BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25787_g1_i1 len=2429 path=[13441:0-343 11810:344-414 13855:415-458
13899:459-489 13929:490-492 @13244@!:493-705 14143:706-709
11969:710-808 14243:809-821 14256:822-894 14329:895-916
20757:917-932 9322:933-970 14403:971-986 14419:987-1131
14564:1132-1137 14570:1138-1163 14595:1164-1191 @13350@!:1192-1622
21452:1623-1678 10120:1679-1704 10146:1705-1712 10154:1713-1802
15224:1803-1820 9820:1821-1876 10591:1877-1961 10676:1962-2021
13188:2022-2056 15477:2057-2072 11346:2073-2098 19129:2099-2126
15546:2127-2223 12023:2224-2237 12037:2238-2280 7968:2281-2304
7992:2305-2428]

Length=2429
                                                                      Score     E

ref|XP_009790257.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    823   0.0      
ref|XP_009790256.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    822   0.0      
ref|XP_009790258.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    820   0.0      
ref|XP_009602701.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    817   0.0      
ref|XP_009607629.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    812   0.0      
ref|XP_009607627.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    803   0.0      
ref|XP_006343804.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    798   0.0      
ref|XP_004245476.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    788   0.0      
ref|XP_010325332.1|  PREDICTED: uncharacterized protein LOC101244...    775   0.0      
emb|CDP12202.1|  unnamed protein product                                764   0.0      
ref|XP_011070360.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    742   0.0      
ref|XP_002263667.2|  PREDICTED: methyltransferase-like protein 17...    738   0.0      Vitis vinifera
emb|CBI34552.3|  unnamed protein product                                740   0.0      
ref|XP_006439273.1|  hypothetical protein CICLE_v10019764mg             717   0.0      
ref|XP_011026826.1|  PREDICTED: methyltransferase-like protein 17...    716   0.0      
ref|XP_006476328.1|  PREDICTED: methyltransferase-like protein 17...    715   0.0      
gb|KDP25245.1|  hypothetical protein JCGZ_20401                         711   0.0      
ref|XP_004511078.1|  PREDICTED: methyltransferase-like protein 17...    711   0.0      
ref|XP_007039452.1|  Methyltransferases,copper ion binding isoform 1    710   0.0      
ref|XP_008388377.1|  PREDICTED: methyltransferase-like protein 17...    709   0.0      
gb|KHG27770.1|  Methyltransferase-like protein 17, mitochondrial        706   0.0      
ref|XP_002518877.1|  cytochrome C oxidase assembly protein cox11,...    705   0.0      Ricinus communis
ref|XP_009359576.1|  PREDICTED: methyltransferase-like protein 17...    704   0.0      
ref|XP_010055995.1|  PREDICTED: methyltransferase-like protein 17...    702   0.0      
ref|XP_007133679.1|  hypothetical protein PHAVU_011G200000g             701   0.0      
ref|XP_008390311.1|  PREDICTED: methyltransferase-like protein 17...    700   0.0      
gb|EYU33507.1|  hypothetical protein MIMGU_mgv1a004118mg                700   0.0      
ref|XP_009344049.1|  PREDICTED: methyltransferase-like protein 17...    698   0.0      
ref|XP_010676849.1|  PREDICTED: methyltransferase-like protein 17...    696   0.0      
ref|XP_004161453.1|  PREDICTED: methyltransferase-like protein 17...    696   0.0      
ref|XP_004143852.1|  PREDICTED: methyltransferase-like protein 17...    694   0.0      
ref|XP_010278481.1|  PREDICTED: methyltransferase-like protein 17...    692   0.0      
ref|XP_004300486.1|  PREDICTED: methyltransferase-like protein 17...    689   0.0      
ref|XP_008437428.1|  PREDICTED: methyltransferase-like protein 17...    687   0.0      
ref|XP_007209115.1|  hypothetical protein PRUPE_ppa005403mg             685   0.0      
ref|XP_006594363.1|  PREDICTED: methyltransferase-like protein 17...    686   0.0      
gb|KHN37711.1|  Methyltransferase-like protein 17, mitochondrial        684   0.0      
gb|AET02450.2|  ribosomal methyltransferase                             679   0.0      
ref|XP_004511080.1|  PREDICTED: methyltransferase-like protein 17...    668   0.0      
ref|XP_003627974.1|  RSM22-like protein                                 664   0.0      
gb|EPS63995.1|  hypothetical protein M569_10786                         658   0.0      
ref|XP_010106345.1|  Methyltransferase-like protein 17                  657   0.0      
ref|XP_008388378.1|  PREDICTED: rsm22-cox11 tandem protein 2, mit...    654   0.0      
ref|XP_006439272.1|  hypothetical protein CICLE_v10019764mg             652   0.0      
gb|KDO76648.1|  hypothetical protein CISIN_1g012511mg                   649   0.0      
ref|XP_009344050.1|  PREDICTED: methyltransferase-like protein 17...    645   0.0      
ref|XP_009358659.1|  PREDICTED: methyltransferase-like protein 17...    638   0.0      
ref|XP_002299443.2|  hypothetical protein POPTR_0001s11080g             634   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008775004.1|  PREDICTED: methyltransferase-like protein 17...    634   0.0      
ref|XP_006857863.1|  hypothetical protein AMTR_s00069p00083920          635   0.0      
ref|XP_009397843.1|  PREDICTED: 37S ribosomal protein S22, mitoch...    631   0.0      
ref|XP_010919278.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    627   0.0      
ref|XP_010533560.1|  PREDICTED: uncharacterized protein LOC104809...    627   0.0      
ref|XP_010418535.1|  PREDICTED: methyltransferase-like protein 17...    625   0.0      
ref|XP_010430603.1|  PREDICTED: methyltransferase-like protein 17...    624   0.0      
ref|XP_010533559.1|  PREDICTED: uncharacterized protein LOC104809...    622   0.0      
ref|XP_003571978.2|  PREDICTED: 37S ribosomal protein S22, mitoch...    620   0.0      
gb|EMT26597.1|  Protein RSM22-like protein, mitochondrial               616   0.0      
dbj|BAK06673.1|  predicted protein                                      615   0.0      
ref|NP_176641.2|  copper ion binding / methyltransferase                612   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK32955.1|  hypothetical protein AALP_AA6G311300                    612   0.0      
ref|XP_007039453.1|  Methyltransferases,copper ion binding isoform 2    607   0.0      
ref|XP_002465050.1|  hypothetical protein SORBIDRAFT_01g031290          609   0.0      Sorghum bicolor [broomcorn]
ref|XP_009112845.1|  PREDICTED: rsm22-cox11 tandem protein 2, mit...    610   0.0      
ref|XP_002887871.1|  hypothetical protein ARALYDRAFT_474886             609   0.0      
ref|XP_006302082.1|  hypothetical protein CARUB_v10020069mg             606   0.0      
emb|CDY08387.1|  BnaC09g12090D                                          613   0.0      
emb|CDY47833.1|  BnaA09g12120D                                          613   0.0      
ref|XP_010278482.1|  PREDICTED: methyltransferase-like protein 17...    593   0.0      
tpg|DAA45965.1|  TPA: hypothetical protein ZEAMMB73_551244              595   0.0      
ref|XP_007039454.1|  Methyltransferases,copper ion binding isoform 3    590   0.0      
ref|XP_010496921.1|  PREDICTED: methyltransferase-like protein 17...    569   0.0      
ref|XP_006661965.1|  PREDICTED: methyltransferase-like protein 17...    552   0.0      
gb|EEC81814.1|  hypothetical protein OsI_25549                          551   0.0      Oryza sativa Indica Group [Indian rice]
gb|EEE58133.1|  hypothetical protein OsJ_09036                          550   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006391603.1|  hypothetical protein EUTSA_v10023366mg             550   0.0      
ref|NP_001059414.2|  Os07g0297300                                       539   1e-179   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55405.1|  Rsm22-cox11 tandem protein 2, mitochondrial             538   2e-178   
dbj|BAC84790.1|  unknown protein                                        541   3e-178   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009358660.1|  PREDICTED: methyltransferase-like protein 17...    523   1e-175   
gb|KDO76650.1|  hypothetical protein CISIN_1g012511mg                   520   3e-174   
ref|XP_004986868.1|  PREDICTED: LOW QUALITY PROTEIN: 5-oxoprolina...    523   2e-161   
gb|AAF19677.1|AC009519_11  F1N19.17                                     475   1e-154   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775005.1|  PREDICTED: rsm22-cox11 tandem protein 2, mit...    459   6e-151   
gb|KDO76651.1|  hypothetical protein CISIN_1g012511mg                   435   2e-142   
ref|XP_010430604.1|  PREDICTED: uncharacterized protein LOC104714...    434   3e-140   
ref|XP_010418536.1|  PREDICTED: uncharacterized protein LOC104704...    432   2e-139   
ref|XP_001777377.1|  predicted protein                                  389   2e-122   
ref|XP_008366924.1|  PREDICTED: methyltransferase-like protein 17...    373   7e-119   
tpg|DAA45964.1|  TPA: hypothetical protein ZEAMMB73_551244              357   5e-112   
ref|XP_008246152.1|  PREDICTED: methyltransferase-like protein 17...    300   7e-93    
ref|XP_002970612.1|  hypothetical protein SELMODRAFT_93775              279   6e-83    
ref|XP_002968446.1|  hypothetical protein SELMODRAFT_409261             273   2e-77    
ref|NP_001182916.1|  uncharacterized protein LOC100501202               208   1e-58    
ref|XP_002981304.1|  hypothetical protein SELMODRAFT_444842             206   3e-53    
ref|XP_002969697.1|  hypothetical protein SELMODRAFT_410587             206   3e-53    
gb|EXX74933.1|  hypothetical protein RirG_046430                        194   1e-50    
gb|ESA05301.1|  hypothetical protein GLOINDRAFT_4133                    196   1e-50    
ref|XP_008239203.1|  PREDICTED: uncharacterized protein LOC103337812    181   6e-49    
ref|XP_005649270.1|  Rsm22-domain-containing protein                    180   8e-45    
ref|XP_002683531.1|  predicted protein                                  183   2e-44    Naegleria gruberi strain NEG-M
gb|KFH64042.1|  hypothetical protein MVEG_09867                         179   4e-44    
ref|WP_025747529.1|  ribosomal small subunit Rsm22                      169   4e-43    
emb|CDH49418.1|  ribosomal small subunit rsm22                          169   4e-42    
ref|WP_031458500.1|  ribosomal small subunit Rsm22                      166   9e-42    
ref|WP_012257997.1|  MULTISPECIES: ribosomal small subunit Rsm22        161   4e-40    
ref|XP_003293336.1|  hypothetical protein DICPUDRAFT_90205              169   7e-40    
ref|WP_028457992.1|  ribosomal small subunit Rsm22                      160   9e-40    
emb|CDS03966.1|  hypothetical protein LRAMOSA06921                      162   1e-39    
ref|XP_629675.1|  hypothetical protein DDB_G0292286                     168   2e-39    Dictyostelium discoideum AX4
ref|XP_006676364.1|  hypothetical protein BATDEDRAFT_85388              162   2e-39    
ref|WP_015940294.1|  Ribosomal small subunit Rsm22                      157   1e-38    
dbj|GAM26921.1|  hypothetical protein SAMD00019534_100960               164   2e-38    
dbj|GAA93920.1|  hypothetical protein E5Q_00566                         160   4e-38    
ref|WP_015311170.1|  ribosomal methyltransferase Rsm22                  155   6e-38    
