIDCLIDAILIWKKNP  178

Query  608   ARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGEFGYGQLE  429
                F G LLFLTLFY+DRVE     + R  P    W  +A++ R + E+ AG FG+G++ 
Sbjct  179   CGFFTGSLLFLTLFYLDRVEFIGSQIERKAPIICCWKAKAIEERCKAEIKAGSFGFGRIL  238

Query  428   EP  423
              P
Sbjct  239   PP  240



>ref|XP_010685734.1| PREDICTED: uncharacterized protein LOC104900092 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=549

 Score =   115 bits (287),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 124/254 (49%), Gaps = 11/254 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R RP+ L+ L   LST+Q+  V SIG G L  L+++  P  +   L  NF P    + + 
Sbjct  147   RCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMIG  206

Query  995   NGRFLRITEEGVAAVLGLPNGS--VTMTERDTHMVGPDLLAWRCKVKNRKGNIT---VHA  831
             N R +++    VA V G+P G   + +++RD      +   W     +  G +T   +  
Sbjct  207   NHR-VQLKPADVADVFGIPMGKFKIPISKRDDDTKLKNF--WLENYAHSSGIVTPASMRM  263

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  +      G   FKR F +    TL+A +LN+ A+ K V    DV  IK+ DWC Y+L
Sbjct  264   LMEMDDDFLSGNDDFKRCFVMFAIITLLAPSLNTQADFKIVRALIDVNRIKEYDWCSYVL  323

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               L      + +++     G +L L + YV R++    + P++ P    WT + L  +E+
Sbjct  324   EDLATRMQKY-EDSKTYIGGCVLLLQICYVQRLKFQGLSSPKSLPLIQHWTTKKL--KER  380

Query  470   QEVDAGEFGYGQLE  429
               ++AG++G G LE
Sbjct  381   ITLEAGKYGVGLLE  394



>ref|XP_010685733.1| PREDICTED: uncharacterized protein LOC104900092 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=564

 Score =   114 bits (286),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 124/254 (49%), Gaps = 11/254 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R RP+ L+ L   LST+Q+  V SIG G L  L+++  P  +   L  NF P    + + 
Sbjct  162   RCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMIG  221

Query  995   NGRFLRITEEGVAAVLGLPNGS--VTMTERDTHMVGPDLLAWRCKVKNRKGNIT---VHA  831
             N R +++    VA V G+P G   + +++RD      +   W     +  G +T   +  
Sbjct  222   NHR-VQLKPADVADVFGIPMGKFKIPISKRDDDTKLKNF--WLENYAHSSGIVTPASMRM  278

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  +      G   FKR F +    TL+A +LN+ A+ K V    DV  IK+ DWC Y+L
Sbjct  279   LMEMDDDFLSGNDDFKRCFVMFAIITLLAPSLNTQADFKIVRALIDVNRIKEYDWCSYVL  338

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               L      + +++     G +L L + YV R++    + P++ P    WT + L  +E+
Sbjct  339   EDLATRMQKY-EDSKTYIGGCVLLLQICYVQRLKFQGLSSPKSLPLIQHWTTKKL--KER  395

Query  470   QEVDAGEFGYGQLE  429
               ++AG++G G LE
Sbjct  396   ITLEAGKYGVGLLE  409



>ref|XP_010666722.1| PREDICTED: uncharacterized protein LOC104883856 [Beta vulgaris 
subsp. vulgaris]
Length=601

 Score =   114 bits (286),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/254 (30%), Positives = 124/254 (49%), Gaps = 11/254 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R RP+ L+ L   LST+Q+  V SIG G L  L+++  P  +   L  NF P    + + 
Sbjct  199   RCRPAALINLFKKLSTQQKDAVCSIGFGSLFELKLEEFPRDMIRMLCRNFCPKDKVLMIG  258

Query  995   NGRFLRITEEGVAAVLGLPNGS--VTMTERDTHMVGPDLLAWRCKVKNRKGNIT---VHA  831
             N R +++    VA V G+P G   + +++RD      +   W     +  G +T   +  
Sbjct  259   NHR-VQLKPADVADVFGIPMGKFKIPISKRDDDTKLKNF--WLENYAHSSGIVTPASMRM  315

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  +      G   FKR F +    TL+A +LN+ A+ K V    DV  IK+ DWC Y+L
Sbjct  316   LMEMDDDFLSGNDDFKRCFVMFAIITLLAPSLNTQADFKIVRALIDVNRIKEYDWCSYVL  375

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               L      + +++     G +L L + YV R++    + P++ P    WT + L  +E+
Sbjct  376   EDLATRMQKY-EDSKTYIGGCVLLLQICYVQRLKFQGLSSPKSLPLIQHWTTKKL--KER  432

Query  470   QEVDAGEFGYGQLE  429
               ++AG++G G LE
Sbjct  433   ITLEAGKYGVGLLE  446



>ref|XP_009804894.1| PREDICTED: uncharacterized protein LOC104250057 isoform X2 [Nicotiana 
sylvestris]
Length=436

 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 120/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  WL+  FN  + +
Sbjct  134   KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRS  193

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPD--LLAWRCKVKNRKGNITVH  834
             +++   R + +T   V  V+GLP        +D    G D  +L  R K       I+V 
Sbjct  194   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILELRKKYNATNRGISVR  247

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TLV  T     +   +H   ++ ++   +W  +L
Sbjct  248   LLEE-RLAAPEAGEDFKRSFVLYVMGTLVCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  306

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  307   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  366

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  367   REKQEKELGGYGSGEV  382



>ref|XP_009804893.1| PREDICTED: uncharacterized protein LOC104250057 isoform X1 [Nicotiana 
sylvestris]
Length=639

 Score =   111 bits (278),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 120/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  WL+  FN  + +
Sbjct  134   KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRS  193

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPD--LLAWRCKVKNRKGNITVH  834
             +++   R + +T   V  V+GLP        +D    G D  +L  R K       I+V 
Sbjct  194   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILELRKKYNATNRGISVR  247

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TLV  T     +   +H   ++ ++   +W  +L
Sbjct  248   LLEE-RLAAPEAGEDFKRSFVLYVMGTLVCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  306

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  307   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  366

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  367   REKQEKELGGYGSGEV  382



>ref|XP_009587673.1| PREDICTED: uncharacterized protein LOC104085366, partial [Nicotiana 
tomentosiformis]
Length=598

 Score =   110 bits (275),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 120/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  WL+  FN  + +
Sbjct  95    KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWLLERFNTVRRS  154

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GLP        +D    G D L    + K    N  I+V 
Sbjct  155   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILELRKKYNATNRGISVR  208

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TLV  T     +   +H   ++ ++   +W  +L
Sbjct  209   LLEE-RLAAPEAGEDFKRSFVLYVMGTLVCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  267

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  268   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  327

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  328   REKQEKELGGYGSGEV  343



>ref|XP_006364023.1| PREDICTED: uncharacterized protein LOC102585691 isoform X1 [Solanum 
tuberosum]
Length=616

 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/256 (30%), Positives = 121/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  WL+  FN  + +
Sbjct  113   KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGNILGLRCRTLRRSLCLWLLERFNTVRRS  172

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GLP        +D    G D L  + + +    N  I+V 
Sbjct  173   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILQLRKRYNATNRGISVR  226

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  227   LLEE-RLAAPEAGEDFKRSFVLYVMGTLLCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  285

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  286   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  345

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  346   REKQEKELGGYGSGEV  361



>ref|XP_006364024.1| PREDICTED: uncharacterized protein LOC102585691 isoform X2 [Solanum 
tuberosum]
Length=602

 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/256 (30%), Positives = 121/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  WL+  FN  + +
Sbjct  113   KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGNILGLRCRTLRRSLCLWLLERFNTVRRS  172

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GLP        +D    G D L  + + +    N  I+V 
Sbjct  173   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILQLRKRYNATNRGISVR  226

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  227   LLEE-RLAAPEAGEDFKRSFVLYVMGTLLCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  285

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  286   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  345

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  346   REKQEKELGGYGSGEV  361



>ref|XP_004234633.1| PREDICTED: uncharacterized protein LOC101262187 [Solanum lycopersicum]
Length=637

 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 121/256 (47%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q++ V S+G G +LGLR + L   L  W++  FN  + +
Sbjct  134   KLVTRCSPGRLLNVLQRLTPDQKEAVKSMGFGSILGLRCRTLRRSLCLWILERFNTVRRS  193

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GLP        +D    G D L  + + +    N  I+V 
Sbjct  194   LEICGER-IPLTPRDVELVMGLPASG-----KDVVNSGSDELILQLRKRYNATNRGISVR  247

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  248   LLEE-RLAAPEAGEDFKRSFVLYVMGTLLCPTARLDVSPSFLHFLTNMDVLHQYNWGKFL  306

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE--RNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  G    + P A P    W +  +  
Sbjct  307   LDRLVREISRFRQGKQRAVGGCLLFLQLFYYESVAVGAAYESAPVAFPCLFSWGEEEISE  366

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  367   REKQEKELGGYGSGEV  382



>ref|XP_011097137.1| PREDICTED: uncharacterized protein LOC105176128 isoform X2 [Sesamum 
indicum]
Length=609

 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/256 (30%), Positives = 119/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q+  V S+G G +L LR + L   L  WL+  FN  + +
Sbjct  105   KLVTRCSPGRLLNVLQRLTPDQKAAVKSMGFGSILNLRCRTLRRSLCLWLLEKFNTVRRS  164

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GL +       +D    GPD L    + K    N  I+V 
Sbjct  165   LEICGER-IPLTPRDVELVMGLASNG-----KDVVNSGPDELISELRKKYNATNRGISVR  218

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  219   LLEE-RLAFPEAGDDFKRSFLLYVLGTLLCPTARLDVSPSFLHFLTNMDVVHQYNWGKFL  277

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  GE +   P   P    W +  +  
Sbjct  278   LDRLVREVARYRQGKQRAVGGCLLFLQLFYYESVAVGEPSELSPAIFPCLASWGEEEISE  337

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  338   REKQERELGGYGCGEV  353



>gb|KDP22662.1| hypothetical protein JCGZ_02504 [Jatropha curcas]
Length=609

 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 119/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+++Q++ V S+G G LLGLR + L   L  WL+  FN    +
Sbjct  113   KLVTRCSPGRLFNVLQSLTSEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLQRFNTTGRS  172

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             + +   R + ++ + V  V+GL     T + +D    G D L    +      N  I+V 
Sbjct  173   LDICGER-IPLSPKDVEFVIGL-----TASGKDVVNSGSDDLIADLRQSYNATNRGISVR  226

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L   E G  FKR F +    TL+  T     +   +H   D+ +I   +W  +L
Sbjct  227   LLEE-RLKATEAGEEFKRSFVLYALGTLLCPTARLDVSPSFLHFLTDMDVIHQYNWGKFL  285

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDR--VEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +R  VE  +  VP   P    W +  +  
Sbjct  286   LDRLVREVSRFRQGKQRAVGGCLLFLQLFYYERISVEGSDALVPAPAPCLSSWGEEEITE  345

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  346   REKRERELGGYGLGEV  361



>ref|XP_011097136.1| PREDICTED: uncharacterized protein LOC105176128 isoform X1 [Sesamum 
indicum]
Length=613

 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 76/256 (30%), Positives = 119/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  Q+  V S+G G +L LR + L   L  WL+  FN  + +
Sbjct  105   KLVTRCSPGRLLNVLQRLTPDQKAAVKSMGFGSILNLRCRTLRRSLCLWLLEKFNTVRRS  164

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GL +       +D    GPD L    + K    N  I+V 
Sbjct  165   LEICGER-IPLTPRDVELVMGLASNG-----KDVVNSGPDELISELRKKYNATNRGISVR  218

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  219   LLEE-RLAFPEAGDDFKRSFLLYVLGTLLCPTARLDVSPSFLHFLTNMDVVHQYNWGKFL  277

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  GE +   P   P    W +  +  
Sbjct  278   LDRLVREVARYRQGKQRAVGGCLLFLQLFYYESVAVGEPSELSPAIFPCLASWGEEEISE  337

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  338   REKQERELGGYGCGEV  353



>ref|XP_010108937.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
 gb|EXC20577.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
Length=703

 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 128/281 (46%), Gaps = 22/281 (8%)
 Frame = -2

Query  1262  APTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLL  1083
             +  PPR P+    T+ V           TR  P  L  +L  L+ +Q+  V  +G G LL
Sbjct  181   SAAPPRTPKPRKQTKLV-----------TRCSPGRLFNVLQHLTAEQKDAVKIMGFGSLL  229

Query  1082  GLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTH  903
             GLR + L   L  WL+  FN  Q ++++  G  + +  + V  V+GL       + +D  
Sbjct  230   GLRCRTLRRSLCLWLLERFNTMQRSLEICGGH-IHLYPKDVELVMGL-----AASGKDVV  283

Query  902   MVGPDLLAWRCKVKNRKGN--ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNS  729
               GPD L    +      N  I+V  L    LS  E G  FKR F +    TL++ T   
Sbjct  284   NSGPDDLIADLRNNYNATNRGISVRLLEE-RLSAPEAGDDFKRSFVLYALGTLLSPTARL  342

Query  728   YANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVE  549
               +   +H   ++ ++   +W  +LL  LV     + Q   +   G LLFL LFY +R+ 
Sbjct  343   DVSPSFLHFLTNMSVVHQYNWGKFLLDRLVREISRFRQGKQQAVGGCLLFLQLFYYERIS  402

Query  548   -AGERNVPRA-NPAAHGWTKRALDAREQQEVDAGEFGYGQL  432
               G R++  A +P    W +  +  RE+QE + G +G GQ+
Sbjct  403   IEGTRDLSSAVSPCLSSWGEDEITEREKQERERGGYGCGQV  443



>ref|XP_010660351.1| PREDICTED: uncharacterized protein LOC100263780 isoform X3 [Vitis 
vinifera]
Length=630

 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 153/335 (46%), Gaps = 30/335 (9%)
 Frame = -2

Query  1274  VDDEAPTPPRDPEELDDTEPVHDIMSPFPQ----IETRGRPSELVRLLTGLSTKQRKDVI  1107
             ++++A    R  E  D+        +P P+    + TR  P  L  +L  L+  Q+  V 
Sbjct  79    LEEKAKYTKRSREVWDNYLTTAPARAPKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVR  138

Query  1106  SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSV  927
             S+G G LLGLR + L   L  WL+  FN A+ ++++   R + ++ + V  V+GL     
Sbjct  139   SMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEICGER-IPLSPKDVELVMGL-----  192

Query  926   TMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK----EGGVWFKRHFCVVVA  759
               + +D    GPD L    +++N   N T H ++   L  +    E G  FKR F +   
Sbjct  193   AASGKDVVNSGPDDLI--VELRNSY-NATNHGISVRLLEERLAAPEAGEEFKRSFILYAL  249

Query  758   STLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLF  579
              T++  T     +   +H   ++  I   +W  +LL  LV     + Q   R   G LLF
Sbjct  250   GTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLF  309

Query  578   LTLFYVDRVEAGERN---VPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL---EEPFS  417
             L LFY + V   ER    VP   P    W +  +  RE++E + G +G+G++   E    
Sbjct  310   LQLFYYETVSV-ERPGSLVPGLGPCLSSWGEEEITEREKRERELGGYGFGEVLYKESCLG  368

Query  416   TSASRPRCRSSVEQTRYGR----ADSRPQPVHQGH  324
             T +S  RCR+ ++    GR    ++  P   H+G+
Sbjct  369   TESS--RCRAQLDCLPSGRMGTSSEHGPALGHEGN  401



>ref|XP_010660347.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660348.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660349.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
 ref|XP_010660350.1| PREDICTED: uncharacterized protein LOC100263780 isoform X2 [Vitis 
vinifera]
Length=635

 Score =   104 bits (260),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 153/335 (46%), Gaps = 30/335 (9%)
 Frame = -2

Query  1274  VDDEAPTPPRDPEELDDTEPVHDIMSPFPQ----IETRGRPSELVRLLTGLSTKQRKDVI  1107
             ++++A    R  E  D+        +P P+    + TR  P  L  +L  L+  Q+  V 
Sbjct  84    LEEKAKYTKRSREVWDNYLTTAPARAPKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVR  143

Query  1106  SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSV  927
             S+G G LLGLR + L   L  WL+  FN A+ ++++   R + ++ + V  V+GL     
Sbjct  144   SMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEICGER-IPLSPKDVELVMGL-----  197

Query  926   TMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK----EGGVWFKRHFCVVVA  759
               + +D    GPD L    +++N   N T H ++   L  +    E G  FKR F +   
Sbjct  198   AASGKDVVNSGPDDLI--VELRNSY-NATNHGISVRLLEERLAAPEAGEEFKRSFILYAL  254

Query  758   STLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLF  579
              T++  T     +   +H   ++  I   +W  +LL  LV     + Q   R   G LLF
Sbjct  255   GTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLF  314

Query  578   LTLFYVDRVEAGERN---VPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL---EEPFS  417
             L LFY + V   ER    VP   P    W +  +  RE++E + G +G+G++   E    
Sbjct  315   LQLFYYETVSV-ERPGSLVPGLGPCLSSWGEEEITEREKRERELGGYGFGEVLYKESCLG  373

Query  416   TSASRPRCRSSVEQTRYGR----ADSRPQPVHQGH  324
             T +S  RCR+ ++    GR    ++  P   H+G+
Sbjct  374   TESS--RCRAQLDCLPSGRMGTSSEHGPALGHEGN  406



>ref|XP_010660346.1| PREDICTED: uncharacterized protein LOC100263780 isoform X1 [Vitis 
vinifera]
Length=637

 Score =   104 bits (260),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 153/335 (46%), Gaps = 30/335 (9%)
 Frame = -2

Query  1274  VDDEAPTPPRDPEELDDTEPVHDIMSPFPQ----IETRGRPSELVRLLTGLSTKQRKDVI  1107
             ++++A    R  E  D+        +P P+    + TR  P  L  +L  L+  Q+  V 
Sbjct  86    LEEKAKYTKRSREVWDNYLTTAPARAPKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVR  145

Query  1106  SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSV  927
             S+G G LLGLR + L   L  WL+  FN A+ ++++   R + ++ + V  V+GL     
Sbjct  146   SMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEICGER-IPLSPKDVELVMGL-----  199

Query  926   TMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK----EGGVWFKRHFCVVVA  759
               + +D    GPD L    +++N   N T H ++   L  +    E G  FKR F +   
Sbjct  200   AASGKDVVNSGPDDLI--VELRNSY-NATNHGISVRLLEERLAAPEAGEEFKRSFILYAL  256

Query  758   STLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLF  579
              T++  T     +   +H   ++  I   +W  +LL  LV     + Q   R   G LLF
Sbjct  257   GTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLF  316

Query  578   LTLFYVDRVEAGERN---VPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL---EEPFS  417
             L LFY + V   ER    VP   P    W +  +  RE++E + G +G+G++   E    
Sbjct  317   LQLFYYETVSV-ERPGSLVPGLGPCLSSWGEEEITEREKRERELGGYGFGEVLYKESCLG  375

Query  416   TSASRPRCRSSVEQTRYGR----ADSRPQPVHQGH  324
             T +S  RCR+ ++    GR    ++  P   H+G+
Sbjct  376   TESS--RCRAQLDCLPSGRMGTSSEHGPALGHEGN  408



>emb|CBI33564.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 153/335 (46%), Gaps = 30/335 (9%)
 Frame = -2

Query  1274  VDDEAPTPPRDPEELDDTEPVHDIMSPFPQ----IETRGRPSELVRLLTGLSTKQRKDVI  1107
             ++++A    R  E  D+        +P P+    + TR  P  L  +L  L+  Q+  V 
Sbjct  204   LEEKAKYTKRSREVWDNYLTTAPARAPKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVR  263

Query  1106  SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSV  927
             S+G G LLGLR + L   L  WL+  FN A+ ++++   R + ++ + V  V+GL     
Sbjct  264   SMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEICGER-IPLSPKDVELVMGL-----  317

Query  926   TMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK----EGGVWFKRHFCVVVA  759
               + +D    GPD L    +++N   N T H ++   L  +    E G  FKR F +   
Sbjct  318   AASGKDVVNSGPDDLI--VELRNSY-NATNHGISVRLLEERLAAPEAGEEFKRSFILYAL  374

Query  758   STLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLF  579
              T++  T     +   +H   ++  I   +W  +LL  LV     + Q   R   G LLF
Sbjct  375   GTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLF  434

Query  578   LTLFYVDRVEAGERN---VPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL---EEPFS  417
             L LFY + V   ER    VP   P    W +  +  RE++E + G +G+G++   E    
Sbjct  435   LQLFYYETVSV-ERPGSLVPGLGPCLSSWGEEEITEREKRERELGGYGFGEVLYKESCLG  493

Query  416   TSASRPRCRSSVEQTRYGR----ADSRPQPVHQGH  324
             T +S  RCR+ ++    GR    ++  P   H+G+
Sbjct  494   TESS--RCRAQLDCLPSGRMGTSSEHGPALGHEGN  526



>emb|CAN72428.1| hypothetical protein VITISV_032233 [Vitis vinifera]
Length=708

 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 93/335 (28%), Positives = 153/335 (46%), Gaps = 30/335 (9%)
 Frame = -2

Query  1274  VDDEAPTPPRDPEELDDTEPVHDIMSPFPQ----IETRGRPSELVRLLTGLSTKQRKDVI  1107
             ++++A    R  E  D+        +P P+    + TR  P  L  +L  L+  Q+  V 
Sbjct  120   LEEKAKYTKRSREVWDNYLTTAPARAPKPRKQTNLVTRCSPGRLFNVLQRLTPDQKAAVR  179

Query  1106  SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSV  927
             S+G G LLGLR + L   L  WL+  FN A+ ++++   R + ++ + V  V+GL     
Sbjct  180   SMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEICGER-IPLSPKDVELVMGL-----  233

Query  926   TMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK----EGGVWFKRHFCVVVA  759
               + +D    GPD L    +++N   N T H ++   L  +    E G  FKR F +   
Sbjct  234   AASGKDVVNSGPDDLI--VELRNSY-NATNHGISVRLLEERLAAPEAGEEFKRSFILYAL  290

Query  758   STLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLF  579
              T++  T     +   +H   ++  I   +W  +LL  LV     + Q   R   G LLF
Sbjct  291   GTVLCPTARLDVSPSFLHFLTNMDTIHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLF  350

Query  578   LTLFYVDRVEAGER---NVPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL---EEPFS  417
             L LFY + V   ER    VP   P    W +  +  RE++E + G +G+G++   E    
Sbjct  351   LQLFYYETVSV-ERPGSLVPGLGPCLSSWGEEEITEREKRERELGGYGFGEVLYKESCLG  409

Query  416   TSASRPRCRSSVEQTRYGR----ADSRPQPVHQGH  324
             T +S  RCR+ ++    GR    ++  P   H+G+
Sbjct  410   TESS--RCRAQLDCLPSGRMGTSSEHGPALGHEGN  442



>ref|XP_010645203.1| PREDICTED: serine/threonine-protein phosphatase 7 long form homolog 
[Vitis vinifera]
Length=283

 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 116/237 (49%), Gaps = 11/237 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FNP 
Sbjct  19    PKLYLQTRCSPERVIRVIEKLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPN  78

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLP--NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DL    C   ++KG +
Sbjct  79    TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVGH--KNDLCKKYC---DKKGRL  132

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W 
Sbjct  133   PLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWA  192

Query  662   GYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVP---RANPAAHGW  501
              ++LS LV+  + + +       G LLFL LFY + +   E+ +P   R +P    W
Sbjct  193   EFVLSYLVHGIEEFKKKQQSGVCGCLLFLMLFYHEHISFEEKFLPLYTRPSPRITAW  249



>gb|EYU41323.1| hypothetical protein MIMGU_mgv1a003049mg [Erythranthe guttata]
Length=612

 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 119/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ +L  L+  QR  V S+G G +L L+ + L   L  WL+  FN  + +
Sbjct  103   KLVTRCSPGRLLNVLQRLTPDQRDAVKSMGFGSILNLKCRTLRRSLCLWLLEKFNTVRRS  162

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + +T   V  V+GL +       +D    GPD L    +      N  I+V 
Sbjct  163   LEICGER-IPLTARDVELVMGLSSSG-----KDVVNSGPDELIAELRKNYNATNRGISVR  216

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L++ E G  F+R F + V  TL+  T     +   +H   ++ ++   +W  +L
Sbjct  217   LLEE-RLAVPEAGEDFQRSFLLYVLGTLLCPTARLDVSPSFLHFLTNMEVVHQYNWGKFL  275

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + V  GE +   P   P    W +  +  
Sbjct  276   LDRLVREVARYRQGKQRAVGGCLLFLQLFYYESVAVGEPSELSPAIFPCLASWGEEEISE  335

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  336   REKQERELGGYGCGEV  351



>gb|KHN37849.1| E3 ubiquitin-protein ligase SINA-like 10 [Glycine soja]
Length=613

 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 150/359 (42%), Gaps = 38/359 (11%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L ++L  L+ +Q++ V S+G G LLGLR + L   L  WL+  F+    +
Sbjct  117   KLVTRCSPGRLFKVLQRLTPEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLERFDTTNCS  176

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++ N   + +T   V  VLGL      +       +  DL   R         I+V  L
Sbjct  177   LEICNVD-VPLTPNDVEMVLGLSASGKEVVNSGPEDMISDL---RNSYNAINHGISVRLL  232

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                 L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +LL 
Sbjct  233   EE-QLATAESGDDFKRSFVLYVLGTLLCPTARLDVSPSFLHFLTNMDLVHQYNWGKFLLD  291

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV--EAGERNVPRANPAAHGWTKRALDARE  474
              LV     + Q   R   G LLFL LFY + +  E     VP   P    W +  +  RE
Sbjct  292   RLVREVLRFHQGKQRTVGGCLLFLQLFYYENISLEGSSAPVPTIVPYLFSWGEEEIAERE  351

Query  473   QQEVDAGEFGYGQLEEPFSTSASRPRCRSSVEQTRYGRADSRPQPVHQGHTPGVSMVSAA  294
             ++E + G +G G+L       AS+ +C                 P ++ H  G  + +  
Sbjct  352   KREKELGGYGSGEL-------ASKKKCH------------HMEFPEYRDHPDGPLITTEI  392

Query  293   SRAPTVP-SPQGDTTGSRGAAGDHPVHHGLI---------PDANKGFGCE--LDSMIAD  153
             SR    P  P+ +    RG   +  V  G +         P  NK +GC   +D M ++
Sbjct  393   SRIGHGPLRPESNEEDIRGFPRNRTVLSGDVDLVVESIEAPCRNKEYGCNETVDCMTSN  451



>gb|EPS61547.1| hypothetical protein M569_13248, partial [Genlisea aurea]
Length=414

 Score =   100 bits (250),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 118/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ LL  L+  Q+  V ++G G +L LR + L   L  +L+  FN  +  
Sbjct  106   KLVTRCSPGRLLNLLQRLTADQKAAVKNMGFGSILNLRCRTLRRSLCLFLLEKFNTVRRT  165

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPD--LLAWRCKVKNRKGNITVH  834
             ++L   R + +T   V  V+GL     + + +D    GPD  +   R K       I+V 
Sbjct  166   LELCGER-IPLTPRDVELVMGL-----SCSGKDVVNSGPDEAIAELRKKYNATNHGISVR  219

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L++ E G  F+R F + V  TL+  T     +   +H   D+  +   +W  +L
Sbjct  220   LLEE-RLAIPESGEDFRRSFLLYVLGTLLCPTARLDVSPSFLHFLTDMDTVDQYNWGKFL  278

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + +  GE +   P   P    W +  +  
Sbjct  279   LDRLVREVARYRQGKQRAVGGCLLFLQLFYYESIAVGEPSELSPAVFPCLASWGEEEISE  338

Query  479   REQQEVDAGEFGYGQL  432
             RE+QE + G +G G++
Sbjct  339   REKQERELGGYGCGEV  354



>ref|XP_006589372.1| PREDICTED: uncharacterized protein LOC100782920 [Glycine max]
Length=601

 Score =   101 bits (252),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 150/359 (42%), Gaps = 38/359 (11%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L ++L  L+ +Q++ V S+G G LLGLR + L   L  WL+  F+    +
Sbjct  105   KLVTRCSPGRLFKVLQRLTPEQKEAVKSMGFGSLLGLRCRTLRRSLCLWLLERFDTTNCS  164

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++ N   + +T   V  VLGL      +       +  DL   R         I+V  L
Sbjct  165   LEICNVD-VPLTPNDVEMVLGLSASGKEVVNSGPEDMISDL---RNSYNAINHGISVRLL  220

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                 L+  E G  FKR F + V  TL+  T     +   +H   ++ ++   +W  +LL 
Sbjct  221   EE-QLATAESGDDFKRSFVLYVLGTLLCPTARLDVSPSFLHFLTNMDLVHQYNWGKFLLD  279

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV--EAGERNVPRANPAAHGWTKRALDARE  474
              LV     + Q   R   G LLFL LFY + +  E     VP   P    W +  +  RE
Sbjct  280   RLVREVLRFHQGKQRTVGGCLLFLQLFYYENISLEGSSAPVPTIVPYLFSWGEEEIAERE  339

Query  473   QQEVDAGEFGYGQLEEPFSTSASRPRCRSSVEQTRYGRADSRPQPVHQGHTPGVSMVSAA  294
             ++E + G +G G+L       AS+ +C                 P ++ H  G  + +  
Sbjct  340   KREKELGGYGSGEL-------ASKKKCH------------HMEFPEYRDHPDGPLITTEI  380

Query  293   SRAPTVP-SPQGDTTGSRGAAGDHPVHHGLI---------PDANKGFGCE--LDSMIAD  153
             SR    P  P+ +    RG   +  V  G +         P  NK +GC   +D M ++
Sbjct  381   SRIGHGPLRPESNEEDIRGFPRNRTVLSGDVDLVVESIEAPCRNKEYGCNETVDCMTSN  439



>ref|XP_002305192.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
 gb|EEE85703.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
Length=628

 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 118/258 (46%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  117   KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  176

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  177   LEIC-GMCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  227

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++ ++   +W  
Sbjct  228   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVVHQYNWGK  287

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  288   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  347

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  348   SEREKRQRELGGYGFGEV  365



>gb|KHG25342.1| hypothetical protein F383_32011 [Gossypium arboreum]
Length=641

 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 119/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+++Q+  V S+G G LLGLR + L   L  WL+  FN A+ +
Sbjct  130   KLVTRCSPGRLFNVLQRLTSEQKDAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRS  189

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + ++   V  V+GL         +D    GPD L    +      N  I+V 
Sbjct  190   LEICGER-IPLSPRDVEHVMGL-----AARGKDVVNSGPDDLIADLRYIYNATNRGISVR  243

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F +    TL++ T     +   +H   ++  +   +W  +L
Sbjct  244   LLEE-RLAAPEAGEDFKRSFILYALGTLLSPTARLDVSPSFLHFLINMDAVHQYNWGKFL  302

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +   +E    + P A P    W +  +  
Sbjct  303   LDRLVQEVSRFRQGKQRAVGGCLLFLQLFYYESISIEGAGSSAPVAIPCLSSWGEEEITE  362

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  363   REKRERELGGYGCGEV  378



>ref|XP_011002801.1| PREDICTED: uncharacterized protein LOC105109714 isoform X4 [Populus 
euphratica]
Length=621

 Score = 99.8 bits (247),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 117/258 (45%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  111   KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  170

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  171   LEIC-GVCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  221

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++  +   +W  
Sbjct  222   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDAVHQYNWGK  281

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  282   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  341

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  342   SEREKRQRELGGYGFGEV  359



>ref|XP_011002799.1| PREDICTED: uncharacterized protein LOC105109714 isoform X2 [Populus 
euphratica]
Length=627

 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 117/258 (45%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  117   KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  176

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  177   LEIC-GVCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  227

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++  +   +W  
Sbjct  228   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDAVHQYNWGK  287

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  288   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  347

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  348   SEREKRQRELGGYGFGEV  365



>ref|XP_011002798.1| PREDICTED: uncharacterized protein LOC105109714 isoform X1 [Populus 
euphratica]
Length=638

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 117/258 (45%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  128   KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  187

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  188   LEIC-GVCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  238

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++  +   +W  
Sbjct  239   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDAVHQYNWGK  298

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  299   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  358

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  359   SEREKRQRELGGYGFGEV  376



>ref|XP_011002800.1| PREDICTED: uncharacterized protein LOC105109714 isoform X3 [Populus 
euphratica]
Length=625

 Score = 99.4 bits (246),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 117/258 (45%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  128   KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  187

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  188   LEIC-GVCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  238

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++  +   +W  
Sbjct  239   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDAVHQYNWGK  298

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  299   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  358

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  359   SEREKRQRELGGYGFGEV  376



>ref|XP_011002802.1| PREDICTED: uncharacterized protein LOC105109714 isoform X5 [Populus 
euphratica]
Length=546

 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/258 (29%), Positives = 117/258 (45%), Gaps = 15/258 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  LS +Q   V S+G G LLGLR + L   L  WL+  FN A  +
Sbjct  36    KLVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCS  95

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +++  G  + ++   V  VLGL       + +D    GPD L    +   R  N T H +
Sbjct  96    LEIC-GVCIPLSPRDVEIVLGL-----AASGKDVINSGPDDLIVDLR---RSYNATNHGI  146

Query  827   ATLALSLK----EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +   L  +    E G  FKR F +    TL++ T     +   +H   ++  +   +W  
Sbjct  147   SVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDAVHQYNWGK  206

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRAL  486
             +LL  LV     + Q   R   G LLFL LFY +   VE    +     P    W +  +
Sbjct  207   FLLDRLVREVSRFHQGKQRAVGGCLLFLQLFYYESISVEGSHSSNSSVVPCLSSWGEEEI  266

Query  485   DAREQQEVDAGEFGYGQL  432
               RE+++ + G +G+G++
Sbjct  267   SEREKRQRELGGYGFGEV  284



>ref|XP_010528520.1| PREDICTED: uncharacterized protein LOC104805598 [Tarenaya hassleriana]
Length=499

 Score = 98.6 bits (244),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 117/254 (46%), Gaps = 7/254 (3%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L+ ++  L+++Q++ V ++G GGLL LR + L   L  WL+  F+  +  
Sbjct  36    KLVTRCSPGRLLNVIQRLTSEQKEAVKNMGFGGLLDLRCRTLRRSLCLWLLERFDTRKCC  95

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             +K+  G  + +  + V  V+GL +    +       V  DL   R         I+VH L
Sbjct  96    LKIC-GHCIPLHPKDVEHVMGLASDGKEVINSGPGDVISDL---RLSYNATNHGISVHNL  151

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                 L + E G  FKR F +    TL++ T     +   +H   ++ +I   +W  +LL 
Sbjct  152   EE-KLLIPEAGEDFKRSFILYALGTLISPTARLDVSPSFLHFLTNIDVIHQFNWGKFLLD  210

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDR--VEAGERNVPRANPAAHGWTKRALDARE  474
              LV     + Q       G LLFL LFY +   V+  +   P   P    W +  ++ RE
Sbjct  211   RLVREVSRFQQRKQHAVGGCLLFLQLFYYENVSVDGTKAPCPTTIPCLSFWGEDEINQRE  270

Query  473   QQEVDAGEFGYGQL  432
             ++E   G +G+G +
Sbjct  271   KREKQLGGYGFGYV  284



>ref|XP_004983646.1| PREDICTED: uncharacterized protein LOC101776344 isoform X1 [Setaria 
italica]
 ref|XP_004983647.1| PREDICTED: uncharacterized protein LOC101776344 isoform X2 [Setaria 
italica]
 ref|XP_004983648.1| PREDICTED: uncharacterized protein LOC101776344 isoform X3 [Setaria 
italica]
Length=581

 Score = 99.0 bits (245),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 115/254 (45%), Gaps = 7/254 (3%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
              R  P  +VRL   L+  QRK +   G GGLL +     PL    WL+  F+     + +
Sbjct  25    NRASPIRIVRLYPHLTPDQRKMIEDAGFGGLLKIGCPTFPLGFCGWLLRRFDTDYCELVI  84

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI--TVHALA  825
                  + +T + V  VLG+PNG   +     + +  D +A+     +  G    TV ++ 
Sbjct  85    KGRGRIPVTSDSVHRVLGIPNGGGDVK----YGLDEDAMAFMSDKLDASGKYWPTVSSIE  140

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
                  +K     F R F V+V S+ +  T +   + +      D++ I++L+WC +++  
Sbjct  141   NSLKQMKSADEHFLRTFMVLVISSFLCPTTSLRISPRCFPPLVDIKSIRELNWCKFVVEQ  200

Query  644   LVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQE  465
             L  +  ++ +      PG L +L + Y+D ++  +  +P   P    W K+ ++   + +
Sbjct  201   LRKSVRAFARKGKNSVPGCLFYLVILYLDSLDTRDMQIPHGTPRISAWNKKLVNKVLEMD  260

Query  464   V-DAGEFGYGQLEE  426
             + D G FG   L++
Sbjct  261   MKDNGSFGKCLLKK  274



>ref|XP_010644061.1| PREDICTED: uncharacterized protein LOC104877474 [Vitis vinifera]
Length=401

 Score = 96.7 bits (239),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 115/237 (49%), Gaps = 11/237 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FNP 
Sbjct  53    PKLYLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPN  112

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLP--NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    D+    C   ++KG +
Sbjct  113   TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVGH--KNDICKKYC---DKKGRL  166

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W 
Sbjct  167   PLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWA  226

Query  662   GYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNV---PRANPAAHGW  501
              ++LS LV+  + + +       G LLFL LFY + +   E+ +    R +P    W
Sbjct  227   EFVLSYLVHGIEEFKKKQQSGVCGCLLFLMLFYHEHISFEEKFLLLYTRPSPRITAW  283



>emb|CAN74236.1| hypothetical protein VITISV_004916 [Vitis vinifera]
Length=849

 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 112/235 (48%), Gaps = 7/235 (3%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L   L+++FNP 
Sbjct  254   PKLYLQTRCSPERVIRVIEKLEPKQKAAIXEIGFGSLLQLRCRKIDHGLCLXLINSFNPN  313

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
                ++L N   ++++   V  ++GL      +          DL    C   ++KG + +
Sbjct  314   TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVXHKNDLCKKYC---DKKGRLPL  369

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W  +
Sbjct  370   VMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWXEF  429

Query  656   LLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVP---RANPAAHGW  501
             +LS LV+  + + +       G LLFL LFY + +   E+ +P   R +P    W
Sbjct  430   VLSYLVHGIEEFKKKQQSGVCGCLLFLMLFYHEHISFEEKFLPLYTRPSPRITAW  484



>ref|XP_010278746.1| PREDICTED: uncharacterized protein LOC104612845 isoform X1 [Nelumbo 
nucifera]
Length=547

 Score = 97.4 bits (241),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  201   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  260

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  261   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  319

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  320   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  379

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  380   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  439

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  440   ISERERKYREIGGYDFAEV  458



>ref|XP_006482158.1| PREDICTED: uncharacterized protein LOC102612380 [Citrus sinensis]
Length=620

 Score = 97.4 bits (241),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 115/256 (45%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+T QR  V S+G G LL LR + L   L  WL+  FN  + +
Sbjct  112   KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRS  171

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             + +  G  + ++   V  V+GL         +D    GPD L    +      N  I+V 
Sbjct  172   LDIC-GECIPLSPRDVEFVMGL-----AACGKDVVNSGPDDLIANLRHSYNATNHGISVR  225

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L++ E G  FKR F +    TL++ T     +   +H   ++ +I   +W  +L
Sbjct  226   LLEE-RLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVIHQYNWGKFL  284

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +   +E      P   P    W +  +  
Sbjct  285   LDRLVREVSRYRQGKQRAVGGCLLFLQLFYYESISIEGSSALAPTVVPCLSSWGEEEITE  344

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  345   REKREKELGGYGSGKV  360



>ref|XP_010278747.1| PREDICTED: uncharacterized protein LOC104612845 isoform X2 [Nelumbo 
nucifera]
Length=544

 Score = 97.1 bits (240),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  198   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  257

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  258   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  316

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  317   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  376

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  377   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  436

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  437   ISERERKYREIGGYDFAEV  455



>ref|XP_008229334.1| PREDICTED: uncharacterized protein LOC103328702 [Prunus mume]
Length=621

 Score = 97.4 bits (241),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 120/269 (45%), Gaps = 18/269 (7%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  ++  L+T+Q+  V S+G G LL LR + L   L  WL+  F+  Q +
Sbjct  112   KLVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFDTTQRS  171

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLA--WRCKVKNRKGNITVH  834
             +++   R + +T + V  V+GL       + +D    GPD L    R         I+V 
Sbjct  172   LEICGER-IPLTPKDVELVMGL-----AASGKDVVNSGPDDLIADLRHSYDATNHGISVR  225

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F +    TL++ T     +   +H   +V ++   +W  +L
Sbjct  226   LLEE-RLAEPEAGEEFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNVDVVHQYNWGKFL  284

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + +   E     P   P    W +  +  
Sbjct  285   LDRLVCEVSRFHQGKQRAVGGCLLFLQLFYYESISVEENGALAPAVVPFLSSWGEDEITE  344

Query  479   REQQEVDAGEFGYGQLEEPFSTSASRPRC  393
             RE++E + G +G G++         R RC
Sbjct  345   REKRERELGGYGCGEV-------VCRERC  366



>ref|XP_010278748.1| PREDICTED: uncharacterized protein LOC104612845 isoform X3 [Nelumbo 
nucifera]
Length=522

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  176   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  235

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  236   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  294

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  295   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  354

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  355   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  414

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  415   ISERERKYREIGGYDFAEV  433



>ref|XP_010278750.1| PREDICTED: uncharacterized protein LOC104612845 isoform X5 [Nelumbo 
nucifera]
Length=505

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  159   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  218

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  219   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  277

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  278   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  337

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  338   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  397

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  398   ISERERKYREIGGYDFAEV  416



>ref|XP_006430659.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
 gb|ESR43899.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
Length=623

 Score = 97.1 bits (240),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 115/256 (45%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+T QR  V S+G G LL LR + L   L  WL+  FN  + +
Sbjct  112   KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRS  171

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             + +  G  + ++   V  V+GL         +D    GPD L    +      N  I+V 
Sbjct  172   LDIC-GECIPLSPRDVEFVMGL-----AACGKDVVNSGPDDLIANLRHSYNATNHGISVR  225

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L++ E G  FKR F +    TL++ T     +   +H   ++ +I   +W  +L
Sbjct  226   LLEE-RLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVIHQYNWGKFL  284

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +   +E      P   P    W +  +  
Sbjct  285   LDRLVREVSRYRQGKQRAVGGCLLFLQLFYYESISIEGSSALAPTIVPCLSSWGEEEITE  344

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  345   REKREKELGGYGSGKV  360



>ref|XP_010278749.1| PREDICTED: uncharacterized protein LOC104612845 isoform X4 [Nelumbo 
nucifera]
Length=514

 Score = 96.7 bits (239),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  168   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  227

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  228   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  286

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  287   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  346

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  347   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  406

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  407   ISERERKYREIGGYDFAEV  425



>ref|XP_007011252.1| RING/U-box and TRAF-like domains [Theobroma cacao]
 gb|EOY20062.1| RING/U-box and TRAF-like domains [Theobroma cacao]
Length=639

 Score = 97.1 bits (240),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 117/256 (46%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+ +Q+  V S+G G LLGLR + L   L  WL+  FN  + +
Sbjct  128   KLVTRCSPGRLFNVLQRLTPEQKAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTVRHS  187

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             +++   R + ++   V  V+GL         +D    GPD L    +      N  I+V 
Sbjct  188   LEICGER-IPLSPRDVEHVMGL-----AACGKDVVNSGPDDLIADLRQSYNATNRGISVR  241

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F +    TL++ T     +   +H   ++ ++   +W  +L
Sbjct  242   LLEEW-LAAPEAGEDFKRSFILYALGTLLSPTARLDVSPSFLHFLINMDVVHQYNWGKFL  300

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +   +E    + P   P    W +  +  
Sbjct  301   LDRLVREVSRFRQGKQRAVGGCLLFLQLFYYESISIEGAGSSAPMVVPCLSSWGEEEITE  360

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  361   REKRERELGGYGRGEV  376



>ref|XP_010278751.1| PREDICTED: uncharacterized protein LOC104612845 isoform X6 [Nelumbo 
nucifera]
Length=502

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  156   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  215

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  216   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  274

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  275   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  334

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  335   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  394

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  395   ISERERKYREIGGYDFAEV  413



>ref|XP_002532643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29746.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score = 95.1 bits (235),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 119/258 (46%), Gaps = 13/258 (5%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+ +Q+  V  +G G LLGLR + L   L  WL+  FN    +
Sbjct  111   KLVTRCSPGRLFNVLQRLTPEQKDAVKDLGFGSLLGLRCRTLRRSLCLWLLQRFNTTGRS  170

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPD--LLAWRCKVKNRKGNITVH  834
             +++   R + ++ + V  V+GL       + +D    GPD  +L  R         I+V 
Sbjct  171   LEICGDR-IPLSPKDVEFVMGL-----AASGKDVVNSGPDNLILDLRRNYNATNRGISVS  224

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L   E G  FKR F +    TL++ T     +   +H   +V ++   +W  +L
Sbjct  225   LLEE-RLKAPEAGEEFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNVDVVHQYNWGKFL  283

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEA-GERNV---PRANPAAHGWTKRAL  486
             L  LV     + Q   R   G LLFL LFY + V   G  ++   P + P    W +  +
Sbjct  284   LDRLVREVARFRQGKQRAVGGCLLFLQLFYYETVSVEGPGSLEPDPASLPCLSSWGEEEI  343

Query  485   DAREQQEVDAGEFGYGQL  432
               RE++E + G +G+G++
Sbjct  344   TEREKRERELGGYGFGEV  361



>gb|KDO63134.1| hypothetical protein CISIN_1g043878mg, partial [Citrus sinensis]
Length=648

 Score = 96.3 bits (238),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 115/256 (45%), Gaps = 11/256 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  +L  L+T QR  V S+G G LL LR + L   L  WL+  FN  + +
Sbjct  111   KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRCRTLRRSLCLWLLERFNTTRRS  170

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVH  834
             + +  G  + ++   V  V+GL         +D    GPD L    +      N  I+V 
Sbjct  171   LDIC-GECIPLSPRDVEFVMGL-----AACGKDVVNSGPDDLIANLRHSYNATNHGISVR  224

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L++ E G  FKR F +    TL++ T     +   +H   ++ +I   +W  +L
Sbjct  225   LLEE-RLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVIHQYNWGKFL  283

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY +   +E      P   P    W +  +  
Sbjct  284   LDRLVREVSRYRQGKQRAVGGCLLFLQLFYYESISIEGSSALAPTVVPCLSSWGEEEITE  343

Query  479   REQQEVDAGEFGYGQL  432
             RE++E + G +G G++
Sbjct  344   REKREKELGGYGSGKV  359



>ref|XP_010672819.1| PREDICTED: protein PRRC2C-like [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 96.7 bits (239),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 112/236 (47%), Gaps = 5/236 (2%)
 Frame = -2

Query  1127  KQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVL  948
             ++R+ +I +G GGLL L +          L+S ++    ++ L  GR + I +  V  V 
Sbjct  373   QKRQAIIDMGFGGLLELDMPKNDPIFCARLLSRYSVGSGSLMLRRGREIEIRDIDVHLVY  432

Query  947   GLPNGSVTMTERDTHMVGPDLL---AWRCKVKNRKGNITVHALAT-LALSLKEGGVWFKR  780
             G+P G + + +   +      L    WR  V  ++G+  V  +AT LA +       +KR
Sbjct  433   GIPLGGLLVDDNKDNDAADYRLMLEEWREYVGVQRGSPYVSTMATHLADAAVPVTDNWKR  492

Query  779   HFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARK  600
              F VV  +  + STLN       +    DV  I + +WC Y + SL+++  SW ++T R 
Sbjct  493   TFLVVAVNCCIKSTLNPQPLTGFLSTTIDVNNIPNYNWCKYTIESLLHSACSWQEDTTRF  552

Query  599   FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGEFGYGQL  432
             F GPL FL + Y DR++      PRA P    W +  + +R   E  +G  G G +
Sbjct  553   FAGPLPFLQVCYFDRLQKELHKPPRAFPLLSVWKREIIRSRISYEFRSG-LGMGTV  607



>ref|XP_010278752.1| PREDICTED: uncharacterized protein LOC104612845 isoform X7 [Nelumbo 
nucifera]
 ref|XP_010278753.1| PREDICTED: uncharacterized protein LOC104612845 isoform X7 [Nelumbo 
nucifera]
Length=465

 Score = 95.1 bits (235),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 116/259 (45%), Gaps = 9/259 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             ++TR  P   + +L  L+ +Q+  V ++G G LLG+R + L   L  WL+  F+PA+  +
Sbjct  119   LQTRCSPGRFLSVLKKLTVEQKVAVENVGFGSLLGIRCETLRRGLCQWLLERFDPARCCL  178

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + IT   V  V+GLP+    +          ++  +     +  GN ++    
Sbjct  179   HI-DGKRIYITVRDVELVMGLPSSGHKVVTSGPDGAIAEMRRYYSAAPDDGGNSSISTGI  237

Query  824   TLA-----LSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
             +L      L  +E G  FKR F +    T++  T    A+ K +H  +    I   +W  
Sbjct  238   SLGLLEKQLETQEAGDEFKRSFALFALGTILCPTAKGEASPKFLHSLRKTDDIPKYNWAQ  297

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRAN-PAAHGWTKRA  489
             ++L  L+     + Q   R   G LLFL  F+ +    G     VP  N P    W +  
Sbjct  298   FVLDRLLRETSRFHQGKQRAVGGCLLFLKFFFYEHTTIGGPSTFVPNLNVPRLLAWGEME  357

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  RE++  + G + + ++
Sbjct  358   ISERERKYREIGGYDFAEV  376



>ref|XP_007215313.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
 gb|EMJ16512.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
Length=567

 Score = 94.4 bits (233),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 73/255 (29%), Positives = 118/255 (46%), Gaps = 11/255 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P  L  ++  L+T+Q+  V S+G G LL LR + L   L  WL+  F+  Q +
Sbjct  113   KLVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFDTTQRS  172

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPD-LLA-WRCKVKNRKGNITVH  834
             +++   R + +T + V  V+GL       + +D    GPD L+A  R         I+V 
Sbjct  173   LEICGER-IPLTPKDVELVMGL-----AASGKDVVNSGPDDLIADLRHSYDATNHGISVR  226

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
              L    L+  E G  FKR F +    TL++ T     +   +H   ++ ++   +W  +L
Sbjct  227   LLEE-RLAEPEAGEEFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVVHQYNWGKFL  285

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDA  480
             L  LV     + Q   R   G LLFL LFY + +   E     P   P    W +  +  
Sbjct  286   LDRLVCEVSRFHQGKQRAVGGCLLFLQLFYYESISVEENGALAPAVVPFLSSWGEDEITE  345

Query  479   REQQEVDAGEFGYGQ  435
             RE++E + G +G G+
Sbjct  346   REKRERELGGYGCGE  360



>ref|XP_008365752.1| PREDICTED: uncharacterized protein LOC103429377 [Malus domestica]
Length=616

 Score = 94.4 bits (233),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 113/251 (45%), Gaps = 7/251 (3%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  ++  L+ +Q+  V S+G G LL LR + L   L  WL+  FN  + ++++
Sbjct  120   TRCSPGRLFNVIQRLTNEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFNTTRXSLEI  179

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
                R + IT + V  V+GL      +    +  +  DL   R         I+V  L   
Sbjct  180   CGER-IPITPKBVELVMGLAASGKDVVNSGSDDLIADL---RHXYDATNHGISVRLLEE-  234

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+  E G  FKR F +    TL++ T     +   +H   ++ ++   +W  +LL  LV
Sbjct  235   RLAZPEAGEEFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVVHQYNWGKFLLDRLV  294

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDAREQQE  465
                  + Q   R   G LLFL LFY + +   E     P   P+   W +  +  RE++E
Sbjct  295   CEVSRFRQGKQRAVGGCLLFLQLFYYESISVEENGALAPALVPSLSSWGEDEITEREKRE  354

Query  464   VDAGEFGYGQL  432
              + G +G G++
Sbjct  355   RELGGYGCGEV  365



>ref|XP_004985207.1| PREDICTED: suppressor protein SRP40-like isoform X1 [Setaria 
italica]
Length=526

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 111/255 (44%), Gaps = 15/255 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRV-KALPLRLGHWLVSNFNPAQMAIK  1002
             +R  PS L++     + +Q   +   G GGLL L+  K  P  L HWL  +FN A   + 
Sbjct  33    SRCNPSNLIQTAKNFTLEQCDLIRRNGFGGLLNLKCRKNPPHLLYHWLAKHFNCATSELV  92

Query  1001  LSNGRFLRITEEGVAAVLGLPNGS----VTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              SNG  + +T + V  +LG+P G+      M  + T ++  D  +           IT  
Sbjct  93    FSNGTVIPVTAKSVQLILGIPYGNRKVKYEMDAQSTALMKQDYYS-----DGLPARIT--  145

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
             ++      +++    F R F ++  S  +  T +   + +      D+  +  LDWC ++
Sbjct  146   SIGEQLSEMRKADDRFLRTFLLLAMSCFLCPTTSCRISPRCFPSLVDISSVAQLDWCDFV  205

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L  LV++   +         G + FL + Y+D ++ G   VP + P    WT + ++   
Sbjct  206   LKQLVSSIKRYKHRLT--ICGCMFFLAVHYLDHLDTGSYRVPSSIPRTRVWTTKVIEKVV  263

Query  473   QQEVDAGEFG-YGQL  432
               +  + + G YG L
Sbjct  264   NMDTISQDDGVYGNL  278



>gb|EMT07156.1| hypothetical protein F775_24002 [Aegilops tauschii]
Length=946

 Score = 85.1 bits (209),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 110/243 (45%), Gaps = 13/243 (5%)
 Frame = -2

Query  1124  QRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLG  945
             QR+   S+G+  LL L+   LP  + H+L SNF+    AI+L NG    IT   +  VLG
Sbjct  29    QRQLARSMGLDHLLDLKCDTLPRGVVHYLASNFDVPSRAIELPNGFKFTITPYCIHQVLG  88

Query  944   LPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI-TVHALATLALSLKEGGVWFKRHFCV  768
             +P G  T+ ++      P L +   +    KGN  T++ L  L     +G   FKR F +
Sbjct  89    IPLGGKTIEKKQ----NPALRSLIAQQTKCKGNYPTINELDNLIQPGLDGDS-FKRIFTM  143

Query  767   VVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGP  588
                + L+  + +  A+    H+ +D   I   D+C  +L  LV + DS+         G 
Sbjct  144   YALTVLLCPSSHGAASPDYYHILEDPEQIGSFDFCTAVLDKLVASIDSYKAGATTVLGGD  203

Query  587   LLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGE-FGYGQL------E  429
             LL LT+ Y + ++     V    P    WT   +   E+++  + +   YG+L      E
Sbjct  204   LLTLTIIYFEFLDTDIMPVTSKRPRISLWTSEIVAEYERRDCTSSDKLLYGRLPTKHVSE  263

Query  428   EPF  420
              PF
Sbjct  264   TPF  266



>gb|AFW81096.1| hypothetical protein ZEAMMB73_569676 [Zea mays]
Length=1349

 Score = 85.1 bits (209),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 108/241 (45%), Gaps = 9/241 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  91    RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  150

Query  995   NGRFLRITEEGVAAVLGLPN-GSV--TMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN GS   TM++ D   +  +L    C K   R   I +  +
Sbjct  151   GGKEIQITEHSVWCVLELPNVGSDPPTMSDADARALRDELGVQICGKSYRRISGINISVI  210

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ I + +WC  L+ 
Sbjct  211   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNIGNKNWCKALVD  270

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ +FYVD ++ G    P + P       + +D
Sbjct  271   RLSIAARLYRKDFAEKGINAPISGCGIFVAMFYVDNLQHGLDTSPFSIPRCAFLDSKMID  330

Query  482   A  480
             A
Sbjct  331   A  331



>ref|XP_007204431.1| hypothetical protein PRUPE_ppa027095mg, partial [Prunus persica]
 gb|EMJ05630.1| hypothetical protein PRUPE_ppa027095mg, partial [Prunus persica]
Length=308

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 108/235 (46%), Gaps = 10/235 (4%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I TR  P ++   +  LS +++  +  +G   LL ++   L   L H+LV   +PA+ +
Sbjct  60    KISTRCSPKDIKDTINVLSDEKKAAIEEMGFVSLLEMKCGKLSHSLCHFLVDKLDPAESS  119

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGP----DLLAWRCKVKNRKGNIT  840
             I L +G+  +I+ +    ++G+ +G       + H  G     D++  R      K  + 
Sbjct  120   IVL-HGKTFKISVDDFVRIMGVKDGG-----EEVHFTGSMDDQDIVNMRNSFLGGKKLLK  173

Query  839   VHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              + L  + +  +E   +FK  F +    TL+  T + Y N K +   +D + I   +W  
Sbjct  174   NNELKQIMVGTEEASDFFKVGFVMFALCTLLCPTTSVYVNLKYLLPLRDSKAIARKNWAS  233

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK  495
             Y L  L+++  S+ +N      G LLFL LFY+D +  G   V R+      W K
Sbjct  234   YSLRFLLDSVRSFKENNQVYIGGCLLFLQLFYLDAIAHGSVLVDRSVLPLTVWGK  288



>ref|XP_008675708.1| PREDICTED: uncharacterized protein LOC103651788 [Zea mays]
Length=695

 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 107/241 (44%), Gaps = 9/241 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  91    RYSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  150

Query  995   NGRFLRITEEGVAAVLGLPN-GSV--TMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN GS   TM++ D   +  +L    C K   R   I +  +
Sbjct  151   GGKEIQITEHSVWCVLELPNVGSDPPTMSDADARALRDELGVQICGKSYRRISGINISVI  210

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ I + +WC  ++ 
Sbjct  211   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNIGNKNWCKAVVD  270

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  271   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLDTSPFSIPRCAFLDSKMID  330

Query  482   A  480
             A
Sbjct  331   A  331



>emb|CDP18389.1| unnamed protein product [Coffea canephora]
Length=296

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 92/184 (50%), Gaps = 11/184 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I  R  P +L++L++ L   +++ +  IG GGLL ++  ++P  L  WL+ +FNP Q  
Sbjct  121   EITIRSSPCQLLKLVSKLDDIKKEAIREIGFGGLLEIQCHSMPSCLLTWLIQHFNPTQCH  180

Query  1007  IKLSNGRFLRITEEGVAAVLGLP-NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             I+L  G+ L++T   V   LG+P NG +   + D      D++  R K         +  
Sbjct  181   IQLDGGQILQVTAHDVEITLGIPGNGPIPKEDEDASEEEVDIIPRRYK--------WIDL  232

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  L +S+ E G  FK+ F + V   L+A +  +    K       V  I++++W  Y +
Sbjct  233   LEEL-ISM-ESGEEFKKKFVIFVCGCLLAPSKRAEHTTKLWRCLHSVEEIRNMNWAEYSI  290

Query  650   SSLV  639
              +++
Sbjct  291   WTVL  294



>ref|XP_008669357.1| PREDICTED: uncharacterized protein LOC103646406 [Zea mays]
Length=554

 Score = 82.8 bits (203),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 117/274 (43%), Gaps = 15/274 (5%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  109   RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  168

Query  995   NGRFLRITEEGVAAVLGLPN-GSV--TMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN GS   TM++ D   +  +L    C K   R   I +  +
Sbjct  169   GGKEIQITEHSVWCVLELPNVGSDPPTMSDADARALRDELGVQICGKSYRRISGINISVI  228

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ I + +WC  ++ 
Sbjct  229   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNIGNKNWCKAVVD  288

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  289   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLDTSPFSIPRCAFLDSKMID  348

Query  482   AREQQEVDAG------EFGYGQLEEPFSTSASRP  399
             A    ++         EFG+ +L     T    P
Sbjct  349   AIANMDLRGDVPPGTTEFGHLRLRSITDTCYGVP  382



>ref|XP_008649459.1| PREDICTED: uncharacterized protein LOC103630154 [Zea mays]
Length=376

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 107/241 (44%), Gaps = 9/241 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  111   RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  170

Query  995   NGRFLRITEEGVAAVLGLPN-GSV--TMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN GS   TM++ D   +  +L    C K   R   I +  +
Sbjct  171   GGKEIQITEHSVWCVLELPNVGSDPPTMSDADARALRDELGVQICGKSYRRISGINISVI  230

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ I + +WC  ++ 
Sbjct  231   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNIGNKNWCKAVVD  290

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  291   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLDTSPFSIPRCAFLDSKMID  350

Query  482   A  480
             A
Sbjct  351   A  351



>ref|XP_002445178.1| hypothetical protein SORBIDRAFT_07g005516 [Sorghum bicolor]
 gb|EES14673.1| hypothetical protein SORBIDRAFT_07g005516 [Sorghum bicolor]
Length=416

 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/254 (23%), Positives = 110/254 (43%), Gaps = 5/254 (2%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +  R  P+ L +L   +S  QRK V   G GGLL +    LP  L  WLV N +     +
Sbjct  2     VRNRATPARLFKLYKEMSEAQRKLVSDTGFGGLLEIGSGRLPSALSKWLVKNVDGESEEL  61

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              +     +++    V  +LGLP G     + + +      +  +C   N +   T+  + 
Sbjct  62    VIPGRGKIKVNAAAVNRILGLPMGE-DEVKYEFNGSAISFINEKCSFDNGRSP-TITTIT  119

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
                 + KE    + R + +V  ST +  +     + K      D+  +K+L+WC +++ +
Sbjct  120   ERLCANKEANDDYLRCWLMVAISTFLCGSTALCISPKCYPSLVDLSKVKELNWCKFVVDT  179

Query  644   LVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQE  465
             L  +     +  +    G L FL++ Y+D +E G   VP   P    W  + ++   + +
Sbjct  180   LKGSVGKMHKKDS--ILGYLYFLSILYLDSLEVGNIQVPEKQPRVAAWNMKLINKVIKMD  237

Query  464   VDA-GEFGYGQLEE  426
              +  G FG  +L++
Sbjct  238   TNTNGTFGKLKLKK  251



>ref|XP_010236671.1| PREDICTED: uncharacterized protein LOC104584197 [Brachypodium 
distachyon]
Length=722

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 113/242 (47%), Gaps = 19/242 (8%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNF--NPAQM  1011
             +  R  P+ L++L   L+  QR+ +   G GGLL LR   LP +L  WL+  F  +  ++
Sbjct  31    VRHRASPARLMKLYLHLTAGQRELIEDAGFGGLLKLRCPVLPAKLCTWLLRRFDADSGEL  90

Query  1010  AIKLSNGRFLRI--TEEGVAAVLGLPNGSVTMTERD-THMVGPDLLAWRCKVKNRKGNIT  840
              I+ + GR  RI  T + V  VL +P G      RD  + +  D +++   V ++ G  +
Sbjct  91    VIR-AGGRRGRIPVTADSVHRVLSIPKGG-----RDVVYGLDEDSISF---VLDKYGVSS  141

Query  839   VHALATLALS---LKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLD  669
             + ++ +L  S   +K+    F R F ++  ST +        + +      D+  I +L+
Sbjct  142   MPSIVSLEDSIKLMKQADEHFLRTFMMIALSTFLCPNSGLKVSPRCFPSLVDISKIGELN  201

Query  668   WCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
             WC +++  L     S+ +   R   G L +L + Y+D ++  +  +P   P    W +  
Sbjct  202   WCQFVVEQLRKCVSSYGKK--RSVGGCLFYLVILYLDSLDTRDLEIPSETPRVSVWNREL  259

Query  488   LD  483
             +D
Sbjct  260   ID  261



>ref|XP_002458043.1| hypothetical protein SORBIDRAFT_03g026065 [Sorghum bicolor]
 gb|EES03163.1| hypothetical protein SORBIDRAFT_03g026065 [Sorghum bicolor]
Length=505

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/257 (24%), Positives = 112/257 (44%), Gaps = 11/257 (4%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +  R  P+ L +L   +S  QRK V   G GGLL +    LP  L  WLV N +     +
Sbjct  2     VRNRATPARLFKLYKEMSEAQRKLVSDAGFGGLLEIGSGRLPSALSKWLVKNVDGVSEEL  61

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              +     +++    V  +LGLP G   + + + +      +  +C   N +      A+ 
Sbjct  62    VIPGRGKIKVNAAAVNRILGLPMGEDEV-KYEFNGSAISFINEKCSFDNGRS----PAIT  116

Query  824   TLALSL---KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
             T+   L   KE    + R + +V  ST +  +     + K      D+  +K+L+WC ++
Sbjct  117   TITERLCANKEANDDYLRCWLMVAISTFLCGSTALCISPKCYPSLVDLSKVKELNWCKFV  176

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             + +L  +     +  +    G L FL++ Y+D +E G   VP   P    W  + ++   
Sbjct  177   VDTLKGSVGKMHKKDS--VLGCLYFLSILYLDSLEVGNIQVPEKQPRVAAWNMKLINKVI  234

Query  473   QQEVDA-GEFGYGQLEE  426
             + + +  G FG  +L++
Sbjct  235   KMDTNTNGTFGKLKLKK  251



>ref|XP_010646728.1| PREDICTED: uncharacterized protein LOC104878295 [Vitis vinifera]
Length=224

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 97/196 (49%), Gaps = 8/196 (4%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FN  
Sbjct  19    PKLYLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNLN  78

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLP--NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DL    C   ++KG +
Sbjct  79    TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVGH--KNDLCKKYC---DKKGRL  132

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W 
Sbjct  133   PLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWA  192

Query  662   GYLLSSLVNTHDSWTQ  615
              ++LS LV+  + + +
Sbjct  193   EFVLSYLVHGIEEFKK  208



>ref|XP_008650421.1| PREDICTED: uncharacterized protein LOC103631248 [Zea mays]
Length=563

 Score = 80.1 bits (196),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/274 (24%), Positives = 117/274 (43%), Gaps = 15/274 (5%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  128   RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMQKLNPETMKLEIG  187

Query  995   NGRFLRITEEGVAAVLGLPN-GSV--TMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN GS    M++ D   +  +L    C K   R   I +  +
Sbjct  188   GGKEIQITEHSVWCVLQLPNVGSDPPPMSDADARALRDELGEQICGKSYRRISGINISVI  247

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ + + +WC  ++ 
Sbjct  248   NDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNMGNKNWCKAVVD  307

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  308   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLETSPFSIPRCAFLDSKMID  367

Query  482   AREQQEVDAG------EFGYGQLEEPFSTSASRP  399
             A   +++         EFG+ +L     T    P
Sbjct  368   AIANKDLRGDVPLGTTEFGHLRLRSITDTCYGVP  401



>ref|XP_006470374.1| PREDICTED: uncharacterized protein LOC102628600 isoform X7 [Citrus 
sinensis]
Length=782

 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 95/211 (45%), Gaps = 5/211 (2%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  137   VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  196

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +L +G+ L +  +  + ++G+ +G + +     +     +   R   +     I +  L 
Sbjct  197   EL-HGKKLELCPKMFSKIMGVKDGGMGIK---INGASDHIAEVRRIFQPTVKGIRIRTLE  252

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              L   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +    
Sbjct  253   ELIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCYDW  311

Query  644   LVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
             LV +   +    A    G L FL +FY+  V
Sbjct  312   LVKSICRFQNQQAAYIGGCLHFLQIFYLHNV  342



>ref|XP_006470370.1| PREDICTED: uncharacterized protein LOC102628600 isoform X3 [Citrus 
sinensis]
 ref|XP_006470371.1| PREDICTED: uncharacterized protein LOC102628600 isoform X4 [Citrus 
sinensis]
 ref|XP_006470372.1| PREDICTED: uncharacterized protein LOC102628600 isoform X5 [Citrus 
sinensis]
 ref|XP_006470373.1| PREDICTED: uncharacterized protein LOC102628600 isoform X6 [Citrus 
sinensis]
Length=795

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 95/211 (45%), Gaps = 5/211 (2%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  105   VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  164

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +L +G+ L +  +  + ++G+ +G + +     +     +   R   +     I +  L 
Sbjct  165   EL-HGKKLELCPKMFSKIMGVKDGGMGIK---INGASDHIAEVRRIFQPTVKGIRIRTLE  220

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              L   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +    
Sbjct  221   ELIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCYDW  279

Query  644   LVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
             LV +   +    A    G L FL +FY+  V
Sbjct  280   LVKSICRFQNQQAAYIGGCLHFLQIFYLHNV  310



>ref|XP_006470368.1| PREDICTED: uncharacterized protein LOC102628600 isoform X1 [Citrus 
sinensis]
Length=827

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 95/211 (45%), Gaps = 5/211 (2%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  137   VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  196

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +L +G+ L +  +  + ++G+ +G + +     +     +   R   +     I +  L 
Sbjct  197   EL-HGKKLELCPKMFSKIMGVKDGGMGIK---INGASDHIAEVRRIFQPTVKGIRIRTLE  252

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              L   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +    
Sbjct  253   ELIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCYDW  311

Query  644   LVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
             LV +   +    A    G L FL +FY+  V
Sbjct  312   LVKSICRFQNQQAAYIGGCLHFLQIFYLHNV  342



>ref|XP_006470369.1| PREDICTED: uncharacterized protein LOC102628600 isoform X2 [Citrus 
sinensis]
Length=823

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 96/213 (45%), Gaps = 9/213 (4%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  133   VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  192

Query  1004  KLSNGRFLRITEEGVAAVLGLPNG--SVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             +L +G+ L +  +  + ++G+ +G   + +     H+        R      KG I +  
Sbjct  193   EL-HGKKLELCPKMFSKIMGVKDGGMGIKINGASDHIAE----VRRIFQPTVKG-IRIRT  246

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  L   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +  
Sbjct  247   LEELIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCY  305

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
               LV +   +    A    G L FL +FY+  V
Sbjct  306   DWLVKSICRFQNQQAAYIGGCLHFLQIFYLHNV  338



>gb|EMS58266.1| hypothetical protein TRIUR3_16719 [Triticum urartu]
Length=717

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/255 (24%), Positives = 116/255 (45%), Gaps = 13/255 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   +  R  P+ +++L   LS  QR+ +   G GGLL L+   +P RL  WL+  F+  
Sbjct  66    PTQGLRHRASPARIMKLYPHLSAGQREMIEGAGFGGLLRLQCPTVPARLSTWLLRRFDTE  125

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
                + +     + +T + V  VLG+P      T RD  + G D  +    V ++ G    
Sbjct  126   SSELVIPGRGRIPVTVDSVHRVLGIPK-----TGRDV-VYGLDDESI-ASVLDKHGVDRP  178

Query  836   HALATLALS---LKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDW  666
              ++A+L  S   +K     F R F ++V S+ +  T +   + +      ++  I++L+W
Sbjct  179   PSMASLEKSIKLMKSADEHFLRTFVMLVLSSFLCPTSSLKVSPRCFPALVNIGSIRELNW  238

Query  665   CGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRAL  486
             C +++  L     S  +  +    G L +L + Y+D ++     +P   P    W ++ +
Sbjct  239   CKFVVEQLEKCVSSLGKKNSAG--GCLFYLVILYLDSLDVRGMEIPDGTPRVSAWDRKLM  296

Query  485   DAREQQEV-DAGEFG  444
             D   + ++ + G FG
Sbjct  297   DKIIEMDMKNNGSFG  311



>ref|XP_008678048.1| PREDICTED: uncharacterized protein LOC103652839 [Zea mays]
Length=479

 Score = 78.6 bits (192),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 115/274 (42%), Gaps = 15/274 (5%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  34    RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  93

Query  995   NGRFLRITEEGVAAVLGLPNGSVT---MTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN       M++ D   +  +L    C K   R   I +  +
Sbjct  94    GGKEIQITEHSVWCVLQLPNVGNDPPPMSDADARALRDELGEQICGKSYRRISGINISVI  153

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ + + +WC  ++ 
Sbjct  154   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNMGNKNWCKAVVD  213

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  214   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLDTSPFSIPRCAFLDSKMID  273

Query  482   AREQQEV------DAGEFGYGQLEEPFSTSASRP  399
             A    ++         EFG+ +L     T  S P
Sbjct  274   AIANMDLRGDVPPGTTEFGHLRLRSITDTCYSVP  307



>ref|XP_002465098.1| hypothetical protein SORBIDRAFT_01g032035 [Sorghum bicolor]
 gb|EER92096.1| hypothetical protein SORBIDRAFT_01g032035 [Sorghum bicolor]
Length=494

 Score = 78.2 bits (191),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 112/264 (42%), Gaps = 34/264 (13%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWL--VSNFNPAQMAI  1005
             +R   S    ++  LST  +  +   G G LL     ++P    HW+  + NFN   + +
Sbjct  103   SRFSVSTFSSVIKSLSTNHQDVIRKYGFGSLLMFDECSVPRNFVHWVARLVNFNSGDIVV  162

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
                NG+ + +T+E V  VL LP G              D  + +  + +R G  +V  ++
Sbjct  163   ---NGKVISLTKEAVHLVLDLPFGGEPFP--------TDYASGKACLLSRFGKDSVPPIS  211

Query  824   TLA---LSLKE-GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               +   +S KE         F VV  ST +    +   +Q+   +F+D+  I+  DWCG+
Sbjct  212   YFSEALISKKELSDDDMFVCFIVVALSTFLCPNSSVVPSQRFFGIFEDLEKIRSYDWCGF  271

Query  656   LLSSLVNTHDSWTQNTARK------FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK  495
             +LS L+     + Q    K        G L FL + Y+D V+ G   VP   P    W K
Sbjct  272   ILSWLLEYIKLFNQLKGCKSTHQATLGGCLYFLAVLYLDHVDFGSHQVPSTIPRISVWKK  331

Query  494   R------ALDAREQQEVDAGEFGY  441
                    +LD +E+     G +GY
Sbjct  332   DMITRYASLDLKEE-----GCYGY  350



>ref|XP_002455711.1| hypothetical protein SORBIDRAFT_03g022135 [Sorghum bicolor]
 gb|EES00831.1| hypothetical protein SORBIDRAFT_03g022135 [Sorghum bicolor]
Length=874

 Score = 79.0 bits (193),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 114/263 (43%), Gaps = 15/263 (6%)
 Frame = -2

Query  1160  ELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFL  981
             +   +L+ LST Q+  +  IG   LLGL+   +P  L HWL+  F+P +  + L NG   
Sbjct  10    KFANVLSNLSTHQKDLIEKIGFSSLLGLQCLEVPNDLYHWLLEYFDPTKSTLILPNGFSY  69

Query  980   RITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKE  801
                ++ V  +LG+P G   +  + T         ++ ++ + +   +V  L TL +    
Sbjct  70    TFNDKCVHKILGIPIGPRRVDGKGT---VESCYFFKNQINSIQHTPSVEELCTL-IKPDL  125

Query  800   GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSW  621
              G  F R F ++  S  +     S  + +      DV+ I + +WC ++L   ++    +
Sbjct  126   HGDEFVRIFMLLALSAFLCPNTRSVCSTRYYAELVDVKSISEFNWCSFVLEWFLSYTSKY  185

Query  620   TQNTARK----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK---RALDAREQQEV  462
              +   RK    + G    L + Y++ +   E N+    P  H W+    +A+   +  E 
Sbjct  186   KKRKLRKPGSPYGGCCHILVIAYLEFLTTSEFNLGLHCPRIHVWSSTIVKAMALLDSCEN  245

Query  461   DAGEFGYGQLEE----PFSTSAS  405
             D   FG  QL+     PF+   S
Sbjct  246   DHKTFGRLQLKHLCCTPFNDCYS  268



>ref|XP_010695530.1| PREDICTED: uncharacterized protein LOC104908144 [Beta vulgaris 
subsp. vulgaris]
Length=303

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 97/212 (46%), Gaps = 11/212 (5%)
 Frame = -2

Query  1040  LVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGS--VTMTERDTHMVGPDLLAWRCK  867
             L  NF P    + + N R +++    VA V G+P G   + +++RD      +   W   
Sbjct  5     LCRNFCPKDKVLMIDNHR-VQLKPADVADVFGIPMGKFKIPISKRDDDTKLKNF--WVEN  61

Query  866   VKNRKGNIT---VHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK  696
               +  G +T   +  L  +          FKR F +    TL+A +LN+ A+ K V    
Sbjct  62    YAHSSGIVTPASMRMLMEMDDDFLSENDDFKRCFVMFAIVTLLAPSLNTQAHFKIVRALI  121

Query  695   DVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
             DV  IK+ DWC Y+L  L      + +++     G +L L + YV R++      P++ P
Sbjct  122   DVGRIKEYDWCSYVLDDLATRMQKY-EDSKTYIGGCVLLLQICYVQRLKFQGLPSPKSLP  180

Query  515   AAHGWTKRALDAREQQEVDAGEFGYGQLEEPF  420
                 WT + L  +E+  ++AG +G G LE  +
Sbjct  181   LIQHWTTKKL--KERITLEAGIYGIGLLENGY  210