ref|XP_004360080.1|  hypothetical protein DFA_04347                     162   2e-37    
ref|WP_013297344.1|  ribosomal small subunit Rsm22                      153   2e-37    
ref|WP_028338649.1|  SAM-dependent methyltransferase                    152   4e-37    
ref|WP_028334783.1|  SAM-dependent methyltransferase                    152   5e-37    
ref|WP_026871664.1|  hypothetical protein                               152   7e-37    
ref|WP_007008136.1|  methyltransferase type 11                          149   4e-36    
ref|WP_014102941.1|  hypothetical protein                               149   5e-36    
ref|WP_025029960.1|  methyltransferase type 11                          149   5e-36    
gb|EFA75703.1|  hypothetical protein PPL_10756                          157   6e-36    Polysphondylium pallidum PN500
ref|XP_009494599.1|  hypothetical protein H696_02422                    157   6e-36    
ref|WP_011523832.1|  hypothetical protein                               148   1e-35    
ref|WP_037318191.1|  rRNA methyltransferase                             148   1e-35    
ref|WP_014758265.1|  MULTISPECIES: Ribosomal small subunit Rsm22        148   1e-35    
ref|WP_009755668.1|  methyltransferase type 11                          148   1e-35    
ref|WP_006563275.1|  Ribosomal small subunit Rsm22                      147   2e-35    
ref|WP_018273382.1|  hypothetical protein                               147   3e-35    
ref|WP_023711948.1|  MULTISPECIES: methyltransferase type 11            147   4e-35    
ref|WP_027048809.1|  methyltransferase type 11                          147   4e-35    
ref|WP_023831142.1|  methyltransferase type 11                          147   5e-35    
ref|WP_023672718.1|  MULTISPECIES: methyltransferase type 11            146   5e-35    
ref|WP_008594811.1|  methyltransferase type 11                          146   7e-35    
gb|EAR83105.2|  small ribosomal subunit Rsm22                           150   8e-35    Tetrahymena thermophila SB210
ref|WP_021076035.1|  serine O-acetyltransferase                         146   8e-35    
ref|WP_027581283.1|  SAM-dependent methyltransferase                    145   1e-34    
ref|WP_023715067.1|  MULTISPECIES: methyltransferase type 11            145   1e-34    
ref|WP_023738601.1|  MULTISPECIES: methyltransferase type 11            145   1e-34    
ref|WP_016839703.1|  hypothetical protein                               145   1e-34    
ref|WP_023727354.1|  methyltransferase type 11                          145   1e-34    
ref|WP_028134864.1|  SAM-dependent methyltransferase                    145   1e-34    
ref|WP_023805668.1|  methyltransferase type 11                          145   1e-34    
ref|WP_023731143.1|  methyltransferase type 11                          145   2e-34    
ref|WP_023733856.1|  MULTISPECIES: methyltransferase type 11            145   2e-34    
gb|EPB84449.1|  hypothetical protein HMPREF1544_08813                   148   2e-34    
ref|WP_023695601.1|  MULTISPECIES: methyltransferase type 11            145   2e-34    
gb|EJN13843.1|  ribosomal methyltransferase Rsm22                       145   2e-34    
ref|WP_038386043.1|  SAM-dependent methyltransferase                    145   2e-34    
ref|WP_035965373.1|  SAM-dependent methyltransferase                    144   2e-34    
ref|WP_023689116.1|  methyltransferase type 11                          144   3e-34    
ref|WP_023693971.1|  MULTISPECIES: methyltransferase type 11            144   4e-34    
ref|WP_023685683.1|  MULTISPECIES: methyltransferase type 11            144   4e-34    
ref|WP_023742311.1|  methyltransferase type 11                          143   6e-34    
ref|WP_011315812.1|  hypothetical protein                               144   7e-34    
ref|XP_002787836.1|  conserved hypothetical protein                     146   8e-34    Perkinsus marinus ATCC 50983
ref|WP_029083726.1|  SAM-dependent methyltransferase                    143   9e-34    
ref|WP_024508263.1|  SAM-dependent methyltransferase                    142   1e-33    
ref|XP_002786781.1|  conserved hypothetical protein                     147   2e-33    Perkinsus marinus ATCC 50983
ref|WP_028158226.1|  SAM-dependent methyltransferase                    142   2e-33    
gb|ETI38572.1|  hypothetical protein F443_15726                         144   2e-33    
gb|ETL32239.1|  hypothetical protein L916_15159                         144   2e-33    
emb|CEG70544.1|  hypothetical protein RMATCC62417_06421                 144   2e-33    
ref|WP_018454932.1|  ribosomal methyltransferase Rsm22                  142   3e-33    
emb|CEJ04110.1|  hypothetical protein RMCBS344292_18078                 144   3e-33    
ref|WP_028150715.1|  SAM-dependent methyltransferase                    141   3e-33    
ref|XP_008895281.1|  hypothetical protein PPTG_04748                    144   3e-33    
ref|WP_027516415.1|  SAM-dependent methyltransferase                    141   4e-33    
gb|EIE89802.1|  hypothetical protein RO3G_14513                         143   4e-33    
ref|XP_002905473.1|  conserved hypothetical protein                     143   5e-33    
ref|WP_035699865.1|  SAM-dependent methyltransferase                    140   5e-33    
ref|XP_003890042.1|  hypothetical protein, variant                      145   5e-33    
ref|WP_020631958.1|  hypothetical protein                               140   6e-33    
ref|XP_002900712.1|  conserved hypothetical protein                     143   6e-33    
ref|WP_027045352.1|  methyltransferase type 11                          140   7e-33    
emb|CEI92948.1|  hypothetical protein RMCBS344292_07193                 142   7e-33    
gb|KDE09055.1|  hypothetical protein MVLG_00773                         147   7e-33    
ref|WP_011474779.1|  hypothetical protein                               140   8e-33    
ref|WP_015467675.1|  hypothetical protein                               140   1e-32    
ref|XP_002156246.2|  PREDICTED: methyltransferase-like protein 17...    143   1e-32    
ref|XP_004027486.1|  mitochondrial ribosomal protein s22, putative      142   1e-32    
ref|XP_788426.2|  PREDICTED: methyltransferase-like protein 17, m...    142   1e-32    Strongylocentrotus purpuratus [purple urchin]
ref|WP_013788606.1|  ribosomal small subunit Rsm22                      139   1e-32    
ref|WP_018648826.1|  ribosomal methyltransferase Rsm22                  139   1e-32    
ref|WP_023773387.1|  MULTISPECIES: methyltransferase type 11            139   2e-32    
gb|KFD53044.1|  hypothetical protein M513_06160                         142   2e-32    
ref|WP_024576024.1|  MULTISPECIES: SAM-dependent methyltransferase      139   2e-32    
ref|WP_012564120.1|  type 11 methyltransferase                          139   2e-32    
ref|WP_034308140.1|  rRNA methyltransferase                             139   2e-32    
ref|WP_037335441.1|  rRNA methyltransferase                             139   2e-32    
ref|WP_038520669.1|  rRNA methyltransferase                             139   2e-32    
ref|WP_009735331.1|  methyltransferase                                  139   2e-32    
emb|CDW55232.1|  Rsm22 domain containing protein                        142   2e-32    
ref|XP_002905459.1|  conserved hypothetical protein                     141   2e-32    
ref|XP_008483408.1|  PREDICTED: methyltransferase-like protein 17...    141   3e-32    
ref|WP_027543649.1|  SAM-dependent methyltransferase                    138   3e-32    
ref|WP_027568583.1|  SAM-dependent methyltransferase                    138   3e-32    
gb|ETO67343.1|  hypothetical protein F444_15704                         140   4e-32    
ref|WP_015318512.1|  methyltransferase type 11                          138   5e-32    
ref|WP_027577018.1|  SAM-dependent methyltransferase                    138   5e-32    
ref|WP_028346965.1|  SAM-dependent methyltransferase                    137   6e-32    
ref|WP_023819180.1|  methyltransferase type 11                          137   6e-32    
ref|WP_007033483.1|  rRNA methylase                                     138   6e-32    
emb|CCA19192.1|  conserved hypothetical protein                         140   6e-32    
ref|WP_023743794.1|  methyltransferase type 11                          137   6e-32    
ref|WP_023705362.1|  MULTISPECIES: methyltransferase type 11            137   7e-32    
ref|WP_002714702.1|  hypothetical protein                               137   7e-32    
ref|WP_023814946.1|  methyltransferase type 11                          137   8e-32    
ref|XP_009538787.1|  hypothetical protein PHYSODRAFT_342126             142   9e-32    
ref|WP_024580463.1|  SAM-dependent methyltransferase                    137   1e-31    
ref|WP_028179393.1|  MULTISPECIES: SAM-dependent methyltransferase      137   1e-31    
ref|XP_001030768.1|  hypothetical protein TTHERM_01016080               140   1e-31    Tetrahymena thermophila
ref|WP_027034477.1|  methyltransferase type 11                          137   1e-31    
ref|WP_016337675.1|  rRNA methylase                                     137   1e-31    
emb|CDX41362.1|  Ribosomal small subunit Rsm22                          136   2e-31    
ref|WP_023782883.1|  methyltransferase type 11                          136   2e-31    
ref|WP_027529184.1|  SAM-dependent methyltransferase                    136   2e-31    
ref|XP_006012130.1|  PREDICTED: methyltransferase-like protein 17...    137   2e-31    
ref|XP_002905496.1|  conserved hypothetical protein                     138   2e-31    
ref|WP_028736064.1|  methyltransferase type 11                          136   2e-31    
ref|WP_014436240.1|  hypothetical protein                               136   2e-31    
ref|WP_023813754.1|  methyltransferase type 11                          136   2e-31    
ref|WP_006340740.1|  hypothetical protein                               136   2e-31    
ref|WP_015687957.1|  hypothetical protein                               136   2e-31    
gb|KFD69815.1|  hypothetical protein M514_17937                         142   3e-31    
ref|XP_009824740.1|  hypothetical protein, variant                      137   3e-31    
ref|WP_029354405.1|  methyltransferase type 11                          135   3e-31    
ref|WP_012920114.1|  rRNA methyltransferase                             135   3e-31    
emb|CDX19175.1|  Ribosomal small subunit Rsm22                          135   3e-31    
ref|WP_022090457.1|  ribosomal small subunit Rsm22                      135   3e-31    
ref|WP_027026335.1|  methyltransferase type 11                          135   3e-31    
ref|WP_011085282.1|  hypothetical protein                               135   4e-31    
ref|WP_023761613.1|  methyltransferase type 11                          135   4e-31    
ref|WP_011176435.1|  hypothetical protein                               135   4e-31    
ref|WP_038645711.1|  methyltransferase type 11                          135   4e-31    
ref|XP_008113590.1|  PREDICTED: methyltransferase-like protein 17...    138   4e-31    
ref|WP_038967972.1|  SAM-dependent methyltransferase                    135   4e-31    
ref|WP_027057636.1|  methyltransferase type 11                          135   5e-31    
ref|WP_019857262.1|  methyltransferase type 11                          135   5e-31    
ref|WP_013924087.1|  hypothetical protein                               135   5e-31    
ref|WP_007608918.1|  methyltransferase type 11                          135   5e-31    
ref|WP_005165201.1|  Methyltransferase                                  135   6e-31    
gb|KGG52427.1|  hypothetical protein DI09_173p10                        138   6e-31    
gb|KGJ67969.1|  hypothetical protein BJA5080_01132                      135   6e-31    
ref|WP_024513745.1|  SAM-dependent methyltransferase                    135   6e-31    
ref|WP_028175023.1|  MULTISPECIES: SAM-dependent methyltransferase      135   6e-31    
ref|XP_009824739.1|  hypothetical protein H257_02690                    137   6e-31    
ref|WP_024919400.1|  MULTISPECIES: SAM-dependent methyltransferase      135   6e-31    
ref|WP_027558139.1|  MULTISPECIES: SAM-dependent methyltransferase      134   7e-31    
ref|WP_022114440.1|  ribosomal small subunit Rsm22                      134   7e-31    
ref|WP_027165531.1|  methyltransferase type 11                          134   7e-31    
ref|WP_029584836.1|  SAM-dependent methyltransferase                    134   8e-31    
emb|CDX60092.1|  Ribosomal small subunit Rsm22                          134   8e-31    
ref|WP_012497676.1|  ribosomal small subunit Rsm22                      134   1e-30    
ref|WP_009798865.1|  hypothetical protein                               134   1e-30    
ref|WP_032929562.1|  methyltransferase type 11                          134   1e-30    
ref|XP_006262271.1|  PREDICTED: methyltransferase-like protein 17...    135   1e-30    
ref|XP_008863699.1|  hypothetical protein H310_02082                    134   1e-30    
ref|WP_019172090.1|  hypothetical protein                               134   2e-30    
ref|WP_013896309.1|  methyltransferase type 11                          134   2e-30    
ref|WP_010915164.1|  methyltransferase type 11                          133   2e-30    
ref|WP_006331509.1|  hypothetical protein                               133   2e-30    
ref|WP_006019003.1|  hypothetical protein                               133   2e-30    
emb|CDX33800.1|  Ribosomal small subunit Rsm22                          134   2e-30    
emb|CDX21864.1|  Ribosomal small subunit Rsm22                          133   2e-30    
emb|CDX24111.1|  Ribosomal small subunit Rsm22                          133   2e-30    
ref|WP_007607087.1|  ribosomal methyltransferase Rsm22                  133   2e-30    
ref|XP_954501.1|  hypothetical protein                                  136   2e-30    Theileria annulata strain Ankara
ref|WP_039360649.1|  hypothetical protein                               132   3e-30    
ref|WP_006203707.1|  methyltransferase type 11                          132   3e-30    
ref|WP_027053305.1|  methyltransferase type 11                          133   3e-30    
ref|WP_024341486.1|  SAM-dependent methyltransferase                    132   3e-30    
ref|XP_006038937.1|  PREDICTED: methyltransferase-like protein 17...    133   3e-30    
ref|WP_011160024.1|  hypothetical protein                               132   3e-30    
emb|CCI39860.1|  unnamed protein product                                134   4e-30    
gb|KIC70832.1|  hypothetical protein DB44_FM00060                       132   4e-30    
ref|WP_023779651.1|  methyltransferase type 11                          132   4e-30    
gb|ETE61969.1|  Methyltransferase-like protein 17, mitochondrial        134   5e-30    
emb|CDW87251.1|  mitochondrial ribosomal protein                        135   5e-30    
emb|CCI39859.1|  unnamed protein product                                134   6e-30    
ref|WP_039146511.1|  SAM-dependent methyltransferase                    132   6e-30    
ref|XP_009266855.1|  hypothetical protein J056_003357                   136   7e-30    
gb|KFM70279.1|  Methyltransferase-like protein 17, mitochondrial        134   7e-30    
ref|XP_005371040.1|  PREDICTED: methyltransferase-like protein 17...    134   7e-30    
ref|WP_027037980.1|  methyltransferase type 11                          131   7e-30    
ref|XP_005371041.1|  PREDICTED: methyltransferase-like protein 17...    134   8e-30    
ref|WP_014889528.1|  ribosomal small subunit Rsm22                      132   8e-30    
ref|WP_023719834.1|  methyltransferase type 11                          131   8e-30    
gb|EMS20336.1|  3-methyl-2-oxobutanoate hydroxymethyltransferase        136   9e-30    
ref|XP_005685443.1|  PREDICTED: methyltransferase-like protein 17...    133   9e-30    
gb|ENN79731.1|  hypothetical protein YQE_03787                          134   9e-30    
ref|WP_027144127.1|  methyltransferase type 11                          131   1e-29    
ref|WP_027553822.1|  SAM-dependent methyltransferase                    131   1e-29    
ref|WP_013532524.1|  methyltransferase type 11                          131   1e-29    
ref|WP_036037189.1|  SAM-dependent methyltransferase                    131   1e-29    
ref|XP_005685444.1|  PREDICTED: methyltransferase-like protein 17...    133   1e-29    
ref|WP_027162701.1|  methyltransferase type 11                          130   2e-29    
ref|WP_024504322.1|  methyltransferase type 11                          130   2e-29    
ref|XP_005087091.1|  PREDICTED: methyltransferase-like protein 17...    132   2e-29    
ref|WP_014497378.1|  hypothetical protein                               130   2e-29    
ref|XP_004010426.1|  PREDICTED: methyltransferase-like protein 17...    132   2e-29    
ref|XP_006161499.1|  PREDICTED: methyltransferase-like protein 17...    132   2e-29    
ref|XP_003514664.1|  PREDICTED: LOW QUALITY PROTEIN: methyltransf...    132   3e-29    
ref|WP_012119666.1|  rRNA methyltransferase                             130   3e-29    
ref|WP_032124776.1|  hypothetical protein                               130   3e-29    
ref|WP_036006325.1|  SAM-dependent methyltransferase                    130   3e-29    
ref|WP_024348916.1|  methyltransferase type 11                          130   3e-29    
ref|WP_009340347.1|  Ribosomal small subunit Rsm22                      130   3e-29    
ref|WP_025090534.1|  methyltransferase type 11                          129   4e-29    
ref|WP_006467369.1|  methyltransferase                                  129   4e-29    
ref|XP_007537895.1|  PREDICTED: methyltransferase-like protein 17...    131   4e-29    
ref|WP_011501615.1|  hypothetical protein                               129   4e-29    
ref|WP_011958440.1|  rRNA methyltransferase                             130   4e-29    
ref|WP_023677713.1|  methyltransferase type 11                          129   4e-29    
ref|XP_004830047.1|  mitochondrial small ribosomal subunit Rsm22 ...    132   5e-29    
ref|WP_027486117.1|  methyltransferase type 11                          129   5e-29    
dbj|BAE33043.1|  unnamed protein product                                131   5e-29    
ref|XP_007442030.1|  PREDICTED: methyltransferase-like protein 17...    131   6e-29    
ref|WP_036024849.1|  SAM-dependent methyltransferase                    129   6e-29    
ref|NP_001025161.1|  methyltransferase-like protein 17, mitochond...    131   6e-29    
gb|KDR11155.1|  RSM22-like protein, mitochondrial                       131   6e-29    
ref|WP_009208673.1|  methyltransferase type 11                          129   6e-29    
ref|WP_035094927.1|  hypothetical protein                               129   6e-29    
ref|WP_021587000.1|  methyltransferase                                  129   7e-29    
emb|CEG08930.1|  Ketopantoate hydroxymethyltransferase                  129   8e-29    
ref|WP_022343814.1|  ribosomal small subunit Rsm22                      128   8e-29    
gb|KDQ14022.1|  hypothetical protein BOTBODRAFT_66460                   133   8e-29    
gb|KDQ63035.1|  hypothetical protein JAAARDRAFT_146949                  134   8e-29    
ref|XP_002501037.1|  predicted protein                                  133   8e-29    
ref|XP_005960941.1|  PREDICTED: methyltransferase-like protein 17...    130   8e-29    
ref|XP_005960940.1|  PREDICTED: methyltransferase-like protein 17...    130   8e-29    
ref|XP_007612250.1|  PREDICTED: methyltransferase-like protein 17...    130   9e-29    
emb|CDO73157.1|  hypothetical protein BN946_scf185007.g212              132   1e-28    
ref|XP_010636159.1|  PREDICTED: methyltransferase-like protein 17...    130   1e-28    
ref|WP_036291703.1|  ribosomal small subunit Rsm22                      128   1e-28    
ref|XP_007360537.1|  Rsm22-domain-containing protein                    132   1e-28    
ref|WP_027152680.1|  methyltransferase type 11                          128   1e-28    
ref|WP_039386194.1|  hypothetical protein                               128   1e-28    
ref|WP_028098721.1|  hypothetical protein                               127   1e-28    
ref|XP_008032684.1|  hypothetical protein TRAVEDRAFT_138473             132   1e-28    
ref|WP_018684931.1|  hypothetical protein                               127   1e-28    
ref|XP_010887975.1|  PREDICTED: methyltransferase-like protein 17...    129   2e-28    
ref|WP_019998237.1|  hypothetical protein                               127   2e-28    
gb|EDL42278.1|  methyltransferase 11 domain containing 1, isoform...    129   2e-28    
ref|WP_033408131.1|  rRNA methyltransferase                             128   2e-28    
ref|XP_006062112.1|  PREDICTED: methyltransferase-like protein 17...    129   2e-28    
ref|WP_036309645.1|  ribosomal small subunit Rsm22                      127   2e-28    
ref|WP_002716619.1|  hypothetical protein                               127   2e-28    
ref|XP_007180557.1|  PREDICTED: methyltransferase-like protein 17...    129   3e-28    
ref|WP_013504338.1|  Ribosomal small subunit Rsm22                      127   3e-28    
gb|ESY63355.1|  methyltransferase type 11                               126   3e-28    
ref|XP_009066481.1|  hypothetical protein LOTGIDRAFT_229745             130   3e-28    
ref|WP_031148780.1|  rRNA methyltransferase                             127   3e-28    
ref|XP_008582345.1|  PREDICTED: methyltransferase-like protein 17...    129   3e-28    
ref|XP_010837729.1|  PREDICTED: methyltransferase-like protein 17...    129   3e-28    
ref|WP_007876084.1|  ribosomal small subunit Rsm22                      127   3e-28    
ref|WP_023800712.1|  methyltransferase type 11                          127   3e-28    
ref|WP_028167443.1|  SAM-dependent methyltransferase                    126   4e-28    
ref|XP_010599297.1|  PREDICTED: methyltransferase-like protein 17...    129   4e-28    
ref|NP_001120620.1|  methyltransferase like 17                          128   4e-28    
ref|XP_010887965.1|  PREDICTED: methyltransferase-like protein 17...    129   4e-28    
ref|XP_007844452.1|  3-methyl-2-oxobutanoate hydroxymethyltransfe...    130   4e-28    
ref|XP_007567514.1|  PREDICTED: methyltransferase-like protein 17...    127   4e-28    
ref|XP_223974.4|  PREDICTED: methyltransferase-like protein 17, m...    128   4e-28    
ref|XP_007091413.1|  PREDICTED: methyltransferase-like protein 17...    128   4e-28    
ref|XP_006996844.1|  PREDICTED: methyltransferase-like protein 17...    128   4e-28    