>dbj|BAM64827.1| hypothetical protein [Beta vulgaris]
Length=2403

 Score = 78.2 bits (191),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 73/265 (28%), Positives = 115/265 (43%), Gaps = 16/265 (6%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             I+ R RP  L  L+  L+ KQ   V  +G GG+LGL++      +  WLV  FN A +  
Sbjct  1640  IKVRCRPHSLELLIKDLTPKQIDAVKEVGFGGILGLKLTETCKIMMPWLVERFNGASLMF  1699

Query  1004  KLSNGRFLRITEEGVAAVLGLP-NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
              +   +   +T   V  V  LP N    + E     VG ++ +    V  ++ N  VH  
Sbjct  1700  NIGVNKEFVVTRYDVYDVFCLPMNVGNDVPEIAIVRVGENIDSQLKDVWKQQFN--VHGY  1757

Query  827   ATLAL--------SLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL  672
               + L         L +GG  FK+ F +    + +  T N   + K       V  I++ 
Sbjct  1758  DGIPLGKIEARIRELIDGGDEFKKLFVMHALCSFLTPTANRTVDLKLAKALHVVSEIRNY  1817

Query  671   DWCGYLLSSLVNTHDSWTQNTARK--FPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGW  501
             DWC Y+L  L   H S  ++  ++    G +L L + Y  R++  G++  P   P    W
Sbjct  1818  DWCSYVLGQL-GKHVSHFKDHEKQESLCGCMLLLEIIYFHRLKFQGKKENPTI-PLIQHW  1875

Query  500   TKRALDAREQQEVDAGEFGYGQLEE  426
             T   +  R + E  A +FG G L+E
Sbjct  1876  TDEKVRKRVKLEKMANDFGQGLLDE  1900



>emb|CAN77525.1| hypothetical protein VITISV_041421 [Vitis vinifera]
Length=557

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/257 (27%), Positives = 105/257 (41%), Gaps = 20/257 (8%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I +R    +L  LL  LS +++  +  IG GGLL L    +   L  W+V++ N A   
Sbjct  22    KINSRCFSKKLRHLLDELSDEKKSTIQHIGFGGLLQLSSTEIRHSLCRWIVAHLNIAHCR  81

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             + +   R   IT   V  +LG+P              G  LL       NR  N     L
Sbjct  82    LDIGQERQFPITCADVGEILGIP------------YFGRRLLLSPTNRNNRMEN-----L  124

Query  827   ATL--ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
             + L   L L E  V FK+ F     +TL+A T     + +            +++W  ++
Sbjct  125   SNLRDRLILMEDMVEFKKLFIFFSCATLLAPTSKLDGSHELWCTLLAGDFDINVNWGQFV  184

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L +LV     +       F G L+FL LFYV++       VP   P    WT   +    
Sbjct  185   LDTLVAEIRHFRLGKGSWFTGCLIFLQLFYVNKFYIPTMLVPHTIPICAAWTDDLIKKMV  244

Query  473   QQEV-DAGEFGYGQLEE  426
               E+ D G+FG   ++E
Sbjct  245   HAELHDYGDFGLADVQE  261



>emb|CAN64547.1| hypothetical protein VITISV_026046 [Vitis vinifera]
Length=637

 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 91/189 (48%), Gaps = 21/189 (11%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FNP 
Sbjct  116   PKLYLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPN  175

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGL--PNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DLL    +++      
Sbjct  176   TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVGH--KNDLLMLENQIRED----  228

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
                         KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W 
Sbjct  229   ------------KEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWA  276

Query  662   GYLLSSLVN  636
              ++LS LV+
Sbjct  277   EFVLSYLVH  285



>ref|XP_002455322.1| hypothetical protein SORBIDRAFT_03g008395 [Sorghum bicolor]
 gb|EES00442.1| hypothetical protein SORBIDRAFT_03g008395 [Sorghum bicolor]
Length=873

 Score = 77.0 bits (188),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/263 (24%), Positives = 113/263 (43%), Gaps = 15/263 (6%)
 Frame = -2

Query  1160  ELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFL  981
             +   +L+ LST Q+  +  IG   LLGL+   +P  L HWL+  F+P +  + L NG   
Sbjct  10    KFANVLSNLSTHQKDLIEKIGFSSLLGLQCLEVPNDLYHWLLEYFDPTKSTLILPNGFSY  69

Query  980   RITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKE  801
                ++ V  +LG+P G   +  + T         ++ ++ + +   +V  L TL +    
Sbjct  70    TFNDKCVHKILGIPIGPRRVDGKGT---VESCYFFKNQINSIQHTPSVEELCTL-IKPDL  125

Query  800   GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSW  621
              G  F R F ++  S  +        + +      DV+ I + +WC ++L   ++    +
Sbjct  126   HGDEFVRIFMLLALSAFLCPNTRFVCSTRYYAELVDVKSISEFNWCSFVLEWFLSYTSKY  185

Query  620   TQNTARK----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK---RALDAREQQEV  462
              +   RK    + G    L + Y++ +   E N+    P  H W+    +A+   +  E 
Sbjct  186   KKRKLRKPGSPYGGCCHILVIAYLEFLTTSEFNLGLHCPRIHVWSSTIVKAMALLDSCEN  245

Query  461   DAGEFGYGQLEE----PFSTSAS  405
             D   FG  QL+     PF+   S
Sbjct  246   DHKTFGRLQLKHLCCTPFNDCYS  268



>dbj|BAJ98466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 103/247 (42%), Gaps = 16/247 (6%)
 Frame = -2

Query  1235  ELDDTEPVHDIMSP--FPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKA-  1065
             ++ D +P   I +P   P + +R    ++  L+   +  +R  V  IG GG+LG+++ A 
Sbjct  36    DIADADPGEAICAPGSAPSVTSRISVQKVCSLVGKFNKFKRDLVEEIGFGGMLGIKMLAK  95

Query  1064  LPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDL  885
             L L+   WL+        A+K+   R L+I +  V  V  LP G+ ++    T       
Sbjct  96    LNLKFSAWLMERVEVESSALKIDEQRVLQIQDHDVQKVFSLPCGTRSICPDTTEPSEACK  155

Query  884   LAWRCKVKNRKGNITVHALATLAL-------SLKEGGVWFKRHFCVVVASTLVA-STLNS  729
                R      KG  ++ A     L       S K     FK  F + V   L+A ST + 
Sbjct  156   EFIRASAYLSKGAHSLKAAEAYLLRDDINADSSKVRIDCFKIAFVIFVVGHLLAPSTKHD  215

Query  728   YANQKTVHMFKDVRMIKDLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFY  564
             Y          D+  IK+ +WC Y+L  L         D   +N      G  LFL +FY
Sbjct  216   YITIDFWAALNDISQIKEFNWCAYVLEHLNRAVGKLKSDIRNRNITVHLVGCHLFLQVFY  275

Query  563   VDRVEAG  543
             +D ++ G
Sbjct  276   LDNLDVG  282



>ref|XP_006490448.1| PREDICTED: uncharacterized protein LOC102625311 isoform X5 [Citrus 
sinensis]
Length=804

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 117/281 (42%), Gaps = 24/281 (9%)
 Frame = -2

Query  1319  ADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLT  1140
             A  R+P+ +SD     D +A    +  +++               ++TR  P     L+ 
Sbjct  78    AKYRKPLNVSDYDAQTDTDAQLQTKMDKQI---------------LDTRCAPDRFSDLVQ  122

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
               + ++++ +  IG G LL LR   L  +L  WLV  F P Q  + L+N + +++  +  
Sbjct  123   AFNVEKQRAIREIGFGNLLHLRTGRLRRQLCAWLVEQFVPDQHVLVLNN-QHIKLNAKTF  181

Query  959   AAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWF  786
             + ++G+ +G ++++     + G   ++   R   K     I +  L          G  F
Sbjct  182   SDIMGVHDGGLSVS-----LSGQPENIATLRETFKCTGRGIAIKTLEDFIKQSDGSGNDF  236

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
             K  F +   +T++  +  +  +   +H   D   IK+ +W  +  S LV     +  N +
Sbjct  237   KVAFMLFALATILCPSSATLISASFLHPLVDTNAIKEYNWASFCYSRLVMAISKFKSNES  296

Query  605   RKFPGPLLFLTLFYVDRVEAGERNVPRAN-PAAHGWTKRAL  486
                 G LLFL +FY   VE    N   ++ P    WT   +
Sbjct  297   AHLGGCLLFLQIFYFQNVENYYNNQWGSSLPPVLAWTDEEI  337



>gb|EMT33139.1| hypothetical protein F775_04826 [Aegilops tauschii]
Length=724

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 117/265 (44%), Gaps = 18/265 (7%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   +  R  P+ +++L   L+  QR+ +   G GGLL L+   +P RL  WL+  F+  
Sbjct  67    PTQGLRHRASPARIMKLYPHLTAGQREMIEGAGFGGLLRLQCPTVPARLSTWLLRRFDTD  126

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNG----------SVTMTERDTHMVGPDLLAWRCK  867
                + +     + +T + V  VLG+P             +  T RD  + G D  +    
Sbjct  127   SSELVIPGRGRIPVTVDSVHRVLGIPKTGRDVVVHRVLGIPKTGRDV-VYGLDDESI-AS  184

Query  866   VKNRKGNITVHALATLALS---LKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK  696
             V ++ G     ++A+L  S   +K     F R F ++V S+ +  T +   + +      
Sbjct  185   VLDKHGVDGPPSMASLEKSIKLMKSADEHFLRTFVMLVLSSFLCPTSSLKISPRCFPALV  244

Query  695   DVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
             ++  IK+L+WC +++  L     S  +  +    G L +L + Y+D ++     +P   P
Sbjct  245   NIGSIKELNWCKFVVEQLEKCVSSLGKKNSAG--GCLFYLVILYLDSLDVRGMEIPDGTP  302

Query  515   AAHGWTKRALDAREQQEV-DAGEFG  444
                 W ++ +D   + ++ + G FG
Sbjct  303   RVSAWDRKLMDKVIEMDMKNNGSFG  327



>ref|XP_006490446.1| PREDICTED: uncharacterized protein LOC102625311 isoform X3 [Citrus 
sinensis]
Length=850

 Score = 75.9 bits (185),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 117/281 (42%), Gaps = 24/281 (9%)
 Frame = -2

Query  1319  ADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLT  1140
             A  R+P+ +SD     D +A    +  +++               ++TR  P     L+ 
Sbjct  78    AKYRKPLNVSDYDAQTDTDAQLQTKMDKQI---------------LDTRCAPDRFSDLVQ  122

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
               + ++++ +  IG G LL LR   L  +L  WLV  F P Q  + L+N + +++  +  
Sbjct  123   AFNVEKQRAIREIGFGNLLHLRTGRLRRQLCAWLVEQFVPDQHVLVLNN-QHIKLNAKTF  181

Query  959   AAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWF  786
             + ++G+ +G ++++     + G   ++   R   K     I +  L          G  F
Sbjct  182   SDIMGVHDGGLSVS-----LSGQPENIATLRETFKCTGRGIAIKTLEDFIKQSDGSGNDF  236

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
             K  F +   +T++  +  +  +   +H   D   IK+ +W  +  S LV     +  N +
Sbjct  237   KVAFMLFALATILCPSSATLISASFLHPLVDTNAIKEYNWASFCYSRLVMAISKFKSNES  296

Query  605   RKFPGPLLFLTLFYVDRVEAGERNVPRAN-PAAHGWTKRAL  486
                 G LLFL +FY   VE    N   ++ P    WT   +
Sbjct  297   AHLGGCLLFLQIFYFQNVENYYNNQWGSSLPPVLAWTDEEI  337



>ref|XP_006490447.1| PREDICTED: uncharacterized protein LOC102625311 isoform X4 [Citrus 
sinensis]
Length=822

 Score = 75.5 bits (184),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 117/281 (42%), Gaps = 24/281 (9%)
 Frame = -2

Query  1319  ADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLT  1140
             A  R+P+ +SD     D +A    +  +++               ++TR  P     L+ 
Sbjct  78    AKYRKPLNVSDYDAQTDTDAQLQTKMDKQI---------------LDTRCAPDRFSDLVQ  122

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
               + ++++ +  IG G LL LR   L  +L  WLV  F P Q  + L+N + +++  +  
Sbjct  123   AFNVEKQRAIREIGFGNLLHLRTGRLRRQLCAWLVEQFVPDQHVLVLNN-QHIKLNAKTF  181

Query  959   AAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWF  786
             + ++G+ +G ++++     + G   ++   R   K     I +  L          G  F
Sbjct  182   SDIMGVHDGGLSVS-----LSGQPENIATLRETFKCTGRGIAIKTLEDFIKQSDGSGNDF  236

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
             K  F +   +T++  +  +  +   +H   D   IK+ +W  +  S LV     +  N +
Sbjct  237   KVAFMLFALATILCPSSATLISASFLHPLVDTNAIKEYNWASFCYSRLVMAISKFKSNES  296

Query  605   RKFPGPLLFLTLFYVDRVEAGERNVPRAN-PAAHGWTKRAL  486
                 G LLFL +FY   VE    N   ++ P    WT   +
Sbjct  297   AHLGGCLLFLQIFYFQNVENYYNNQWGSSLPPVLAWTDEEI  337



>ref|XP_006475686.1| PREDICTED: uncharacterized protein LOC102608522 isoform X5 [Citrus 
sinensis]
Length=642

 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 95/213 (45%), Gaps = 4/213 (2%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  L++ L+ KQRK V  IG+G ++ L+   L  +L  WLV   + A+  ++L
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              NG  L ++      ++G+ +G + M   +      ++ A+  K       I +  +  +
Sbjct  161   -NGHELELSPNSFGYIMGVTDGGMPM---ELQGDSAEVAAYLDKFNATSRGINIKTMEDI  216

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+ K+    FK  F +    TL+      + +   +   KDV  I++ +W  +    L+
Sbjct  217   LLTSKDADNDFKVAFMLFTLCTLLCPPGGVHISYSFLFTLKDVHSIRNRNWATFCFERLM  276

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE  540
                  +         G LL+L + Y++ V  G+
Sbjct  277   RGITRYKDEKLAHVGGCLLYLEILYINSVVYGK  309



>ref|XP_006490449.1| PREDICTED: uncharacterized protein LOC102625311 isoform X6 [Citrus 
sinensis]
Length=698

 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 117/281 (42%), Gaps = 24/281 (9%)
 Frame = -2

Query  1319  ADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLT  1140
             A  R+P+ +SD     D +A    +  +++               ++TR  P     L+ 
Sbjct  78    AKYRKPLNVSDYDAQTDTDAQLQTKMDKQI---------------LDTRCAPDRFSDLVQ  122

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
               + ++++ +  IG G LL LR   L  +L  WLV  F P Q  + L+N + +++  +  
Sbjct  123   AFNVEKQRAIREIGFGNLLHLRTGRLRRQLCAWLVEQFVPDQHVLVLNN-QHIKLNAKTF  181

Query  959   AAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWF  786
             + ++G+ +G ++++     + G   ++   R   K     I +  L          G  F
Sbjct  182   SDIMGVHDGGLSVS-----LSGQPENIATLRETFKCTGRGIAIKTLEDFIKQSDGSGNDF  236

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
             K  F +   +T++  +  +  +   +H   D   IK+ +W  +  S LV     +  N +
Sbjct  237   KVAFMLFALATILCPSSATLISASFLHPLVDTNAIKEYNWASFCYSRLVMAISKFKSNES  296

Query  605   RKFPGPLLFLTLFYVDRVEAGERNVPRAN-PAAHGWTKRAL  486
                 G LLFL +FY   VE    N   ++ P    WT   +
Sbjct  297   AHLGGCLLFLQIFYFQNVENYYNNQWGSSLPPVLAWTDEEI  337



>ref|XP_006475682.1| PREDICTED: uncharacterized protein LOC102608522 isoform X1 [Citrus 
sinensis]
 ref|XP_006475683.1| PREDICTED: uncharacterized protein LOC102608522 isoform X2 [Citrus 
sinensis]
 ref|XP_006475684.1| PREDICTED: uncharacterized protein LOC102608522 isoform X3 [Citrus 
sinensis]
Length=649

 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 95/213 (45%), Gaps = 4/213 (2%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  L++ L+ KQRK V  IG+G ++ L+   L  +L  WLV   + A+  ++L
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              NG  L ++      ++G+ +G + M   +      ++ A+  K       I +  +  +
Sbjct  161   -NGHELELSPNSFGYIMGVTDGGMPM---ELQGDSAEVAAYLDKFNATSRGINIKTMEDI  216

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+ K+    FK  F +    TL+      + +   +   KDV  I++ +W  +    L+
Sbjct  217   LLTSKDADNDFKVAFMLFTLCTLLCPPGGVHISYSFLFTLKDVHSIRNRNWATFCFERLM  276

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE  540
                  +         G LL+L + Y++ V  G+
Sbjct  277   RGITRYKDEKLAHVGGCLLYLEILYINSVVYGK  309



>ref|XP_006475685.1| PREDICTED: uncharacterized protein LOC102608522 isoform X4 [Citrus 
sinensis]
Length=647

 Score = 75.1 bits (183),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/213 (24%), Positives = 95/213 (45%), Gaps = 4/213 (2%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  L++ L+ KQRK V  IG+G ++ L+   L  +L  WLV   + A+  ++L
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              NG  L ++      ++G+ +G + M   +      ++ A+  K       I +  +  +
Sbjct  161   -NGHELELSPNSFGYIMGVTDGGMPM---ELQGDSAEVAAYLDKFNATSRGINIKTMEDI  216

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+ K+    FK  F +    TL+      + +   +   KDV  I++ +W  +    L+
Sbjct  217   LLTSKDADNDFKVAFMLFTLCTLLCPPGGVHISYSFLFTLKDVHSIRNRNWATFCFERLM  276

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGE  540
                  +         G LL+L + Y++ V  G+
Sbjct  277   RGITRYKDEKLAHVGGCLLYLEILYINSVVYGK  309



>ref|XP_006490444.1| PREDICTED: uncharacterized protein LOC102625311 isoform X1 [Citrus 
sinensis]
 ref|XP_006490445.1| PREDICTED: uncharacterized protein LOC102625311 isoform X2 [Citrus 
sinensis]
Length=883

 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 117/281 (42%), Gaps = 24/281 (9%)
 Frame = -2

Query  1319  ADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLT  1140
             A  R+P+ +SD     D +A    +  +++               ++TR  P     L+ 
Sbjct  78    AKYRKPLNVSDYDAQTDTDAQLQTKMDKQI---------------LDTRCAPDRFSDLVQ  122

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
               + ++++ +  IG G LL LR   L  +L  WLV  F P Q  + L+N + +++  +  
Sbjct  123   AFNVEKQRAIREIGFGNLLHLRTGRLRRQLCAWLVEQFVPDQHVLVLNN-QHIKLNAKTF  181

Query  959   AAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWF  786
             + ++G+ +G ++++     + G   ++   R   K     I +  L          G  F
Sbjct  182   SDIMGVHDGGLSVS-----LSGQPENIATLRETFKCTGRGIAIKTLEDFIKQSDGSGNDF  236

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
             K  F +   +T++  +  +  +   +H   D   IK+ +W  +  S LV     +  N +
Sbjct  237   KVAFMLFALATILCPSSATLISASFLHPLVDTNAIKEYNWASFCYSRLVMAISKFKSNES  296

Query  605   RKFPGPLLFLTLFYVDRVEAGERNVPRAN-PAAHGWTKRAL  486
                 G LLFL +FY   VE    N   ++ P    WT   +
Sbjct  297   AHLGGCLLFLQIFYFQNVENYYNNQWGSSLPPVLAWTDEEI  337



>gb|EMS50409.1| hypothetical protein TRIUR3_25471 [Triticum urartu]
Length=726

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 86/344 (25%), Positives = 135/344 (39%), Gaps = 31/344 (9%)
 Frame = -2

Query  1298  ILSDDGTDVDDEAPTP--PRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLTGLSTK  1125
             ++S  G   DDE      P       DT+P    +   P   +R    ++V ++   S  
Sbjct  104   VMSRSGNCDDDELEVEQIPMPQGRTSDTDPN---LEQAPNYTSRMSVKQVVAVIKDFSEY  160

Query  1124  QRKDVISIGMGGLLGLRV-KALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVL  948
             ++  V  IG GG+L L   +   LRL  WL+SN    + AI ++  + L+   E V  V 
Sbjct  161   KKWLVTEIGFGGMLDLPTHQKFNLRLSAWLMSNVGVHRCAIHITEKKVLKFWAEDVGKVF  220

Query  947   GLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLK-----EGGVWFK  783
             G+P GS  +  RD   V P+ + +  K   R   +  H+L      LK     + G   K
Sbjct  221   GIPCGSRDVKGRDAD-VNPNSVDF-IKRTLRMDQVGAHSLRAAEEFLKRDITEDSGKLEK  278

Query  782   RHF-----CVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWT  618
               F      V++   LV ST ++YA         +   I+  +WC Y+LS L ++     
Sbjct  279   DCFQIAFVIVMMGHILVPSTKHNYATIDFWGALANPENIQQFNWCEYVLSCLTDSVTKLQ  338

Query  617   QNTAR-----KFPGPLLFLTLFYVDRVEAG-----ERNVPRANPAAHGWTKRALDAREQQ  468
             ++           G  LFL +F++D +E G         PR +       +R +      
Sbjct  339   KDLVMNVQTINLTGCHLFLQVFFLDNLELGIFTTKHDIFPRISAFDRATLRRMITMATDI  398

Query  467   EVDAGEFGYGQLEEPFSTSASRPRCRSSVEQTR---YGRADSRP  345
                   +    L +P     +R    SSV   R   YG   S P
Sbjct  399   GKSPSTYTSAMLRDPHGLCYTRSNFMSSVGNLRDVPYGPNWSTP  442



>ref|XP_008664244.1| PREDICTED: uncharacterized protein LOC103642847 [Zea mays]
Length=377

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/274 (22%), Positives = 112/274 (41%), Gaps = 15/274 (5%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  L  + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  55    RCSPGKFIKLVNSLFDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMQKLNPETMKLEIG  114

Query  995   NGRFLRITEEGVAAVLGLPNGSVT---MTERDTHMVGPDLLAWRCKVKNRK-GNITVHAL  828
              G+ ++ITE  V  VL LPN       M++ D   +  +L    C    R    I +  +
Sbjct  115   GGKEIQITEHSVWCVLQLPNVGSDPPPMSDADARALRDELGEQICGKSYRHISGINISVI  174

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+    ++      V   +D++ + + +WC  ++ 
Sbjct  175   TDRLQKRTLNGELGLRAFFMAAFQCLLFFNTDTRIRIDDVKYTQDIQNMGNKNWCKAVVD  234

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  235   RLSIAARIYRKDFAEKGINTPISGCGIFIAMLYVDNLQHGLYTSPFSIPRCAFLDSKMID  294

Query  482   AREQQEVDAG------EFGYGQLEEPFSTSASRP  399
             A   +++         EFG+ +L     T    P
Sbjct  295   AIANKDLRGDVPPGTTEFGHLRLRSITDTCYGVP  328



>ref|XP_010231407.1| PREDICTED: uncharacterized protein LOC100825094 isoform X2 [Brachypodium 
distachyon]
Length=407

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 101/249 (41%), Gaps = 16/249 (6%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             L+ +Q+K V S+    +L +    LP  +  W+   FN      +L NG  + +T   + 
Sbjct  27    LTLEQQKLVRSMDFENVLDIACDTLPRGVALWMAGYFNVHTRTFELPNGLKIHVTPFCMH  86

Query  956   AVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRH  777
              +LG+P G      R        +     +  N KGN    A     ++   GG  FKR 
Sbjct  87    QILGIPLGG-----RKVEKCTAQMRTLIAEQTNCKGNFPTIAELEKMITPGLGGDLFKRV  141

Query  776   FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKF  597
             F + V +T +  + +  A+ +  H  +D   I   DWC   L  LV + ++W +      
Sbjct  142   FLMFVLATFICPSSHGAASPEYYHALEDPDNIASFDWCTAALDKLVLSIENWQKAGTSVL  201

Query  596   PGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGEFG---YGQL--  432
              G LL + + Y + ++          P    WT + +   E + +D   F    YG+L  
Sbjct  202   GGNLLSIVILYFEFIDINIMKATTTLPRLSLWTTQMIS--EYERMDCMSFPLQIYGKLPV  259

Query  431   ----EEPFS  417
                 + PFS
Sbjct  260   KDVSQTPFS  268



>emb|CAN80690.1| hypothetical protein VITISV_032424 [Vitis vinifera]
Length=512

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 97/235 (41%), Gaps = 44/235 (19%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQR  +  IG G LL LR +                 
Sbjct  70    PKLYLQTRCSPERVIRVIEELEPKQRAAIEEIGFGSLLQLRCR-----------------  112

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
                 K+ +G              GL  G   M +  +H    DL    C   ++KG + +
Sbjct  113   ----KIDHG------------ARGLKIG---MNKDVSH--NNDLCKKYC---DKKGQLPL  148

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L       KEGG  FK  F + V   L+  T+  +  +  +H+ +D+  IK ++W  +
Sbjct  149   VMLENQIREDKEGGNDFKXXFVLFVLGALLCPTMKLFVKRSFLHLVEDIDSIKKMNWAEF  208

Query  656   LLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVP---RANPAAHGW  501
             +LS LV+  + +         G LLFL LFY + +   E+ +P   R  P    W
Sbjct  209   VLSYLVHGIEEFKMKQQSGVCGCLLFLMLFYHEHISFEEKFLPLYTRPCPCITAW  263



>ref|XP_010231408.1| PREDICTED: uncharacterized protein LOC100825094 isoform X3 [Brachypodium 
distachyon]
Length=373

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 101/249 (41%), Gaps = 16/249 (6%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             L+ +Q+K V S+    +L +    LP  +  W+   FN      +L NG  + +T   + 
Sbjct  27    LTLEQQKLVRSMDFENVLDIACDTLPRGVALWMAGYFNVHTRTFELPNGLKIHVTPFCMH  86

Query  956   AVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRH  777
              +LG+P G      R        +     +  N KGN    A     ++   GG  FKR 
Sbjct  87    QILGIPLGG-----RKVEKCTAQMRTLIAEQTNCKGNFPTIAELEKMITPGLGGDLFKRV  141

Query  776   FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKF  597
             F + V +T +  + +  A+ +  H  +D   I   DWC   L  LV + ++W +      
Sbjct  142   FLMFVLATFICPSSHGAASPEYYHALEDPDNIASFDWCTAALDKLVLSIENWQKAGTSVL  201

Query  596   PGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGEFG---YGQL--  432
              G LL + + Y + ++          P    WT + +   E + +D   F    YG+L  
Sbjct  202   GGNLLSIVILYFEFIDINIMKATTTLPRLSLWTTQMIS--EYERMDCMSFPLQIYGKLPV  259

Query  431   ----EEPFS  417
                 + PFS
Sbjct  260   KDVSQTPFS  268



>gb|EMS63117.1| hypothetical protein TRIUR3_21596 [Triticum urartu]
Length=356

 Score = 73.2 bits (178),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/247 (26%), Positives = 102/247 (41%), Gaps = 16/247 (6%)
 Frame = -2

Query  1235  ELDDTEPVHDIMSP--FPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKA-  1065
             ++ D +P   I +P   P + +R    ++  L+   +  +R  V  IG GG+LG+++ A 
Sbjct  36    DIADADPGEAICAPGSAPSVTSRISVQKVCSLVGKFNKFKRDLVEEIGFGGMLGIKMLAK  95

Query  1064  LPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDL  885
             L L+   WL+         +K+   R L+I +  V  V  LP G+ ++    T       
Sbjct  96    LNLKFSAWLMERVEVESSTLKIDEQRVLQIQDHDVQKVFSLPCGTRSICPDTTEPSAACK  155

Query  884   LAWRCKVKNRKGNITVHALATLAL-------SLKEGGVWFKRHFCVVVASTLVA-STLNS  729
                R      KG  ++ A     L       S K     FK  F + V   L+A ST + 
Sbjct  156   EFMRASAYLSKGAHSLKAAEAYLLRDDINADSSKVQIDCFKIAFVIFVVGHLLAPSTKHD  215

Query  728   YANQKTVHMFKDVRMIKDLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFY  564
             Y          D+  IK+ +WC Y+L  L         D   +N      G  LFL +FY
Sbjct  216   YITIDFWAALNDISQIKEFNWCAYVLEHLNRAVGKLKTDIRNRNITVHLVGCHLFLQVFY  275

Query  563   VDRVEAG  543
             +D ++ G
Sbjct  276   LDNLDLG  282



>ref|XP_010231404.1| PREDICTED: uncharacterized protein LOC100825094 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010231405.1| PREDICTED: uncharacterized protein LOC100825094 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010231406.1| PREDICTED: uncharacterized protein LOC100825094 isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 101/249 (41%), Gaps = 16/249 (6%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             L+ +Q+K V S+    +L +    LP  +  W+   FN      +L NG  + +T   + 
Sbjct  27    LTLEQQKLVRSMDFENVLDIACDTLPRGVALWMAGYFNVHTRTFELPNGLKIHVTPFCMH  86

Query  956   AVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRH  777
              +LG+P G      R        +     +  N KGN    A     ++   GG  FKR 
Sbjct  87    QILGIPLGG-----RKVEKCTAQMRTLIAEQTNCKGNFPTIAELEKMITPGLGGDLFKRV  141

Query  776   FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKF  597
             F + V +T +  + +  A+ +  H  +D   I   DWC   L  LV + ++W +      
Sbjct  142   FLMFVLATFICPSSHGAASPEYYHALEDPDNIASFDWCTAALDKLVLSIENWQKAGTSVL  201

Query  596   PGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGEFG---YGQL--  432
              G LL + + Y + ++          P    WT + +   E + +D   F    YG+L  
Sbjct  202   GGNLLSIVILYFEFIDINIMKATTTLPRLSLWTTQMIS--EYERMDCMSFPLQIYGKLPV  259

Query  431   ----EEPFS  417
                 + PFS
Sbjct  260   KDVSQTPFS  268



>ref|XP_006489863.1| PREDICTED: uncharacterized protein LOC102626655 isoform X5 [Citrus 
sinensis]
Length=679

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 8/233 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ETR  P    +L+  LS  ++K V+ +G   LL ++   L   L  WLV NF+P    I
Sbjct  24    METRCAPDRFAKLVAKLSENKKKAVVELGFESLLHIKCGRLKRDLCSWLVQNFDPFTSCI  83

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              L +G+ + ++      ++G+ +G V +           L    C   +  G I +  L 
Sbjct  84    FL-HGKSINLSPRDFEYIMGIKDGGVDIDVDLDIDDIDKLKNEYC---DDSGYIKLKTLE  139

Query  824   TLALSLKEGGVWFKRHFCVVVASTLV--ASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             +  ++ +E    FKR F +   +T++   S LN  A    V + KD   I   +W  +  
Sbjct  140   SKLVNQREVNDDFKRSFVLFAIATIIFPKSGLN-LAPYYLVFL-KDTSAINKKNWATWAF  197

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR  492
               LV     +     +   G +LFL LFY+D +    + + ++      WT R
Sbjct  198   KGLVEGIQKFKAGQHKVVNGCVLFLELFYMDSISFARKFIDKSLSPITTWTNR  250



>dbj|BAD20055.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD28889.1| hypothetical protein [Oryza sativa Japonica Group]
Length=834

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 112/260 (43%), Gaps = 15/260 (6%)
 Frame = -2

Query  1208  DIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSN  1029
             D+     Q  +R  P +L++L   +S +Q++ +   G  GL+ L+   L   L  WL+ +
Sbjct  39    DLGFHLKQESSRASPMKLIKLYPHMSGEQKRLIEGAGFHGLVDLKCSKLRPDLCSWLMEH  98

Query  1028  FNPAQMAIKLSNGRFLRITEEGVAAVLGLPNG----SVTMTERDTHMVGPDLLAWRCKVK  861
             FNPA   +       + + EE V +VLG+P G    S  M    T  V  +LL       
Sbjct  99    FNPATNQLVFPGRGAIDVNEESVKSVLGIPMGDKDVSYEMESEATEFV-LNLLGI-----  152

Query  860   NRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMI  681
             N   + ++ +L      LK     + R + +   S+++A T  +  + +      D   +
Sbjct  153   NDGISPSLTSLGIQLEKLKLADDKYLRMWIIYAISSVLAPTTATTVSPRCYPSVVDAGNV  212

Query  680   KDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGW  501
             K+L+WC +++S L     +     +      LL++ + Y+D +     NVP     A  W
Sbjct  213   KNLNWCKFIISILQKAAKAGKNTNS----ACLLYMMILYLDSLSFKNLNVPVEGYRATVW  268

Query  500   TKRALDAREQQEVDA-GEFG  444
             T   ++     +  A G FG
Sbjct  269   TNEMINQAILADTSADGSFG  288



>ref|XP_006489859.1| PREDICTED: uncharacterized protein LOC102626655 isoform X1 [Citrus 
sinensis]
 ref|XP_006489860.1| PREDICTED: uncharacterized protein LOC102626655 isoform X2 [Citrus 
sinensis]
Length=786

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 8/233 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ETR  P    +L+  LS  ++K V+ +G   LL ++   L   L  WLV NF+P    I
Sbjct  24    METRCAPDRFAKLVAKLSENKKKAVVELGFESLLHIKCGRLKRDLCSWLVQNFDPFTSCI  83

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              L +G+ + ++      ++G+ +G V +           L    C   +  G I +  L 
Sbjct  84    FL-HGKSINLSPRDFEYIMGIKDGGVDIDVDLDIDDIDKLKNEYC---DDSGYIKLKTLE  139

Query  824   TLALSLKEGGVWFKRHFCVVVASTLV--ASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             +  ++ +E    FKR F +   +T++   S LN  A    V + KD   I   +W  +  
Sbjct  140   SKLVNQREVNDDFKRSFVLFAIATIIFPKSGLN-LAPYYLVFL-KDTSAINKKNWATWAF  197

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR  492
               LV     +     +   G +LFL LFY+D +    + + ++      WT R
Sbjct  198   KGLVEGIQKFKAGQHKVVNGCVLFLELFYMDSISFARKFIDKSLSPITTWTNR  250



>ref|XP_006489861.1| PREDICTED: uncharacterized protein LOC102626655 isoform X3 [Citrus 
sinensis]
Length=738

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 8/233 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ETR  P    +L+  LS  ++K V+ +G   LL ++   L   L  WLV NF+P    I
Sbjct  24    METRCAPDRFAKLVAKLSENKKKAVVELGFESLLHIKCGRLKRDLCSWLVQNFDPFTSCI  83

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              L +G+ + ++      ++G+ +G V +           L    C   +  G I +  L 
Sbjct  84    FL-HGKSINLSPRDFEYIMGIKDGGVDIDVDLDIDDIDKLKNEYC---DDSGYIKLKTLE  139

Query  824   TLALSLKEGGVWFKRHFCVVVASTLV--ASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             +  ++ +E    FKR F +   +T++   S LN  A    V + KD   I   +W  +  
Sbjct  140   SKLVNQREVNDDFKRSFVLFAIATIIFPKSGLN-LAPYYLVFL-KDTSAINKKNWATWAF  197

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR  492
               LV     +     +   G +LFL LFY+D +    + + ++      WT R
Sbjct  198   KGLVEGIQKFKAGQHKVVNGCVLFLELFYMDSISFARKFIDKSLSPITTWTNR  250



>ref|XP_006489864.1| PREDICTED: uncharacterized protein LOC102626655 isoform X6 [Citrus 
sinensis]
Length=656

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 8/233 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ETR  P    +L+  LS  ++K V+ +G   LL ++   L   L  WLV NF+P    I
Sbjct  24    METRCAPDRFAKLVAKLSENKKKAVVELGFESLLHIKCGRLKRDLCSWLVQNFDPFTSCI  83

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              L +G+ + ++      ++G+ +G V +           L    C   +  G I +  L 
Sbjct  84    FL-HGKSINLSPRDFEYIMGIKDGGVDIDVDLDIDDIDKLKNEYC---DDSGYIKLKTLE  139

Query  824   TLALSLKEGGVWFKRHFCVVVASTLV--ASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             +  ++ +E    FKR F +   +T++   S LN  A    V + KD   I   +W  +  
Sbjct  140   SKLVNQREVNDDFKRSFVLFAIATIIFPKSGLN-LAPYYLVFL-KDTSAINKKNWATWAF  197

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR  492
               LV     +     +   G +LFL LFY+D +    + + ++      WT R
Sbjct  198   KGLVEGIQKFKAGQHKVVNGCVLFLELFYMDSISFARKFIDKSLSPITTWTNR  250



>ref|XP_010646966.1| PREDICTED: uncharacterized protein LOC104878391 [Vitis vinifera]
Length=998

 Score = 73.9 bits (180),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/262 (23%), Positives = 108/262 (41%), Gaps = 19/262 (7%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L+ ++++ +  +G GGLL    + L   L  WL+S ++     + 
Sbjct  323   KSRCSGKKFITVIARLAPEKQQAIREMGFGGLLTFACRELRYELCGWLISQYDFTYHRLN  382

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALAT  822
             +  G  + + EE V  V+G+PN  V +           ++  R    NR      + L  
Sbjct  383   METGNAITVNEEHVNKVMGIPNSGVDV-----------VILKRTTPSNR-----TYTLRV  426

Query  821   LALSLKEGGVW--FKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             L  +L+   V   F + F +   +TL+A       +        D  +    +W  +LL 
Sbjct  427   LEQNLENLPVCDEFLKSFLIFSCATLLAPNSKLEGSHDLWDTIWDGDVGVQRNWAKFLLK  486

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQ  468
              L +    + Q       G L+FL LFY+        NV   +P A  WT   +  R   
Sbjct  487   HLEDGIKEYRQKQPTYIRGCLMFLQLFYMAYFYMPSVNVEVTSPLAAAWTDDVMKRRLAA  546

Query  467   EVDA-GEFGYGQLEEPFSTSAS  405
             E+   G +GY   +E   ++A+
Sbjct  547   EISTFGGYGYVHAQERAQSTAN  568



>ref|XP_010651563.1| PREDICTED: uncharacterized protein LOC104879661 [Vitis vinifera]
 ref|XP_010651564.1| PREDICTED: uncharacterized protein LOC104879661 [Vitis vinifera]
 ref|XP_010651565.1| PREDICTED: uncharacterized protein LOC104879661 [Vitis vinifera]
 ref|XP_010651566.1| PREDICTED: uncharacterized protein LOC104879661 [Vitis vinifera]
Length=369

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 81/335 (24%), Positives = 131/335 (39%), Gaps = 36/335 (11%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR   S  ++L   L  ++   V  +  GGLL L  K +   +  WL+++FN     
Sbjct  8     RLYTRCSSSRFLKLCNRLPPEKLDVVRDLQFGGLLHLNCKEIRHNICTWLIAHFNVGYKR  67

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I++++ R   +T   V  V GLP  S  +    T    P             G +     
Sbjct  68    IEITSHRRYDLTAADVGLVFGLPTTSRILHIATTPSDHP------------FGTLNTCEE  115

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
               L L + E    F+R F     + L+A T      +   H   +     D++W  +++ 
Sbjct  116   RLLNLPIGEE---FRRCFIYYACAMLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVD  172

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQ  468
              LV     + Q  +    G ++FL L YV + +    +VP   P    W+   +  R   
Sbjct  173   QLVEGIRRFKQGNSVWVHGCIIFLQLHYVMKFKIPSVHVPMTAPLLSAWSDELIKERLSA  232

Query  467   EV-DAGEFGYGQLEEPFSTSA---------SRPRCRSSVEQTRYG---RADSRPQPV-HQ  330
             E+ + G FG+G   E F  S+         S P   + +    Y    + +S  + + HQ
Sbjct  233   EISEFGSFGHG---EAFDESSPPRTHVEDDSGPTSSNEILDKYYAAERQINSYQKGIQHQ  289

Query  329   -GHTPGVSMVSAASRAPTVPSPQGDTTGSRGAAGD  228
              G   G+     A R   VPSP   T G  G A D
Sbjct  290   LGIMRGLIQRLDARRKRNVPSP---TAGHSGYAAD  321



>ref|XP_006489862.1| PREDICTED: uncharacterized protein LOC102626655 isoform X4 [Citrus 
sinensis]
Length=702

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 101/233 (43%), Gaps = 8/233 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ETR  P    +L+  LS  ++K V+ +G   LL ++   L   L  WLV NF+P    I
Sbjct  24    METRCAPDRFAKLVAKLSENKKKAVVELGFESLLHIKCGRLKRDLCSWLVQNFDPFTSCI  83

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              L +G+ + ++      ++G+ +G V +           L    C   +  G I +  L 
Sbjct  84    FL-HGKSINLSPRDFEYIMGIKDGGVDIDVDLDIDDIDKLKNEYC---DDSGYIKLKTLE  139

Query  824   TLALSLKEGGVWFKRHFCVVVASTLV--ASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             +  ++ +E    FKR F +   +T++   S LN  A    V + KD   I   +W  +  
Sbjct  140   SKLVNQREVNDDFKRSFVLFAIATIIFPKSGLN-LAPYYLVFL-KDTSAINKKNWATWAF  197

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR  492
               LV     +     +   G +LFL LFY+D +    + + ++      WT R
Sbjct  198   KGLVEGIQKFKAGQHKVVNGCVLFLELFYMDSISFARKFIDKSLSPITTWTNR  250



>gb|AFW74449.1| hypothetical protein ZEAMMB73_867294 [Zea mays]
Length=803

 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/241 (24%), Positives = 103/241 (43%), Gaps = 9/241 (4%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + +  V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  109   RCSPGKFIKLVNSLSDELKSQVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  168

Query  995   NGRFLRITEEGVAAVLGLPNGSVT---MTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN       M++ D   +  +L    C K   R   I +  +
Sbjct  169   GGKEIQITEHSVWCVLQLPNVGSDPPPMSDADARSLRDELGEQICGKSYRRISGINISVI  228

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ + + +WC  ++ 
Sbjct  229   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNMGNKNWCKAVVD  288

Query  647   SLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              L      + ++ A K       G  +F+ + YVD ++ G    P + P       + +D
Sbjct  289   RLSIAARLYRKDFAEKGINAPISGCGIFVAMLYVDNLQHGLDTSPFSIPRCAFLDSKMID  348

Query  482   A  480
             A
Sbjct  349   A  349



>gb|EMT25344.1| hypothetical protein F775_10136 [Aegilops tauschii]
Length=365

 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 103/247 (42%), Gaps = 16/247 (6%)
 Frame = -2

Query  1235  ELDDTEPVHDIMSP--FPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKA-  1065
             ++ D +P   I +P   P + +R    ++  L+   +  +R  V  IG GG+LG+++ A 
Sbjct  44    DIADADPGEAIGAPGSAPSVTSRISVQKVCSLVGKFNKFKRDLVEEIGFGGMLGIQMLAK  103

Query  1064  LPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDL  885
             L L+   WL+   +     +K+   R L+I +  V  V  LP G+ ++    T       
Sbjct  104   LNLKFSAWLMERVDVESSTLKIDEQRVLQIQDHDVQKVFSLPCGTRSICPDTTEPSEACK  163

Query  884   LAWRCKVKNRKGNITVHALATLAL-------SLKEGGVWFKRHFCVVVASTLVA-STLNS  729
                R      KG  ++ A     L       S K     FK  F + V   L+A ST + 
Sbjct  164   EFMRASAYLSKGAHSLKAAEAYLLRDDINADSSKVQIDCFKIAFVIFVVGHLLAPSTKHD  223

Query  728   YANQKTVHMFKDVRMIKDLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFY  564
             Y          D+  +K+ +WC Y+L  L         D   +N      G  LFL +FY
Sbjct  224   YITIDFWAALNDISQVKEFNWCAYVLEHLNRAVGKLKTDIRNRNITVHLVGCHLFLQVFY  283

Query  563   VDRVEAG  543
             +D ++ G
Sbjct  284   LDNLDLG  290



>ref|XP_002444868.1| hypothetical protein SORBIDRAFT_07g000630 [Sorghum bicolor]
 gb|EES14363.1| hypothetical protein SORBIDRAFT_07g000630 [Sorghum bicolor]
Length=369

 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 63/265 (24%), Positives = 117/265 (44%), Gaps = 15/265 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +  + +++ LS +++  + S G G LL      +P  L  W V+N   ++    +
Sbjct  104   TRFSATAFMNVISSLSPEKKDVIASYGFGSLLLFDKCFVPNSLAKW-VANLVDSKSGDIV  162

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              +G+ + +TEE V  VL LP G+       +  VG D +  +   K++   ++  A   +
Sbjct  163   HDGKVISLTEESVHLVLDLPIGTRPFPSDPS--VGKDFILSKFG-KSKIPPVSFFADKLI  219

Query  818   AL-SLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSL  642
                 L +  V+    F +V  S+ +    N+  + K   +F+DV  IKD  WC Y+L  L
Sbjct  220   KKDDLSDEDVFI--CFMIVALSSFLCPNTNTIPSPKYFGIFEDVDHIKDFKWCAYVLQWL  277

Query  641   VNTHDSWTQNTARK------FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDA  480
             +    ++      K        G L +L + Y+D ++ G+R +  + P    W    +  
Sbjct  278   LEHVKAFNGGKDAKAKRCLGLGGCLYYLAVVYLDHIDFGQRQLVDSIPRICVWKGDLIKF  337

Query  479   REQQEVDA-GEFGYGQLEEPFSTSA  408
                 ++ + G +GY  L  PF  + 
Sbjct  338   YANLDIKSPGVYGYRPL-LPFDNTC  361



>emb|CAN76862.1| hypothetical protein VITISV_001668 [Vitis vinifera]
Length=326

 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 86/179 (48%), Gaps = 8/179 (4%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR     ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FN  
Sbjct  150   PKLYLQTRCSXERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNXN  209

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGL--PNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DL    C   ++KG +
Sbjct  210   TYMLQLYNT-CIKLSPIDVEFIMGLRARGXKIGMNKDVGH--KNDLCKKYC---DKKGRL  263

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDW  666
              +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W
Sbjct  264   PLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKINW  322



>ref|XP_010659348.1| PREDICTED: uncharacterized protein LOC104881311 [Vitis vinifera]
 ref|XP_010659349.1| PREDICTED: uncharacterized protein LOC104881311 [Vitis vinifera]
Length=247

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 83/171 (49%), Gaps = 8/171 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FNP 
Sbjct  82    PKLYLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPN  141

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGL--PNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DL    C   ++KG +
Sbjct  142   TYMLQLYNT-CIKLSPIDVEFIMGLRARGFKIGMNKDVGH--KNDLCKKYC---DKKGRL  195

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDV  690
              +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+
Sbjct  196   PLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDI  246



>ref|XP_010649037.1| PREDICTED: uncharacterized protein LOC104879128 [Vitis vinifera]
 ref|XP_010649038.1| PREDICTED: uncharacterized protein LOC104879128 [Vitis vinifera]
Length=357

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/252 (24%), Positives = 103/252 (41%), Gaps = 16/252 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR   S  ++L   L  ++   V     GGLL L  K +   +  WL+++FN     
Sbjct  8     RLYTRCSSSRFLKLCNRLPHEKLDVVRDFQFGGLLHLNCKEIRHNICTWLIAHFNVGYKR  67

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I++++ R   +T   V  V GLP      T R  H+             +  G +     
Sbjct  68    IEITSHRRYDLTAADVGLVFGLPT-----TGRILHIATT-------PSNHPFGTLNTCEE  115

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
               L L + E    F+R F     +TL+A T      +   H   +     D++W  +++ 
Sbjct  116   RLLNLPIGEE---FRRCFIYYACATLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVD  172

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQ  468
              LV     + Q  +    G ++FL L YV + +    +VP   P    W+   +  R   
Sbjct  173   QLVEGIRRFKQGNSVWVHGCIIFLQLHYVMKFKIPSVHVPMTAPLLSTWSDELIKERLSA  232

Query  467   EV-DAGEFGYGQ  435
             E+ + G FG+G+
Sbjct  233   EISEFGSFGHGE  244



>gb|KDO39693.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
 gb|KDO39694.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
 gb|KDO39695.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
 gb|KDO39696.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
 gb|KDO39697.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
 gb|KDO39698.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
Length=317

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 91/205 (44%), Gaps = 5/205 (2%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  105   VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  164

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +L +G+ L +  +  + ++G+ +G + +     +     +   R   +     I +  L 
Sbjct  165   EL-HGQKLELCPKMFSKIMGVKDGGMAI---KINGASDHIAEVRRIFQPTVKGIRIRTLE  220

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              +   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +    
Sbjct  221   EVIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCYDW  279

Query  644   LVNTHDSWTQNTARKFPGPLLFLTL  570
             LV +   +    A    G L FL +
Sbjct  280   LVKSICRFQNQQAAYIGGCLHFLQV  304



>ref|XP_002446780.1| hypothetical protein SORBIDRAFT_06g022285 [Sorghum bicolor]
 gb|EES11108.1| hypothetical protein SORBIDRAFT_06g022285 [Sorghum bicolor]
Length=903

 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/261 (23%), Positives = 118/261 (45%), Gaps = 18/261 (7%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P+  + +++ LS +++  +   G G LL      +P +   W V+    ++    +
Sbjct  104   TRFSPTAFMNVISSLSPEKKAVIDGYGFGSLLMFNKCFVPNKFATW-VARLVDSKSGDII  162

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA---L  828
              NG+ + ++EE V  VL LP G+       +  +G D++  +   K+R   ++  A   +
Sbjct  163   RNGKVISLSEESVHFVLDLPLGTRAFPSDSS--IGKDIVLSKFG-KDRIPPVSFFADKLI  219

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             +   LS ++  + F     VV  S+ +    N   + K   +F+D+  IKD  WC ++L 
Sbjct  220   SNEQLSNEDMLICF----LVVALSSFLCPNTNIVPSPKYFGVFEDIDHIKDFKWCAFVLE  275

Query  647   SLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRAL  486
              L++   ++ +  + K        G L +L + Y+D ++  +R V    P    W +  +
Sbjct  276   WLLDHIKAFNRGKSDKLKRCQGLGGCLYYLVVVYLDHIDFRQRQVADFIPRISVWKQDMI  335

Query  485   DAREQQEVDA-GEFGYGQLEE  426
                   ++ + G +GY  L E
Sbjct  336   QFYCSLDLKSPGVYGYRPLLE  356



>ref|XP_002441202.1| hypothetical protein SORBIDRAFT_09g022220 [Sorghum bicolor]
 gb|EES19632.1| hypothetical protein SORBIDRAFT_09g022220 [Sorghum bicolor]
Length=369

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/270 (23%), Positives = 116/270 (43%), Gaps = 25/270 (9%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +  + +++ LS +++  + S G G LL      +P  L  W V+N   ++    +
Sbjct  104   TRFSATAFMNVISSLSPEKKDVIASYGFGSLLLFDKCFVPNSLAKW-VANLVDSKSGDIV  162

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              +G+ + +TEE V  VL LP G+       +  VG D +       ++ G   +  ++  
Sbjct  163   HDGKVISLTEESVHLVLDLPIGTRPFPSDPS--VGKDFIL------SKFGKSMIPPVSFF  214

Query  818   ALS------LKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
             A        L +  V+    F +V  S+ +    N+  + K   +F+DV  IKD  WC Y
Sbjct  215   ADKLIKKDDLSDEDVFI--CFMIVALSSFLCPNTNTIPSPKYFGIFEDVDHIKDFKWCAY  272

Query  656   LLSSLVNTHDSWTQNTARK------FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK  495
             +L  L+    ++      K        G L +L + Y+D ++ G+R +  + P    W  
Sbjct  273   VLQWLLEHVKAFNGGKDAKAKRCLGLGGCLYYLAVVYLDHIDFGQRQLVDSIPRICVWKG  332

Query  494   RALDAREQQEVDA-GEFGYGQLEEPFSTSA  408
               +      ++ + G +GY  L  PF  + 
Sbjct  333   DLIKFYANLDIKSPGVYGYRPL-LPFDNTC  361



>ref|XP_002441252.1| hypothetical protein SORBIDRAFT_09g023175 [Sorghum bicolor]
 gb|EES19682.1| hypothetical protein SORBIDRAFT_09g023175 [Sorghum bicolor]
Length=934

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/261 (23%), Positives = 118/261 (45%), Gaps = 18/261 (7%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P+  + +++ LS +++  +   G G LL      +P +   W V+    ++    +
Sbjct  54    TRFSPTAFMNVISSLSPEKKAVIDGYGFGSLLMFNKCFVPNKFATW-VARLVDSKSGDII  112

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA---L  828
              NG+ + ++EE V  VL LP G+       +  +G D++  +   K+R   ++  A   +
Sbjct  113   RNGKVISLSEESVHFVLDLPLGTRAFPSDSS--IGKDIVLSKFG-KDRIPPVSFFADKLI  169

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             +   LS ++  + F     VV  S+ +    N   + K   +F+D+  IKD  WC ++L 
Sbjct  170   SNEQLSNEDMLICF----LVVALSSFLCPNTNIVPSPKYFGVFEDIDHIKDFKWCAFVLE  225

Query  647   SLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRAL  486
              L++   ++ +  + K        G L +L + Y+D ++  +R V    P    W +  +
Sbjct  226   WLLDHIKAFNRGKSDKLKRCQGLGGCLYYLVVVYLDHIDFRQRQVADFIPRISVWKQDMI  285

Query  485   DAREQQEVDA-GEFGYGQLEE  426
                   ++ + G +GY  L E
Sbjct  286   QFYCSLDLKSPGVYGYRPLLE  306



>ref|XP_007203458.1| hypothetical protein PRUPE_ppa022162mg, partial [Prunus persica]
 gb|EMJ04657.1| hypothetical protein PRUPE_ppa022162mg, partial [Prunus persica]
Length=347

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 102/235 (43%), Gaps = 29/235 (12%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I TR  P ++  ++  L+ +++  +  IG   LL ++ + L   + H+L+S        
Sbjct  36    KIATRCSPKDVNDIINVLTDEKKAAIQEIGFVSLLEMKCRKLSYSMCHFLISV-------  88

Query  1007  IKLSNGRFLRI--TEEGVAAV--LGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNIT  840
                    F+RI   ++G   V   G  +    +  R++ +VG  LL      KN      
Sbjct  89    -----DDFIRIMGVKDGGEEVDFTGSMDEQQIVNVRNSFLVGKKLL------KN------  131

Query  839   VHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              + L  + +  +E G +FK  F +    TL+  T + Y N K +   +D ++I    W  
Sbjct  132   -NELKQIMVGTEEVGEFFKVGFAMFALCTLLCPTTSVYVNLKYLLPLRDSKIISRKKWAS  190

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTK  495
             Y    L++   S+ +N      G LLFL LFY+D +  G   V R+      W K
Sbjct  191   YSFKFLLHNIRSFKENNQVYIGGCLLFLQLFYLDAIAHGSLFVDRSVLPLAVWRK  245



>ref|XP_010657156.1| PREDICTED: uncharacterized protein LOC104880853 [Vitis vinifera]
Length=448

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 102/252 (40%), Gaps = 16/252 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR   S  ++L   L  ++   V  +  GGLL L  K +   L  WL+++FN     
Sbjct  8     RLYTRCSSSRFLKLCNRLPPEKLDVVRDLQFGGLLHLNCKEIRHNLCTWLIAHFNVGYKR  67

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I++++     +T   V  V GLP     +    T    P      C+   R  N+ +   
Sbjct  68    IEITSHIRYDLTAADVGLVFGLPTTGRILDIATTPSDHPFGTLNTCE--ERLLNLPI---  122

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G  F+R F     +TL+A T      +   H   +     D++W  +++ 
Sbjct  123   ----------GEEFRRCFIYYTCATLLAPTSRIDGCRNLWHTIHENGFRNDVNWGQFVVD  172

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQ  468
              LV     + Q  +    G ++FL L YV + +    +VP   P    W+   +  R   
Sbjct  173   QLVEGIRRFKQGNSVWVHGCIIFLQLHYVMKFKIPSVHVPMTVPLLSAWSDELIKERLSA  232

Query  467   EV-DAGEFGYGQ  435
             E+ + G FG+G+
Sbjct  233   EISEFGSFGHGE  244



>ref|XP_002456195.1| hypothetical protein SORBIDRAFT_03g031960 [Sorghum bicolor]
 gb|EES01315.1| hypothetical protein SORBIDRAFT_03g031960 [Sorghum bicolor]
Length=461

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 63/265 (24%), Positives = 117/265 (44%), Gaps = 15/265 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +  + +++ LS +++  + S G G LL      +P  L  W V+N   ++    +
Sbjct  104   TRFSATAFMNVISSLSPEKKDVIASYGFGSLLLFDKCFVPNSLAKW-VANLVDSKSGDIV  162

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              +G+ + +TEE V  VL LP G+       +  VG D +  +   K++   ++  A   +
Sbjct  163   HDGKVISLTEESVHLVLDLPIGTRPFPSDPS--VGKDFILSKFG-KSKIPPVSFFADKLI  219

Query  818   AL-SLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSL  642
                 L +  V+    F +V  S+ +    N+  + K   +F+DV  IKD  WC Y+L  L
Sbjct  220   KKDDLSDEDVFI--CFMIVALSSFLCPNTNTIPSPKYFGIFEDVDHIKDFKWCAYVLQWL  277

Query  641   VNTHDSWTQNTARK------FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDA  480
             +    ++      K        G L +L + Y+D ++ G+R +  + P    W    +  
Sbjct  278   LEHVKAFNGGKDAKAKRCLGLGGCLYYLAVVYLDHIDFGQRQLVDSIPRICVWKGDLIKF  337

Query  479   REQQEVDA-GEFGYGQLEEPFSTSA  408
                 ++ + G +GY  L  PF  + 
Sbjct  338   YANLDIKSPGVYGYRPL-LPFDNTC  361



>ref|XP_002455608.1| hypothetical protein SORBIDRAFT_03g013915 [Sorghum bicolor]
 gb|EES00728.1| hypothetical protein SORBIDRAFT_03g013915 [Sorghum bicolor]
Length=884

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/273 (25%), Positives = 114/273 (42%), Gaps = 30/273 (11%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWL--VSNFNPAQMAI  1005
             +R   S    ++  LST  +  +   G G LL     ++P    HW+  + NFN   + +
Sbjct  9     SRFSVSTFSSVIKSLSTNHQDVIRKYGFGSLLMFDECSVPRNFVHWVARLVNFNSGDIVV  68

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
                NG+ + +T+E V  VL LP G              D  + +  + +R G  +V  ++
Sbjct  69    ---NGKVISLTKEAVHLVLDLPFGGEPFPT--------DYASGKACLLSRFGKDSVPPIS  117

Query  824   TLA---LSLKE-GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               +   +S KE         F VV  ST +    +   +Q+   +F+D+  I+  DWCG+
Sbjct  118   YFSEALISKKELSDDDMFVCFIVVALSTFLCPNSSVVPSQRFFGIFEDLEKIRSYDWCGF  177

Query  656   LLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKR-----  492
             +LS L+     + Q    K         + Y+D V+ G   VP   P    W K      
Sbjct  178   ILSWLLEYIKLFNQLKGCKSTHQATL--VLYLDHVDFGSHQVPSTIPRISVWKKDMITRY  235

Query  491   -ALDAREQQEVDAGEFGYGQLEEPFSTSASRPR  396
              +LD +E+     G +GY  + +   T  ++ R
Sbjct  236   ASLDLKEE-----GCYGYHPIMDYSRTCYAKIR  263



>gb|KDO39699.1| hypothetical protein CISIN_1g021140mg [Citrus sinensis]
Length=280

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 92/205 (45%), Gaps = 9/205 (4%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +ET+  P     L+  LS +++K +  IG   LL LR   L  +L HWLV+ F P +  I
Sbjct  68    VETKCVPERFCALVKSLSEEKKKAIREIGFESLLELRCGKLKRKLCHWLVNQFKPERNII  127

Query  1004  KLSNGRFLRITEEGVAAVLGLPNG--SVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             +L +G+ L +  +  + ++G+ +G  ++ +     H+        R      KG I +  
Sbjct  128   EL-HGQKLELCPKMFSKIMGVKDGGMAIKINGASDHIAE----VRRIFQPTVKG-IRIRT  181

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             L  +   L E    FK  F +   +TL+   + SY +   +H   DV  IK L+W  +  
Sbjct  182   LEEVIEQLDEANKIFKVAFTLFAIATLLCP-IGSYISTLFLHPIMDVSSIKSLNWATFCY  240

Query  650   SSLVNTHDSWTQNTARKFPGPLLFL  576
               LV +   +    A    G L FL
Sbjct  241   DWLVKSICRFQNQQAAYIGGCLHFL  265



>emb|CAN75849.1| hypothetical protein VITISV_040636 [Vitis vinifera]
Length=895

 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 95/235 (40%), Gaps = 44/235 (19%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQR  +  IG G LL LR +                 
Sbjct  440   PKLYLQTRCSPERVIRVIEELEPKQRAAIEEIGFGSLLQLRCR-----------------  482

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
                 K+ +G              GL  G   M +  +H    DL    C   ++KG + +
Sbjct  483   ----KIDHG------------ARGLKIG---MNKDVSH--NNDLCKKYC---DKKGQLPL  518

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L       KEGG  FK  F + V   L+  T+  +  +  +H+ +D+  IK ++W  +
Sbjct  519   VMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKXFVKRSFLHLVEDIDSIKKMNWAEF  578

Query  656   LLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNV---PRANPAAHGW  501
             +LS LV+  + +         G LLFL LFY   +   E+ +    R  P    W
Sbjct  579   VLSYLVHGIEEFKMKQQSGVCGCLLFLMLFYHXHISFEEKFLXLYTRPCPXITAW  633



>emb|CAN65618.1| hypothetical protein VITISV_001359 [Vitis vinifera]
Length=1316

 Score = 70.5 bits (171),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 114/286 (40%), Gaps = 26/286 (9%)
 Frame = -2

Query  1259  PTPPRD-PEELDDTEPVHDIM-SPFP--------QIETRGRPSELVRLLTGLSTKQRKDV  1110
             P P  + P+  DD   V D   + FP        ++ TR   S  ++L   L  ++   V
Sbjct  699   PLPTHNMPKLCDDEGYVIDCAGNSFPACQPPHSNRLYTRCSSSRFLKLCNKLPPQKLDVV  758

Query  1109  ISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGS  930
               +  GGLL L  K +   +  WL+++FN     I+++  R   +T   V+ V GLP   
Sbjct  759   RDLHFGGLLHLNCKEIRHNICIWLIAHFNVGYKRIEITFDRRYDMTAADVSLVFGLPT--  816

Query  929   VTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTL  750
                       +G  L        +  G +       L L + E    F+R F     +TL
Sbjct  817   ----------IGRILHIATTSSDHPFGTLNTCEERLLNLPIGEE---FRRCFIYYACATL  863

Query  749   VASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTL  570
             +A T      +   H   +     D++W  +++  LV     + Q       G +LFL L
Sbjct  864   LAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVDQLVEGIRRFKQGNNVWVHGCILFLQL  923

Query  569   FYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEV-DAGEFGYGQ  435
              YV + +    +VP   P    W+   +  R   E+ + G FG+GQ
Sbjct  924   HYVMKFKIPSVDVPLTAPLLSAWSDELIKERLSTEISEFGSFGHGQ  969



>emb|CAN73205.1| hypothetical protein VITISV_025946 [Vitis vinifera]
Length=1268

 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 106/263 (40%), Gaps = 26/263 (10%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +   +L   L   + + + ++  GGLL L    +   L  +L+ +FN     I+ 
Sbjct  663   TRCSAARFKKLYNRLPEAKIQAIRNLQFGGLLNLNCTEVRHNLCIFLIQHFNVGFRRIEF  722

Query  998   SNGRFLRITEEGVAAVLGLP----NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             S  +   +T   V  + GLP    N  VT T  D H  G     W C+ K          
Sbjct  723   SAQKHYPVTTIDVGLIFGLPTEGRNLQVTSTSSD-HPFGT---IWACEEK----------  768

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                L L + E    F+R F     +TL+A T      +   H   +     D++W  ++L
Sbjct  769   --LLDLPVGEE---FRRAFIYYACATLLAPTSRLNGCRNLWHTIHEDGFRNDVNWAQFVL  823

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               LV     + Q+      G +LFL L YV + +     VP   P A  WT   +  R  
Sbjct  824   DQLVEGIRRYQQSKTSWVHGCVLFLQLHYVIKFQIPSVQVPITVPPALAWTDDMIKRRLV  883

Query  470   QEVDAGEFG-YGQLEEPFSTSAS  405
              E+   EFG +G +E  F++  S
Sbjct  884   AEIK--EFGAFGHVEIDFASQRS  904



>gb|EMS56314.1| hypothetical protein TRIUR3_35199 [Triticum urartu]
Length=447

 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/259 (23%), Positives = 115/259 (44%), Gaps = 12/259 (5%)
 Frame = -2

Query  1166  PSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGR  987
             P  + +L   ++  QR  V ++G G LL ++   L   +  W    ++  +    +    
Sbjct  79    PLAICKLYEHINEGQRVAVRAMGTGQLLDIKCAYLHNTILTWFTRLYHSGRRGFVVPGRG  138

Query  986   FLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSL  807
             F+ +TEE V  +LG+P+G + +     + +  +  A        + NIT   +AT  ++ 
Sbjct  139   FIPLTEESVHQILGIPHGDIEVKYEADYDMEQEFAATLFPGNGSRPNIT--TVATAIINH  196

Query  806   KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHD  627
              E    FK+ + + + ST++A T ++  + K   M  D+     L+ C +++  L   H+
Sbjct  197   NEADDRFKKLWFIYIVSTVLAPTTDARISNKCYPMLADINRADRLNLCKFVVDQL---HE  253

Query  626   SWTQNTARKFPGPLLFLTLFYVDRVEAG--ERNVPRANPAAHGWTKRALDA---REQQEV  462
               ++   +   G LL+  L Y+D ++    E  +       + W+K  +D     +  E 
Sbjct  254   HLSK--GKYTNGCLLYCMLRYLDALDCDGMELELTDTPYRVNAWSKTQVDVVAELDMLEH  311

Query  461   DAGEFGYGQLEEPFSTSAS  405
             D   FG  QL+E F   A+
Sbjct  312   DPPCFGRLQLKEEFREEAA  330



>ref|XP_008240712.1| PREDICTED: uncharacterized protein LOC103339208 [Prunus mume]
Length=253

 Score = 67.0 bits (162),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 97/206 (47%), Gaps = 18/206 (9%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             LS +++  +  +G   LLG++   L   +  +LV   NP++ +I L +G+ L+I+ +   
Sbjct  46    LSDEKKAAIEEMGFVSLLGMKCGKLSHSMCCFLVDKLNPSESSIVL-HGKTLKISVDDFV  104

Query  956   AVLGLPNG----SVTMTERDTHMVGPDLLAWRCKVKN----RKGNITVHALATLALSLKE  801
              ++G+ +       T +  D H+V         KV+N     K  +  + L  + +  +E
Sbjct  105   RIMGVKDRGEEVDFTGSMDDQHIV---------KVRNSFLGEKKLLKNNELKQIMVGTEE  155

Query  800   GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSW  621
              G +FK  F +    TL+  T + Y N K +   +D + I   +W  Y    L+++  S+
Sbjct  156   AGDFFKVGFVMFSLCTLLCPTTSVYVNLKHLLPLRDNKTIARKNWASYSFKFLLDSVRSF  215

Query  620   TQNTARKFPGPLLFLTLFYVDRVEAG  543
              +N      G LLF  LFY+D +  G
Sbjct  216   KENNQVYIGGCLLFHQLFYLDAIAHG  241



>ref|XP_002449327.1| hypothetical protein SORBIDRAFT_05g008100 [Sorghum bicolor]
 gb|EES08315.1| hypothetical protein SORBIDRAFT_05g008100 [Sorghum bicolor]
Length=435

 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 104/243 (43%), Gaps = 15/243 (6%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVA  957
             +S  QRK V   G GGLL +    L   L  WLV N +     + +     +++    V 
Sbjct  1     MSEAQRKLVSDAGFGGLLEIGSGRLSSALSKWLVKNVDGESEELVIPGRGKIKVNAAAVN  60

Query  956   AVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSL---KEGGVWF  786
              +LGLP G   + + + +      +  +C   N +      A+ T+   L   KE    +
Sbjct  61    RILGLPMGEDEV-KYEFNGSAISFINEKCNFDNGRS----PAITTITERLCANKEANDDY  115

Query  785   KRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTA  606
              R + +V  ST +  +     + K      D+  +K+L+WC +    +V+T   +     
Sbjct  116   LRCWLMVAISTFLCGSTALCISPKCYPSLVDLSKVKELNWCKF----VVDTLKGYVGKMH  171

Query  605   RK--FPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDA-GEFGYGQ  435
             +K    G L FL++ Y+D +E G   +P   P    W  + ++   + + +  G FG  +
Sbjct  172   KKDSVLGCLYFLSILYLDSLEVGNIQIPEKQPRVAAWNMKLINKVIKMDTNTNGTFGKLK  231

Query  434   LEE  426
             L++
Sbjct  232   LKK  234



>emb|CAN83476.1| hypothetical protein VITISV_019328 [Vitis vinifera]
Length=479

 Score = 68.6 bits (166),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 95/235 (40%), Gaps = 44/235 (19%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQR  +  IG G LL LR +                 
Sbjct  91    PKLYLQTRCSPERVIRVIEELEPKQRAAIEEIGFGSLLQLRCR-----------------  133

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
                 K+ +G              GL  G   M +  +H    DL    C   ++KG + +
Sbjct  134   ----KIDHG------------ARGLKIG---MNKDVSH--NNDLCKKYC---DKKGQLPL  169

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L       KEGG  FK  F + V   L+  T+  +  +  +H+ +D+  IK ++W  +
Sbjct  170   VMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVKRSFLHLVEDIDSIKKMNWAEF  229

Query  656   LLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNV---PRANPAAHGW  501
             +LS LV+  + +         G LLFL LFY   +   E+ +    R  P    W
Sbjct  230   VLSYLVHGIEEFKMKQQSGVCGCLLFLMLFYHXHISFEEKFLXLYTRPCPXITAW  284



>gb|EEC80882.1| hypothetical protein OsI_23519 [Oryza sativa Indica Group]
Length=1207

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/280 (21%), Positives = 112/280 (40%), Gaps = 44/280 (16%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVS--NFNPAQMAI  1005
             TR       R+++ LS  Q+  +   G   LL      +P +   W+    +F  +Q+ +
Sbjct  328   TRFSTKYFCRVISALSPHQKTIIQGAGFQNLLEFNSNYVPNKFATWIAKHVDFKTSQIIL  387

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +    + + +T++ V  + GLP+G +          G D  A +  +      ++++ L+
Sbjct  388   R---DKVISVTKQTVCDIFGLPSGGLEF--------GKDFEAGKEYI------LSMYGLS  430

Query  824   TLALSLKEGGVWFKRH----------FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD  675
              L      G  + K+           F +V  +  +    +   + K + +F+DV  +++
Sbjct  431   CLPSVRFFGDQFIKKEPLTNEKVITSFLIVALACFLCPNSSILPSTKYLTIFQDVNNLRN  490

Query  674   LDWCGYLLSSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPA  513
              DW  ++          W+ N  +KF       G L    + Y+D VE G+ NV    P 
Sbjct  491   YDWSKFIY--------DWSMNYMKKFVKTNSLGGCLYMWAVVYLDNVEFGDNNVSNEIPR  542

Query  512   AHGWTKRALDAR-EQQEVDAGEFGYGQLEEPFSTSASRPR  396
                W    + A  E  ++D   FG   L +  ST   +P+
Sbjct  543   ICVWKSDMIHAYSEFDKIDDDTFGLRPLRDFKSTCYFQPQ  582



>ref|XP_006475687.1| PREDICTED: uncharacterized protein LOC102608522 isoform X6 [Citrus 
sinensis]
Length=603

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/203 (24%), Positives = 89/203 (44%), Gaps = 4/203 (2%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  L++ L+ KQRK V  IG+G ++ L+   L  +L  WLV   + A+  ++L
Sbjct  101   TRCAPDRLAALVSHLTEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              NG  L ++      ++G+ +G + M   +      ++ A+  K       I +  +  +
Sbjct  161   -NGHELELSPNSFGYIMGVTDGGMPM---ELQGDSAEVAAYLDKFNATSRGINIKTMEDI  216

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+ K+    FK  F +    TL+      + +   +   KDV  I++ +W  +    L+
Sbjct  217   LLTSKDADNDFKVAFMLFTLCTLLCPPGGVHISYSFLFTLKDVHSIRNRNWATFCFERLM  276

Query  638   NTHDSWTQNTARKFPGPLLFLTL  570
                  +         G LL+L +
Sbjct  277   RGITRYKDEKLAHVGGCLLYLEV  299



>gb|EMT09021.1| hypothetical protein F775_30912 [Aegilops tauschii]
Length=442

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/260 (24%), Positives = 114/260 (44%), Gaps = 13/260 (5%)
 Frame = -2

Query  1166  PSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGR  987
             P  + +L   ++  QR  V ++G G  L ++   L      W    ++  +    +    
Sbjct  73    PHAICKLYKHINEGQRVAVRAMGTGPFLDIKCAYLHNTAVTWFTRLYHSGRRGFVVPGRG  132

Query  986   FLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSL  807
             F+ +TEE V  +LG+P+G + +     + +  +  A        + NIT   +AT  ++ 
Sbjct  133   FIPLTEESVHQILGIPHGDIEVKYEADYDMEQEFAATLFPGDGSRPNITT--VATAIINH  190

Query  806   KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK-DVRMIKDLDWCGYLLSSLVNTH  630
              E    FK+ + + + STL+A T ++  + K   M K D+     L+ C +++  L + H
Sbjct  191   SEADDKFKKLWLIYIVSTLLAPTTDARVSNKCYPMLKADINRADRLNLCKFVVDQL-HEH  249

Query  629   DSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRAN--PAAHGWTKRALD---AREQQE  465
              S  + T     G LL+  L Y+D ++     +   N     + W+K  +D     +  E
Sbjct  250   LSNGKYTN----GCLLYCMLRYLDALDCDGMELELTNRPYRVNAWSKTQVDIVAELDMLE  305

Query  464   VDAGEFGYGQLEEPFSTSAS  405
              D   FG  QL+E F   A+
Sbjct  306   HDPPCFGKFQLKEEFREEAA  325



>gb|AAP54389.2| Ulp1 protease family, C-terminal catalytic domain containing 
protein [Oryza sativa Japonica Group]
Length=986

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/280 (21%), Positives = 112/280 (40%), Gaps = 44/280 (16%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVS--NFNPAQMAI  1005
             TR       R+++ LS  Q+  +   G   LL      +P +   W+    +F  +Q+ +
Sbjct  96    TRFSTKYFCRVISALSPHQKTIIQGAGFQNLLEFNSNYVPNKFATWIAKHVDFKTSQIIL  155

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +    + + +T++ V  + GLP+G +          G D  A +  +      ++++ L+
Sbjct  156   R---DKVISVTKQTVCDIFGLPSGGLEF--------GKDFEAGKEYI------LSMYGLS  198

Query  824   TLALSLKEGGVWFKRH----------FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD  675
              L      G  + K+           F +V  +  +    +   + K + +F+DV  +++
Sbjct  199   CLPSVRFFGDQFIKKEPLTNEKVITSFLIVALACFLCPNSSILPSTKYLTIFQDVNNLRN  258

Query  674   LDWCGYLLSSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPA  513
              DW  ++          W+ N  +KF       G L    + Y+D VE G+ NV    P 
Sbjct  259   YDWSKFIY--------DWSMNYMKKFVKTNSLGGCLYMWAVVYLDNVEFGDNNVSNEIPR  310

Query  512   AHGWTKRALDAR-EQQEVDAGEFGYGQLEEPFSTSASRPR  396
                W    + A  E  ++D   FG   L +  ST   +P+
Sbjct  311   ICVWKSDMIHAYSEFDKIDDDTFGLRPLRDFKSTCYFQPQ  350



>ref|XP_010665511.1| PREDICTED: uncharacterized protein LOC104882809 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 77/177 (44%), Gaps = 8/177 (5%)
 Frame = -2

Query  1157  LVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLR  978
             L  L    +++Q+K +  IG G LL L++      L  WLV  F+      K+  G+  R
Sbjct  109   LCELNEAFNSEQKKAITEIGFGSLLHLKITRTNNALSAWLVDMFDGGSGMFKVGYGKEFR  168

Query  977   ITEEGVAAVLGLP---NGSVTMTERDTHMVGP--DLLA-WR--CKVKNRKGNITVHALAT  822
             + +  V  V   P      V    R  +   P  DL A WR   KV   KG I + A+  
Sbjct  169   VNQYDVYDVFQFPLVEGQDVVDVSRGPNADNPYFDLKASWREYFKVNREKGQIGLSAVYY  228

Query  821   LALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                 L  GG  FK+ + +   S+ +A   N+  + + V    +VR I   +WC Y+L
Sbjct  229   ELKKLVNGGEVFKKLYVLFAFSSFLAPVANNTLDLRLVLAVHEVRKIPHYNWCKYIL  285



>gb|EEC76309.1| hypothetical protein OsI_13839 [Oryza sativa Indica Group]
Length=786