ref|WP_025038149.1|  SAM-dependent methyltransferase                    126   4e-28    
ref|WP_011511622.1|  methyltransferase type 12                          127   5e-28    
ref|WP_030389991.1|  rRNA methyltransferase                             126   5e-28    
ref|WP_035037688.1|  hypothetical protein                               126   5e-28    
tpg|DAA25482.1|  TPA: protein RSM22 homolog, mitochondrial precursor    128   5e-28    
ref|NP_001033631.1|  methyltransferase-like protein 17, mitochond...    128   5e-28    
ref|XP_005900634.1|  PREDICTED: methyltransferase-like protein 17...    128   5e-28    
ref|XP_007449544.1|  PREDICTED: methyltransferase-like protein 17...    128   6e-28    
ref|WP_030723488.1|  rRNA methyltransferase                             126   6e-28    
ref|XP_005629480.1|  PREDICTED: methyltransferase like 17               127   6e-28    
ref|WP_018408143.1|  Ribosomal small subunit Rsm22                      126   6e-28    
ref|WP_009365162.1|  methyltransferase                                  125   7e-28    
ref|XP_007390869.1|  hypothetical protein PHACADRAFT_248077             129   7e-28    
ref|WP_035025646.1|  MULTISPECIES: methyltransferase type 11            125   7e-28    
ref|WP_008507018.1|  methyltransferase                                  125   7e-28    
gb|KDD74790.1|  mitochondrial small ribosomal subunit Rsm22             127   7e-28    
ref|WP_022567958.1|  methyltransferase                                  125   8e-28    
ref|XP_004482352.1|  PREDICTED: methyltransferase-like protein 17...    126   8e-28    
ref|XP_007567513.1|  PREDICTED: methyltransferase-like protein 17...    127   8e-28    
gb|EDL42277.1|  methyltransferase 11 domain containing 1, isoform...    127   8e-28    
ref|WP_030507848.1|  rRNA methyltransferase                             126   8e-28    
ref|WP_033444584.1|  hypothetical protein                               124   8e-28    
ref|WP_008936169.1|  MULTISPECIES: methyltransferase                    125   9e-28    
ref|XP_006190896.1|  PREDICTED: methyltransferase-like protein 17...    127   9e-28    
ref|WP_030770616.1|  MULTISPECIES: rRNA methyltransferase               125   9e-28    
ref|XP_003987473.1|  PREDICTED: methyltransferase like 17               127   9e-28    
ref|WP_018430183.1|  hypothetical protein                               125   9e-28    
ref|WP_015358502.1|  MULTISPECIES: ribosomal small subunit Rsm22        125   9e-28    
ref|XP_006190897.1|  PREDICTED: methyltransferase-like protein 17...    127   9e-28    
ref|XP_010947978.1|  PREDICTED: methyltransferase-like protein 17...    127   1e-27    
ref|XP_007104840.1|  PREDICTED: methyltransferase-like protein 17...    127   1e-27    
ref|WP_007595023.1|  ribosomal methyltransferase Rsm22                  125   1e-27    
ref|XP_004341527.1|  methyltransferase domain containing protein        127   1e-27    
ref|WP_029650030.1|  ribosomal small subunit Rsm22                      125   1e-27    
ref|WP_030431596.1|  rRNA methyltransferase                             125   1e-27    
ref|WP_037959564.1|  rRNA methyltransferase                             125   1e-27    
gb|KIC75332.1|  hypothetical protein DB42_AJ00200                       125   1e-27    
ref|XP_004482349.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_007661834.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_007449545.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_004672409.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_002131121.2|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_003260989.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_003260990.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_001142880.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
gb|EPT03482.1|  hypothetical protein FOMPIDRAFT_1115974                 128   2e-27    
ref|XP_008625713.1|  hypothetical protein YYE_03846                     127   2e-27    
ref|WP_024899386.1|  methyltransferase type 11                          124   2e-27    
ref|WP_018323316.1|  ribosomal methyltransferase Rsm22                  124   2e-27    
ref|XP_006720298.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
emb|CDP53659.1|  Methyltransferase                                      123   2e-27    
ref|XP_004320092.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_004274119.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|NP_073571.1|  methyltransferase-like protein 17, mitochondria...    126   2e-27    
ref|XP_007479826.1|  PREDICTED: methyltransferase-like protein 17...    126   2e-27    
ref|XP_004078634.1|  PREDICTED: methyltransferase-like protein 17...    126   3e-27    
ref|XP_003978289.1|  PREDICTED: methyltransferase-like protein 17...    125   3e-27    
ref|WP_038956563.1|  SAM-dependent methyltransferase                    124   3e-27    
ref|WP_031146156.1|  rRNA methyltransferase                             124   3e-27    
ref|XP_004482350.1|  PREDICTED: methyltransferase-like protein 17...    126   3e-27    
ref|WP_038935357.1|  SAM-dependent methyltransferase                    124   3e-27    
gb|EHH63402.1|  hypothetical protein EGM_16365                          125   3e-27    
ref|WP_030967436.1|  rRNA methyltransferase                             124   3e-27    
ref|WP_033261605.1|  rRNA methyltransferase                             124   3e-27    
ref|XP_008333153.1|  PREDICTED: methyltransferase-like protein 17...    125   3e-27    
ref|WP_015799707.1|  methyltransferase                                  124   3e-27    
ref|WP_006195809.1|  hypothetical protein                               123   3e-27    
ref|XP_007265329.1|  Rsm22-domain-containing protein                    127   3e-27    
ref|XP_004892774.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
gb|EHH27693.1|  hypothetical protein EGK_17958                          125   4e-27    
ref|XP_001093161.1|  PREDICTED: protein RSM22 homolog, mitochondr...    125   4e-27    
ref|XP_004054910.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
ref|NP_001025162.1|  methyltransferase-like protein 17, mitochond...    125   4e-27    
ref|WP_009718437.1|  rRNA methyltransferase                             124   4e-27    
ref|WP_006088499.1|  hypothetical protein                               123   4e-27    
ref|WP_002964677.1|  MULTISPECIES: methyltransferase                    123   4e-27    
ref|WP_028141695.1|  MULTISPECIES: SAM-dependent methyltransferase      124   4e-27    
ref|XP_004054909.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
emb|CDZ79773.1|  Ketopantoate hydroxymethyltransferase                  123   4e-27    
ref|XP_004865080.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
ref|XP_004892775.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
ref|XP_004402204.1|  PREDICTED: methyltransferase-like protein 17...    125   4e-27    
ref|WP_038972152.1|  SAM-dependent methyltransferase                    123   5e-27    
ref|XP_005560779.1|  PREDICTED: methyltransferase-like protein 17...    125   5e-27    
ref|XP_004865081.1|  PREDICTED: methyltransferase-like protein 17...    125   5e-27    
ref|WP_004691538.1|  MULTISPECIES: methyltransferase                    123   5e-27    
ref|XP_009247150.1|  PREDICTED: methyltransferase-like protein 17...    125   5e-27    
ref|XP_007861584.1|  hypothetical protein GLOTRDRAFT_123898             126   6e-27    
gb|KEZ35948.1|  ribosomal methyltransferase Rsm22                       123   6e-27    
gb|AAK08201.1|  false p73 target protein                                125   6e-27    
ref|WP_004688621.1|  methyltransferase                                  123   6e-27    
gb|ERE89556.1|  methyltransferase-like protein 17                       125   6e-27    
ref|WP_030774296.1|  rRNA methyltransferase                             123   7e-27    
ref|XP_009054438.1|  hypothetical protein LOTGIDRAFT_239481             126   7e-27    
ref|NP_001085539.1|  methyltransferase like 17                          124   7e-27    
ref|WP_024923885.1|  MULTISPECIES: methyltransferase type 11            123   7e-27    
gb|ETK78777.1|  hypothetical protein, variant                           123   7e-27    
ref|XP_006883346.1|  PREDICTED: methyltransferase-like protein 17...    125   7e-27    
emb|CDS45949.1|  mitochondrial ribosomal protein S22 precursor, p...    125   7e-27    
gb|ETI38573.1|  hypothetical protein, variant                           123   7e-27    
gb|ETL32240.1|  hypothetical protein, variant                           123   7e-27    
ref|XP_745202.1|  hypothetical protein                                  125   7e-27    
ref|XP_010374758.1|  PREDICTED: methyltransferase-like protein 17...    124   8e-27    
gb|AAK08200.1|AF321002_1  false p73 target protein                      125   8e-27    
ref|XP_004402203.1|  PREDICTED: methyltransferase-like protein 17...    124   8e-27    
ref|WP_030730711.1|  rRNA methyltransferase                             123   8e-27    
ref|XP_008709336.1|  PREDICTED: methyltransferase-like protein 17...    124   8e-27    
ref|XP_002927871.1|  PREDICTED: LOW QUALITY PROTEIN: protein RSM2...    124   8e-27    
emb|CDQ67346.1|  unnamed protein product                                124   8e-27    
ref|XP_004390068.1|  PREDICTED: methyltransferase-like protein 17...    124   9e-27    
ref|WP_036282454.1|  ribosomal small subunit Rsm22                      122   9e-27    
ref|WP_006161284.1|  MULTISPECIES: methyltransferase                    122   9e-27    
ref|WP_037796356.1|  rRNA methyltransferase                             122   9e-27    
ref|WP_004689871.1|  ribosomal small subunit                            122   9e-27    
ref|XP_006218765.1|  PREDICTED: methyltransferase-like protein 17...    124   1e-26    
gb|KDQ31281.1|  hypothetical protein PLEOSDRAFT_1036119                 126   1e-26    
ref|WP_037354575.1|  rRNA methyltransferase                             122   1e-26    
ref|XP_006218764.1|  PREDICTED: methyltransferase-like protein 17...    124   1e-26    
gb|ETM38607.1|  hypothetical protein, variant                           122   1e-26    
ref|WP_038948307.1|  SAM-dependent methyltransferase                    122   1e-26    
ref|XP_003708527.1|  PREDICTED: methyltransferase-like protein 17...    124   1e-26    
ref|WP_030849007.1|  rRNA methyltransferase                             122   1e-26    
ref|XP_008895282.1|  hypothetical protein, variant                      122   1e-26    
ref|XP_005412132.1|  PREDICTED: methyltransferase-like protein 17...    124   1e-26    
ref|XP_003901572.2|  PREDICTED: methyltransferase-like protein 17...    125   1e-26    
gb|EKE09122.1|  ribosomal small subunit Rsm22                           122   1e-26    
gb|EKC19738.1|  RSM22-like protein, mitochondrial                       125   1e-26    
ref|WP_027507798.1|  methyltransferase type 11                          122   1e-26    
ref|XP_008333154.1|  PREDICTED: methyltransferase-like protein 17...    124   1e-26    
ref|WP_029929180.1|  methyltransferase type 11                          122   2e-26    
ref|WP_004684090.1|  MULTISPECIES: methyltransferase                    122   2e-26    
ref|XP_007988885.1|  PREDICTED: methyltransferase-like protein 17...    123   2e-26    



>ref|XP_009790257.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=523

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/522 (78%), Positives = 472/522 (90%), Gaps = 8/522 (2%)
 Frame = -1

Query  2054  LNPT------LSEAPIPMASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIK  1893
             L+PT      + +AP  MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++
Sbjct  4     LHPTANKFAGIRQAPPEMASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLR  63

Query  1892  EQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIG  1713
             EQE+PHMKRKVLRLSESF  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+SAYGDIG
Sbjct  64    EQEEPHMKRKVLRLSESFSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSAYGDIG  123

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             L+Y EDE +AYVASRMPAVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVW
Sbjct  124   LKYREDETVAYVASRMPAVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVW  183

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
             PRSL ++NLVEPSQSMQRAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASY
Sbjct  184   PRSLNRINLVEPSQSMQRAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASY  243

Query  1352  VLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
             VLGEIPSLKDRITVVRQLW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL++
Sbjct  244   VLGEIPSLKDRITVVRQLWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLED  303

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSL  993
             +SGK CKALTTLK+GA+IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  L
Sbjct  304   ASGKECKALTTLKNGAYIVAPCPHDGSCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPL  363

Query  992   RGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPsenedd  813
             RGFEDEKF ++ FRRGQRPRE WPL+GMKFETLKEQHARRNPEDLEIDYEDQF S  ++D
Sbjct  364   RGFEDEKFCFIAFRRGQRPREPWPLDGMKFETLKEQHARRNPEDLEIDYEDQFISSEDED  423

Query  812   lneeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMD  633
             + +E+ ISY+SD TE D +T+N++ E+E EET  A A+LG+GWGRI+Y+P+ RGKR+EMD
Sbjct  424   VQDEDPISYDSDVTETDAITENDDWEEEGEET--AHANLGSGWGRIIYNPLRRGKRVEMD  481

Query  632   VCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +CR+ D EGT+GSFDRI+ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  482   ICRSMDREGTEGSFDRIVITKSKNPTLHHQARRSVWGDLWPF  523



>ref|XP_009790256.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=523

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/512 (79%), Positives = 468/512 (91%), Gaps = 2/512 (0%)
 Frame = -1

Query  2042  LSEAPIPMASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRK  1863
             + +AP  MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++EQE+PHMKRK
Sbjct  14    IRQAPPEMASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLREQEEPHMKRK  73

Query  1862  VLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIA  1683
             VLRLSESF  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+SAYGDIGL+Y EDE +A
Sbjct  74    VLRLSESFSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSAYGDIGLKYREDETVA  133

Query  1682  YVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLV  1503
             YVASRMPAVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLV
Sbjct  134   YVASRMPAVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLNRINLV  193

Query  1502  EPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKD  1323
             EPSQSMQRAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKD
Sbjct  194   EPSQSMQRAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKD  253

Query  1322  RITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALT  1143
             RITVVRQLW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+++SGK CKALT
Sbjct  254   RITVVRQLWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEDASGKECKALT  313

Query  1142  TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
             TLK+GA+IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF +
Sbjct  314   TLKNGAYIVAPCPHDGSCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCF  373

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN  783
             + FRRGQRPRE WPL+GMKFETLKEQHARRNPEDLEIDYEDQF S  ++D+ +E+ ISY+
Sbjct  374   IAFRRGQRPREPWPLDGMKFETLKEQHARRNPEDLEIDYEDQFISSEDEDVQDEDPISYD  433

Query  782   SddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGT  603
             SD TE D +T+N++ E+E EET  A A+LG+GWGRI+Y+P+ RGKR+EMD+CR+ D EGT
Sbjct  434   SDVTETDAITENDDWEEEGEET--AHANLGSGWGRIIYNPLRRGKRVEMDICRSMDREGT  491

Query  602   KGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +GSFDRI+ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  492   EGSFDRIVITKSKNPTLHHQARRSVWGDLWPF  523



>ref|XP_009790258.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like isoform 
X3 [Nicotiana sylvestris]
Length=503

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/505 (80%), Positives = 464/505 (92%), Gaps = 2/505 (0%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++EQE+PHMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLREQEEPHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+SAYGDIGL+Y EDE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSAYGDIGLKYREDETVAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLNRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+++SGK CKALTTLK+GA+
Sbjct  241   LWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEDASGKECKALTTLKNGAY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF ++ FRRGQ
Sbjct  301   IVAPCPHDGSCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFIAFRRGQ  360

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevd  762
             RPRE WPL+GMKFETLKEQHARRNPEDLEIDYEDQF S  ++D+ +E+ ISY+SD TE D
Sbjct  361   RPREPWPLDGMKFETLKEQHARRNPEDLEIDYEDQFISSEDEDVQDEDPISYDSDVTETD  420

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              +T+N++ E+E EET  A A+LG+GWGRI+Y+P+ RGKR+EMD+CR+ D EGT+GSFDRI
Sbjct  421   AITENDDWEEEGEET--AHANLGSGWGRIIYNPLRRGKRVEMDICRSMDREGTEGSFDRI  478

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             +ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  479   VITKSKNPTLHHQARRSVWGDLWPF  503



>ref|XP_009602701.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=502

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/505 (80%), Positives = 460/505 (91%), Gaps = 3/505 (1%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++EQE+PHMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLREQEEPHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+S YGDIGL+Y EDE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSVYGDIGLKYREDETVAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLNRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+RK RKL+++SGK CKALTTLK+GA+
Sbjct  241   LWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRKSRKLEDASGKECKALTTLKNGAY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF ++ FRRGQ
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFIAFRRGQ  360

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevd  762
             RPRE WPL+GMKFETLKEQHARRNPEDLEIDYEDQF    ++D+ +E+ I Y+SD TE D
Sbjct  361   RPREPWPLDGMKFETLKEQHARRNPEDLEIDYEDQF-ISEDEDVQDEDPICYDSDVTETD  419

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              +T+N++ E+E EE   A ADLG+GWGRI+YSP+ RGKRIEMD+CR+ D EGT+GSFDRI
Sbjct  420   AITENDDWEEEGEEM--AHADLGSGWGRIIYSPLRRGKRIEMDICRSMDREGTEGSFDRI  477

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             +ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  478   VITKSKNPTLHHQARRSVWGDLWPF  502



>ref|XP_009607629.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like isoform 
X2 [Nicotiana tomentosiformis]
Length=502

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/505 (79%), Positives = 462/505 (91%), Gaps = 3/505 (1%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++EQE+ HMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLREQEELHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+SAYGDIGL+Y EDE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSAYGDIGLKYREDETVAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLNRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+++SGK CKALTTLK+GA+
Sbjct  241   LWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEDASGKECKALTTLKNGAY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF ++ FRRGQ
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFIAFRRGQ  360

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevd  762
             RPRE WPL+GMKFETLKEQHARRNPEDLEIDYEDQF    ++D+ +E+ ISY+SD TE D
Sbjct  361   RPREPWPLDGMKFETLKEQHARRNPEDLEIDYEDQF-ISEDEDVQDEDPISYDSDVTETD  419

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              +T+N++ E+E EET  A A+LG+GWGRI+Y+P+ RGKR+EMD+CR+ D EGT+GSFDRI
Sbjct  420   AITENDDWEEEGEET--AHANLGSGWGRIIYNPLRRGKRVEMDICRSMDREGTEGSFDRI  477

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             +ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  478   VITKSKNPTLHHQARRSVWGDLWPF  502



>ref|XP_009607627.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like isoform 
X1 [Nicotiana tomentosiformis]
Length=515

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/518 (77%), Positives = 462/518 (89%), Gaps = 16/518 (3%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VPLRLRRAIKKY++EQE+ HMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPLRLRRAIKKYLREQEELHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+VEDPLKSVECS+RWKI+SAYGDIGL+Y EDE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELVEDPLKSVECSQRWKIKSAYGDIGLKYREDETVAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLNRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+LTGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+++SGK CKALTTLK+GA+
Sbjct  241   LWELTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEDASGKECKALTTLKNGAY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF ++ FRRGQ
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFIAFRRGQ  360

Query  941   RPR-------------ETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlnee  801
             RPR             E WPL+GMKFETLKEQHARRNPEDLEIDYEDQF    ++D+ +E
Sbjct  361   RPRQVVHQEYNMPLVKEPWPLDGMKFETLKEQHARRNPEDLEIDYEDQF-ISEDEDVQDE  419

Query  800   eiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRA  621
             + ISY+SD TE D +T+N++ E+E EET  A A+LG+GWGRI+Y+P+ RGKR+EMD+CR+
Sbjct  420   DPISYDSDVTETDAITENDDWEEEGEET--AHANLGSGWGRIIYNPLRRGKRVEMDICRS  477

Query  620   SDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              D EGT+GSFDRI+ITKSKNPTLHH ARRS+WGDLWPF
Sbjct  478   MDREGTEGSFDRIVITKSKNPTLHHQARRSVWGDLWPF  515



>ref|XP_006343804.1| PREDICTED: 37S ribosomal protein S22, mitochondrial-like [Solanum 
tuberosum]
Length=503

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/505 (78%), Positives = 454/505 (90%), Gaps = 2/505 (0%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C VVP+RLRRAIKKY++EQE+PHMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHVVPIRLRRAIKKYLREQEEPHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+ EDPLKSV+CS+RWKI+SAYGDIGL+Y +DE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELFEDPLKSVDCSQRWKIKSAYGDIGLKYRDDETLAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWAVREVWPRSLSRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLKNLPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKNLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+ TGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+  SGK  KALTTLK+G +
Sbjct  241   LWEQTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEGVSGKDSKALTTLKNGVY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF ++ FRRG+
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFIAFRRGE  360

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevd  762
             RPRE WPL+ MKFETLKEQHARRNPEDLEIDYEDQF SE+ED  +E +  +Y+SD TE D
Sbjct  361   RPREPWPLDSMKFETLKEQHARRNPEDLEIDYEDQFISEDEDIQDEVDHATYDSDATETD  420

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              VT+N++ E+E EE   A ADLG GWGRI+YSP+ RGKRIEMDVCR+ + EG++GSF+RI
Sbjct  421   AVTENDDWEEEGEEK--AHADLGGGWGRIIYSPLRRGKRIEMDVCRSMNQEGSEGSFERI  478

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             +ITKSKNPTLHH ARRSLWGDLWPF
Sbjct  479   VITKSKNPTLHHQARRSLWGDLWPF  503



>ref|XP_004245476.1| PREDICTED: 37S ribosomal protein S22, mitochondrial isoform X2 
[Solanum lycopersicum]
Length=503

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/505 (77%), Positives = 453/505 (90%), Gaps = 2/505 (0%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VP+RLRRAIKKY++EQE+PHMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPIRLRRAIKKYLREQEEPHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+ EDPLKSV+CS+RWKI+SAYGDIGL+Y +DE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELFEDPLKSVDCSQRWKIKSAYGDIGLKYRDDETLAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWAVREVWPRSLSRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLK+LPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKSLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+ TGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+  SGK  KALTTLK+G +
Sbjct  241   LWEQTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEGVSGKDSKALTTLKNGVY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RT+SQRAYKRS G  LRGFEDEKF ++ FRRG+
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTSSQRAYKRSKGEPLRGFEDEKFCFIAFRRGE  360

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevd  762
             RP+E WPL+ MKFETLKEQHARRNPEDLEIDYEDQF SE+E   +E + ++Y+SD TE D
Sbjct  361   RPKEPWPLDSMKFETLKEQHARRNPEDLEIDYEDQFISEDEGIEDEVDHVTYDSDATETD  420