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/280 (21%), Positives = 111/280 (40%), Gaps = 44/280 (16%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVS--NFNPAQMAI  1005
             TR       R+++ LS  Q+  +   G   LL      +P +   W+    +F  +Q+ +
Sbjct  61    TRFSTKYFCRVISALSPHQKTIIQGAGFQNLLEFNSNYVPNKFATWIAKHVDFKTSQIIL  120

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
             +    + + +T++ V  + GLP+G +          G D  A +  +      ++++ L+
Sbjct  121   R---DKVISVTKQTVCDIFGLPSGGLEF--------GKDFEAGKEYI------LSMYGLS  163

Query  824   TLALSLKEGGVWFKRH----------FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD  675
              L      G  + K+           F +V     +    +   + K + +F+DV  +++
Sbjct  164   CLPSVRFFGDQFIKKEPLTNEKVITSFLIVALVCFLCPNSSILPSTKYLTIFQDVNNLRN  223

Query  674   LDWCGYLLSSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPA  513
              DW  ++          W+ N  +KF       G L    + Y+D VE G+ NV    P 
Sbjct  224   YDWSKFIY--------DWSMNYMKKFVKTNSLGGCLYMWAVVYLDNVEFGDNNVSNEIPR  275

Query  512   AHGWTKRALDAR-EQQEVDAGEFGYGQLEEPFSTSASRPR  396
                W    + A  E  ++D   FG   L +  ST   +P+
Sbjct  276   ICVWKSDMIHAYSEFDKIDDDTFGLRPLRDFKSTCYFQPQ  315



>ref|XP_004290281.1| PREDICTED: uncharacterized protein LOC101292173 [Fragaria vesca 
subsp. vesca]
Length=391

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/247 (23%), Positives = 109/247 (44%), Gaps = 13/247 (5%)
 Frame = -2

Query  1211  HDIMSPFPQIE---TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHW  1041
             H++   F  ++    R RP     +++  S +++  V  +G G LL L+ + L L L  W
Sbjct  23    HNVEYKFGVVKPKMLRCRPKLFKDVVSKFSVEKKVAVEEMGFGLLLKLQCEQLQLGLCGW  82

Query  1040  LVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCK-V  864
             L+  F+P++ +I++   RF  +       ++G+ +G       D  + G        K +
Sbjct  83    LIDRFDPSKSSIEVHGKRF-NLGPTDFENIMGVKDGG-----HDVEIRGSKAEIQELKNI  136

Query  863   KNRKGNITVHALATLALSLKEGGV---WFKRHFCVVVASTLVASTLNSYANQKTVHMFKD  693
                +    +  ++ +A  LKE       F+  F +   +TL+  +++    +K +H  +D
Sbjct  137   HFGRSRHRISGMSKMAEKLKEKKNVDDTFRVRFVLFALATLLCPSISGDLTEKYLHPLRD  196

Query  692   VRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPA  513
             +  IK  +W  +  + LV    ++ +       G +LFL LFY D V  G   V R+   
Sbjct  197   IDGIKLKNWATFSFNYLVEGLGTFKKKNTSCISGCVLFLKLFYFDLVVHGRTFVNRSLTP  256

Query  512   AHGWTKR  492
                W ++
Sbjct  257   IVAWGEK  263



>ref|XP_010645331.1| PREDICTED: uncharacterized protein LOC104877845 [Vitis vinifera]
Length=561

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 100/255 (39%), Gaps = 24/255 (9%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +   +L   L   + + +  +  GGLL L    +   L  +L+ +FN     I+ 
Sbjct  324   TRCSAARFKKLCNRLPEAKIQAIRDLQFGGLLNLNCTEVRHNLCIFLIQHFNVGFRRIEF  383

Query  998   SNGRFLRITEEGVAAVLGLP----NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             S  +   +T   V  +LGLP    N  VT T  D H  GP                 + A
Sbjct  384   SAQKHYPVTATDVGLILGLPTEGRNLQVTSTSSD-HPFGP-----------------IRA  425

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                  L L  G   F+R F     +TL+A T      +   H   +     D++W  ++L
Sbjct  426   CEEKLLDLPVGEE-FRRAFIYYACATLLAPTSRLNGCRNLWHTIHEDGFRNDVNWAQFVL  484

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               LV     + Q+      G +LFL L YV + +     VP   P    WT   +  R  
Sbjct  485   DQLVEGIRRYQQSKTSWVHGCVLFLQLHYVIKFQIPLVQVPITVPPTLAWTDDLIKGRLV  544

Query  470   QEV-DAGEFGYGQLE  429
              E+ + G FG+ +++
Sbjct  545   AEIKEFGAFGHAEID  559



>ref|XP_010648058.1| PREDICTED: uncharacterized protein LOC104878867 [Vitis vinifera]
Length=698

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/259 (23%), Positives = 107/259 (41%), Gaps = 33/259 (13%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L   +R  +I +G GGLL L    L   L  W++SN++ A   + 
Sbjct  23    KSRCSGKKFISVIARLPDDKRDAIIEMGFGGLLHLACPELRYELCSWIISNYDTAYHQLN  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGS---VTMTERDTHMVGPDLLAWRCKVKNRKGNITV--  837
             ++ G  + +T + V  ++G+P      V  T R T               NR   I++  
Sbjct  83    MATGVVVSVTAQDVDNIMGIPCSGEKIVVHTRRGT--------------SNRTYTISLLE  128

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL----D  669
               L  LA+     G  F++ F +   +TL+A      +  + +H   D     D+    +
Sbjct  129   QNLENLAI-----GDDFRKTFLIFACATLLAPN----SKLEGIHDLWDTIWDGDVGVQKN  179

Query  668   WCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
             W  ++L  + +    + +N      G L+FL LFY+ +       V    P    W+   
Sbjct  180   WSKFVLHYIEDGIREYQKNQPTYICGCLIFLQLFYMTKFYLPSVTVDVTMPLLAAWSDDL  239

Query  488   LDAREQQEVDAGEFGYGQL  432
             +  R   E+ A   GYG +
Sbjct  240   IKRRLSAEI-ATFGGYGHV  257



>gb|EMT31475.1| hypothetical protein F775_01889 [Aegilops tauschii]
Length=418

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 88/210 (42%), Gaps = 7/210 (3%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
              R     L  L  G +  Q+     +GM  L+ +R K L   +  WL   + PA     +
Sbjct  18    NRASQEHLTILTEGFTDDQKVAAAELGMQALMDVRCKNLVNPVCDWLGEIYEPASREFVI  77

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
                  L + EE V   LG+P G + +     + +   L A          N TV  LA  
Sbjct  78    PGRGRLPLDEESVFCTLGVPRGEIKVLYEVNNTIEETLFARLFLGMTSMPNTTV--LANS  135

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
                +K  G  FK    + + S + A T +   + K   +   ++ +K+++WC ++   L 
Sbjct  136   LEGMKTHGEVFKMKLLMYLISAVFAPTTSLRPSNKCFPIPAKLKEVKNMNWCKFIADVL-  194

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVE  549
               HD+++    +K  G  L L L YVDR++
Sbjct  195   --HDAFSNKMYQK--GCRLHLMLMYVDRLD  220



>ref|XP_004966769.1| PREDICTED: uncharacterized protein LOC101766235 [Setaria italica]
Length=819

 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 115/281 (41%), Gaps = 25/281 (9%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLR-LGHWLVSNFNPAQMAIK  1002
              R  PS     +  L+  QR+ +  +G GGLL +  + L  R L  +L    +P  M + 
Sbjct  111   VRCAPSTFNSFVDHLTLWQRRQIKDMGFGGLLCVAAERLESRELLKFLFDRLDPKTMVLN  170

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGN--ITVHAL  828
             ++  + + +T   V  VL LP G   +           L A++  +  ++ +     H  
Sbjct  171   VAKDKGIHVTPFVVKQVLDLPEGGEDIVLSTHIQASKALSAFKTLLGLQESHDLNASHLQ  230

Query  827   ATLALSLKEGGVWFK-----RHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              TL   L+ G          R F ++  + L+  + ++    K V++ +D+  +  L+WC
Sbjct  231   KTLKDDLELGSGMITDDMAIRFFFIIACNKLLFPSTDNNIRCKDVYLTRDLSCLPALNWC  290

Query  662   GYLLSSLVNTHDSWTQNTARK-FPGPLLFLTLFYVDRVEAGER----NVPRANPAAHGWT  498
               ++  L     +W  + A+K F G  + L + Y+D ++   +    + PRA        
Sbjct  291   KAVVDDLREAALNWQSDKAKKSFSGCAILLIILYLDNLQCQHQVQHMDTPRAKYFTQNVI  350

Query  497   KRALDA-REQQEVDAGEFG-----------YGQLEEPFSTS  411
             K+ + A R + +     FG           Y   E P ST+
Sbjct  351   KKIISADRTKDQQGKATFGLLPLRNIIDTCYHTTENPSSTT  391



>ref|XP_010665438.1| PREDICTED: uncharacterized protein LOC104882773 [Vitis vinifera]
Length=241

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 3/126 (2%)
 Frame = -2

Query  869  KVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDV  690
            K  ++KG + +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+
Sbjct  44   KYCDKKGRLPLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDI  103

Query  689  RMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVP---RAN  519
              IK ++W  ++LS LV+  + + +       G LLFL LFY + +   E+ +P   R +
Sbjct  104  DSIKKMNWAEFVLSYLVHGIEEFKKKQQSGVCGCLLFLMLFYHEHISFEEKFLPLYTRPS  163

Query  518  PAAHGW  501
            P    W
Sbjct  164  PRITAW  169



>dbj|BAD38572.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD37729.1| hypothetical protein [Oryza sativa Japonica Group]
Length=721

 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/241 (22%), Positives = 112/241 (46%), Gaps = 22/241 (9%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I TR  P+ L  L +G   +Q++ V  +   GLL +R+  L  + G W++   +P+   
Sbjct  73    KIYTRCTPTILSDLFSGFGDQQKELVKQMEFDGLLSMRLTKLNKQFGAWILCKLDPSSGN  132

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKGNITVH  834
             +   +   + +T E V+ +LG+P G   +     + V  D+ A+ C++  K+    +T+ 
Sbjct  133   LFAGSRHEICLTCEDVSLLLGIPCGRKEILPAIKNEVK-DVKAYMCEIFEKDSFDGLTIV  191

Query  833   ALATL-------ALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMIK  678
              +  +        +++ E  V FK  F + V +  +A  ++N++ + + +    DV  I 
Sbjct  192   TIQRILEKKFNRTMTVHEQIV-FKTAFIIFVVTKFLAPQSVNNHISIRYMKALVDVENIH  250

Query  677   DLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFYVDRVEAG-----ERNVP  528
               +W  ++L  + +      H    + +     G ++   LFY+D ++ G     + N+P
Sbjct  251   KYNWAEFVLHDIKDAAAALQHKIRHRKSIGYINGCIILPQLFYLDNLDFGTDTPEQENIP  310

Query  527   R  525
             R
Sbjct  311   R  311



>gb|KDO62590.1| hypothetical protein CISIN_1g039418mg [Citrus sinensis]
Length=297

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 48/201 (24%), Positives = 87/201 (43%), Gaps = 4/201 (2%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR  P  L  L++ L  KQRK V  IG+G ++ L+   L  +L  WLV   + A+  ++L
Sbjct  101   TRCAPDRLAALVSHLIEKQRKAVCDIGLGSIIDLKCGRLKRKLCAWLVERIDTARCVLQL  160

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              NG  L ++      ++G+ +G + M   +      ++ A+  K       I +  +  +
Sbjct  161   -NGHELELSPNSFGYIMGVTDGGMPM---ELQGDSAEVAAYLDKFNATSRGINIKTMEDI  216

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L+ K+    FK  F +    TL+      + +   +   KDV  I++ +W  +    L+
Sbjct  217   LLTSKDADNDFKVAFMLFTLCTLLCPPGGVHISYSFLFTLKDVHSIRNRNWATFCFERLM  276

Query  638   NTHDSWTQNTARKFPGPLLFL  576
                  +         G LL+L
Sbjct  277   RGITRYKDEKLAHVGGCLLYL  297



>gb|AAT93957.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAT94017.1| hypothetical protein [Oryza sativa Japonica Group]
Length=758

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 53/241 (22%), Positives = 112/241 (46%), Gaps = 22/241 (9%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I TR  P+ L  L  G   +Q++ V  +   GLL +R+  L  + G W++   +P+   
Sbjct  73    KIYTRCTPAILSDLFLGFGDQQKELVKQMEFDGLLSMRLTKLNKQFGAWILCKLDPSSGN  132

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKGNITVH  834
             +   +   + +T E V+ +LG+P G   +     + V  D+ A++C++  K+    +T+ 
Sbjct  133   LFAGSRHEICLTCEDVSLLLGIPCGRKEILPAIKNEVK-DVKAYKCEIFEKDSFDGLTIV  191

Query  833   ALATL-------ALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMIK  678
              +  +        +++ E  V FK  F + V +  +A  ++N++ + + +    DV  I 
Sbjct  192   TIQRILEKKFNRTMTVHEQIV-FKTAFIIFVVTKFLAPQSVNNHISIRYMKALVDVENIH  250

Query  677   DLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFYVDRVEAG-----ERNVP  528
               +W  ++L  + +      H    + +     G ++   LFY+D ++ G     + N+P
Sbjct  251   KYNWAEFVLHDIKDAAAALQHKIRHRKSIGYINGCIILPQLFYLDNLDFGTDTPEQENIP  310

Query  527   R  525
             R
Sbjct  311   R  311



>ref|XP_010646184.1| PREDICTED: uncharacterized protein LOC104878110 [Vitis vinifera]
Length=279

 Score = 64.3 bits (155),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 96/246 (39%), Gaps = 21/246 (9%)
 Frame = -2

Query  1103  IGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVT  924
             +G GGLL    + L   L  WL+S ++     + +     + + EE V  V+G+PN  V 
Sbjct  1     MGFGGLLTFACRELRYELCRWLISQYDFTYHRLNIETDNAITVNEEHVNRVMGIPNSGVD  60

Query  923   MTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVW--FKRHFCVVVASTL  750
             +           ++  R    NR      + L  L  +L+   V   F + F +   +TL
Sbjct  61    V-----------VILKRTAPSNR-----TYTLRVLEQNLENLPVCDDFLKSFLIFSCATL  104

Query  749   VASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTL  570
             +A       +        D  +    +W  +LL  L +    + Q       G L+FL L
Sbjct  105   LAPNSKLEGSHDLWDTIWDGDVGVQRNWAKFLLKHLEDGIKEYRQKQPTYIRGCLMFLQL  164

Query  569   FYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDAGE-FGYGQLEEP--FSTSASRP  399
             FY+        NV   +P A  WT   +  R   E+   + +GY  + E     TS S  
Sbjct  165   FYMAYFYMPSVNVEVTSPLATAWTDDVMKCRLAAEISTFDGYGYVHVIEARVIDTSESML  224

Query  398   RCRSSV  381
             R  SS+
Sbjct  225   RLASSL  230



>emb|CAN67356.1| hypothetical protein VITISV_035313 [Vitis vinifera]
Length=535

 Score = 65.9 bits (159),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/260 (22%), Positives = 107/260 (41%), Gaps = 33/260 (13%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L   +R  +  +G GGLL L  + L   L  W++SN++ A   + 
Sbjct  23    KSRCSGKKFISVIARLPDDKRDAITEMGFGGLLHLACRELRYELCSWIISNYDTAYHQLN  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGS---VTMTERDTHMVGPDLLAWRCKVKNRKGNITV--  837
             ++ G  + +T + V  ++G+P      V  T R T               NR   I++  
Sbjct  83    MATGVVVPVTAQDVGNIMGIPCSGEEIVVHTRRGT--------------SNRTYTISLLE  128

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL----D  669
               L  LA+     G  F++ F +   +TL+A      +  + +H   D     D+    +
Sbjct  129   QNLENLAI-----GDDFRKTFLIFACATLLAPN----SKLEGIHDLWDTIWDGDVGVQKN  179

Query  668   WCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
             W  ++L  + +    + +N      G L+FL LFY+ +       V    P    W+   
Sbjct  180   WSKFVLHYIEDGIREYQKNQPTYIRGCLIFLQLFYMTKFYLPSVTVDVTMPLLAAWSDDL  239

Query  488   LDAREQQEVDAGEFGYGQLE  429
             +  R   E+ A   GYG + 
Sbjct  240   IKRRLSAEI-ATFGGYGHVH  258



>ref|XP_002316329.1| hypothetical protein POPTR_0010s22160g [Populus trichocarpa]
 gb|EEF02500.1| hypothetical protein POPTR_0010s22160g [Populus trichocarpa]
Length=586

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 51/233 (22%), Positives = 112/233 (48%), Gaps = 24/233 (10%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             +++R    +   ++      Q + V ++G+ GLL ++ +    ++   L + F+     +
Sbjct  166   LDSRCSLRKFAAVVKMFDQDQIQAVNALGLAGLLHIKKQKRKFQVIEDLAARFDIQSCEL  225

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA--  831
             ++  GR L++T  GV  +LGLP+  +++ +     +G D      ++    G+  +HA  
Sbjct  226   EVHGGR-LKLTPGGVEWLLGLPSSGLSVEQ----FIGND---EDVRMMYNLGSDRIHAGQ  277

Query  830   ----LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
                 LA++  S +     F+  F +   ST++  + + Y +     + K++ ++  L+W 
Sbjct  278   LGDGLASIPASPE-----FQAKFLLYAISTVIRPSTSVYVSPSCFGILKNLSIVCALNWA  332

Query  662   GYLLSSLVNTHDSWTQ-----NTARKFPGPLLFLTLFYVDRVEAGERNVPRAN  519
              Y L  LV+    + +     + A++  G LL L +FY++ V  G+  +PRA+
Sbjct  333   KYALEGLVSGIKKYRETDFAPSKAKRLTGCLLILEIFYLEHVNVGQIKLPRAS  385



>ref|XP_002448620.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor]
 gb|EES12948.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor]
Length=482

 Score = 65.5 bits (158),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/265 (22%), Positives = 112/265 (42%), Gaps = 21/265 (8%)
 Frame = -2

Query  1157  LVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLR  978
              V +++ LS +Q++ V  +G  GLL L    LP  L  WL+ +FN A   + L NG    
Sbjct  37    FVDVVSNLSQQQKEVVQDLGFSGLLELCCPRLPTNLLLWLIDHFNAATRTLMLPNGFNFE  96

Query  977   ITEEGVAAVLGLPNGSVTMTE---RDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSL  807
             +  + V  +LG+PNG + +      +++ +  D      ++ +R    TV  L    ++ 
Sbjct  97    LNPKCVHKILGIPNGGLHILRFGTLESYKIIKD------QIYSRGVTPTVSELCN-QITP  149

Query  806   KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHD  627
                   F R F ++  S+ +        + +  H   ++  +   DWC ++L  LV+   
Sbjct  150   DLSDFEFGRLFMLLALSSFLCPNTRGACSTRYYHAVLNISSVPKYDWCSFVLDWLVSYLV  209

Query  626   SWTQNT----ARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDA---REQQ  468
              +  +     +    G    L + Y++ + +   ++    P  H W+   ++A    + +
Sbjct  210   KFKVHKRTTGSNVIGGCCHILVISYLEFLSSNAFDLGLRCPRLHAWSSTVVNALAFMDAK  269

Query  467   EVDAGEFGYGQLEE----PFSTSAS  405
                +  FG  Q++     PFS   S
Sbjct  270   SDSSSSFGKLQMKHICWTPFSDCFS  294



>ref|XP_008666016.1| PREDICTED: uncharacterized protein LOC103644616 [Zea mays]
Length=338

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 86/196 (44%), Gaps = 4/196 (2%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  109   RCSPGKFIKLVNSLSDELKSEVVAKGFGGLLRFKPHLLSRKLLSWLMRKLNPETMKLEID  168

Query  995   NGRFLRITEEGVAAVLGLPNGSVT---MTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ ++ITE  V  VL LPN       M++ D   +  +L    C K   R   I +  +
Sbjct  169   GGKEIQITEHSVWCVLQLPNVGSDPPPMSDADARALRDELGEQICGKSYRRISGINISVI  228

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ + + +WC  ++ 
Sbjct  229   TDRLQKRTLNGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNMGNKNWCKAVVD  288

Query  647   SLVNTHDSWTQNTARK  600
              +      + ++ A K
Sbjct  289   RMSIAARLYRKDFAEK  304



>ref|XP_007213382.1| hypothetical protein PRUPE_ppa026444mg, partial [Prunus persica]
 gb|EMJ14581.1| hypothetical protein PRUPE_ppa026444mg, partial [Prunus persica]
Length=274

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 99/220 (45%), Gaps = 28/220 (13%)
 Frame = -2

Query  1193  FPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQ  1014
             + +I TR  P ++   +  LS +++  +  +G   LL ++   L   +  +LV   NP++
Sbjct  8     YLKIATRCSPKDVNDTINVLSDEKKVAIEEMGFISLLEMKCGKLSHSICRFLVDKLNPSE  67

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPNG------SVTMTERDTHMVGPDLLAWRCKVKNRK  852
              +I L +G+ L+I+ +    ++G+  G      + +M E+    V   LL     +KN +
Sbjct  68    SSIVL-HGKTLKISLDDFVCIMGVKYGGEEVDFTRSMDEQHIVNVRNSLLVGMKLLKNNE  126

Query  851   GNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL  672
                    L  + +  +E  V+FK  F +    TL+ ST + Y  +K              
Sbjct  127   -------LKKMMVGTEEASVFFKVGFAMFALCTLLCSTTSVYIARK--------------  165

Query  671   DWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
             +W  Y    L+++  S+ +N      G LLFL LFY+  +
Sbjct  166   NWGSYSFKFLLDSISSFKENNQVYIGGCLLFLQLFYLGTI  205



>ref|XP_010664913.1| PREDICTED: uncharacterized protein LOC104882596 [Vitis vinifera]
Length=852

 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 103/258 (40%), Gaps = 19/258 (7%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   S  ++L   L  ++   V  +  GGLL L  K +   L  WL+++FN     I++
Sbjct  535   TRCSSSRFLKLCNRLPPEKLDVVRDLQFGGLLHLNCKEIRHNLCTWLIAHFNVGYKRIEI  594

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
             ++     +T   V  V GLP     +    T    P             G +       L
Sbjct  595   TSHIRYDLTAADVGLVFGLPTTGRILDIATTPSDHP------------FGTLNTCEERLL  642

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L + E    F+R F     +TL+A T      +   H   +     D++W  +++  LV
Sbjct  643   NLPIGEE---FRRCFIYYACATLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVDQLV  699

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEV-  462
                  + Q  +    G ++FL L YV + +    +VP   P    W+   +  R   E+ 
Sbjct  700   EGIRRFKQGNSVWVHGCIIFLQLHYVMKFKIPSVHVPMTAPLLSAWSDELIKERLSAEIS  759

Query  461   DAGEFGYGQLEEPFSTSA  408
             + G FG+G   E F+ S+
Sbjct  760   EFGSFGHG---EAFAESS  774



>emb|CDM81972.1| unnamed protein product [Triticum aestivum]
Length=890

 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 48/210 (23%), Positives = 87/210 (41%), Gaps = 7/210 (3%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
              I +R     +  L    +  Q+     +GM  L+ +R   L   +  WL   + PA   
Sbjct  35    HIRSRASQERVTVLTDKFTGDQKGAAAEMGMQALMDVRCTNLVNPVCDWLGEIYQPASRE  94

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
               +     LR+ EE +   LG+P G +++     + +   L            N +  AL
Sbjct  95    FMIPGRGRLRLNEESMFCTLGVPRGHISVPYEVNNEIEEALFPRLFPGMESMPNTS--AL  152

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             A    ++   G  FK    + + S + A T +   + K   +  D++ +K+++WC ++  
Sbjct  153   ADSLQAMTTHGDVFKMKLLMYLISAVFAPTTSLRPSNKCFPILADLKNVKNMNWCKFIAD  212

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVD  558
              L   HD+++    +K  G  L L L YVD
Sbjct  213   FL---HDAFSSKMYQK--GCQLHLMLMYVD  237



>emb|CBI20523.3| unnamed protein product [Vitis vinifera]
Length=703

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/269 (23%), Positives = 111/269 (41%), Gaps = 26/269 (10%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  LS +++  +  +G GGL+ L  + L   L  W+V+N++     + 
Sbjct  23    KSRCSGKKFLSIIDTLSVEKKNVISGMGFGGLMQLGCRELRYDLLTWIVANYDIGYHRVC  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALAT  822
             +     + IT + V  VLG+P+  V +           ++  R    N   NI V     
Sbjct  83    MQTNVAVPITPQDVREVLGIPDQGVDI-----------VIHNRRATPNCTYNIKVLEDKL  131

Query  821   LALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD----LDWCGYL  654
               L +   G  F + F +   +T++A      + Q+ +H   D     D    ++W  +L
Sbjct  132   HDLPI---GDEFMKCFLIFACATILAPN----SKQEGMHDLWDTIWDSDVGVRINWAKFL  184

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L  L +    +         G LLFL LFY+ +       V   +P    WT   +  R 
Sbjct  185   LQYLEDGIRDYRNTHPTYIRGCLLFLQLFYMTKFYLMSFKVEVRSPLCAAWTDEHIKCRL  244

Query  473   QQEVDA-GEFGYGQLEE---PFSTSASRP  399
               E+   G +G+ Q+ E   P   + +RP
Sbjct  245   AAEIQTYGNYGHVQVLEQSNPHVRNDARP  273



>ref|XP_010644344.1| PREDICTED: uncharacterized protein LOC100852586 [Vitis vinifera]
 ref|XP_003634702.2| PREDICTED: uncharacterized protein LOC100852586 [Vitis vinifera]
 ref|XP_010644345.1| PREDICTED: uncharacterized protein LOC100852586 [Vitis vinifera]
 ref|XP_010644346.1| PREDICTED: uncharacterized protein LOC100852586 [Vitis vinifera]
Length=696

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/269 (23%), Positives = 110/269 (41%), Gaps = 26/269 (10%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  LS +++  +  +G GGL+ L  + L   L  W+V+N++     + 
Sbjct  23    KSRCSGKKFLSIIDTLSVEKKNVISGMGFGGLMQLGCRELRYDLLTWIVANYDIGYHRVC  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALAT  822
             +     + IT + V  VLG+P+  V +   +           R    N   NI V     
Sbjct  83    MQTNVAVPITPQDVREVLGIPDQGVDIVIHN-----------RRATPNCTYNIKVLEDKL  131

Query  821   LALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD----LDWCGYL  654
               L +   G  F + F +   +T++A      + Q+ +H   D     D    ++W  +L
Sbjct  132   HDLPI---GDEFMKCFLIFACATILAPN----SKQEGMHDLWDTIWDSDVGVRINWAKFL  184

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L  L +    +         G LLFL LFY+ +       V   +P    WT   +  R 
Sbjct  185   LQYLEDGIRDYRNTHPTYIRGCLLFLQLFYMTKFYLMSFKVEVRSPLCAAWTDEHIKCRL  244

Query  473   QQEVDA-GEFGYGQLEE---PFSTSASRP  399
               E+   G +G+ Q+ E   P   + +RP
Sbjct  245   AAEIQTYGNYGHVQVLEQSNPHVRNDARP  273



>ref|XP_008671132.1| PREDICTED: uncharacterized protein LOC103648438 [Zea mays]
Length=817

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 66/293 (23%), Positives = 122/293 (42%), Gaps = 25/293 (9%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINLLNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V  L    L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NVAVLQD-RLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  330

Query  497   K---RALDAREQQEVDAGEFGYGQLEEPFSTSA-----------SRPRCRSSV  381
             K   +AL   ++++V  G   +G  E   ST             S P CR+++
Sbjct  331   KNIIKALTKADKRKVRHGAESFGHCEFRSSTETCYAVGPKIDRQSEPECRTNI  383



>gb|EEE51994.1| hypothetical protein OsJ_33682 [Oryza sativa Japonica Group]
Length=805

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 13/216 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPL-RLGHWLVSNFNPAQMAIK  1002
             TR   + +V+    LST   + +  IG+  +    +++L    L  WL+   +P  M I 
Sbjct  77    TRCSAALVVQACRALSTVHHEKLEEIGLDAVAYKSLESLEQPDLIQWLMDRTDPDTMCIS  136

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMT------ERDTHMVGPDLLAWRCKVKNRKGNIT  840
             + + R + IT   V  VLG P G   +        R  H    D L       ++K  ++
Sbjct  137   IDDDRKIPITSRTVRLVLGTPLGGNDIVLPSHKVVRTVHESITDELGI-----HKKARLS  191

Query  839   VHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
                L  +  S K+      R+F +V+ S L+  T + Y  +  V +  D+  +  +DW  
Sbjct  192   TKQLIEVIKSQKDDSRAV-RYFIMVLMSKLLVPTTDVYVPKGDVWVASDLDRVAAIDWSK  250

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
              +  +L ++   W QN A      ++FL + Y+D +
Sbjct  251   AVFRALNDSIRCWCQNPASSIASCVIFLVVLYLDNI  286



>emb|CDM82590.1| unnamed protein product [Triticum aestivum]
Length=1070

 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 88/213 (41%), Gaps = 7/213 (3%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I  R     L  L+   +  Q+     +GM  L+ +R   L   +  WL   ++PA   
Sbjct  89    RIRNRASQERLTVLIDKFTDDQKGAAAEMGMQVLMDVRCTNLVNPVCDWLGEIYDPASRE  148

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
               +     L + EE V   LG+P G + +     + +  +L A          N +V  L
Sbjct  149   FVIPGRGRLPLNEESVFCTLGVPRGHIKVPYEVNNEIEEELFAHLFPGLEAMPNTSV--L  206

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             A     +   G  FK    + + S + A T +   + K   +  +++ +K ++WC ++  
Sbjct  207   ADSLQDMTTHGEVFKMKLLMYLISAVFAPTTSLRPSNKCFPILANLKNVKSMNWCKFIAD  266

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVE  549
              L   HD++     +K  G  L L L YVD ++
Sbjct  267   FL---HDAFKNKMYQK--GCRLHLMLMYVDSLD  294



>emb|CAN65830.1| hypothetical protein VITISV_038135 [Vitis vinifera]
Length=904

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/269 (23%), Positives = 110/269 (41%), Gaps = 26/269 (10%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  LS +++  +  +G GGL+ L  + L   L  W+V+N++     + 
Sbjct  23    KSRCSGKKFLSIIDTLSVEKKNVISGMGFGGLMQLGCRELRYDLLTWIVANYDIGYHRVC  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALAT  822
             +     + IT + V  VLG+P+  V +   +           R    N   NI V     
Sbjct  83    MQTNVAVPITPQDVREVLGIPDQGVDIVIHN-----------RRATPNCTYNIKVLEDKL  131

Query  821   LALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD----LDWCGYL  654
               L +   G  F + F +   +T++A      + Q+ +H   D     D    ++W  +L
Sbjct  132   HDLPI---GDEFMKCFLIFACATILAPN----SKQEGMHDLWDTIWDSDVGVRINWAKFL  184

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L  L +    +         G LLFL LFY+ +       V   +P    WT   +  R 
Sbjct  185   LQYLEDGIRDYRNTHPTYIRGCLLFLQLFYMTKFYLMSFKVEVRSPLCAAWTDEHIKCRL  244

Query  473   QQEVDA-GEFGYGQLEE---PFSTSASRP  399
               E+   G +G+ Q+ E   P   + +RP
Sbjct  245   AAEIQTYGNYGHVQVLEQSNPHVRNDARP  273



>ref|XP_008666669.1| PREDICTED: uncharacterized protein LOC103645388 [Zea mays]
Length=612

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/293 (23%), Positives = 121/293 (41%), Gaps = 25/293 (9%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P  ++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQYVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  330

Query  497   K---RALDAREQQEVDAGEFGYGQLEEPFSTSA-----------SRPRCRSSV  381
             K   +AL   ++++V  G   +G  E   ST             S P CR+++
Sbjct  331   KNSIKALTKADKRKVRHGAESFGHCEFRSSTETCYAVGPKIDRQSEPECRTNI  383



>ref|XP_008666079.1| PREDICTED: uncharacterized protein LOC103644692 [Zea mays]
Length=770

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/284 (23%), Positives = 120/284 (42%), Gaps = 22/284 (8%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFN  1023
             P  ++  R  P +++  +  L+ +Q++ +   G   +L +R+ AL  R  H  WL+   +
Sbjct  80    PRQKLNVRCNPQDVLVSIQILNDRQQQAIARRGFSSILDMRLDALGSR-SHLAWLMEKLD  138

Query  1022  PAQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGN  846
             P  M I+   G+ L+IT++ V  +LGLPN G  T    D  +V  +L   R ++   K +
Sbjct  139   PNDMTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVVANNL---RAELGLSKED  195

Query  845   ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDW  666
               V AL        +  +   R F +++ + L+  T +       V + + +     +DW
Sbjct  196   FGVTALQDRLRKGSDDDLSI-RCFFLILFNRLLFPTASWGITNHEVLLTEQMDRFHQIDW  254

Query  665   CGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPRANPA  513
             C  + + L      W      N +    G  + + L+Y+D +        +R  PR    
Sbjct  255   CQLIFNDLCQAAKKWHNRSVTNVSTTIYGCSIVILLYYLDHLHDSAAPLNKRGTPRIKYF  314

Query  512   AHGWTKRALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
                  + AL   ++ ++  GE  +G      S  +S   C + V
Sbjct  315   DRNIIQ-ALTRADKGKIRKGEEAFGHC----SFRSSSETCYTDV  353



>ref|XP_008660743.1| PREDICTED: uncharacterized protein LOC103639825 [Zea mays]
Length=753

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/284 (23%), Positives = 120/284 (42%), Gaps = 22/284 (8%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFN  1023
             P  ++  R  P +++  +  L+ +Q++ +   G   +L +R+ AL  R  H  WL+   +
Sbjct  93    PRQKLNVRCNPQDVLVSIQILNDRQQQAIARRGFSSILDMRLDALGSR-SHLAWLMEKLD  151

Query  1022  PAQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGN  846
             P  M I+   G+ L+IT++ V  +LGLPN G  T    D  +V  +L   R ++   K +
Sbjct  152   PNDMTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVVANNL---RAELGLSKED  208

Query  845   ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDW  666
               V AL        +  +   R F +++ + L+  T +       V + + +     +DW
Sbjct  209   FGVTALQDRLRKGSDDDLSI-RCFFLILFNRLLFPTASWGITNHEVLLTEQMDRFHQIDW  267

Query  665   CGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPRANPA  513
             C  + + L      W      N +    G  + + L+Y+D +        +R  PR    
Sbjct  268   CQLIFNDLCQAAKKWHNRSVTNVSTTIYGCSIVILLYYLDHLHDSAAPLNKRGTPRIKYF  327

Query  512   AHGWTKRALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
                  + AL   ++ ++  GE  +G      S  +S   C + V
Sbjct  328   DRNIIQ-ALTRADKGKIRKGEEAFGHC----SFRSSSETCYTDV  366



>ref|XP_002458283.1| hypothetical protein SORBIDRAFT_03g030645 [Sorghum bicolor]
 gb|EES03403.1| hypothetical protein SORBIDRAFT_03g030645 [Sorghum bicolor]
Length=977

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/262 (23%), Positives = 112/262 (43%), Gaps = 20/262 (8%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             +R   +    +++ LS K++  +   G G LL      +P +  +W V+    ++    +
Sbjct  54    SRFSATAFSNVISALSPKEKGVIERYGFGSLLLFNKCFVPNKFANW-VARLVDSKSGDII  112

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
               G+ + ++ E +  VLGLP G      R    V P   A +  V ++ G   +  ++  
Sbjct  113   REGKVISLSVESIHLVLGLPLG------RRAFPVDPS--AGKDVVLSKFGKDKIPPISFF  164

Query  818   ALSL--KEGGVWFKRHFC--VVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             A  L  KE         C  VV  S+ +    N   + K   +F+D+  IKD +WCG++L
Sbjct  165   ADKLIKKENLSDEDMFICFMVVALSSFLCPNTNIVPSPKYFGVFQDIDHIKDFNWCGFVL  224

Query  650   SSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
               L++   ++ +    +        G L +L + Y+D ++  +R V  + P    W    
Sbjct  225   DWLLDHIKAFNRGKNDRLKRCQGLGGCLYYLVVVYLDHIDFSQRQVDDSIPRISVWKHDM  284

Query  488   LDAREQQEVDA-GEFGYGQLEE  426
             +      ++ + G +GY  L E
Sbjct  285   IKFYSNLDLKSPGVYGYRPLIE  306



>emb|CDM82578.1| unnamed protein product [Triticum aestivum]
Length=1083

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 86/210 (41%), Gaps = 7/210 (3%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I  R     L  L+   S  Q+     +GM  L+ +R   L   +  WL   ++PA   
Sbjct  35    RIRNRASQERLTVLIDKFSDDQKGAAAEMGMQVLMDVRCTNLVNPVCDWLGEIYDPASRE  94

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
               +     L + EE V   LG+P G + +     +    +L A          N +V  L
Sbjct  95    FVIPGRGRLPLNEESVFCTLGVPRGHIKVPYEVNNETEEELFARLFPGLEAMSNTSV--L  152

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             A    ++   G  FK    + + S +   T +   + K   +  +++ +K+++WC ++  
Sbjct  153   ADSLQAMMTHGEVFKMKLLMYLISAIFVPTTSLRPSNKCFPILANLKNVKNMNWCKFIAD  212

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVD  558
              L   HD++     +K  G  L L L YVD
Sbjct  213   FL---HDAFKNKMYQK--GCRLHLMLMYVD  237



>gb|AAQ06290.1| hypothetical protein [Zea mays]
Length=872

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/289 (22%), Positives = 122/289 (42%), Gaps = 21/289 (7%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  330

Query  497   K---RALDAREQQEVDAGEFGYGQLEEP-------FSTSASRPRCRSSV  381
             K   +AL   ++++V  G   +G  E         +    ++P CR+++
Sbjct  331   KNSIKALTKADKRKVRHGAESFGHCENTKVDMDSYYFLLNNQPECRTNI  379



>gb|EMS53718.1| hypothetical protein TRIUR3_20643 [Triticum urartu]
Length=274

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/236 (24%), Positives = 101/236 (43%), Gaps = 15/236 (6%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGL-RVKALPLRLGHWLVSNFNPAQ  1014
             P   +R    ++  L+T  +  +R+ V+ IG GG+L L  +  L L+   W++S  +   
Sbjct  22    PTPTSRTSLQKVCALITTFNEFKRRLVVEIGFGGMLRLPAITRLNLKFSAWIMSMVDGPN  81

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVK-NRKGN-IT  840
               IKLS  R ++   E +  V G+P G++ +   +       +  +R  +  + KGN + 
Sbjct  82    RCIKLSQDRSIKFWPEDIHKVFGIPCGTIGIHSPEYQQAESSVQFFRSVLGFSDKGNQVL  141