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              VT+N++ E+E EE     ADLG GWGRI+YSP+ RGKRIEMDVCR+ + EG++GSF+RI
Sbjct  421   AVTENDDWEEEGEER--THADLGGGWGRIIYSPLRRGKRIEMDVCRSINQEGSEGSFERI  478

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             +ITKS+NPTLHH ARRSLWGDLWPF
Sbjct  479   VITKSRNPTLHHQARRSLWGDLWPF  503



>ref|XP_010325332.1| PREDICTED: uncharacterized protein LOC101244401 isoform X1 [Solanum 
lycopersicum]
Length=528

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/530 (73%), Positives = 453/530 (85%), Gaps = 27/530 (5%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SETVPKFTAEAL++AAKQS+ C +VP+RLRRAIKKY++EQE+PHMKRKVLRLSES
Sbjct  1     MASIVSETVPKFTAEALKSAAKQSERCHIVPIRLRRAIKKYLREQEEPHMKRKVLRLSES  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NL+LPT+TSKE+ EDPLKSV+CS+RWKI+SAYGDIGL+Y +DE +AYVASRMP
Sbjct  61    FSQIKEVNLMLPTSTSKELFEDPLKSVDCSQRWKIKSAYGDIGLKYRDDETLAYVASRMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL ++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRLPGFSPAKVLDFGAGTGSAFWAVREVWPRSLSRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L +GLK+LPLI SY S+QALSQ++KKS+RQHDLVIASYVLGEIPSLKDRITVVRQ
Sbjct  181   RAGQSLIKGLKSLPLIQSYGSIQALSQDVKKSDRQHDLVIASYVLGEIPSLKDRITVVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LW+ TGD+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+  SGK  KALTTLK+G +
Sbjct  241   LWEQTGDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKLEGVSGKDSKALTTLKNGVY  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPL+ +GKYCHFVQRL+RT+SQRAYKRS G  LRGFEDEKF ++ FRRG+
Sbjct  301   IVAPCPHDGRCPLDNTGKYCHFVQRLQRTSSQRAYKRSKGEPLRGFEDEKFCFIAFRRGE  360

Query  941   RP-------------------------RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQ  837
             RP                         +E WPL+ MKFETLKEQHARRNPEDLEIDYEDQ
Sbjct  361   RPKQVLLQEYGMPIVNLFLACSIITIVKEPWPLDSMKFETLKEQHARRNPEDLEIDYEDQ  420

Query  836   FPseneddlneeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPIC  657
             F SE+E   +E + ++Y+SD TE D VT+N++ E+E EE     ADLG GWGRI+YSP+ 
Sbjct  421   FISEDEGIEDEVDHVTYDSDATETDAVTENDDWEEEGEER--THADLGGGWGRIIYSPLR  478

Query  656   RGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             RGKRIEMDVCR+ + EG++GSF+RI+ITKS+NPTLHH ARRSLWGDLWPF
Sbjct  479   RGKRIEMDVCRSINQEGSEGSFERIVITKSRNPTLHHQARRSLWGDLWPF  528



>emb|CDP12202.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/507 (75%), Positives = 445/507 (88%), Gaps = 5/507 (1%)
 Frame = -1

Query  2021  MASRLSET-VPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS +S T VP+FTA+ LR+AAK S  C VVP+RLRRAIKKY++E+EDPHMKRKVL LSE
Sbjct  1     MASSVSGTIVPRFTADTLRSAAKLSQGCHVVPVRLRRAIKKYLREKEDPHMKRKVLSLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  +KE NLLLPT+TSKE+VEDPLKS++ SKRWKI+SAYGDIGL+Y +DE IAYVASRM
Sbjct  61    SFHEVKEVNLLLPTSTSKELVEDPLKSMQSSKRWKIKSAYGDIGLKYRDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVY+A YRVLSEV+RR+PDFSPAKVLDFGAGTGSA WA+REVWP+S++K+NL+EPSQSM
Sbjct  121   PAVYAACYRVLSEVKRRLPDFSPAKVLDFGAGTGSAMWALREVWPKSMEKINLIEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L + LK+LP I SY S+QAL+Q+I KS RQHDLVIASYVLGEIPSLKDRITVVR
Sbjct  181   QRAGQRLIKDLKDLPFIQSYGSIQALTQSISKSERQHDLVIASYVLGEIPSLKDRITVVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLTGD+L+L+EPGTP+GSNIISQ+RSHILWME RK RKL+ +S KS K+L T+KSGA
Sbjct  241   QLWDLTGDVLILIEPGTPEGSNIISQMRSHILWMESRKIRKLESASHKSSKSLITMKSGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FIVAPCPHDG CPL  +GKYCHFVQRLERTTSQRAYKRS G  LRG+EDEKFSYV FRRG
Sbjct  301   FIVAPCPHDGRCPLYNTGKYCHFVQRLERTTSQRAYKRSRGKPLRGYEDEKFSYVAFRRG  360

Query  944   QRP-RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddte  768
             +RP RE WPL+GMKF+TLKEQHA+R+PEDLEIDYEDQ  SE +DD  E+ ++SYNSD TE
Sbjct  361   RRPSREPWPLDGMKFDTLKEQHAKRSPEDLEIDYEDQIESEVDDDEQEQNLVSYNSDITE  420

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
              D +TD++  E+ +E      AD+G+GWGRI+YSPI RGKR+EMDVCRA++ +GT+G FD
Sbjct  421   TDAITDDDSGEEAEER---GRADVGSGWGRIIYSPIRRGKRVEMDVCRATNRDGTEGFFD  477

Query  587   RIIITKSKNPTLHHHARRSLWGDLWPF  507
             RI++T+SKNPTLHH ARRSLWGDLWPF
Sbjct  478   RIVVTQSKNPTLHHQARRSLWGDLWPF  504



>ref|XP_011070360.1| PREDICTED: 37S ribosomal protein S22, mitochondrial [Sesamum 
indicum]
 ref|XP_011070361.1| PREDICTED: 37S ribosomal protein S22, mitochondrial [Sesamum 
indicum]
Length=515

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/506 (71%), Positives = 425/506 (84%), Gaps = 2/506 (0%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             M+S +SET+PKFTAEAL+ AAKQS+ C +VP+RLR AIKKY++EQE  HM+RKVL LS+S
Sbjct  1     MSSAISETLPKFTAEALKLAAKQSERCHIVPVRLRHAIKKYLQEQEATHMRRKVLSLSQS  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKE NLLLP++TSKE+VEDPLK++ECS+RWK+++AYGD+GL Y+ED+ +AYVA+RMP
Sbjct  61    FNGIKEVNLLLPSSTSKELVEDPLKAMECSQRWKVKTAYGDVGLTYQEDQTVAYVAARMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVL+EVRRRVPDF+PAKVLDFGAGTGSA WAM EVWP SL+++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLNEVRRRVPDFTPAKVLDFGAGTGSALWAMMEVWPGSLERINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L + L+ LPLI SY S+Q+L+++I KS R+HDLVIASYVLGEIPSLKDRIT+VRQ
Sbjct  181   RAGQSLVKDLRKLPLIQSYDSIQSLTKDINKSGRRHDLVIASYVLGEIPSLKDRITLVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LWDLT DILVLVEPGTPQGSNIISQ+RSHILWME+R+ RKL+ ++ K+ K L TLK+GAF
Sbjct  241   LWDLTADILVLVEPGTPQGSNIISQMRSHILWMEKRRTRKLQHAANKASKDLMTLKTGAF  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDGPCPL  + KYCHFVQRLERT+SQR YKRS  G LRGFEDEKF YV FRRG 
Sbjct  301   IVAPCPHDGPCPLHNTDKYCHFVQRLERTSSQRLYKRSK-GPLRGFEDEKFCYVAFRRGT  359

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN-Sddtev  765
             RPRE WPL+GMKFETLK+ HA+R PEDLE++ E QF SE   + + E+      S D++ 
Sbjct  360   RPREPWPLDGMKFETLKQMHAKRVPEDLEVEVESQFGSEAAQNDDYEKDDENTVSYDSDY  419

Query  764   dtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDR  585
                       DE EE     ADLG+GWGRIVY PI RGKR+E+DVCRA++ EGT+GSFDR
Sbjct  420   SETDAAAGESDEDEEEDVPRADLGSGWGRIVYMPIRRGKRVELDVCRATNSEGTEGSFDR  479

Query  584   IIITKSKNPTLHHHARRSLWGDLWPF  507
             ++IT+SKNPTLHH ARRSLWGDLWP 
Sbjct  480   VVITQSKNPTLHHQARRSLWGDLWPL  505



>ref|XP_002263667.2| PREDICTED: methyltransferase-like protein 17, mitochondrial [Vitis 
vinifera]
Length=510

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/510 (71%), Positives = 434/510 (85%), Gaps = 5/510 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MA+ + ET  + FT EALR+AAKQS+ C +VP+RLRRAIKK+++EQE+PHMKRKVLRLSE
Sbjct  1     MAALVPETAQRIFTPEALRSAAKQSERCHIVPVRLRRAIKKFLREQEEPHMKRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NLLL  +TS+E+VEDPLKS+E SKRWKI+SAYGDIGL+Y +DE +AYVASRM
Sbjct  61    SFCEIKDVNLLLTASTSRELVEDPLKSMERSKRWKIKSAYGDIGLKYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVLSEVRRR+P FSPA VLDFG+GTGSA WA+REVWPR+L+++NLVEPS+SM
Sbjct  121   PAVYSACYRVLSEVRRRLPGFSPAGVLDFGSGTGSALWALREVWPRTLERINLVEPSKSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QR  Q L +  KNLPLIHSY S+QAL+QNI KS R+HDLVIASYVLGEIPSLKDRIT+VR
Sbjct  181   QRVSQSLIQDQKNLPLIHSYDSIQALTQNISKSEREHDLVIASYVLGEIPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RK +++S +  K    LK GA
Sbjct  241   QLWDLTRDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKNEDASDEVSKDKMALKGGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             +IVAPCPHDGPCPLEK+GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF +V F+RG
Sbjct  301   YIVAPCPHDGPCPLEKTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFVAFKRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtev  765
             QRPRE WPL+GMKF+TLKEQHA+RNPEDLEID+EDQF  E+ED   +E+ +SY+SD  E 
Sbjct  361   QRPREPWPLDGMKFDTLKEQHAKRNPEDLEIDFEDQFQLEDEDIPYQEDPVSYDSDVIET  420

Query  764   dt----vtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKG  597
                     + EE E+E+ +     ADLG+GWGRI+++P+ RGK++ MDVCRA++ EG++G
Sbjct  421   AAIDDDNEEEEEEEEEEGDEETTNADLGSGWGRIIFTPVRRGKQVAMDVCRATNREGSEG  480

Query  596   SFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             SFDR++IT+SKNPTLH  ARRSLWGDLWPF
Sbjct  481   SFDRVVITQSKNPTLHRQARRSLWGDLWPF  510



>emb|CBI34552.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/510 (71%), Positives = 434/510 (85%), Gaps = 5/510 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MA+ + ET  + FT EALR+AAKQS+ C +VP+RLRRAIKK+++EQE+PHMKRKVLRLSE
Sbjct  76    MAALVPETAQRIFTPEALRSAAKQSERCHIVPVRLRRAIKKFLREQEEPHMKRKVLRLSE  135