Query  839   VHALATLALSLKEGGV------WFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMI  681
              +  A L   L E          FK  F +     ++A ST +  +         +   I
Sbjct  142   KNVEAVLMKDLSESTASNLEIDCFKMAFVIYSMGHILAPSTKHDVSVIDYWAAIANTDKI  201

Query  680   KDLDWCGYLLSSLVNTHDSWTQNTARKFP-----GPLLFLTLFYVDRVEAGERNVP  528
              D ++C Y+ + L+       Q+     P     G  LF  +FY+D ++ G  N+P
Sbjct  202   VDFNFCEYVFADLLAACWKVQQDIQNNRPVTHLMGCHLFFQIFYLDNLDLGMLNLP  257



>emb|CAH66455.1| OSIGBa0145N07.11 [Oryza sativa Indica Group]
Length=952

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 109/268 (41%), Gaps = 29/268 (11%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR        +L+ LS  Q+K + S G G LL     A+P +   W+ S  +     I L
Sbjct  90    TRFSVKYFCEVLSSLSEHQKKKIASYGFGSLLLFDSHAVPNKFASWIASKVDVTTSEIIL  149

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              + + + +T+  V AVL LP G +          G D    +  + ++ G +++ ++   
Sbjct  150   RD-KIIPVTKHSVHAVLDLPIGGLEF--------GRDRERGKQFILSKFGQLSIPSVKYF  200

Query  818   ALSLKEGGVWFKRH----FCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                  +  V         F +V  +  +    +   + K + +F+DV  ++  DW  ++ 
Sbjct  201   GDQFIQKKVMSDEDVIISFLIVALACFLCPNSSLTPSTKYLTIFEDVDSLRSYDWSKFVY  260

Query  650   SSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
                      W   + +KF       G      + Y+D V+ GER + ++ P    W K  
Sbjct  261   --------DWLMYSVKKFKKRKSLGGCFYLWAVQYLDCVDFGERYIDQSIPRIAVWKKGM  312

Query  488   LDA-REQQEVDAGEFGYGQLEEPFSTSA  408
             +    +  ++D   FG   +++ FST+ 
Sbjct  313   ITTFSDLDKIDENTFGLRHVKD-FSTTC  339



>gb|AAQ06288.1| hypothetical protein [Zea mays]
Length=872

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/289 (22%), Positives = 122/289 (42%), Gaps = 21/289 (7%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  330

Query  497   K---RALDAREQQEVDAGEFGYGQLEEP-------FSTSASRPRCRSSV  381
             K   +AL   ++++V  G   +G  E         +    ++P CR+++
Sbjct  331   KNSIKALTKADKRKVRHGAESFGHCENTKVDMDSYYFLLNNQPECRTNI  379



>ref|XP_008646992.1| PREDICTED: uncharacterized protein LOC103628599 [Zea mays]
Length=876

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 120/294 (41%), Gaps = 27/294 (9%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNHLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVEAG-----ERNVPRANPAA  510
               + + L      W    T N +    G  + + L+Y+D +        +   PR N   
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRINFFD  330

Query  509   HGWTKRALDAREQQEVDAGEFGYGQLEEPFSTSA-----------SRPRCRSSV  381
                 K AL   ++++V  G   +   E   ST             S P CR+++
Sbjct  331   KNSIK-ALTKADKRKVRHGAESFRHCEFRSSTETCYAVGPKIDRQSEPECRTNI  383



>ref|XP_011027068.1| PREDICTED: uncharacterized protein LOC105127453 [Populus euphratica]
Length=553

 Score = 63.5 bits (153),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 108/226 (48%), Gaps = 27/226 (12%)
 Frame = -2

Query  1124  QRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLG  945
             Q + V ++G+ GLL ++ +    ++   L + F+     +++  GR L++T   V  +LG
Sbjct  153   QIQAVNALGLAGLLHIKKQKRKFQVIEDLAARFDIQSCELEVHGGR-LKLTPGKVEWLLG  211

Query  944   LPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA------LATLALSLKEGGVWFK  783
             LP+  +++ +     +G D      ++    G+  +HA      LA++  S +     F+
Sbjct  212   LPSSGLSVEQ----FIGND---EDVRMMYNLGSDRIHAGQLGDSLASIPASPE-----FQ  259

Query  782   RHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQ----  615
               F +   ST++  + + Y +     + K++ ++  L+W  Y L  LV+    + +    
Sbjct  260   AKFLLYAISTVIRPSTSVYVSPSCFGILKNLSIVCALNWAKYALEGLVSGIKKYRETDFV  319

Query  614   -NTARKFPGPLLFLTLFYVDRVEAGERNVPRAN---PAAHGWTKRA  489
              + A++  G LL L +FY++ V  G+  +PRA+   P    W + A
Sbjct  320   PSKAKRLTGCLLILEIFYLEHVNVGQIKIPRASGLAPRICDWDEDA  365



>gb|AAQ06285.1| hypothetical protein [Zea mays]
Length=895

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 67/292 (23%), Positives = 127/292 (43%), Gaps = 26/292 (9%)
 Frame = -2

Query  1199  SPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFN  1023
             +P  ++  R  P +++  +  L+ +QR+ V   G   +L + + AL  R    WL+   +
Sbjct  101   TPRQKLNVRCNPQDVIITIKILNERQRQAVARKGFSNILDMTLDALGSRSHLRWLMDKLD  160

Query  1022  PAQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGN  846
                M I+   G+ L+IT+E V  +LGLPN G       D  + G +L   R ++   K  
Sbjct  161   HKDMTIRPGVGKELKITKETVHLILGLPNAGGGKPLGIDEAVAGNNL---RAELGLSKDE  217

Query  845   ITVHALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL  672
               V   A+L   L++G       R F +++ + L+  T +   +   V + +++    ++
Sbjct  218   FVV---ASLQDRLRKGNDDDLSIRCFFLILFNRLLFPTSSWGISNHEVLLTEEMDRFHEI  274

Query  671   DWCGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPRAN  519
             DWC  + + L      W    T N +    G  + + L+Y+D +        +R  PR  
Sbjct  275   DWCHLIYNDLCEAAQKWHTRSTSNVSTTIYGCSVVILLYYLDHLHDAAAPPNKRGTPRIK  334

Query  518   PAAHGWTKRALDAREQQEVDAGE-FGYGQLEEPFSTSASRPRCRSSVEQTRY  366
                    +    A +++   +GE FG+ +    FS +     C S+V   ++
Sbjct  335   FFDKNIIQALTKADKRKPRQSGEPFGHCEFRS-FSET-----CYSAVPSVQF  380



>ref|XP_008676407.1| PREDICTED: uncharacterized protein LOC103652651 [Zea mays]
Length=482

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 63/281 (22%), Positives = 119/281 (42%), Gaps = 22/281 (8%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFNPAQ  1014
             ++  R  P +++  +  L+ +Q++ +   G   +L +R+ AL  R  H  WL+   +P  
Sbjct  84    KLNVRCNPQDVLVSIQILNDRQQQAIARRGFSSILDMRLDALGSR-SHLAWLMEKLDPND  142

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
             M I+   G+ L+IT++ V  +LGLPN G  T    D  +V  +L   R ++   K +  V
Sbjct  143   MTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVVANNL---RAELGLSKEDFGV  199

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
              AL        +  +   R F +++ + L+  T +       V + + +     +DWC  
Sbjct  200   TALQDRLRKGSDDDLSI-RCFFLILFNRLLFPTASWGITNHEVLLTEQMDRFHQIDWCQL  258

Query  656   LLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPRANPAAHG  504
             + + L      W      N +    G  + + L+Y+D +        +R  PR       
Sbjct  259   IFNDLCQAAKKWHNRSVTNVSTTIYGCSIVILLYYLDHLHDSAAPLNKRGTPRIKYFDRN  318

Query  503   WTKRALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
               + AL   ++ ++  GE  +G      S  +S   C + V
Sbjct  319   IIQ-ALTRADKGKIRKGEEAFGHC----SFRSSSETCYTDV  354



>emb|CAN75116.1| hypothetical protein VITISV_002419 [Vitis vinifera]
Length=1757

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/232 (24%), Positives = 94/232 (41%), Gaps = 17/232 (7%)
 Frame = -2

Query  1124  QRKDVI-SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVL  948
             ++ DV+  +  GGLL L  K +   L  WL+++FN     I++++     +T   V  V 
Sbjct  680   EKLDVVRDLQFGGLLHLNCKEIRHNLCTWLIAHFNVGYKRIEITSHIRYDLTAADVGLVF  739

Query  947   GLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCV  768
             GLP     +    T    P             G +       L L + E    F+R F  
Sbjct  740   GLPTTGRILDIATTPSDHP------------FGTLNTCEERLLNLPIGEE---FRRCFIY  784

Query  767   VVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGP  588
                +TL+A T      +   H   +     D++W  +++  LV     + Q  +    G 
Sbjct  785   YACATLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVDQLVEGIRRFKQGNSVWVHGC  844

Query  587   LLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEV-DAGEFGYGQ  435
             ++FL L YV + +    +VP   P    W+   +  R   E+ + G FG+G+
Sbjct  845   IIFLQLHYVMKFKIPSVHVPMTAPLLSAWSDELIKERLSAEISEFGSFGHGE  896



>ref|XP_010658796.1| PREDICTED: uncharacterized protein LOC104881203 [Vitis vinifera]
Length=186

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (49%), Gaps = 5/127 (4%)
 Frame = -2

Query  806  KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHD  627
            KE G  FK  F + V   L+  T+  + N+  +H+ +D+  IK ++W  ++LS LV+  +
Sbjct  10   KESGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDIDSIKKMNWAEFVLSYLVHGIE  69

Query  626  SWTQNTARKFPGPLLFLTLFYVDRVEAGERNVP---RANPAAHGWTKRALDAREQQEVDA  456
             + +       G LLFL LFY + +   E+ +P   R +P    W    +  R+Q+    
Sbjct  70   EFKKKQQSGVCGCLLFLMLFYHEHISFEEKFLPLYTRPSPRITAWGDDEVLDRKQRLKKL  129

Query  455  GEFGYGQ  435
            G  GY  
Sbjct  130  G--GYAN  134



>gb|AAX95440.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABA92777.1| hypothetical protein LOC_Os11g19030 [Oryza sativa Japonica Group]
Length=1243

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 93/216 (43%), Gaps = 13/216 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPL-RLGHWLVSNFNPAQMAIK  1002
             TR   + +V+    LST   + +  IG+  +    +++L    L  WL+   +P  M I 
Sbjct  77    TRCSAALVVQACRALSTVHHEKLEEIGLDAVAYKSLESLEQPDLIQWLMDRTDPDTMCIS  136

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMT------ERDTHMVGPDLLAWRCKVKNRKGNIT  840
             + + R + IT   V  VLG P G   +        R  H    D L       ++K  ++
Sbjct  137   IDDDRKIPITSRTVRLVLGTPLGGNDIVLPSHKVVRTVHESITDELG-----IHKKARLS  191

Query  839   VHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
                L  +  S K+      R+F +V+ S L+  T + Y  +  V +  D+  +  +DW  
Sbjct  192   TKQLIEVIKSQKDDSRAV-RYFIMVLMSKLLVPTTDVYVPKGDVWVASDLDRVAAIDWSK  250

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
              +  +L ++   W QN A      ++FL + Y+D +
Sbjct  251   AVFRALNDSIRCWCQNPASSIASCVIFLVVLYLDNI  286



>ref|XP_008650444.1| PREDICTED: uncharacterized protein LOC103631282 [Zea mays]
Length=356

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 61/270 (23%), Positives = 113/270 (42%), Gaps = 17/270 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFNPAQ  1014
             ++  R  P +++  +  L+ +QR+ +   G   +L +R+  L  R  H  WL+   +   
Sbjct  85    RLNVRCNPQDVLVSIQILNDRQRQAIARRGFSSILDMRLDVLGSR-SHLAWLMEKLDHND  143

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
             M I+   G+ L+IT++ V  +LGLPN G  T    D  +   +L   R ++   K +  V
Sbjct  144   MTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVAANNL---RAELGLSKEDFGV  200

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
              AL  L     +  +     F ++    L  +      N + V + +++     +DWC  
Sbjct  201   AALQDLLRKGSDDDLSITSFFLILFNRLLFPTASWGITNHE-VLLTEEMDRFHQMDWCQL  259

Query  656   LLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV-EAGERNVPRANPAAHGWTKR  492
             + + L      W      N +    G  + + L+Y+D + +A      R  P    + + 
Sbjct  260   IFNDLCQATKKWHTRSVTNVSTTIYGCSIVILLYYLDHLHDAAAPQNKRGTPRIKYFDRN  319

Query  491   ALDAREQQEVDAGEFGYGQLEEPFSTSASR  402
              + A  +   D G+   G  EEPF   + R
Sbjct  320   IIQALTR--ADKGKIRKG--EEPFGHCSFR  345



>dbj|BAD61116.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD61338.1| hypothetical protein [Oryza sativa Japonica Group]
Length=764

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 122/292 (42%), Gaps = 31/292 (11%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             +R  PS +  ++   S ++++ V  +G  GLL + +        +WL+S  +P + AI+L
Sbjct  44    SRCVPSSITPIIQRFSAEKKELVAEMGFEGLLHMPLITNHRDFSYWLLSRVSPTRSAIEL  103

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKG-NITV---  837
              +G  L ++ E V  VLG+P     +   +   V     L+A R KV + K  N  V   
Sbjct  104   ESGEVLPLSPEDVKKVLGIPCVGEELQAPNVEFVSHVKRLIAERMKVASFKDVNKEVLED  163

Query  836   ----HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK---DVRMIK  678
                 H    ++ + KE    FK  F ++V    +A   N   + K    F    D   I 
Sbjct  164   VLDKHHRGQMSKAEKES---FKTAFLMLVMMKFLAPQSN--MDNKCPRYFSALLDPNEIA  218

Query  677   DLDWCGYLLSSLVNTHDSWTQNTAR-----KFPGPLLFLTLFYVDRVEAG-----ERNV-  531
               +W GY+L+ +++   +  +  A         G  ++L + Y+D V+ G     E N+ 
Sbjct  219   KFNWSGYVLNEILDAAATVQKKHADGTKCGYITGCSIYLQVHYLDNVDFGGDLNLEHNIF  278

Query  530   PRANPAAHGWTKR--ALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
             PR         K    LD  E+    A +FG  +L         R   R+SV
Sbjct  279   PRIALYDRDTIKERYQLDISERNYYQATQFGKLKLRPKNEVCYKRTCERTSV  330



>ref|NP_001042045.2| Os01g0152500 [Oryza sativa Japonica Group]
 dbj|BAF03959.2| Os01g0152500 [Oryza sativa Japonica Group]
Length=856

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 122/292 (42%), Gaps = 31/292 (11%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             +R  PS +  ++   S ++++ V  +G  GLL + +        +WL+S  +P + AI+L
Sbjct  44    SRCVPSSITPIIQRFSAEKKELVAEMGFEGLLHMPLITNHRDFSYWLLSRVSPTRSAIEL  103

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVG--PDLLAWRCKVKNRKG-NITV---  837
              +G  L ++ E V  VLG+P     +   +   V     L+A R KV + K  N  V   
Sbjct  104   ESGEVLPLSPEDVKKVLGIPCVGEELQAPNVEFVSHVKRLIAERMKVASFKDVNKEVLED  163

Query  836   ----HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK---DVRMIK  678
                 H    ++ + KE    FK  F ++V    +A   N   + K    F    D   I 
Sbjct  164   VLDKHHRGQMSKAEKES---FKTAFLMLVMMKFLAPQSN--MDNKCPRYFSALLDPNEIA  218

Query  677   DLDWCGYLLSSLVNTHDSWTQNTAR-----KFPGPLLFLTLFYVDRVEAG-----ERNV-  531
               +W GY+L+ +++   +  +  A         G  ++L + Y+D V+ G     E N+ 
Sbjct  219   KFNWSGYVLNEILDAAATVQKKHADGTKCGYITGCSIYLQVHYLDNVDFGGDLNLEHNIF  278

Query  530   PRANPAAHGWTKR--ALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
             PR         K    LD  E+    A +FG  +L         R   R+SV
Sbjct  279   PRIALYDRDTIKERYQLDISERNYYQATQFGKLKLRPKNEVCYKRTCERTSV  330



>gb|EEC80327.1| hypothetical protein OsI_22377 [Oryza sativa Indica Group]
Length=880

 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 99/234 (42%), Gaps = 15/234 (6%)
 Frame = -2

Query  1130  TKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAV  951
             ++ ++ +   G  GL+ L+   L   L  WL+ +FNPA   +       + + EE V +V
Sbjct  96    SRSKRLIEGAGFHGLVDLKCSKLRPDLCSWLMEHFNPATNQLVFPGRGAIDVNEESVKSV  155

Query  950   LGLPNG----SVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFK  783
             LG+P G    S  M    T  V  +LL       N   + ++ +L      LK     + 
Sbjct  156   LGIPMGDKDVSYDMESEATEFV-LNLLGI-----NDGISPSLTSLGIQLEKLKLADDKYL  209

Query  782   RHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTAR  603
             R + +   S+++A T  +  + +      D   IK+L+WC +++S L     +     + 
Sbjct  210   RMWIIYAISSVLAPTTATTVSPRCYPSVVDAGNIKNLNWCKFVISILQKAAKAGKNTNS-  268

Query  602   KFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDA-GEFG  444
                  LL++ + Y+D +     NVP     A  WT   ++     +  A G FG
Sbjct  269   ---SCLLYMMILYLDSLSFKNLNVPVEGYRATVWTNELINQTILADTSADGSFG  319



>gb|EMT15184.1| hypothetical protein F775_03449 [Aegilops tauschii]
Length=257

 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/205 (25%), Positives = 87/205 (42%), Gaps = 7/205 (3%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
              R     L     G + +Q+     +GM  L+ +R K L   +  WL   ++PA     +
Sbjct  38    NRASQERLTIFTEGFTDEQKGAAGEMGMQALMDVRCKNLVNPICDWLGEIYDPASREFVI  97

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
                  L + EE V   LG+P G + +     + +   L A          N TV  LAT 
Sbjct  98    PGRGRLPLDEESVFCTLGVPRGEIKVPYEVNNKIEEALFARLFPGMASMPNTTV--LATS  155

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
                +K  G  FK    + + S + A T +   + K   +   ++ +K+++WC ++   L 
Sbjct  156   LEGMKTHGEVFKMKLLMYLISPVFAPTTSLRPSNKCFPILVKLKDVKNMNWCKFIAVFL-  214

Query  638   NTHDSWTQNTARKFPGPLLFLTLFY  564
               HD+++ N  RK  G  L L +F+
Sbjct  215   --HDAFSNNMYRK--GCRLHLMVFF  235



>emb|CAN80921.1| hypothetical protein VITISV_005310 [Vitis vinifera]
Length=1234

 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 101/252 (40%), Gaps = 16/252 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++E       L+  L  L T++   V  +  GGLL L  K +   +  WL+++FN     
Sbjct  404   KVEAYNNHFILLWPLRRLPTEKLDVVRDLQFGGLLHLNCKEIRHNICIWLIAHFNVGFRR  463

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I +++ +   +T   V  + GL     + T R  H+             +  G +     
Sbjct  464   IDITSHKRYDLTAADVGLIFGL-----STTGRILHIATT-------PSDHPFGTLNTCEE  511

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
               L L + E    F+R F     +TL+A T      +   H   +     D++W  +++ 
Sbjct  512   RLLNLPIGEE---FRRCFIYYTCATLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVD  568

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQ  468
              LV     + Q       G +LFL L YV + +    +VP   P    W+   +  R   
Sbjct  569   QLVEGIRRFKQGNNVWVHGCILFLQLHYVIKFKIPSIHVPMTAPLLSAWSDELIKERLSA  628

Query  467   EV-DAGEFGYGQ  435
             E+ + G FG+GQ
Sbjct  629   EISEFGSFGHGQ  640



>gb|EEC78496.1| hypothetical protein OsI_18409 [Oryza sativa Indica Group]
Length=925

 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 109/268 (41%), Gaps = 29/268 (11%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR        +L+ LS  Q+K + S G G LL     A+P +   W+ S  +     I L
Sbjct  89    TRFSVKYFCEVLSSLSEHQKKKIASYGFGSLLLFDSHAVPNKFASWIASKVDVTTSEIIL  148

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
              + + + +T+  V AVL LP G +          G D    +  + ++ G +++ ++   
Sbjct  149   RD-KIIPVTKHSVHAVLDLPIGGLEF--------GRDRERGKQFILSKFGQLSIPSVKYF  199

Query  818   ALSLKEGGVWFKR----HFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                  +  V         F +V  +  +    +   + K + +F+DV  ++  DW  ++ 
Sbjct  200   GDQFIQKKVMSDEDVIISFLIVALACFLCPNSSLTPSTKYLTIFEDVDSLRSYDWSKFVY  259

Query  650   SSLVNTHDSWTQNTARKFP------GPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRA  489
                      W   + +KF       G      + Y+D V+ GER + ++ P    W K  
Sbjct  260   --------DWLMYSVKKFKKRKSLGGCFYLWAVQYLDCVDFGERYIDQSIPRIAVWKKGM  311

Query  488   LDA-REQQEVDAGEFGYGQLEEPFSTSA  408
             +    +  ++D   FG   +++ FST+ 
Sbjct  312   ITTFSDLDKIDENTFGLRPVKD-FSTTC  338



>ref|XP_008675696.1| PREDICTED: uncharacterized protein LOC103651774 [Zea mays]
Length=376

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 61/268 (23%), Positives = 114/268 (43%), Gaps = 14/268 (5%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P  M
Sbjct  95    RLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDPKDM  154

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K    V 
Sbjct  155   TIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEFNV-  210

Query  833   ALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
             A     L   E      R F +++ + L+  T +       V + +++    ++DWC  +
Sbjct  211   AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWCQLI  270

Query  653   LSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWTK--  495
              + L      W    T N +    G  + + L+Y+D +  A   +     P    + K  
Sbjct  271   FNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFDKNS  330

Query  494   -RALDAREQQEVDAGEFGYGQLEEPFST  414
              +AL   ++++V  G   +G  E   ST
Sbjct  331   IKALTKADKRKVRHGAESFGHCEFRSST  358



>ref|XP_008650342.1| PREDICTED: uncharacterized protein LOC103631125 [Zea mays]
Length=651

 Score = 62.4 bits (150),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 86/196 (44%), Gaps = 4/196 (2%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G G LL  +   L  +L  WL+   NP  M +++ 
Sbjct  263   RCSPGKFIKLVNALSDELKSEVVAKGFGSLLRFKPHLLSRKLLSWLMRKLNPETMKLEIG  322

Query  995   NGRFLRITEEGVAAVLGLPN-GS--VTMTERDTHMVGPDLLAWRC-KVKNRKGNITVHAL  828
              G+ + ITE  V  VL LPN GS    M++ D   +  +L    C K   R   I +  +
Sbjct  323   GGKEIPITEHIVWCVLQLPNVGSDPPPMSDADARALRDELGEQICGKSYRRISGINISVI  382

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                       G    R F +     L+ S  ++      V   +D++ + + +WC  ++ 
Sbjct  383   TDKLQKRILTGELGLRAFFMAAFQCLLFSNTDTRIRIDDVKYTQDIQNMGNKNWCKVVVD  442

Query  647   SLVNTHDSWTQNTARK  600
              L      + ++ A K
Sbjct  443   RLSIAARLYRKDFAEK  458



>emb|CAE02207.2| OSJNBa0095H06.14 [Oryza sativa Japonica Group]
Length=519

 Score = 62.0 bits (149),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 52/241 (22%), Positives = 111/241 (46%), Gaps = 22/241 (9%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             +I TR  P+ L  L +    +Q++ V  +G  GLL +R+  L  + G W++   +P+   
Sbjct  73    KIYTRCTPAILSDLFSSFGDQQKELVKQMGFDGLLSMRLTKLNKQFGAWILCKLDPSSGN  132

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKGNITVH  834
             +   +   + +T E V+ +LG+P G   +     + V  D+ A+  ++  K+    +T+ 
Sbjct  133   LFTGSRHEICLTCEDVSLLLGIPCGRKEILPAIKNEVK-DVKAYMYEIFEKDSFDGLTIV  191

Query  833   ALATL-------ALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMIK  678
              +  +        +++ E  V FK  F + V +  +A  ++N++ + + +    DV  I 
Sbjct  192   TIQRILEKKFNRTMTVHEQIV-FKTAFIIFVVTKFLAPQSVNNHISIRYMKALVDVENIH  250

Query  677   DLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFYVDRVEAG-----ERNVP  528
               +W  ++L  + +      H    + +     G ++   LFY+D ++ G     + N+P
Sbjct  251   KYNWAEFVLHDIKDAAAALQHKIRHRKSIGYINGCIILPQLFYLDNLDFGTDTPEQENIP  310

Query  527   R  525
             R
Sbjct  311   R  311



>ref|XP_007203306.1| hypothetical protein PRUPE_ppa025878mg, partial [Prunus persica]
 gb|EMJ04505.1| hypothetical protein PRUPE_ppa025878mg, partial [Prunus persica]
Length=219

 Score = 59.7 bits (143),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/207 (23%), Positives = 95/207 (46%), Gaps = 16/207 (8%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR  P ++  ++  L+ +++  +  +G   LL ++   L   +  +LV   NP++ +
Sbjct  25    KMATRCSPKDVNDIINVLTDEKKAAIQEMGFVSLLEMKCGKLSHSMCRFLVDKLNPSESS  84

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I L +G+ L+I+ +    ++ + +G   +  R++ +VG  LL      KN       + L
Sbjct  85    IVL-HGKTLKISVDDFICIMDVKDGGEEV--RNSFLVGKKLL------KN-------NEL  128

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
               + +  +E G +FK  F +    TL+  T + Y N K +   +D + I   +W  Y   
Sbjct  129   KQIMVGTEEVGEFFKVGFAMFALCTLLCPTTSVYVNLKYLLPLRDSKTISRKNWASYSFK  188

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLF  567
              L++   S+ +N      G L     F
Sbjct  189   FLLHNIRSFKENNQVYIGGCLFSFNCF  215



>ref|XP_009371811.1| PREDICTED: uncharacterized protein LOC103961030 [Pyrus x bretschneideri]
Length=422

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 67/157 (43%), Gaps = 10/157 (6%)
 Frame = -2

Query  803  EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDS  624
            E G  FKR F +    TL++ T     +   +H   ++ ++   +W  +LL  LV     
Sbjct  46   EAGEEFKRSFVLYALGTLLSPTARLDVSPSFLHFLTNMDVVHQYNWGKFLLDRLVCEVSR  105

Query  623  WTQNTARKFPGPLLFLTLFYVDRVEAGERN--VPRANPAAHGWTKRALDAREQQEVDAGE  450
            + Q   R   G LLFL LFY + +   E     P   P+   W +  +  RE++E + G 
Sbjct  106  FHQGKQRAVGGCLLFLQLFYYESISVEENGALAPALVPSLSSWGEDEITEREKRERELGG  165

Query  449  FGYGQLEEPFSTSASRPRCRSSVEQTRYGRADSRPQP  339
            +G G++         + RC         G+ D RP P
Sbjct  166  YGCGEV-------VCKERCLDLDSCEFMGQLD-RPPP  194



>ref|XP_010664984.1| PREDICTED: uncharacterized protein LOC104882626 [Vitis vinifera]
 ref|XP_010664992.1| PREDICTED: uncharacterized protein LOC104882626 [Vitis vinifera]
 ref|XP_010664995.1| PREDICTED: uncharacterized protein LOC104882626 [Vitis vinifera]
 ref|XP_010664999.1| PREDICTED: uncharacterized protein LOC104882626 [Vitis vinifera]
Length=452

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/266 (21%), Positives = 114/266 (43%), Gaps = 29/266 (11%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L   ++  +  +G  GLL L  K L   L  W+V+N++     + 
Sbjct  23    KSRCSRKKFLSIMDTLPMDKKNAISDMGFRGLLQLGYKELRYELITWIVANYDIGYHHLC  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNIT-VHALA  825
             ++    + +T + V  VLG+P+             G D+L +     NR+G     + + 
Sbjct  83    MATRVVVPVTPKDVREVLGIPDN------------GVDILIY-----NRRGTPNRTYDIK  125

Query  824   TLALSLKE--GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL----DWC  663
              L  +L++   G  F + F +   +T++A      + Q+ +H   D     ++    +W 
Sbjct  126   ILEANLRDLPVGEEFMKSFLIFACATILAPN----SKQEGMHDLWDTVWDSEVGVRKNWA  181

Query  662   GYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              ++L  + +    +  +      G +LFL LFY+ +       V   +P +  WT   + 
Sbjct  182   KFVLQYVEDGIRDYRTSHPTYIRGCVLFLQLFYISKFYMTTFQVEVCSPLSAAWTDEQVK  241

Query  482   AREQQEVDA-GEFGYGQLEEPFSTSA  408
              R   E+   G +G+ Q+ +  + SA
Sbjct  242   RRLAAEIHTYGNYGHVQVIQGSTPSA  267



>ref|XP_008671734.1| PREDICTED: uncharacterized protein LOC103649186 [Zea mays]
Length=379

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/271 (23%), Positives = 115/271 (42%), Gaps = 14/271 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  330

Query  497   K---RALDAREQQEVDAGEFGYGQLEEPFST  414
             K   +AL   ++++V  G   +G  E   ST
Sbjct  331   KNSIKALTKADKRKVRHGAESFGHCEFRSST  361



>ref|XP_008679344.1| PREDICTED: uncharacterized protein LOC103654289 [Zea mays]
Length=319

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 97/224 (43%), Gaps = 10/224 (4%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSTILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+ S G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPSPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V  L    L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NVTFLQD-RLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVEAG  543
               + + L      W    T N +    G  + + L+Y+D +   
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTA  314



>ref|XP_002454247.1| hypothetical protein SORBIDRAFT_04g027467 [Sorghum bicolor]
 gb|EES07223.1| hypothetical protein SORBIDRAFT_04g027467 [Sorghum bicolor]
Length=946

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/248 (23%), Positives = 108/248 (44%), Gaps = 18/248 (7%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVI-SIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             TR   S+   ++  LS + +KDVI S G G LL      +P +   WL S        + 
Sbjct  56    TRQSVSKFASVIGSLS-EDKKDVIRSHGFGSLLLFNKCFVPKKFSKWLASVVESKSGDL-  113

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRC-KVKNRKGNITVHALA  825
             + +G+ + +T + V  VLG+P G         +  G  ++  +  K    + +   + L+
Sbjct  114   IIHGKVISLTPQTVNLVLGIPLGGTPFPS--NYSTGRAVVLSKFDKTSLPQISFFANKLS  171

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              + LS +E  + F     VV     +    N   + + + +F+D+  I   DWCG++L  
Sbjct  172   EVDLSDEEVLICF----LVVSLHCFLCPNSNIVPSPRYLGVFEDIEKISSYDWCGFVLRW  227

Query  644   LVNTHDSWTQN------TARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
             +++   S+ Q       +     G + +L + Y+D V+   R +P + P    W    + 
Sbjct  228   MLDGVKSFNQGKKAGQRSCGTLGGCMFYLAVMYLDHVDFSHRRIPDSFPRIEVWKLNMI-  286

Query  482   AREQQEVD  459
              R+  ++D
Sbjct  287   -RDYSDLD  293



>ref|XP_008650472.1| PREDICTED: uncharacterized protein LOC103631312 [Zea mays]
Length=627

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 111/267 (42%), Gaps = 16/267 (6%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLMFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVEA-----GERNVPRANPAA  510
               + + L      W    T N +    G  + + L+Y+D +        +   PR     
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTTAAPHNKSGTPRIKFFD  330

Query  509   HGWTKRALDAREQQEVDAGEFGYGQLE  429
                 K AL   ++++V  G   +G  E
Sbjct  331   KNSIK-ALTKADKRKVRHGAESFGHCE  356



>ref|NP_001142489.1| uncharacterized protein LOC100274716 [Zea mays]
 gb|ACG24341.1| hypothetical protein [Zea mays]
Length=860

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/252 (23%), Positives = 110/252 (44%), Gaps = 14/252 (6%)
 Frame = -2

Query  1283  GTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVIS  1104
             G D DD  P   +   +L  T+ +    +   ++  R  P +++  +  ++ +QR+ V+ 
Sbjct  65    GDDNDDFMPPKKKSNAKLSVTKKMKVEDTRRQRLNIRCNPQDVLVCIQIMNERQRQAVVR  124

Query  1103  IGMGGLLGLRVKALPLRLG-HWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPN-GS  930
              G   +L + + AL  R    WL+   +P  M +++  G+ L+IT+E V  +LGLPN G 
Sbjct  125   KGFFSILDMTIDALGSRTHLCWLMEKLDPKDMTLRIGPGKELKITKETVHLILGLPNTGG  184

Query  929   VTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGG--VWFKRHFCVVVAS  756
                   D      +L +     K+  G      +A L   L+ GG      R F +++ +
Sbjct  185   GKPLNIDEVNAAVNLRSSLGISKDEFG------VAKLQERLRLGGDDDLSIRCFFLILFN  238

Query  755   TLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSW----TQNTARKFPGP  588
              L+  T +   +   V + + +     +DWC  + + L      W    T N +    G 
Sbjct  239   RLLFPTASWSISNNEVLLTEQLDRFPHIDWCHLIFNDLCEAAHKWHNKSTTNVSATIYGC  298

Query  587   LLFLTLFYVDRV  552
              + + ++Y+D +
Sbjct  299   SIVVLVYYLDHL  310



>ref|XP_007203250.1| hypothetical protein PRUPE_ppa019521mg, partial [Prunus persica]
 gb|EMJ04449.1| hypothetical protein PRUPE_ppa019521mg, partial [Prunus persica]
Length=376

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/250 (26%), Positives = 102/250 (41%), Gaps = 17/250 (7%)
 Frame = -2

Query  1214  VHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLV  1035
             V+D ++    I TR  P    R +  LS ++R  + +IG G +  L    L  +L H+L+
Sbjct  31    VNDSVNEMSWI-TRCSPDRFHRTVEKLSEEKRLAIKAIGFGNVSSLSCTRLHRQLCHFLI  89

Query  1034  SNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCK----  867
               FNP   +I+L +G  +RI+ +    V+GL N     T  D  +   D L    K    
Sbjct  90    QKFNPDMSSIEL-HGNVIRISADEFGRVMGLKN-----TGEDVQL---DRLVEDEKVKQL  140

Query  866   VKNRKGN---ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFK  696
             VK+  GN   + V  LA      +     FK  F +    T++  T +     K +    
Sbjct  141   VKSFGGNGKRVLVKGLAEQLEKCENANEDFKVRFVMFALGTILCPTSSPSVTGKYLTFLT  200

Query  695   DVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
               R I+  +W  +  + L     S+         G LLFL L Y D +  G   V ++  
Sbjct  201   IPRKIETKNWADHGFNFLCEGVRSFKAKKVAYVNGSLLFLQLLYFDSIFHGGVYVDKSLD  260

Query  515   AAHGWTKRAL  486
                 W   ++
Sbjct  261   PIMSWDNNSV  270



>emb|CAN63811.1| hypothetical protein VITISV_016710 [Vitis vinifera]
Length=1126

 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 104/263 (40%), Gaps = 24/263 (9%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L  ++ + +  +G GGLL    + L   L  WL+S ++     +K
Sbjct  541   KSRCSXXKFIXVIARLPPEKHQAIXDMGFGGLLTFACRXLRYELCGWLISQYDFTYHRLK  600

Query  1001  LSNGRF--LRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             ++ G    + + E+ V+ V+ +PN             G DL+     VK    +  ++ L
Sbjct  601   MATGSAVNVNVNEQHVSQVMXIPNS------------GEDLVI----VKRTGPSNRIYTL  644

Query  827   ATLALSLKEGGVW--FKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
               L  +L    V   F + F +   +TL+A       +        D  +    +W  +L
Sbjct  645   RVLEQNLDNLPVGDDFLKSFLIFSCATLLAPNSKLEGSHDLWDTIWDSNLGVQRNWAKFL  704

Query  653   LSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
             L  L +    + Q       G L+FL LFY+         V    P A  W+   +  R 
Sbjct  705   LQHLEDDIREYRQKQPTYIRGCLMFLQLFYMXFFYMPSVIVEVTXPLAAAWSDDVIKRRL  764

Query  473   QQEVDAGEFGYGQL---EEPFST  414
               E+     GYG +   E P ST
Sbjct  765   AAEISTFG-GYGHVDAQEXPXST  786



>ref|XP_007208659.1| hypothetical protein PRUPE_ppa021415mg, partial [Prunus persica]
 gb|EMJ09858.1| hypothetical protein PRUPE_ppa021415mg, partial [Prunus persica]
Length=233

 Score = 58.5 bits (140),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 92/210 (44%), Gaps = 22/210 (10%)
 Frame = -2

Query  1079  LRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNG----SVTMTER  912
             ++   L   +  +LV   NP + +I L   + L+I+ +    ++G+ +G      T +  
Sbjct  1     MKCGKLSHSMCRFLVDKLNPCKSSIVLHE-KTLKISVDDFVRIMGVKDGGEEVDFTGSMH  59

Query  911   DTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLN  732
             + H+V           K  K N     L  + +  +E G +FK  F +    TL+  T +
Sbjct  60    EQHIV-----------KLLKSN----ELKQMMVGTEEAGDFFKVGFAMFALCTLLCPTTS  104

Query  731   SYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
              Y N K + + +D + I   +   Y    L+++  S+ +N      G +LFL LFY+D +
Sbjct  105   VYVNLKYLLLLRDSKAIARKNLASYSFKFLLDSFRSFKENNQVYIGGCMLFLQLFYLDAI  164

Query  551   EAGERNVPRANPAAHGWTKRALDAREQQEV  462
               G   + R       W K  ++ ++ +EV
Sbjct  165   AHGSVLMDRPVLPFAAWGK--VENKKNEEV  192



>gb|AAL77113.1| hypothetical protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/228 (21%), Positives = 99/228 (43%), Gaps = 12/228 (5%)
 Frame = -2

Query  1103  IGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVT  924
             +G G  L ++   L   L  W    ++  +    +    F+ +TEE V  +LG+P G + 
Sbjct  1     MGTGAFLDIKCGYLHNTLVTWFTRQYHSGRKGFVVPRRGFIPLTEESVHKILGIPRGDIE  60

Query  923   MTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVA  744
             +     +    ++ +        +  IT   +AT  ++   G   FK+ + + + ST++A
Sbjct  61    IKYEADYDNEDEITSSLFPGDGSRPKITT--VATAIINNNNGDASFKKLWLIYIVSTVLA  118

Query  743   STLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFY  564
              T ++  + K   M + +     L+ C ++++ L   H+  ++    K  G LL+  L Y
Sbjct  119   PTTDTRISNKCYPMLEHIDQANRLNLCKFVVAQL---HEHLSKGKFTK--GCLLYCMLRY  173