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NLLL  +TS+E+VEDPLKS+E SKRWKI+SAYGDIGL+Y +DE +AYVASRM
Sbjct  136   SFCEIKDVNLLLTASTSRELVEDPLKSMERSKRWKIKSAYGDIGLKYRDDETVAYVASRM  195

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVLSEVRRR+P FSPA VLDFG+GTGSA WA+REVWPR+L+++NLVEPS+SM
Sbjct  196   PAVYSACYRVLSEVRRRLPGFSPAGVLDFGSGTGSALWALREVWPRTLERINLVEPSKSM  255

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QR  Q L +  KNLPLIHSY S+QAL+QNI KS R+HDLVIASYVLGEIPSLKDRIT+VR
Sbjct  256   QRVSQSLIQDQKNLPLIHSYDSIQALTQNISKSEREHDLVIASYVLGEIPSLKDRITIVR  315

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVLVEPGTPQGSNIISQ+RSHILWME+R+ RK +++S +  K    LK GA
Sbjct  316   QLWDLTRDVLVLVEPGTPQGSNIISQMRSHILWMEKRRSRKNEDASDEVSKDKMALKGGA  375

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             +IVAPCPHDGPCPLEK+GKYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKF +V F+RG
Sbjct  376   YIVAPCPHDGPCPLEKTGKYCHFVQRLQRTTSQRAYKRSKGEPLRGFEDEKFCFVAFKRG  435

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtev  765
             QRPRE WPL+GMKF+TLKEQHA+RNPEDLEID+EDQF  E+ED   +E+ +SY+SD  E 
Sbjct  436   QRPREPWPLDGMKFDTLKEQHAKRNPEDLEIDFEDQFQLEDEDIPYQEDPVSYDSDVIET  495

Query  764   dt----vtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKG  597
                     + EE E+E+ +     ADLG+GWGRI+++P+ RGK++ MDVCRA++ EG++G
Sbjct  496   AAIDDDNEEEEEEEEEEGDEETTNADLGSGWGRIIFTPVRRGKQVAMDVCRATNREGSEG  555

Query  596   SFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             SFDR++IT+SKNPTLH  ARRSLWGDLWPF
Sbjct  556   SFDRVVITQSKNPTLHRQARRSLWGDLWPF  585



>ref|XP_006439273.1| hypothetical protein CICLE_v10019764mg [Citrus clementina]
 gb|ESR52513.1| hypothetical protein CICLE_v10019764mg [Citrus clementina]
Length=512

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/514 (70%), Positives = 432/514 (84%), Gaps = 11/514 (2%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             M S + ET  K FTAE LR+AAKQS+ C +VP+RLRRAIK+Y++EQE+PHMKRKVLRLSE
Sbjct  1     MVSLIPETTQKIFTAETLRSAAKQSEGCLIVPVRLRRAIKRYLREQEEPHMKRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK  NL L  +TSKE+ EDPLKSVE SKRWKI+SAYGDIGL+Y +DE IAYVASRM
Sbjct  61    SFNAIKGVNLTLTESTSKELFEDPLKSVEQSKRWKIKSAYGDIGLKYRDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL+KVNLVEPSQSM
Sbjct  121   PAVYSACYRVLCEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLEKVNLVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L +GLK+LPLIHSY+S+QAL+++I KS R+HDLVIASYVLGE+PSL+DRIT+VR
Sbjct  181   QRAGQSLMQGLKDLPLIHSYNSIQALNKDISKSEREHDLVIASYVLGEVPSLQDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL-----KESSGKSCKALTT  1140
             QLWDLT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RK      K+++ ++ K L T
Sbjct  241   QLWDLTRDVLVLVEPGTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDTNKETSKDLVT  300

Query  1139  LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYV  960
             L+SG  IVAPCPH+G CPLE SGKYCHFVQRL+RTTSQRAYKRS    LRGFEDEKFS+V
Sbjct  301   LRSGVHIVAPCPHEGRCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLRGFEDEKFSFV  360

Query  959   VFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiS  789
              FRRG+RPRE WPL+GMKF+TLKEQHA+RNPEDLEIDYED    + E ++    +E++++
Sbjct  361   AFRRGERPRERWPLDGMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEVEPCKKEDLVN  420

Query  788   YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHE  609
             Y SD+ + DTV  +++ E  +EET    ADLG GWGRI++SP+ RG+++ MDVCR+   +
Sbjct  421   YESDEVQDDTVDSDKDQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVAMDVCRSIKRD  478

Query  608   GTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             G++GSF  ++ T+SKNPTLH  A++SLWGDLWPF
Sbjct  479   GSEGSFQHLVFTRSKNPTLHRLAKKSLWGDLWPF  512



>ref|XP_011026826.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Populus 
euphratica]
Length=505

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/509 (70%), Positives = 419/509 (82%), Gaps = 8/509 (2%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + ET  K FTAE LR+A KQSD C +VP+RLRRAIKKY++EQE+PHMK+KVLRLSE
Sbjct  1     MASLIPETTKKLFTAENLRSATKQSDRCLIVPVRLRRAIKKYLREQEEPHMKKKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL+L   TSKE+VEDP KS+E SKRWKI+S+YGDIGL Y +DE IAYVASRM
Sbjct  61    SFSDIKDKNLMLGINTSKELVEDPFKSMERSKRWKIKSSYGDIGLSYRDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV+SA YRVLSEVRRR+P FSP K+LDFGAGTGSAFWA+REVWP+SLQKVNLVEPSQSM
Sbjct  121   PAVFSACYRVLSEVRRRLPGFSPTKILDFGAGTGSAFWAIREVWPKSLQKVNLVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L + LKNLPLIHSY+SLQ LS+ I KS R+HDLVIASYVLGEIPSLKDRIT+VR
Sbjct  181   QRAGRSLIQDLKNLPLIHSYNSLQDLSKTIHKSERKHDLVIASYVLGEIPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LTGD+LVL+EPGTP G  IISQ+RSHILWME+RKC K +    ++CK L   K GA
Sbjct  241   QLWELTGDVLVLIEPGTPHGFGIISQMRSHILWMEKRKCGKAEGKVNETCKDLVPYKGGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             F++APC HDG CPL KSGKYCHFVQRL+RTTSQRAYKRS G +LRGFEDEKFS+V FRRG
Sbjct  301   FVIAPCSHDGSCPLVKSGKYCHFVQRLQRTTSQRAYKRSKGETLRGFEDEKFSFVAFRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYED---QFPseneddlneeeiiSYNSdd  774
             QRPR+ WPL+GM+FETLKEQHA+RNPEDLEIDYED   Q   E E    E + + Y+S  
Sbjct  361   QRPRKPWPLDGMRFETLKEQHAKRNPEDLEIDYEDLIEQNQPEEEVPYEEVDPVYYDS--  418

Query  773   tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGS  594
                   TD  +  DE+E+   A ADLG GWGRIV+SP  RG+++ +DVCR+++ + ++GS
Sbjct  419   --DVIETDTNDDNDEEEQEEEAHADLGGGWGRIVFSPFKRGRQVTLDVCRSNNRDNSEGS  476

Query  593   FDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             F+RI++TKSK+P LH+ ARRS WGDLWPF
Sbjct  477   FERIVVTKSKSPALHYQARRSHWGDLWPF  505



>ref|XP_006476328.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Citrus sinensis]
Length=512

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/514 (70%), Positives = 432/514 (84%), Gaps = 11/514 (2%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + ET  K FTAE LR+AAKQS+ C +VP+RLRRAIK+Y++EQE+PHMKRKVLRLSE
Sbjct  1     MASLIPETTKKIFTAETLRSAAKQSEGCLIVPVRLRRAIKRYLREQEEPHMKRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK  NL L  +TSKE+ EDPLKSVE SKRWKI+SAYGDIGL+Y +DE IAYVASRM
Sbjct  61    SFNAIKGVNLTLMESTSKELFEDPLKSVEQSKRWKIKSAYGDIGLKYRDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL+KVNLVEPSQSM
Sbjct  121   PAVYSACYRVLCEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLEKVNLVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L +G K+LPLIHSY+S+QAL+++I KS R+HDLVIASYVLGE+PSL+DRIT+VR
Sbjct  181   QRAGQSLMQGPKDLPLIHSYNSIQALNKDISKSEREHDLVIASYVLGEVPSLQDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL-----KESSGKSCKALTT  1140
             QLWDLT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RK      K+++ ++ K L T
Sbjct  241   QLWDLTRDVLVLVEPGTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDTNKETSKDLVT  300

Query  1139  LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYV  960
             L+SG  IVAPCPH+G CPLE SGKYCHFVQRL+RTTSQRAYKRS    LRGFEDEKFS+V
Sbjct  301   LRSGVHIVAPCPHEGRCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLRGFEDEKFSFV  360

Query  959   VFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiS  789
              FRRG+RPRE WPL+GMKF+TLKEQHA+RNPEDLEIDYED    + E ++    +E++++
Sbjct  361   AFRRGERPRERWPLDGMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEVEPCKKEDLVN  420

Query  788   YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHE  609
             Y SD+ + DTV  +++ E  +EET    ADLG GWGRI++SP+ RG+++ MDVCR+   +
Sbjct  421   YESDEVQDDTVDSDKDQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVAMDVCRSIKRD  478

Query  608   GTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             G++GSF  ++ T+SKNPTLH  A++SLWGDLWPF
Sbjct  479   GSEGSFQHLVFTRSKNPTLHRLAKKSLWGDLWPF  512



>gb|KDP25245.1| hypothetical protein JCGZ_20401 [Jatropha curcas]
Length=509

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/508 (69%), Positives = 426/508 (84%), Gaps = 5/508 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + ET  K FT E L +AAKQS  C +VP+ LRRAIK+YI+EQE+PHMKRKVLRLSE
Sbjct  1     MASLIPETTQKIFTPETLISAAKQSQGCLIVPISLRRAIKRYIREQEEPHMKRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL+L TT SKE+VEDP KS E SKRWKI+SAYGDIG +Y +DE +AYVASRM
Sbjct  61    SFSEIKDVNLMLTTTASKELVEDPFKS-ERSKRWKIKSAYGDIGFKYADDETVAYVASRM  119

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVLSEVRRR+PDFSPAKVLDFGAGTGSAFWA R+VWP+S++KVNLVEPSQSM
Sbjct  120   PAVYSACYRVLSEVRRRLPDFSPAKVLDFGAGTGSAFWATRKVWPKSVEKVNLVEPSQSM  179

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L +GLK+LPLIHSY+SLQ+L++NI KS R+HDLVIASYVLGEIPSL+DRIT+VR
Sbjct  180   QRAGRSLIQGLKDLPLIHSYNSLQSLTKNINKSEREHDLVIASYVLGEIPSLQDRITIVR  239

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVL+EPGTP GSNIIS +RSHILWME+RK RK    + ++CK L ++KSGA
Sbjct  240   QLWDLTRDVLVLIEPGTPHGSNIISLMRSHILWMEKRKSRKSGVQNSEACKDLVSVKSGA  299

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FIVAPC HDG CPLEKSGKYCHFVQR++RT+SQRAYK S GG LRGFEDEKFS+V FRRG
Sbjct  300   FIVAPCAHDGSCPLEKSGKYCHFVQRMQRTSSQRAYKPSKGGPLRGFEDEKFSFVAFRRG  359