Query  563   VDRVEAG--ERNVPRANPAAHGWTKRALDAREQQEV---DAGEFGYGQ  435
             +D ++    E  +P      + W+K  +D   + ++   D   FG  Q
Sbjct  174   LDALDCDGMELELPNTPYTINAWSKTHVDVVAEMDMLEHDPPSFGNFQ  221



>ref|NP_001064194.2| Os10g0157000 [Oryza sativa Japonica Group]
 dbj|BAF26108.2| Os10g0157000 [Oryza sativa Japonica Group]
Length=1022

 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/253 (23%), Positives = 106/253 (42%), Gaps = 11/253 (4%)
 Frame = -2

Query  1139  GLSTKQRKDVISIGMGGLLGLRVKALPL-RLGHWLVSNFNPAQMAIKLSNGRFLRITEEG  963
              LS    + +  IG+  +  + + +L    L  WL+   +P  M I L + R ++IT   
Sbjct  91    ALSNTHHEKLEEIGLDAVACMTLASLEKPDLIRWLMDRTDPDTMCISLDDDRKIQITPRI  150

Query  962   VAAVLGLPNG--SVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGGVW  789
             V  V+G P G   + +  +    +  D +     +  R   +T   L   A+  ++    
Sbjct  151   VQLVMGTPLGGKDIVIPPKKVVRIVHDRIVEELGLA-RNVRLTPKMLIE-AIKQRKDDPM  208

Query  788   FKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNT  609
               R F +V+ STL+  T + Y  +  V +  D+  +  +DW   +  +L ++   W +N 
Sbjct  209   AVRFFVMVLMSTLLIPTTDFYIPKDYVWLAADLDRVAAIDWSKVVFQALSDSLRCWRENP  268

Query  608   ARKFPGPLLFLTLFYVDRVEAGERNVPR--ANPAAHGWTKRALDAREQQEVDAGEFG---  444
                    ++FL + Y+D +      V      P    +TK  +D    ++ +AG  G   
Sbjct  269   GSSIASCIVFLVVLYLDNILPPREVVMERMFTPRIQMFTKDIVDQLVNEDQNAGGDGTPP  328

Query  443   YGQLE-EPFSTSA  408
             +G L   P ST+ 
Sbjct  329   FGNLPLRPISTTC  341



>gb|EMT23279.1| hypothetical protein F775_07540 [Aegilops tauschii]
Length=850

 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/236 (24%), Positives = 101/236 (43%), Gaps = 14/236 (6%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRV-KALPLRLGHWLVSNFNPAQ  1014
             P I +R    +L  +++  S  +++ V  IG  GLL ++  + + L+   +L+   +   
Sbjct  138   PAITSRLSLLKLGSVISKFSDFKKQLVREIGFDGLLHIKSWQKINLKYSAYLMDRVHVDN  197

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVK-NRKGNITV  837
               I L     L +T+E V +V  +P G + +           +   R     N KG  ++
Sbjct  198   SVINLEGQGMLELTDESVHSVFAIPRGELAIGPEGVEPSEACIEYTRFAASINDKGTHSL  257

Query  836   HA-----LATLALSLKEGGV-WFKRHFCV-VVASTLVASTLNSYANQKTVHMFKDVRMIK  678
              A     +  +A + ++  +  FK  F + V+   L  S  + Y          DV  I+
Sbjct  258   KAAEAYLMRDIAANFRKIDMDCFKIAFVIFVIGHVLAPSAKHDYVTIDFWAALSDVDKIR  317

Query  677   DLDWCGYLLSSLVNTHDSWTQNTARKFP-----GPLLFLTLFYVDRVEAGERNVPR  525
               +WC Y+L  L N    +  +  ++ P     G  LFL +F +D +E G+ N PR
Sbjct  318   TWNWCSYILKHLFNAVRKFKSDVIKRNPTIHIVGCHLFLQVFVLDSLELGQLNKPR  373



>ref|XP_008657800.1| PREDICTED: uncharacterized protein LOC103637366 [Zea mays]
Length=428

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/246 (22%), Positives = 103/246 (42%), Gaps = 25/246 (10%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L A     K+     
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNLRAELGVAKDEFNVA  214

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              +H      L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  215   VLHD----RLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVD---------------RVEAGE  540
               + + L      W    T N +    G  + + L+Y+D               R++  E
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFCE  330

Query  539   RNVPRA  522
             +N+ +A
Sbjct  331   KNIIKA  336



>ref|XP_008675470.1| PREDICTED: uncharacterized protein LOC103651588 isoform X1 [Zea 
mays]
 ref|XP_008675471.1| PREDICTED: uncharacterized protein LOC103651588 isoform X1 [Zea 
mays]
 ref|XP_008675472.1| PREDICTED: uncharacterized protein LOC103651588 isoform X1 [Zea 
mays]
 ref|XP_008675473.1| PREDICTED: uncharacterized protein LOC103651588 isoform X1 [Zea 
mays]
Length=358

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 56/271 (21%), Positives = 114/271 (42%), Gaps = 18/271 (7%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLR-LGHWLVSNFNPAQM  1011
             ++  R  P +++  +  L+ +QR+ ++  G   +L + + A+  R L  WL+   +P  M
Sbjct  90    KLNIRCNPGDVLASIQILNERQRQAIVRKGFSSILDMTIDAIGCRTLLCWLMQKLDPRDM  149

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN--GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
              +++   + L+ T++ V  +LGLPN  G   +   + +         R  +   K    +
Sbjct  150   TLRIGPDKELKNTKQTVHQILGLPNLGGGKPLNINEANAAA----TLRASLNISKDEFVI  205

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L    L L +      R F +++ + L+  T +   +   V + +++     +DWC  
Sbjct  206   SKLQD-RLRLGQDDDISIRCFFLILFNRLLFPTASWSISFNEVVLTEEMERFPQIDWCHL  264

Query  656   LLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV-EAGERNVPRANPAAHGWTK-  495
             + S L      W      N +    G  + + L+Y+D +  A   N     P    + K 
Sbjct  265   IFSDLCEAAQRWHNRSINNVSATIYGCSIIVLLYYLDHLHHAAAPNNKNGTPRIKYFNKN  324

Query  494   --RALDAREQQEVDAGEFGYGQLEEPFSTSA  408
               RAL   ++++   G   +G    PF +S+
Sbjct  325   IIRALSMADKRKPRQGGEPFGVC--PFRSSS  353



>ref|XP_008680581.1| PREDICTED: uncharacterized protein LOC103655638 [Zea mays]
Length=419

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 64/267 (24%), Positives = 112/267 (42%), Gaps = 23/267 (9%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFNPAQ  1014
             ++  R  P  ++  +  L+ +QR+ +   G   +L +RV AL  R  H  WL+   +   
Sbjct  45    RLNVRCNPQNVIVSIQILNDRQRQAIARRGFSSILDMRVDALGSR-SHLAWLMEKLDHND  103

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
             M I+   G+ L+IT+E V  +LGLPN G       D  +   +L A     K   G    
Sbjct  104   MTIRAGPGKELKITKETVHLILGLPNAGGGKALGIDEAVAANNLRAELGLSKEEFG----  159

Query  836   HALATLALSLKEG--GVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
               +A L   L +G       R+F +++ + L+  T         V + +++    ++DWC
Sbjct  160   --VAALQDRLGKGFDDDLSIRYFFLILFNRLLFPTARWGITNHEVLLTEEMDRFHEIDWC  217

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE--AGERNVPRANPAAHGW  501
               + +        W      N +    G  + + L+Y+D +   A  +N  R  P    +
Sbjct  218   QIIFNDFCQAAKKWHTRSVTNVSTTIYGCSIVILLYYLDHLHDSAAPQN-KRGTPRIKYF  276

Query  500   TKRALDAREQQEVDAGEFGYGQLEEPF  420
              +  + A  +   D G+   GQ  EPF
Sbjct  277   DRNIIQALTR--ADKGKIRQGQ--EPF  299



>ref|XP_008657592.1| PREDICTED: uncharacterized protein LOC103637107 [Zea mays]
Length=362

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 119/284 (42%), Gaps = 22/284 (8%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFN  1023
             P  ++  R  P +++  +  L+ +Q++ +   G   +L +R+ AL  R  H  WL+   +
Sbjct  80    PRQRLNVRCNPQDVLVSIQILNDRQQQAIARRGFSSILDMRLDALGSR-SHLAWLMEKLD  138

Query  1022  PAQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGN  846
                M I+   G+ L+IT++ V  +LGLPN G  T    D  +V  +L   R ++   K +
Sbjct  139   HNDMTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVVANNL---RAELGLSKED  195

Query  845   ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDW  666
               V AL        +  +   R F +++ + L+  T +       V + + +     +DW
Sbjct  196   FGVTALQDRLRKGSDDDLSI-RCFFLILFNRLLFPTASWGITNHEVLLTEQMDRFHQIDW  254

Query  665   CGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPRANPA  513
             C  + + L      W      N +    G  + + L+Y+D +        +R  PR    
Sbjct  255   CQLIFNDLCQAAKKWHNRSVTNVSTTIYGCSIVILLYYLDPLHDSAAPQNKRGTPRIKYF  314

Query  512   AHGWTKRALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSV  381
                  + AL   ++ ++  GE  +G      S  +S   C + V
Sbjct  315   DRNIIQ-ALTRADKGKIRKGEEAFGHC----SFRSSSETCYTDV  353



>dbj|BAD87923.1| hypothetical protein [Oryza sativa Japonica Group]
Length=452

 Score = 59.7 bits (143),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/246 (21%), Positives = 111/246 (45%), Gaps = 26/246 (11%)
 Frame = -2

Query  1190  PQIETRGRPSELVR----LLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFN  1023
             P +    RP+ L      L +G   +Q++ V  +G  GLL +R+  L  + G W++   +
Sbjct  27    PNLTGEERPNHLCSPAADLFSGFGDQQKELVKQMGFDGLLSVRLTKLNKQFGAWILCKLD  86

Query  1022  PAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKG  849
             P+   +   +   + +T E V+ +LG+P G   +     + V  D+ A+ C++  K+   
Sbjct  87    PSSGNLFAGSRHEICLTCEDVSLLLGIPCGRKEILPAIKNEVK-DVKAYMCEIFEKDSFD  145

Query  848   NITVHALATL-------ALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKD  693
              +T+  +  +        +++ E  V FK  F + V +  +A  ++N++ + + +    D
Sbjct  146   GLTIVTIQRILEKKFNRTMTVHEQIV-FKTTFIIFVVTKFLAPQSVNNHISIRYMKALVD  204

Query  692   VRMIKDLDWCGYLLSSLVNT-----HDSWTQNTARKFPGPLLFLTLFYVDRVEAG-----  543
             V  I   +W  ++L  + +      H    + +     G ++    FY+D ++ G     
Sbjct  205   VENIHKYNWAEFVLHDIKDAAAALQHKIRHRKSIGYINGCIILPQPFYLDNLDFGTDSPE  264

Query  542   ERNVPR  525
              +N+PR
Sbjct  265   HKNIPR  270



>emb|CAN76545.1| hypothetical protein VITISV_010419 [Vitis vinifera]
Length=1259

 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 59/251 (24%), Positives = 96/251 (38%), Gaps = 16/251 (6%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +   +L   L  ++ + +  +  GGLL L    +   +  +L+ +FN     I+ 
Sbjct  803   TRCSAARFKKLCNRLPEEKIQAIRDLQFGGLLNLNCTEVRHNICIFLIQHFNVGFRRIEF  862

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATL  819
             S  +   IT   V  + GLP     +    T    P             G I       L
Sbjct  863   SAQKHYPITATDVGLIFGLPTEGRILQVTSTSSEHP------------FGTIRACEEKLL  910

Query  818   ALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV  639
              L + E    F+R F     +TL+A T      +   H   +     D++W  ++L  LV
Sbjct  911   DLPVGEE---FRRAFIYYACATLLAPTSRLNGCRNLWHTIHEDGFRNDVNWAQFVLDQLV  967

Query  638   NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEV-  462
                  + Q+      G +LFL L YV +       VP   P A  WT   +  R   E+ 
Sbjct  968   EGIRRYQQSKTSWVHGCVLFLQLHYVIKFXIPSVQVPITVPPALAWTDDLIKRRLVAEIK  1027

Query  461   DAGEFGYGQLE  429
             + G FG+ +++
Sbjct  1028  EFGAFGHAEID  1038



>ref|XP_008677425.1| PREDICTED: uncharacterized protein LOC100303785 isoform X3 [Zea 
mays]
Length=874

 Score = 60.1 bits (144),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  99    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  158

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  159   TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  213

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  214   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  272

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  273   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  312



>ref|XP_008680144.1| PREDICTED: uncharacterized protein LOC103655116 [Zea mays]
 ref|XP_008646729.1| PREDICTED: uncharacterized protein LOC103628281 [Zea mays]
Length=768

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/219 (21%), Positives = 96/219 (44%), Gaps = 12/219 (5%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLR-LGHWLVSNFNPAQM  1011
             ++  R  P +++  +  L+ +QR+ ++  G   +L + + A+  R L  WL+   +P  M
Sbjct  70    KLNIRCNPGDVLASIQILNERQRQAIVRKGFSSILDMTIDAIGCRTLLCWLMQKLDPRYM  129

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN--GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
              +++   + L+IT++ V  +LGLPN  G   +   + +      +  R  +   K    +
Sbjct  130   TLRIGPDKELKITKQTVHQILGLPNLGGGKPLNINEANAA----VTLRVSLNISKDEFVI  185

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
               L    L L +      R F +++ + L+  T +   +   V + +++     +DWC  
Sbjct  186   SKLQD-RLRLGQDDDLSIRCFFLILFNRLLFPTASWSISFNEVVLTEEMERFPQIDWCHL  244

Query  656   LLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
             + S L      W      N +    G  + + L+Y+D +
Sbjct  245   IFSDLCEAAQRWHNKSINNVSATIYGCSIIVLLYYLDHL  283



>ref|XP_008677427.1| PREDICTED: uncharacterized protein LOC100303785 isoform X5 [Zea 
mays]
Length=858

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  99    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  158

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  159   TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  213

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  214   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  272

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  273   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  312



>ref|XP_008677426.1| PREDICTED: uncharacterized protein LOC100303785 isoform X4 [Zea 
mays]
Length=862

 Score = 59.7 bits (143),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  99    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  158

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  159   TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  213

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  214   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  272

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  273   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  312



>ref|XP_008664886.1| PREDICTED: uncharacterized protein LOC103643467 [Zea mays]
Length=293

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 60/266 (23%), Positives = 113/266 (42%), Gaps = 14/266 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  31    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSSILDMTVDALCSRSHLQWLMDKLDP  90

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  91    KDMTIRPGPGKELKITKDIVHLILGVPNHGGDKPLGIDEAVAASNL---RAELGVAKDEF  147

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V A     L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  148   NV-AFLQDRLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHEIDWC  206

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-AGERNVPRANPAAHGWT  498
               + + L      W    T N +    G  + + L+Y+D +  A   +     P    + 
Sbjct  207   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHTAAAPHNKSGTPRIKFFD  266

Query  497   K---RALDAREQQEVDAGEFGYGQLE  429
             K   +AL   ++++V  G   +G  E
Sbjct  267   KNSIKALTKADKRKVRHGAESFGHCE  292



>ref|XP_010647228.1| PREDICTED: uncharacterized protein LOC100253832 [Vitis vinifera]
Length=698

 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 55/266 (21%), Positives = 112/266 (42%), Gaps = 29/266 (11%)
 Frame = -2

Query  1181  ETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             ++R    + + ++  L   ++  +  +G GGLL L  K L   L  W+V+ ++     + 
Sbjct  23    KSRCSGKKFLSIMDTLPMDKKNAISDMGFGGLLQLGCKELRYELITWIVAKYDIGYHRLC  82

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNIT-VHALA  825
             +     + +T + V  VLG+P+             G D+L +     NR+G     + + 
Sbjct  83    METRVAVPVTPKDVREVLGIPDD------------GVDILIY-----NRRGTPNRTYDIK  125

Query  824   TLALSLKE--GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL----DWC  663
              L  +L++   G  F + F +   +T++A      + Q+ +H   D     ++    +W 
Sbjct  126   ILEANLRDLPVGEEFMKSFLIFACATILAPN----SKQEGMHDLWDTVWDSEVGVRKNWA  181

Query  662   GYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
              ++L  + +    +  +      G +LFL LFY+ +       V   +P +  WT   + 
Sbjct  182   KFVLQYVEDGIRDYRTSHPTYIRGCVLFLQLFYISKFYMTAFQVEVRSPLSAAWTDEQVK  241

Query  482   AREQQEVDA-GEFGYGQLEEPFSTSA  408
              R   E+   G +G+ Q+ +    SA
Sbjct  242   RRLAAEIHTYGNYGHVQVIQESKPSA  267



>ref|XP_008677424.1| PREDICTED: uncharacterized protein LOC100303785 isoform X2 [Zea 
mays]
Length=878

 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  99    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  158

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  159   TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  213

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  214   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  272

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  273   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  312



>gb|EEC73277.1| hypothetical protein OsI_07420 [Oryza sativa Indica Group]
Length=644

 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 49/232 (21%), Positives = 106/232 (46%), Gaps = 22/232 (9%)
 Frame = -2

Query  1160  ELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFL  981
             +L  L + +  +Q++ V  +G  GLL +R+  L  + G W++   +P+   +   +   +
Sbjct  54    QLADLFSDIGDQQKELVRQMGFDGLLSMRLTKLNKQFGAWILCKLDPSSGNLFAGSKHEI  113

Query  980   RITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKGNITVHALA------  825
              +T E V+ +LG+P G   +     + V  D+ A+ C++  K+    IT+  +       
Sbjct  114   CLTCEDVSLLLGIPCGRKQILPAIKNEVK-DVKAYMCEIFEKDSFDGITIATIQRILEKK  172

Query  824   -TLALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
              T  +++ E  V FK  F + V +  +A  ++N++ + + +    DV  I   +W  ++L
Sbjct  173   FTRTMTVYEQIV-FKTAFIIFVVTKFLAPQSVNNHISIRYMKALVDVENIHKYNWAEFVL  231

Query  650   SSLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEA-----GERNVPR  525
               + +   +       +       G ++   LFY+  ++      G +N+PR
Sbjct  232   HEIKDAAAALQDKIRHRKSIGYINGCIILPELFYLHNLDFGTDTPGHKNIPR  283



>ref|XP_008677422.1| PREDICTED: uncharacterized protein LOC100303785 isoform X1 [Zea 
mays]
Length=900

 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  99    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  158

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  159   TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  213

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  214   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  272

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  273   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  312



>ref|XP_002448621.1| hypothetical protein SORBIDRAFT_06g030277 [Sorghum bicolor]
 gb|EES12949.1| hypothetical protein SORBIDRAFT_06g030277 [Sorghum bicolor]
Length=882

 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 59/237 (25%), Positives = 97/237 (41%), Gaps = 24/237 (10%)
 Frame = -2

Query  1160  ELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLR-LGHWLVSNFNPAQMAIKLSNGRF  984
             +L+ L+  L+  Q+K V   G G +L L+   +P + L  WL   ++     IK+     
Sbjct  10    KLMNLIRVLTEPQKKLVQQCGFGSILKLKCSIMPYKQLIVWLARCYDKNTQCIKIPGTNE  69

Query  983   LRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRK--GNITVHALATLALS  810
              +I    V  +LG+PNG V +  R +       L  +  + N    G +       +A+ 
Sbjct  70    FKIDGHIVHLILGIPNGEVKIKSRAS-------LELKSFIANETTPGPLAPKIQDLIAMI  122

Query  809   LKE-GGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNT  633
               E  G  F R F +VV S  +  + +  A+       + V+ IK  DWC  ++S L + 
Sbjct  123   TPELVGDRFVRIFILVVLSIFLCPSSSFRASCHYYDGIRSVKKIKSYDWCDAVVSCLNSG  182

Query  632   HDSWTQNTAR-------KFPGPLLFLTLFYVDRVEAGE-----RNVPRANPAAHGWT  498
                + Q+ ++          G +  L   Y D + A E       VPR  P    WT
Sbjct  183   LCKFQQSLSKGSTSDKPTLSGCIFVLFTAYFDYL-ASEMIIVPETVPRIIPRIDAWT  238



>emb|CDM82585.1| unnamed protein product [Triticum aestivum]
Length=557

 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 59/252 (23%), Positives = 100/252 (40%), Gaps = 20/252 (8%)
 Frame = -2

Query  1202  MSPFPQIETRGRPSE--LVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSN  1029
             ++P  +  TR R S+  L  L    +  Q+     +GM  L+ +R K L   +  WL   
Sbjct  107   VTPQKKKRTRNRASQERLTSLTDRFTDDQKGAAAEMGMQALMDVRCKNLVNPVCDWLGEI  166

Query  1028  FNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKG  849
             ++P      +     L + EE V   LG+P G + +     + +   L            
Sbjct  167   YDPTSREFVIPGRGRLPLKEESVFCTLGVPRGEIKVPYEVNNKIKETLFPRLFPGLESMP  226

Query  848   NITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLD  669
             N T   LA     +   G  FK    + + S + A T +   + K   +   ++ +K+++
Sbjct  227   NTTF--LADSPQDMTTHGEVFKMKLLMYLISAVFAPTTSLRPSNKCFPILAKLKDVKNMN  284

Query  668   WCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVE---------AGERNVPRANP  516
             WC +++  L   HD ++    +K  G  L L L YVD ++          G R  P    
Sbjct  285   WCKFIVDFL---HDVFSSKMYQK--GCRLHLMLMYVDCLDLSIVDFIGTGGPR--PTHKF  337

Query  515   AAHGWTKRALDA  480
             A   WT  A+ A
Sbjct  338   AVSAWTYDAVKA  349



>ref|XP_008653599.1| PREDICTED: uncharacterized protein LOC103633661 [Zea mays]
Length=367

 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 96/223 (43%), Gaps = 10/223 (4%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSNILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGLAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V  L    L   E      R F +++ + L+  T +       V + +++    + DWC
Sbjct  212   NVTFLQD-RLRKGEDDDLTIRCFFLILFNRLLFPTASWGITYHEVLLTEEMHRFHETDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVEA  546
               + + L      W    T N +    G  + + L+Y+D + A
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHLHA  313



>ref|XP_008677429.1| PREDICTED: uncharacterized protein LOC100303785 isoform X7 [Zea 
mays]
Length=812

 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 103/230 (45%), Gaps = 18/230 (8%)
 Frame = -2

Query  1205  IMSPFPQIETR----GRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HW  1041
             ++S  P ++TR      P +++  +  ++ +QR+ V+  G   +L + + AL  R    W
Sbjct  1     MLSNLPALKTRLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCW  60

Query  1040  LVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKV  864
             L+   +P  M +++  G+ L+IT+E V  +LGLPN G       D      +L +     
Sbjct  61    LMEKLDPKDMTLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGIS  120

Query  863   KNRKGNITVHALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDV  690
             K+  G      +A L   L+ GG      R F +++ + L+  T +   +   V + + +
Sbjct  121   KDEFG------VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQL  174

Query  689   RMIKDLDWCGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
                  +DWC  + + L      W    T N +    G  + + ++Y+D +
Sbjct  175   DRFPHIDWCHLIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  224



>ref|XP_008657323.1| PREDICTED: uncharacterized protein LOC103636778 [Zea mays]
Length=399

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 132/317 (42%), Gaps = 27/317 (9%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   ++ + V AL  R    WL+   + 
Sbjct  95    PRQRLNVRCNPQDVIASIHILNERQRQAIRRKGFSNIIDMTVDALCSRSHLQWLMDKLDH  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ +  +LG+PN G       D  +   +L A     KN + N+
Sbjct  155   KDMTIRPGPGKELKITKDIMHLILGVPNHGGGKPFGIDEAVAASNLRAELGLAKN-EFNV  213

Query  842   TVHALATLALSLKEG--GVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLD  669
             T+     L   L++G       R F +++ + L+  T +       V + +++    + D
Sbjct  214   TL-----LQDRLRKGDDDDLTIRCFVLILFNRLLFPTASWGITNHEVLLTEEMHRFHETD  268

Query  668   WCGYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVD--RVEAGERNVPRANPAAH  507
             WC  + + L      W    T N +    G  + + L+Y+D   V A  +N   + P   
Sbjct  269   WCQLIFNDLCEAAKKWHNRSTTNVSTTIYGCSIVVLLYYLDHLHVAAAPQN-KLSTPRIK  327

Query  506   GWTKRALDAREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSVEQTRYGRADSRPQPVHQG  327
              + K  + A  + +      G     EPF      P+CR+++      R    P+P    
Sbjct  328   FFDKNIIKALTKADKRKARHG----AEPF--GYCEPKCRTNIFDAL--RPAPTPRPTFNI  379

Query  326   HTPGVS--MVSAASRAP  282
               P +   M S  ++ P
Sbjct  380   QLPSIKEMMSSKINQLP  396



>ref|XP_007220163.1| hypothetical protein PRUPE_ppa017411mg, partial [Prunus persica]
 gb|EMJ21362.1| hypothetical protein PRUPE_ppa017411mg, partial [Prunus persica]
Length=378

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 86/221 (39%), Gaps = 14/221 (6%)
 Frame = -2

Query  1214  VHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLV  1035
             V+D ++    I TR  P    R +  LS ++R  + +IG G +  L    L  +L H L+
Sbjct  31    VNDSVNEMSWI-TRYSPDRFHRTVEKLSEEKRLAIKAIGFGNVSSLSCTRLHRQLCHCLI  89

Query  1034  SNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNR  855
               FNP   +I+L +G  +RI+ +    V+GL N             G D+   R      
Sbjct  90    QKFNPDTSSIEL-HGNVIRISADEFGRVMGLKN------------TGEDVQLDRPSFGGN  136

Query  854   KGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKD  675
                + V  LA      +     FK  F +    T++  T +     K +        I+ 
Sbjct  137   GKRVLVKGLAEQLEKCENANEDFKVRFVMFALGTILCPTSSPSVTGKYLTFLTIPGKIET  196

Query  674   LDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
              +W  +  + L     S+         G LLFL L Y D +
Sbjct  197   KNWADHGFNFLCEGVRSFKAKKVAYVNGSLLFLQLLYFDSI  237



>gb|AAL75744.1|AC091724_17 Hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP52205.1| hypothetical protein LOC_Os10g06810 [Oryza sativa Japonica Group]
Length=446

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 92/385 (24%), Positives = 152/385 (39%), Gaps = 46/385 (12%)
 Frame = -2

Query  1136  LSTKQRKDVISIGMGGLLGLRVKALPL-RLGHWLVSNFNPAQMAIKLSNGRFLRITEEGV  960
             LS    + +  IG+  +  + +++L    L  WL+   +P  M I +++   ++IT   V
Sbjct  91    LSPVHHEKLEEIGLDAVACMSLESLEQPDLIRWLMDRTDPDTMCISINDDMKIQITPRIV  150

Query  959   AAVLGLPNGSVTMT------ERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEG  798
               VLG P G   +        R  H    D L       ++K  ++   L  +  S K+ 
Sbjct  151   RLVLGTPLGGNDIVLPSHKVVRTVHESITDELGM-----HKKARLSAKQLIEVIKSQKDD  205

Query  797   GVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWT  618
                  R+F +V+ S L+  T + Y  +  V +  ++  +  +DW   +  +L ++   W 
Sbjct  206   HRAV-RYFIMVLMSKLLVRTTDFYVPKGDVGVASNLDRVAAIDWSKAVFRALSDSIRCWR  264

Query  617   QNTARKFPGPLLFLTLFYVDRVEAGERNVP---RANPAAHGWTKRALDAREQQEVDAGEF  447
             QN A      ++FL + Y+D +    R++       P    +TK  +D     + +AG  
Sbjct  265   QNPASSIASCVVFLAVLYLDNI-LPPRDIGLDLTFTPRIQMFTKDIVDKLVAADQEAG--  321

Query  446   GYGQLEEPFSTSASRPRCRSSVEQTRYGRADSRPQPVHQGHTPGVSMVSAASRAPTVPSP  267
             G G L  PF     RP     +E T Y       +P  +   P V  +    RAP    P
Sbjct  322   GDGTL--PFGNLPLRP-----LESTCYAN-----KPAGRAKGPMVEDI----RAPAYTFP  365

Query  266   QGDTTGSRGAAGDHPVHHGLIPDANKGFGCELDSMIADLRTVASRVADKVREDPRQAQRR  87
                T       G H    GL PD   G    L+S IA+    A   A ++    R    +
Sbjct  366   NMSTI-----IGPH--FAGLPPDQRLGL---LES-IAEYDRQAKESAMEIERQFRLVVDK  414

Query  86    QCFHHLSGVASLILGLIPASVEVAP  12
             Q     S + +L    +P    VAP
Sbjct  415   QHMLCQSVIDALQANRVPHPPTVAP  439



>ref|XP_002439847.1| hypothetical protein SORBIDRAFT_09g021200 [Sorghum bicolor]
 gb|EES18277.1| hypothetical protein SORBIDRAFT_09g021200 [Sorghum bicolor]
Length=925

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 94/230 (41%), Gaps = 15/230 (7%)
 Frame = -2

Query  1151  RLLTGLSTKQRKDVIS-IGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRI  975
             +L   +  +  K V+   G G LL      +P +   WL S    ++    +  G+ + +
Sbjct  88    KLSLAMQAQDHKAVVRRYGFGSLLLFYKCFVPKKFSKWLAS-LVESKYGDLIVQGKVISL  146

Query  974   TEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRC-KVKNRKGNITVHALATLALSLKEG  798
             T + V  VLG+P G         +  G D +  +  K    + +  V  L    L+ +E 
Sbjct  147   TAQSVNHVLGIPVGGTPFPS--NYSTGKDYVLLKIGKTTLPQVSFFVDKLKAADLNDEEL  204

Query  797   GVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV------N  636
              V F     VV     + S  N   + + + +F+D+  I   DW G++L  L+      N
Sbjct  205   LVCF----LVVALHCFLCSNSNIVPSPRYLGVFEDIEHINSYDWSGFVLRWLLDGVKNFN  260

Query  635   THDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRAL  486
               +  ++       G + +L +FY+D V+   R +P + P    W +  +
Sbjct  261   KGNKASEKHCGTLAGCMFYLAVFYLDHVDFSHRRLPDSFPRIDVWKQNMI  310



>ref|XP_008677430.1| PREDICTED: uncharacterized protein LOC100303785 isoform X8 [Zea 
mays]
Length=811

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  10    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  69

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  70    TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  124

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  125   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  183

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  184   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  223



>ref|XP_008677431.1| PREDICTED: uncharacterized protein LOC100303785 isoform X9 [Zea 
mays]
Length=806

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  5     RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  64

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  65    TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  119

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  120   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  178

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  179   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  218



>ref|XP_008657316.1| PREDICTED: uncharacterized protein LOC103636772 [Zea mays]
Length=495

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 96/221 (43%), Gaps = 10/221 (5%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNP  1020
             P  ++  R  P +++  +  L+ +QR+ +   G   +L + V AL  R    WL+   +P
Sbjct  95    PRQRLNVRCNPQDVIASINILNERQREAIRRKGFSTILDMTVDALCSRSHLQWLMDKLDP  154

Query  1019  AQMAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
               M I+   G+ L+IT++ V  +LG+PN G       D  +   +L   R ++   K   
Sbjct  155   KDMTIRPGPGKELKITKDIVHLILGVPNHGGGKPLGIDEAVAASNL---RAELGVAKDEF  211

Query  842   TVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWC  663
              V  L    L   E      R F +++ + L+  T +       V + +++    ++DWC
Sbjct  212   NVTFLQD-RLRKGEDDDLSIRCFFLILFNRLLFPTASWGITYHEVLLTEELHRFHEIDWC  270

Query  662   GYLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
               + + L      W    T N +    G  + + L+Y+D +
Sbjct  271   QLIFNDLCEAAKKWHNRITTNVSTTIYGCSIVVLLYYLDHL  311



>gb|EMT08151.1| E3 ubiquitin-protein ligase SINA-like protein 4 [Aegilops tauschii]
Length=1015

 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 97/226 (43%), Gaps = 18/226 (8%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P  + +++  LS +Q+  V  IG G LL +    +   L  WLV  F+    A++  
Sbjct  384   RCSPRLIPQIVELLSEEQKGFVRKIGFGSLLSMADFEMNKALTLWLVGKFSCDTNALEFG  443

Query  995   NGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLA  816
              G  + +    V +VLG+P+G + + +   H V   L +  C VK +        LA   
Sbjct  444   GGLSIPV-RPLVKSVLGIPSGPIQVVQ-GLH-VDYGLFSQYCTVKFKNA----RKLAEEM  496

Query  815   LSLKEGGVWFKRHFCVVVASTLVASTL----NSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
              S+ E     +  FC+    T++A  L        N+  +   + V  +K +DWCG++  
Sbjct  497   CSITE-----EEPFCIAFMMTILAIYLAPNTTVLVNRSFLGAAQQVGSLKQMDWCGFVAD  551

Query  647   SLVNTHDSWTQNTA--RKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
              L      + ++ A      G +  L++ ++D V+     VP   P
Sbjct  552   YLFKGIREFKESDAPFGCLKGCVHILSVIFIDLVKHAAFEVPNGFP  597


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/226 (23%), Positives = 96/226 (42%), Gaps = 24/226 (11%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P  + R++  LS +Q+  V  IG G LL +    +   L  WLV  F+    A++  
Sbjct  78    RCSPHLIPRIVGLLSEEQKGFVRKIGFGSLLSMADFEINKALTLWLVGRFSCETEALEFE  137

Query  995   NGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLA  816
              G  + +    V +VLG+P+G + + +       P       KV+  K            
Sbjct  138   GGVSIPV-RPLVKSVLGIPSGPIPVVQ------SPYSHFSSTKVRKAK-----------E  179

Query  815   LSLKEGGVWFKRHFC----VVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             L+ +  G+  +  FC    +V+ +  +A       N+  +   + V  ++ +DWCG++  
Sbjct  180   LAEEMCGITEEEPFCTAFMMVILAIYLAPNTTMLVNRSLLGAAQKVGSLRQMDWCGFVAD  239

Query  647   SLVNTHDSWTQNTA--RKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
              L+     + ++ A      G +  L++ ++D V+  E  VP   P
Sbjct  240   YLIKGLMEFKESDAPFVLLKGCVHILSVIFIDHVKHAEFQVPNGFP  285



>ref|XP_008677428.1| PREDICTED: uncharacterized protein LOC100303785 isoform X6 [Zea 
mays]
Length=812

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/220 (23%), Positives = 98/220 (45%), Gaps = 14/220 (6%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG-HWLVSNFNPAQM  1011
             ++  R  P +++  +  ++ +QR+ V+  G   +L + + AL  R    WL+   +P  M
Sbjct  11    RLNIRCNPQDVLVCIQIMNERQRQAVVRKGFFNILDMTIDALGSRTHLCWLMEKLDPKDM  70

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVH  834
              +++  G+ L+IT+E V  +LGLPN G       D      +L +     K+  G     
Sbjct  71    TLRIGPGKELKITKETVHLILGLPNTGGGKPLNIDEVNAAVNLRSSLGISKDEFG-----  125

Query  833   ALATLALSLKEGG--VWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG  660
              +A L   L+ GG      R F +++ + L+  T +   +   V + + +     +DWC 
Sbjct  126   -VAKLQERLRLGGDDDLSIRCFFLILFNRLLFPTASWSISNNEVLLTEQLDRFPHIDWCH  184

Query  659   YLLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRV  552
              + + L      W    T N +    G  + + ++Y+D +
Sbjct  185   LIFNDLCEAAHKWHNRSTTNVSATIYGCSIVVLVYYLDHL  224



>ref|XP_002457499.1| hypothetical protein SORBIDRAFT_03g008346 [Sorghum bicolor]
 gb|EES02619.1| hypothetical protein SORBIDRAFT_03g008346 [Sorghum bicolor]
Length=559

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 150/382 (39%), Gaps = 46/382 (12%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVIS-IGMGGLLGLRV-KALPLRLGHWLVSNFNPA  1017
             P+   R  P  +  LL GLST+Q+K  +   G   LL  ++ + +P     WL    +  
Sbjct  172   PRWNVRSYPKRIHNLLNGLSTEQKKIFLEDTGFDKLLQFKLERNIPPAFLQWLYKRIDHH  231

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
              M I+L  G+ L++T+E    +LGLP       + +   +  D      + K+ +  + +
Sbjct  232   TMTIRLGPGKELKLTKEVFYRILGLPKTGAQQEKIEEWSLRKD------EAKDLRKALKI  285

Query  836   HALA-----TLALSLKEGGV--WFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIK  678
               L       L   +K+ G     KR F +V+ + ++  T +   +   +    D+    
Sbjct  286   TELKEFNPDILIQHVKKKGTDELTKRCFFIVLFNCMLFCTGSWVISNNEIMRTADMSNFH  345

Query  677   DLDWCGYLLSSLVNTHDSWTQNTAR-----KFPGPLLFLTLFYVDRVEAGERNVPRANPA  513
              +DWC  + +  V+  + +  +  +       PG  + + L+Y D ++  +    R   +
Sbjct  346   KIDWCHEIYTFFVHQMELFANDLKKPQVSYTIPGCSVAVALYYFDWLDHKDGAKDRRTTS  405

Query  512   AHG-WTKRALD-------AREQQEVDAGEFGYGQLEEPFSTSASRPRCRSSVEQTRYGRA  357
               G +    +D        R++Q +     GYG+L+     S              +   
Sbjct  406   RIGAYVSDTIDNLLSRDVIRDKQTI----IGYGKLDVGSFISYYL--------SWYFLGY  453

Query  356   DSRPQPVHQGHTPGVSMVSAASRAPTVPSPQGDTTGSRGAAGDHPVHHGLIPDANKGFGC  177
             +S+  PV Q    G   V   S  P + +  GD   S  A GDH    G I +    +  
Sbjct  454   NSQFIPVSQTCYIGTPEVGGIS-IPRISTLLGDKLMSL-AEGDHDHILGYINE----YDD  507

Query  176   ELDSMIADLRTVASRVADKVRE  111
             E+     ++     R+ +K RE
Sbjct  508   EVQHQCHNIEAAIDRIVEKQRE  529



>gb|EMT15864.1| hypothetical protein F775_02762 [Aegilops tauschii]
Length=269

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 96/236 (41%), Gaps = 9/236 (4%)
 Frame = -2

Query  1175  RGRPSE--LVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIK  1002
             R R S+  L  L  G +  Q+     +G   L+ +R K L   +  WL   + PA     
Sbjct  37    RNRASQERLTILTEGFTDDQKGAAAELGTQALMDVRCKNLVNPVCDWLGEIYEPASREFV  96

Query  1001  LSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALAT  822
             +     L + EE V   LG+P G   +     + +   L A          N TV  LAT
Sbjct  97    VPGCGRLPLDEESVFCTLGVPRGETKVPYEVNNTIEETLFARLFPGMTSMPNTTV--LAT  154

Query  821   LALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSL  642
                 +K  G  FK    + + S + A T +   + K   +   ++ +K+++WC ++   L
Sbjct  155   SLEGMKTHGEVFKMKLLMYLISAIFAPTTSLRPSNKCFPILAKLKEVKNMNWCKFIADFL  214

Query  641   VNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDARE  474
                HD+++    +K  G  L+L    +       R+ PR + +  G     LD R+
Sbjct  215   ---HDAFSNKMYQK--GCRLYLMGAPIAGDTPSTRSSPRTSTSNTGDPVVLLDLRK  265



>ref|XP_008653589.1| PREDICTED: uncharacterized protein LOC100278068 [Zea mays]
Length=858

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/233 (23%), Positives = 101/233 (43%), Gaps = 17/233 (7%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGH--WLVSNFNPAQ  1014
             ++  R  P +++  +  L+ +QR+ +   G   +L +R+ AL  R  H  WL+   +   
Sbjct  169   RLNVRCNPQDVLVSIQILNDRQRQAIARRGFSSILDMRLDALGSR-SHLAWLMEKLDHND  227

Query  1013  MAIKLSNGRFLRITEEGVAAVLGLPN-GSVTMTERDTHMVGPDLLAWRCKVKNRKGNITV  837
             M I+   G+ L+IT++ V  +LGLPN G  T    D  +   +L   R ++   K +  V
Sbjct  228   MTIRAGPGKELKITKDTVHLILGLPNAGGGTALGIDEAVAANNL---RAELGLLKEDFGV  284

Query  836   HALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGY  657
              AL        +  +   R F +++ + L+  T +       V + +++     +DWC  
Sbjct  285   TALQDRLRKGSDDDLSI-RCFFLILFNRLLFPTASWGITNHEVLLTEEMDRFHQMDWCQL  343

Query  656   LLSSLVNTHDSW----TQNTARKFPGPLLFLTLFYVDRVE-----AGERNVPR  525
             + + L      W      N +    G  + + L+Y+D +        +R  PR
Sbjct  344   IFNDLCQAAMKWHTRSVTNVSTTIYGCSIVILLYYLDHLHDSAAPQNKRGTPR  396



>gb|KDO39692.1| hypothetical protein CISIN_1g047588mg [Citrus sinensis]
Length=421

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/204 (23%), Positives = 84/204 (41%), Gaps = 6/204 (3%)
 Frame = -2

Query  1184  IETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             IE R  P     L+   S ++++ V  IG   LL LR   L  +L  WLV  F P +  I
Sbjct  6     IECRCAPDRFHELVKMFSLQKQRSVREIGFESLLQLRTGRLRRKLCAWLVDKFLPDEGVI  65

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMT-ERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
              L   R + +T    + ++G+ +G ++++   D   +      ++C  +     I++  L
Sbjct  66    ILHKQR-IPVTATTFSNIMGIHDGGLSVSLSGDADKIARFRDTFKCTGRG----ISIQNL  120

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
                          FK  F +   +T++  +     +   +H   D   I++ +W  +   
Sbjct  121   EDFLNQSDGTADEFKVAFVLFALATVLCPSSAPIISASFLHTLSDTSAIRERNWASFCYD  180

Query  647   SLVNTHDSWTQNTARKFPGPLLFL  576
              LV     +  N++    G LLFL
Sbjct  181   RLVIAISKFKSNSSAHVGGCLLFL  204



>ref|XP_004305674.1| PREDICTED: uncharacterized protein LOC101308491 [Fragaria vesca 
subsp. vesca]
Length=694

 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 100/236 (42%), Gaps = 7/236 (3%)
 Frame = -2

Query  1226  DTEPVHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLG  1047
             + E V++       I T   P E  R+++ +S ++   +I +G G +   R   L L L 
Sbjct  23    EVETVNNSGGSESSIVTGCDPKEFKRVVSRISNERIILIIEMGFGPVHNFRCGKLNLSLC  82

Query  1046  HWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMV--GPDLLAWR  873
               L++NF+     I++ +GR + ITE+     LGL       TE D   V  G D +  +
Sbjct  83    EMLLNNFDVKNQTIEI-HGRHMSITEKDFDRFLGL---RCRGTEVDIEHVSGGRDAVDLK  138

Query  872   CKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKD  693
              ++   + NI +  L  + +   E    F   F +   ST+   +   Y + + +   ++
Sbjct  139   ERLCGDETNINLKTLKKMVV-FTEDDELFMVSFVLFALSTMFCPSTPGYVDPRFLIPLRN  197

Query  692   VRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPR  525
              R I+  +W  +  + L      +         G L+FL +FY+  +  G   V R
Sbjct  198   PRAIRSYNWGRFAYTKLAEGVTLYQSGNHSPTMGCLVFLQVFYLSVLGEGMLIVSR  253



>ref|XP_008661971.1| PREDICTED: uncharacterized protein LOC103640583 [Zea mays]
Length=258

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = -2

Query  1160  ELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFL  981
             + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+ N NP  M +++  G+ +
Sbjct  116   KFIKLVNALSDELKGEVVAKGFGGLLRFKPHLLSRKLLSWLMRNLNPETMKLEIGGGKEI  175

Query  980   RITEEGVAAVLGLPN  936
              ITE  V  VL LPN
Sbjct  176   PITEHSVWCVLQLPN  190



>emb|CDM80369.1| unnamed protein product [Triticum aestivum]
Length=1011

 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/226 (23%), Positives = 97/226 (43%), Gaps = 24/226 (11%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P  + R++  LS +Q+  V  IG G LL +    +   L  WLV  F+    A++  
Sbjct  44    RCSPHLIPRIVGLLSEEQKGFVRKIGFGSLLSMADFEINKALTLWLVGRFSCETEALEFE  103

Query  995   NGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLA  816
              G  + +    V +VLG+P+G + + +       P    +  KV+  K            
Sbjct  104   GGVSIPVRPL-VKSVLGIPSGPIPVVQ------APYSHYYSTKVRKAK-----------E  145

Query  815   LSLKEGGVWFKRHFC----VVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
             L+ +  G+  +  FC    +V+ +  +A       N+  +   + V  ++ +DWCG++  
Sbjct  146   LAEEMCGITEEEPFCTAFMMVILAIYLAPNTTMLVNRSLLGAAQKVGSLRQMDWCGFVAD  205

Query  647   SLVNTHDSWTQNTA--RKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
              L+     + ++ A      G +  L++ ++D V+  E  VP   P
Sbjct  206   YLMKGLMEFKESDAPFVLLKGCVHILSVIFIDHVKHAEFQVPNGFP  251


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/231 (24%), Positives = 96/231 (42%), Gaps = 21/231 (9%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQM  1011
             P   +  RP ++V LL   S +Q+  V  IG G LL +    +   L  WLV  F+    
Sbjct  379   PPSRSAKRPRKIVELL---SEEQKGFVRKIGFGSLLSMADFEMNKALTLWLVGKFSCDTN  435

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             A++   G  + +    V +VLG+P+G + + +      G    +  C V  +        
Sbjct  436   ALEFGGGLSIPVRPL-VKSVLGIPSGPIQVVQGLEVDYG--FFSQYCSVNFKNA----RK  488

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTL----NSYANQKTVHMFKDVRMIKDLDWC  663
             LA    S+ E     +  FC+    T++A  L        N+  +   + V  +K +DWC
Sbjct  489   LAEEMCSITE-----EEPFCIAFMMTILAIYLAPNTTVLVNRSFLGAAEQVGSLKQMDWC  543

Query  662   GYLLSSLVNTHDSWTQNTA--RKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
             G++   L      + ++ A      G +  L++ ++D V+     VP   P
Sbjct  544   GFVADYLFKGIREFKESGAPFGCLKGCVHILSVIFIDLVKHAAFEVPNGFP  594



>ref|XP_007226785.1| hypothetical protein PRUPE_ppa017990mg, partial [Prunus persica]
 gb|EMJ27984.1| hypothetical protein PRUPE_ppa017990mg, partial [Prunus persica]
Length=448

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 94/228 (41%), Gaps = 11/228 (5%)
 Frame = -2

Query  1214  VHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLV  1035
             V+D ++    I TR       R +  LS ++R  + +IG G +  L    L  +L H+L+
Sbjct  73    VNDSVNEMSWI-TRCSLDRFHRTVEKLSEEKRLAIKAIGFGNVSSLSCTRLHRQLCHFLI  131

Query  1034  SNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGP-DLLAWRCKVKN  858
               FNP   +I+L +G  +RI+ +    V+GL N     T  D  +  P +    +  VK+
Sbjct  132   QKFNPDMSSIEL-HGNVIRISADEFGRVMGLKN-----TGEDVQLDRPVEDEKVKQLVKS  185

Query  857   RKGN---ITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVR  687
               GN   + V  LA      +     FK  F +    T++  T +     K +       
Sbjct  186   FGGNGKRVLVKCLAEQLEKCENANEDFKVRFVMFALGTILCPTSSPSVTGKYLTFLTIPG  245

Query  686   MIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAG  543
              I+  +W  +  + L     S+         G LLFL L Y D +  G
Sbjct  246   KIETKNWADHGFNFLCEGVRSFKAKKVAYVNGSLLFLQLLYFDSIVHG  293



>emb|CDP20833.1| unnamed protein product [Coffea canephora]
Length=494

 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 63/310 (20%), Positives = 128/310 (41%), Gaps = 11/310 (4%)
 Frame = -2

Query  1331  DHSGADARQPIILSDDGTDVDDEAPTPPRDPEELDDTEPVHDIMSPFPQIETRGRPSELV  1152
             ++ GA++    + ++   D  D + +   + E L   + V   +S  P   TR     + 
Sbjct  44    ENEGAESNSTRMRTEARHDAADASSSA--NVENLQSEQVVRAAISRSP-YSTRSSTHMVK  100

Query  1151  RLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRIT  972
              ++  L+ +Q   +  +G   +L +    L      WLV +FN  Q  + + +GR L++T
Sbjct  101   EIIDKLTPEQENAIKDLGFAPILKILAFNLDNDYCSWLVDHFNAEQRTLNV-HGRSLKVT  159

Query  971   EEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVK-NRKGNITVHALATLALSLKEGG  795
              + V  V GL +  + +   ++ +   D L     ++ +  G I +  L T  +     G
Sbjct  160   PKHVGYVTGLNSEGLDVAALESELSLDDNLLTEFNIQLDNDGEIGLARLRTSLMKTNSSG  219

Query  794   VWFKRHFCVVVASTLVASTLNSYANQKTV-HMFKDVRMIKDLDWCGYLLSSLVNTHDSWT  618
               FK  F V+     +      +A +K++  +   V  +K+++W  Y+L  L+++  +  
Sbjct  220   TDFKVKF-VLFLLCRLLCRRTKFAIRKSLLAVVAKVDNLKNMNWSKYILDHLIDSLRNQR  278

Query  617   QNTARKFPGPLLFLTLFYVDRV----EAGERNVPRANPAAHGWTKRALDAREQQEVDAGE  450
             Q    +F G ++ L + Y +      +A      R  P    W +     +  Q    G 
Sbjct  279   QRNQFEFVGCIVVLMILYFEHFCIHGDAYTALCNRHIPRVEDWDEEVWKGKVDQLKVMGV  338

Query  449   FGYGQLEEPF  420
             F   Q++  F
Sbjct  339   FNGAQVDAMF  348



>ref|XP_010238936.1| PREDICTED: uncharacterized protein LOC104584864 [Brachypodium 
distachyon]
Length=224

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 96/218 (44%), Gaps = 19/218 (9%)
 Frame = -2

Query  1229  DDTEPVHDIMSPFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRL  1050
             +D E  +++ +    +     P +++++   L  KQRK ++ +G G  L ++   L   L
Sbjct  7     EDVEDANNVEAKKQTLFNSASPMKVIKVCKLLDRKQRKKIMKVGFGSFLDIKCSKLFPEL  66

Query  1049  GHWLVSNFNPAQMAIKLSNGR--FLRITEEGVAAVLGLPNGSV-TMTERDTHMVGP--DL  885
               +L+ +F+P   A++        + I  + V  VLG+P G++  + + D+  V    DL
Sbjct  67    CKYLMDHFDPDTSALEFPEDERGIIPIIVDTVFEVLGIPKGALPVIYQYDSVSVKYVLDL  126

Query  884   LAW----RCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQ  717
             L      + K+ + +  +T    A     L    +W     C +  +T V  + N Y + 
Sbjct  127   LQVEDGRQPKISDIETRLTEMGTAEDPFLL----LWMLYVVCFLAPTTGVRVSPNCYPS-  181

Query  716   KTVHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTAR  603
                    +V  I  LDWC + ++ L+ T  +  +N  +
Sbjct  182   -----LVNVSQINKLDWCRFTINILIQTAKAKNKNCFK  214



>ref|XP_006471547.1| PREDICTED: uncharacterized protein LOC102624571 [Citrus sinensis]
Length=740

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 90/213 (42%), Gaps = 4/213 (2%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQM  1011
             P+  +R  P     ++  L+ +Q+    S+G G L+ L    L  +L  WLV   + A+ 
Sbjct  119   PKFVSRCVPKRFAVVVANLTAEQKAAACSLGFGKLIELNCGRLKKKLCDWLVDRVDIARS  178

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
              + L +G+ L ++ +    V+G+ +G + + E +  M   ++  +  +       I +  
Sbjct  179   TL-LVHGKELELSPQSFGYVMGISDGGMHV-ELNGDM--KEVSGYLDRFDATSNGINIKK  234

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             LA +    K+    FK  F +    +++  T         +   KDV  I+  +W  +  
Sbjct  235   LAEMLRESKQADDEFKVIFTLFTLHSMLCPTGGVNICSSFLLSIKDVNTIRYRNWATFCF  294

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
               L+     + Q       G LL+L + Y++ V
Sbjct  295   GRLMQGIMRYKQEKLAHIGGCLLYLQILYINSV  327



>emb|CDM80114.1| unnamed protein product [Triticum aestivum]
Length=936

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 55/231 (24%), Positives = 96/231 (42%), Gaps = 21/231 (9%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQM  1011
             P   +  RP ++V LL   S +Q+  V  IG G LL +    +   L  WLV  F+    
Sbjct  304   PPSRSAKRPRKIVELL---SEEQKGFVRKIGFGSLLSMADFEMNKALTLWLVGKFSCDTN  360

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             A++   G  + +    V +VLG+P+G + + +     V     +  C V  +        
Sbjct  361   ALEFGGGLSIPV-RPLVKSVLGIPSGPIQVVQGLE--VDYGFFSQYCSVNFKNA----RK  413

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTL----NSYANQKTVHMFKDVRMIKDLDWC  663
             LA    S+ E     +  FC+    T++A  L        N+  +   + V  +K +DWC
Sbjct  414   LAEEMCSITE-----EEPFCIAFMMTILAIYLAPNTTVLVNRSFLGAAEQVGSLKQMDWC  468

Query  662   GYLLSSLVNTHDSWTQNTA--RKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
             G++   L      + ++ A      G +  L++ ++D V+     VP   P
Sbjct  469   GFVADYLFKGIREFKESGAPFGCLKGCVHILSVIFIDLVKHAAFEVPNGFP  519



>ref|XP_004971707.1| PREDICTED: uncharacterized protein LOC101782728 [Setaria italica]
Length=694

 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 91/215 (42%), Gaps = 17/215 (8%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLR-LGHWLVSNFNPAQMAIKL  999
             R  PS     +  L+  QR+ +  +G GGLL +  + L  R L  +L    +P  M + +
Sbjct  131   RCAPSTFNSFVDHLTLWQRRRIKDMGFGGLLCVAAERLESRELLKFLFDRLDPKTMVLNV  190

Query  998   SNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL---  828
             +  + + +T   V  VL LP G   +    TH+     L+    +K   G    H L   
Sbjct  191   AKDKGIHVTPFMVKQVLDLPEGGEDIV-LSTHIQASKALS---ALKTLLGLQESHDLNAS  246

Query  827   ---ATLALSLKEGGVWFK-----RHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDL  672
                 TL   L+ G          R F ++  + L+  + ++    K V++ +D+  +  L
Sbjct  247   HLQKTLKDDLELGSGMITDDMAIRFFFIIACNKLLFPSTDNNIRCKDVYLTRDLSCLPAL  306

Query  671   DWCGYLLSSLVNTHDSWTQNTARK-FPGPLLFLTL  570
             +WC  ++  L     +W  + A+K F G  + L L
Sbjct  307   NWCKAVVDDLREAALNWQSDKAKKSFSGCAILLIL  341



>emb|CBI37409.3| unnamed protein product [Vitis vinifera]
Length=739

 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 53/244 (22%), Positives = 104/244 (43%), Gaps = 29/244 (12%)
 Frame = -2

Query  1115  DVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPN  936
             +   +G  GLL L  K L   L  W+V+N++     + ++    + +T + V  VLG+P+
Sbjct  123   NYYDMGFRGLLQLGYKELRYELITWIVANYDIGYHHLCMATRVVVPVTPKDVREVLGIPD  182

Query  935   GSVTMTERDTHMVGPDLLAWRCKVKNRKGNIT-VHALATLALSLKE--GGVWFKRHFCVV  765
                          G D+L     + NR+G     + +  L  +L++   G  F + F + 
Sbjct  183   N------------GVDIL-----IYNRRGTPNRTYDIKILEANLRDLPVGEEFMKSFLIF  225

Query  764   VASTLVASTLNSYANQKTVHMFKDVRMIKDL----DWCGYLLSSLVNTHDSWTQNTARKF  597
               +T++A      + Q+ +H   D     ++    +W  ++L  + +    +  +     
Sbjct  226   ACATILAPN----SKQEGMHDLWDTVWDSEVGVRKNWAKFVLQYVEDGIRDYRTSHPTYI  281

Query  596   PGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEVDA-GEFGYGQLEEPF  420
              G +LFL LFY+ +       V   +P +  WT   +  R   E+   G +G+ Q+ +  
Sbjct  282   RGCVLFLQLFYISKFYMTTFQVEVCSPLSAAWTDEQVKRRLAAEIHTYGNYGHVQVIQGS  341

Query  419   STSA  408
             + SA
Sbjct  342   TPSA  345



>ref|XP_002445567.1| hypothetical protein SORBIDRAFT_07g021695 [Sorghum bicolor]
 gb|EES15062.1| hypothetical protein SORBIDRAFT_07g021695 [Sorghum bicolor]
Length=852

 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/248 (22%), Positives = 102/248 (41%), Gaps = 20/248 (8%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLS--TKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAI  1005
             TR   S+   ++  LS   K R+     G G LL      +P +   WL S        +
Sbjct  15    TRQSVSKFASVIGSLSEDKKDRRH----GFGSLLLFNKCFVPKKFSKWLASVVESKSGDL  70

Query  1004  KLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALA  825
              + +G+ + +T + V  VLG+P G        +      L  +  K    + +   + L+
Sbjct  71    -IIHGKVISLTPQTVNLVLGIPLGGTPFPSNYSSGRAIVLSKFD-KTSLPQISFFANKLS  128

Query  824   TLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSS  645
              + LS +E  + F     VV     +    N   + + + +F+D+  I   DWCG++L  
Sbjct  129   EVDLSDEEVLICF----LVVSLHCFLCPNSNIVPSPRYLGVFEDIEKISSYDWCGFVLRW  184

Query  644   LVNTHDSWTQN------TARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALD  483
             +++   S+ Q       +     G + +L + Y+D V+   R +P + P    W    + 
Sbjct  185   MLDGVKSFNQGKKAGQRSCGTLGGCMFYLAVMYLDHVDFSHRRIPDSFPRIEVWKLNMI-  243

Query  482   AREQQEVD  459
              R+  ++D
Sbjct  244   -RDYSDLD  250



>gb|EMT25385.1| hypothetical protein F775_25105 [Aegilops tauschii]
Length=883

 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 93/233 (40%), Gaps = 17/233 (7%)
 Frame = -2

Query  1157  LVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLR  978
              +  L+ L+  Q+  V  +G G +L +   +    L HWL + FN +   IKL NG   +
Sbjct  58    FLIFLSNLTDDQKSLVRKLGFGSILHISCNSNVDDLFHWLAAQFNTSTCIIKLENGFKFQ  117

Query  977   ITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLA--LSLK  804
              T+  V  +LG+P G + +     H +  D          +  N T   + ++    + K
Sbjct  118   FTDNVVHKILGIPCGGLRI-----HTIPTDQTVQFMNTFLQSANATQEHIFSMISPTTTK  172

Query  803   EGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL---SSLVNT  633
             E    F R F ++  S L+A        +K  +   D+    DLD  G  L   S  +  
Sbjct  173   ED---FSRIFMLLALSILIAPNSKGVPTKKFFNALVDID--SDLDTIGANLPCPSWYIKL  227

Query  632   HDSWTQNTARKFPGPL-LFLTLFYVDRVEAGERNVP-RANPAAHGWTKRALDA  480
               S  +N     PG   L L + + + +   E  +P    P    W+   L+A
Sbjct  228   KKSDIRNNPSAMPGGCKLILVVMHFEFLITSEYKIPCNTFPRLPMWSSTMLNA  280



>dbj|BAD45718.1| hypothetical protein [Oryza sativa Japonica Group]
Length=737

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/210 (25%), Positives = 88/210 (42%), Gaps = 18/210 (9%)
 Frame = -2

Query  1049  GH---WLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNG----SVTMTERDTHMVGP  891
             GH   WL+ +FNPA   +       + + EE V +VLG+P G    S  M    T  V  
Sbjct  55    GHFFCWLMEHFNPATNQLVFPGRGAIDVNEESVKSVLGIPMGDKDVSYDMESEATEFV-L  113

Query  890   DLLAWRCKVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKT  711
             +LL       N   + ++ +L      LK     + R + +   S+++A T  +  + + 
Sbjct  114   NLLGI-----NDGISPSLTSLGIQLEKLKLADDKYLRMWIIYAISSVLAPTTATTVSPRC  168

Query  710   VHMFKDVRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNV  531
                  D   IK+L+WC +++S L     +     +      LL++ + Y+D +     NV
Sbjct  169   YPSVVDAGNIKNLNWCKFVISILQKAAKAGKNTNS----SCLLYMMILYLDSLSFKNLNV  224

Query  530   PRANPAAHGWTKRALDAREQQEVDA-GEFG  444
             P     A  WT   ++     +  A G FG
Sbjct  225   PVEGYRATVWTNELINQTILADTSADGSFG  254



>ref|XP_010651673.1| PREDICTED: uncharacterized protein LOC104879677 [Vitis vinifera]
Length=219

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 67/140 (48%), Gaps = 8/140 (6%)
 Frame = -2

Query  1196  PFPQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPA  1017
             P   ++TR  P  ++R++  L  KQ+  +  IG G LL LR + +   L  WL+++FNP 
Sbjct  82    PKLYLQTRCSPERVIRVIENLEPKQKAAIEEIGFGSLLQLRCRKIDHGLCLWLINSFNPN  141

Query  1016  QMAIKLSNGRFLRITEEGVAAVLGL--PNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNI  843
                ++L N   ++++   V  ++GL      + M +   H    DL    C   ++KG +
Sbjct  142   TYMLQLYNT-CIKLSPIDVQFIMGLRARGFKIGMNKDVGH--KNDLCKKYC---DKKGRL  195

Query  842   TVHALATLALSLKEGGVWFK  783
              +  L       KEGG  FK
Sbjct  196   PLVMLENQIREDKEGGNDFK  215



>emb|CAN71714.1| hypothetical protein VITISV_036352 [Vitis vinifera]
Length=1152

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/224 (24%), Positives = 89/224 (40%), Gaps = 15/224 (7%)
 Frame = -2

Query  1187  QIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMA  1008
             ++ TR   S  ++L   L  ++   V  +  GGLL L  K +   +  WL+++FN     
Sbjct  575   RLYTRCSSSRFLKLCNXLPPZKLDVVRDLHFGGLLHLNCKEIRHNICIWLIAHFNVGYKR  634

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             I+++  R   +T   V+ V GLP             +G  L        +  G +     
Sbjct  635   IEITFDRRYDMTAADVSLVFGLPT------------IGRILHIATTSSDHPFGTLNTCEE  682

Query  827   ATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLS  648
               L L + E    F+R F     +TL+A T      +   H   +     D++W  +++ 
Sbjct  683   RLLNLPIGEE---FRRCFIYYACATLLAPTSRIDGCRNLWHTIHEDGFRNDVNWGQFVVD  739

Query  647   SLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
              LV     + Q       G +LFL L YV + +    +VP   P
Sbjct  740   QLVEGIRRFKQGNNVWVHGCILFLQLHYVMKFKIPSVDVPXTAP  783



>gb|EMS56031.1| hypothetical protein TRIUR3_17933 [Triticum urartu]
Length=980

 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 97/231 (42%), Gaps = 25/231 (11%)
 Frame = -2

Query  1166  PSELVRLLTGLSTKQRKD------VISIGMGGLLGL-RVKALPLRLGHWLVSNFNPAQMA  1008
             P+  + L   +S  Q  D      V  IG GG+L L  ++ L L+   W++S  + ++  
Sbjct  216   PTSRISLKHAVSVIQTFDDYKKWLVEQIGFGGMLKLPALQKLSLKTSAWIMSRVSVSRRE  275

Query  1007  IKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHAL  828
             IKL + + L+   +    V G+P G  ++  RD + + P+ + +  K   +     VH+L
Sbjct  276   IKLRDNKVLKFYPQDFYKVFGIPCGHRSVKGRDAN-INPEAVHF-IKTTLQMNKTGVHSL  333

Query  827   AT----LALSLKEGGV-----WFKRHFCVVVAS-TLVASTLNSYANQKTVHMFKDVRMIK  678
                   L   + E         F+  F + V    LV +T ++Y          ++  I 
Sbjct  334   RAAEDFLMRDINENSSKLEKDCFQIAFVIFVMDHVLVPTTKHNYTTIDFWGAIANIESID  393

Query  677   DLDWCGYLLSSLVNT-----HDSWTQNTARKFPGP-LLFLTLFYVDRVEAG  543
               +WC Y+L  L++       D    N +    G  L F  +F +D ++ G
Sbjct  394   QFNWCEYVLKHLLDAVKKLKRDMMANNLSTNLTGCHLFFRQVFLLDNLDLG  444



>ref|XP_006471548.1| PREDICTED: uncharacterized protein LOC102624847 [Citrus sinensis]
Length=601

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 89/213 (42%), Gaps = 4/213 (2%)
 Frame = -2

Query  1190  PQIETRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQM  1011
             P+  +R  P     ++  L+ +Q+    S+G G L+ L    L  +L  WLV   + A+ 
Sbjct  119   PKFVSRCVPKRFAVVVANLTAEQKAAACSLGFGKLIELNCGRLKKKLCDWLVDRVDIARS  178

Query  1010  AIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
              + L +G+ L ++ +    V+G+ +G + + E D      ++  +  +       I +  
Sbjct  179   TL-LVHGKELELSPQSFGYVMGISDGGMHV-ELDGD--KKEVSGYLDRFDATSNGINIKK  234

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
             LA +    K+    FK  F +    +++  T         +   KDV  I+  +W  +  
Sbjct  235   LAEMLRESKQADDEFKVIFTLFTLHSMLCPTGGVNICSSFLLSIKDVNTIRYRNWATFCF  294

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRV  552
               L+     + Q       G LL+L + Y++ V
Sbjct  295   GRLMQGIMRYKQEKLAHIGGCLLYLQILYINSV  327



>ref|XP_010645948.1| PREDICTED: uncharacterized protein LOC100853025 [Vitis vinifera]
Length=517

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 110/293 (38%), Gaps = 36/293 (12%)
 Frame = -2

Query  1178  TRGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKL  999
             TR   +   +L   L   + + +  +  GGLL L    +   L  +L+ +FN     I+ 
Sbjct  155   TRCSAARFKKLCNRLPEAKIQAIRDLQFGGLLNLNCTEVRHNLCIFLIQHFNVGFRRIEF  214

Query  998   SNGRFLRITEEGVAAVLGLP----NGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHA  831
             S  +   +T   V  +LGLP    N  VT T  D H  G                 T+ A
Sbjct  215   SAQKHYPVTATDVGLILGLPTEGRNLQVTSTSSD-HPFG-----------------TIRA  256

Query  830   LATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLL  651
                  L L  G   F+R F     +TL+A T      +   H   +     D++W  ++L
Sbjct  257   CEEKLLDLPVGEE-FRRAFIYYACATLLAPTSRLNGCRNLWHTIHEDGFRNDVNWAQFVL  315

Query  650   SSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQ  471
               LV     + Q+             L YV + +     VP   P A  WT   +  R  
Sbjct  316   DQLVEGIRRYQQSKTS---------WLHYVIKFKIPSVQVPFTVPPALAWTDDLIKRRLV  366

Query  470   QEV-DAGEFGYGQLEEPFSTSASRPRC---RSSVEQTRYGRADSRPQPVHQGH  324
              E+ + G FG+ +++     S +  R     ++V+      A++  +  HQ H
Sbjct  367   AEIKEFGAFGHAEIDFASQRSPTVERTMEPETNVDHDTNVDAENSDEIWHQYH  419



>ref|NP_001046962.2| Os02g0517900 [Oryza sativa Japonica Group]
 dbj|BAF08876.2| Os02g0517900 [Oryza sativa Japonica Group]
Length=296

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/222 (21%), Positives = 101/222 (45%), Gaps = 17/222 (8%)
 Frame = -2

Query  1163  SELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRF  984
              +L  L + +  +Q++ V  +G  GLL +R+  L  + G W++   +P+   +   +   
Sbjct  5     KQLADLFSDIGDQQKELVRQMGFDGLLSMRLTKLNKQFGAWILCKLDPSSGNLFAGSKHE  64

Query  983   LRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV--KNRKGNITVHALA-----  825
             + +T E V+ +LG+P G   +     + V  D+ A+ C++  K+    IT+  +      
Sbjct  65    ICLTCEDVSLLLGIPCGRKQILPAIKNEV-KDVKAYMCEIFEKDSFDGITIATIQRILEK  123

Query  824   --TLALSLKEGGVWFKRHFCVVVASTLVA-STLNSYANQKTVHMFKDVRMIKDLDWCGYL  654
               T  +++ E  V FK  F + V +  +A  ++N++ + + +    DV  I   +W  ++
Sbjct  124   KFTRTMTVHEQIV-FKTAFIIFVVTKFLAPQSVNNHISIRYMKALVDVENIHKYNWAEFV  182

Query  653   LSSLVNTHDSWTQNTARK-----FPGPLLFLTLFYVDRVEAG  543
             L  + +   +       +       G ++   LFY+  ++ G
Sbjct  183   LHEIKDAAAALQDKIRHRKSIGYINGCIILPELFYLHHLDFG  224



>ref|XP_002454270.1| hypothetical protein SORBIDRAFT_04g027776 [Sorghum bicolor]
 gb|EES07246.1| hypothetical protein SORBIDRAFT_04g027776 [Sorghum bicolor]
Length=960

 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/241 (21%), Positives = 96/241 (40%), Gaps = 21/241 (9%)
 Frame = -2

Query  1151  RLLTGLSTKQRKDVIS-IGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLSNGRFLRI  975
             +L   +  +  K V+   G G LL      +P +   WL S    ++    +  G+ + +
Sbjct  88    KLSLAMQAQDHKAVVRRYGFGSLLLFDKCFVPKKFSKWLAS-LVESKSGDLIVQGKVISL  146

Query  974   TEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALSLKEGG  795
             T + V  VLG+P G              D  A +  V ++ G  T+  ++     LK   
Sbjct  147   TAQSVNLVLGIPVGGTPFPS--------DYSAGKDYVLSKIGKTTLPQVSFFVDKLKAAD  198

Query  794   V---WFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLV-----  639
             +        F VV     +    N   + + + +F+D+  I   DW G++L  L+     
Sbjct  199   LNDEVLLVCFLVVALHCFLCPNSNIVPSPRYLGVFEDIEHINSYDWSGFVLRWLLDGVKN  258

Query  638   -NTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPAAHGWTKRALDAREQQEV  462
              N  +  ++       G + +L + Y+D V+   R +P + P    W +  +  R+  ++
Sbjct  259   FNKGNKASEKHCGTLAGCMFYLAVVYLDHVDFSHRRLPDSFPRIDVWKQNMI--RDFSDL  316

Query  461   D  459
             D
Sbjct  317   D  317



>emb|CAN68470.1| hypothetical protein VITISV_028193 [Vitis vinifera]
Length=588

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = -2

Query  869  KVKNRKGNITVHALATLALSLKEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKDV  690
            K  ++KG + +  L       KEGG  FK  F + V   L+  T+  + N+  +H+ +D+
Sbjct  151  KYCDKKGRLPLVMLENQIREDKEGGNDFKVRFVLFVLGALLCPTMKLFVNRSFLHLVEDI  210

Query  689  RMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTL  570
              IK ++W  ++LS LV+  + + +       G LLFL L
Sbjct  211  BSIKKMNWAEFVLSYLVHGIEEFKKKQQSGVCGCLLFLML  250



>gb|EMS61417.1| hypothetical protein TRIUR3_05443 [Triticum urartu]
Length=895

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/228 (24%), Positives = 96/228 (42%), Gaps = 28/228 (12%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P  + +++  LS +Q+  V  IG G LL +    +   L  WLV  F+    A++  
Sbjct  78    RCSPHLIPQIVGLLSEEQKGFVRKIGFGSLLSMADFEINKALTLWLVGRFSCETEALEFE  137

Query  995   NGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLA  816
              G  + +    V ++LG+P+G + + +       P       KV+  K            
Sbjct  138   GGVSIPV-RPLVKSILGIPSGPIPVVQ------SPYSHFSSTKVRKAK-----------E  179

Query  815   LSLKEGGVWFKRHFC----VVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCG----  660
             L+ +  G+  +  FC    +V+ +  +A       N+  +   + V  +K +DWCG    
Sbjct  180   LAEEMCGITEEEPFCTAFMMVILAIYLAPNTTMLVNRSLLGAAQKVGNLKQMDWCGFVAD  239

Query  659   YLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANP  516
             YLL  L+   +S       K  G +  L++ ++D V+  E  VP   P
Sbjct  240   YLLKGLMEFKESDAPFVLLK--GCVHILSVIFIDHVKHAEFQVPNGFP  285



>ref|XP_002453254.1| hypothetical protein SORBIDRAFT_04g002605 [Sorghum bicolor]
 gb|EES06230.1| hypothetical protein SORBIDRAFT_04g002605 [Sorghum bicolor]
Length=742

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 85/204 (42%), Gaps = 11/204 (5%)
 Frame = -2

Query  1043  WLVSNFNPAQMAIKLSNGRFLRITEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKV  864
             WLV N +     + +     +++    V  +LGLP G     + + +      +  +C  
Sbjct  2     WLVKNVDGESEELVIPGRGKIKVNAAAVNRILGLPMGE-DEVKYEFNGSAISFINEKCSF  60

Query  863   KNRKGNITVHALATLALSL---KEGGVWFKRHFCVVVASTLVASTLNSYANQKTVHMFKD  693
              N +      A+ T+   L   KE    + R + +V  ST +  +     + K      D
Sbjct  61    DNGRS----PAITTITERLCANKEANDDYLRCWLMVAISTFLCGSTALCISPKCYPSLVD  116

Query  692   VRMIKDLDWCGYLLSSLVNTHDSWTQNTARKFPGPLLFLTLFYVDRVEAGERNVPRANPA  513
             +  +K+L+WC +++ +L  +     +  +    G L FL++ Y+D +E G   VP   P 
Sbjct  117   LSKVKELNWCKFVVDTLKGSVGKMHKKDS--VLGCLYFLSILYLDSLEVGNIQVPEKQPR  174

Query  512   AHGWTKRALDAREQQEVDA-GEFG  444
                W  + ++   + + +  G FG
Sbjct  175   VAAWNMKLINKVIKMDTNTNGTFG  198



>ref|XP_008666045.1| PREDICTED: uncharacterized protein LOC103644648 [Zea mays]
Length=450

 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -2

Query  1175  RGRPSELVRLLTGLSTKQRKDVISIGMGGLLGLRVKALPLRLGHWLVSNFNPAQMAIKLS  996
             R  P + ++L+  LS + + +V++ G GGLL  +   L  +L  WL+   NP  M +++ 
Sbjct  375   RCSPGKFIKLVNALSDELKSEVVAKGFGGLLRFKSHLLSRKLLSWLMRKLNPETMKLEIG  434

Query  995   NGRFLRITEEGVAAVL  948
              G+ + ITE  V  VL
Sbjct  435   GGKEIPITEHSVWCVL  450



>ref|XP_002462213.1| hypothetical protein SORBIDRAFT_02g021835 [Sorghum bicolor]
 gb|EER98734.1| hypothetical protein SORBIDRAFT_02g021835 [Sorghum bicolor]
Length=436

 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 52/219 (24%), Positives = 104/219 (47%), Gaps = 18/219 (8%)
 Frame = -2

Query  1148  LLTGLSTKQRKDVI-SIGMGGLLGLRVKAL-PLRLGHWLVSNFNPAQMAIKLSNGRFLRI  975
             ++  LS +QR+  +    +  LL +++ +  P  L  WL  + +P  MA+++  G+ L+I
Sbjct  1     MMKILSEEQRRVFVRGYNLSSLLDIKLTSSGPPSLLKWLYDHIDPNTMALRVGPGKELKI  60

Query  974   TEEGVAAVLGLPNGSVTMTERDTHMVGPDLLAWRCKVKNRKGNITVHALATLALS---LK  804
             T+E V  VLG+ +   ++++  ++    +      K++N + N+T     T+ +    ++
Sbjct  61    TKEVVHYVLGVSSKGQSISDNASYTARVNEAK---KLRN-ELNVTNAKDFTVKVCTNRIQ  116

Query  803   EGGV--WFKRHFCVVVASTLVASTLNSYANQKTVHMFKDVRMIKDLDWCGYLLSSLVNTH  630
             +GG     KR F +V+ + L  S  +   N   +    D+    ++DWC  +   LV   
Sbjct  117   QGGTDDLTKRCFFLVLFNRLFFSIASWQINNAEIGKTMDMSNFDNIDWCHMIYQHLVYVV  176

Query  629   DSW-----TQNTARKFPGPLLFLTLFYVDRVE--AGERN  534
               W      + TA    G    + L+Y+D ++  AG +N
Sbjct  177   KMWHEKTDEEQTAYTIWGCSTVILLYYLDWLDHPAGPKN  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5403850482906