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYE--DQFPseneddlneeeiiSYNSddt  771
             QRPRE+WPL+GM+FETLKEQ  +RNP DLE DY+  D+   ++      E  ++Y+SD T
Sbjct  360   QRPRESWPLDGMQFETLKEQRTKRNPVDLESDYDEIDEQDQDSIVHYKGENPLNYDSDAT  419

Query  770   evdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSF  591
             E DT+ DN+E  +E++E   A ADLG GWGRI++ P+ RG+++ MDVCR+ +  G++GSF
Sbjct  420   ETDTIDDNDEDGEEEQEK-TARADLGGGWGRIIFPPVRRGRQVTMDVCRSMNQNGSEGSF  478

Query  590   DRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +RI++T+SKNP LH  AR+SLWGDLWPF
Sbjct  479   ERIVVTRSKNPALHRQARKSLWGDLWPF  506



>ref|XP_004511078.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004511079.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=514

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/514 (68%), Positives = 420/514 (82%), Gaps = 9/514 (2%)
 Frame = -1

Query  2021  MASR-LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLS  1848
             MA++ ++ET  K  T E LR AAKQS  C  VP+ LRRAIKKY++EQE+P+MKRKVLRLS
Sbjct  1     MATQTIAETAQKIVTPETLRYAAKQSQRCLTVPIHLRRAIKKYLREQEEPYMKRKVLRLS  60

Query  1847  ESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASR  1668
             +SF  IK  NL L TTTS+EIVEDPLKS E SKRWKI+S+YGDIGL Y +DE IAYVASR
Sbjct  61    QSFNEIKNVNLQLTTTTSREIVEDPLKSSEQSKRWKIKSSYGDIGLTYRDDETIAYVASR  120

Query  1667  MPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQS  1488
             MPAVYSA +RVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWP+SL+KVNL+EPSQS
Sbjct  121   MPAVYSACFRVLKEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPKSLEKVNLIEPSQS  180

Query  1487  MQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVV  1308
             MQRAGQGL +GLKNLPLIHSY S+QALS+NI KS R HDLVIASYVLGEIPSLKDRIT+V
Sbjct  181   MQRAGQGLIQGLKNLPLIHSYDSIQALSKNIGKSERGHDLVIASYVLGEIPSLKDRITIV  240

Query  1307  RQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSG  1128
             RQLWDLT D+LVLVEPGTP GS+II+Q+RSHILWME RK RK    + + CK L T K+G
Sbjct  241   RQLWDLTQDVLVLVEPGTPHGSSIIAQMRSHILWMEERKHRKSSNKNNEVCKDLITEKAG  300

Query  1127  AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             AF+VAPCPHDG CPL KSGKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKFSYV FRR
Sbjct  301   AFVVAPCPHDGTCPLVKSGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFSYVAFRR  360

Query  947   GQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFP-----seneddlneeeiiSYN  783
             G+RP E WPL+G+ F++LKEQHA+RNPEDLEIDYED         +++      + + Y+
Sbjct  361   GRRPSEPWPLDGITFDSLKEQHAKRNPEDLEIDYEDWLKLQQADDDDDASREVVKAVKYD  420

Query  782   Sddtevdtvtd--neeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHE  609
             SD  E D+  +  ++  E E+ E    +ADLG GWGRIV+ P+ RG+++ M+VCR++  +
Sbjct  421   SDTIETDSDENGEDDNEEAEEMEEETDSADLGGGWGRIVFMPVRRGRQVTMNVCRSTKRD  480

Query  608   GTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              ++GS+DRI++TKSKNPTLHH A++S+WGDLWPF
Sbjct  481   ASEGSYDRIVVTKSKNPTLHHQAKKSIWGDLWPF  514



>ref|XP_007039452.1| Methyltransferases,copper ion binding isoform 1 [Theobroma cacao]
 gb|EOY23953.1| Methyltransferases,copper ion binding isoform 1 [Theobroma cacao]
Length=526

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/518 (69%), Positives = 424/518 (82%), Gaps = 14/518 (3%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS +SET  K FT E+LRAAAKQS+ C  VP+RLRRAIKKY++EQEDP+M+RKVLRLSE
Sbjct  1     MASLISETTQKIFTPESLRAAAKQSERCLDVPVRLRRAIKKYLREQEDPYMRRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L   TSKE+VEDPLKSVE SKRWKI+SAYGDIGL Y +DE +AYVASRM
Sbjct  61    SFSEIKDVNLHLTAETSKELVEDPLKSVEQSKRWKIKSAYGDIGLTYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVL EVRRR+P FSP KVLDFGAGTGSAFWA+REVWP++++K+N+VEPSQSM
Sbjct  121   PAVYSACYRVLGEVRRRLPGFSPTKVLDFGAGTGSAFWAIREVWPKTVEKINIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L +GLKNLPLIHSY+SLQ L+++I KS R+HDLVIASYVLGE+PSLKDRIT+VR
Sbjct  181   QRAGRSLIQGLKNLPLIHSYASLQTLTKDISKSEREHDLVIASYVLGEVPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTP GSNIISQ+RSHILWME+RKCRK K ++ +  K L  L+SGA
Sbjct  241   QLWNLTRDVLVLVEPGTPHGSNIISQMRSHILWMEKRKCRKAK-ANKEGSKDLIDLRSGA  299

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FI+APCPHDG CPLEKSGKYCHFVQRL+RT+SQRAYKRS G  LRGFEDEKF +V FRRG
Sbjct  300   FIIAPCPHDGCCPLEKSGKYCHFVQRLQRTSSQRAYKRSKGDPLRGFEDEKFCFVAFRRG  359

Query  944   QRP-RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSd  777
             QRP RE+WPL+G+KFETLKEQ A+RNPEDLEIDYED    +   D+    E    +Y+SD
Sbjct  360   QRPRRESWPLDGIKFETLKEQRAKRNPEDLEIDYEDLVNIKETADVIPYEEVHSSAYDSD  419

Query  776   dtevdtvtdneelede--------qeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRA  621
               E D V+DN+E             +E   A ADLG GWGRI++ P+ RG+++ M++CR 
Sbjct  420   VMETDLVSDNDEDHQVEEQDNDEEDQEEETALADLGGGWGRIIFPPVRRGRQVHMNICRP  479

Query  620   SDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             ++ + ++GSFD  +IT+SKNPTLHH ARRS WGDLWP 
Sbjct  480   TNGDASEGSFDHEVITQSKNPTLHHQARRSFWGDLWPL  517



>ref|XP_008388377.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Malus domestica]
Length=508

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/503 (69%), Positives = 416/503 (83%), Gaps = 2/503 (0%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  T EALR+AAKQS  C   P+RLRRAIKKY++EQ++PHMKRKVLRLSESF  
Sbjct  6     LPETAQKLLTREALRSAAKQSQRCLTTPVRLRRAIKKYLREQDEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIRSNYGDIGLTYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRIPEFSPAKVLDFGAGTGSAFWALREVWPHSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q LT+G KNLPLIHSY SLQ+L+++  KS R+HDLVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  186   QKLTQGQKNLPLIHSYDSLQSLTKSXTKSEREHDLVIASYVLGEIPSLKDRITIVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ S ++ K L T KSGAFIVA
Sbjct  246   LTRDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGSEETSKDLVTQKSGAFIVA  305

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRP  936
             PC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFEDEKFS+V FRRGQRP
Sbjct  306   PCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFEDEKFSFVAFRRGQRP  365

Query  935   RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtv  756
             RE WPL+GMKFETLKEQHA+R+PEDLEID ++   S+  D +  EE    N D   ++T 
Sbjct  366   REPWPLDGMKFETLKEQHAKRSPEDLEIDLDESISSQQADLVPFEEPNPVNYDSDVMETD  425

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
               +E  ++ +EE     ADLG GWGRI+Y P+ RGK++ MDVCR++  +G++G   R+++
Sbjct  426   MVDENDKNNEEEDETGHADLGGGWGRIIYMPVRRGKQVTMDVCRSTKRDGSEGELQRVVV  485

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             TKSKNPTLH  AR+S+WGDLWPF
Sbjct  486   TKSKNPTLHLQARKSIWGDLWPF  508



>gb|KHG27770.1| Methyltransferase-like protein 17, mitochondrial [Gossypium arboreum]
Length=512

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/505 (69%), Positives = 421/505 (83%), Gaps = 4/505 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS +SET+ K FT E LRAAAKQS+ C VVP+RLRRAIKKY++EQEDP+M+RKVLRLS+
Sbjct  1     MASLISETIQKIFTPETLRAAAKQSERCLVVPVRLRRAIKKYLREQEDPYMRRKVLRLSQ  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF +IK+ NL L   TSKE+V DPLKS+E S+RWKI+SAYGDIGL Y +DE +AYVASRM
Sbjct  61    SFSNIKDVNLQLVAETSKELVADPLKSMEQSQRWKIKSAYGDIGLTYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVLSEVRRR+P FSP KVLDFGAGTGSAFWAMREVWP+S++K+N+VEPSQSM
Sbjct  121   PAVYSACYRVLSEVRRRLPGFSPTKVLDFGAGTGSAFWAMREVWPKSVEKLNIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L + LKNLPLIH Y+SLQAL++ ++KS RQHDLVIASYVLGEIPSLKDRIT+VR
Sbjct  181   QRAGRSLVQDLKNLPLIHGYTSLQALTKEVRKSERQHDLVIASYVLGEIPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTP GSNIISQ+RSHILWME+RK RK K +   S K L  L+SGA
Sbjct  241   QLWNLTQDVLVLVEPGTPHGSNIISQMRSHILWMEKRKFRKAKVNKEDS-KDLIDLRSGA  299

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FIVAPCPHDG CPLEKS KYCHFVQRL+RTTSQRAYKRS G  LRGFEDEKFS++ FRRG
Sbjct  300   FIVAPCPHDGHCPLEKSSKYCHFVQRLQRTTSQRAYKRSKGDPLRGFEDEKFSFIAFRRG  359

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtev  765
             QRPR+ WPL+GMKFETLKEQ A+RNPED EI+YED   +E   D+   E    ++ D++V
Sbjct  360   QRPRDRWPLDGMKFETLKEQRAKRNPEDFEIEYEDLVDAEETSDMIPYEEEDPSAYDSDV  419

Query  764   dtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDR  585
                 +  + +++QEET    A+LG GWGRIV+ P+ RG+++ M++CR+++ + ++GSFD 
Sbjct  420   METDNIIDNDEDQEET--VNANLGGGWGRIVFPPVRRGRQVHMNICRSTNPDASEGSFDH  477

Query  584   IIITKSKNPTLHHHARRSLWGDLWP  510
              +IT++KNPTLH  AR+S WGDLWP
Sbjct  478   EVITQTKNPTLHLQARKSFWGDLWP  502



>ref|XP_002518877.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus 
communis]
 gb|EEF43410.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus 
communis]
Length=501

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/496 (69%), Positives = 413/496 (83%), Gaps = 3/496 (1%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
              T EALR+AAKQS  C VVP+ LRRAIK+Y++EQE+PHMKRKVLRLSESF  IK+ NL+L
Sbjct  7     LTPEALRSAAKQSQGCLVVPVTLRRAIKRYLREQEEPHMKRKVLRLSESFSEIKDVNLML  66

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
               TTSKE+VEDP KS+E SKRWKI+S YGD+GL+Y +DE +AYVASRMPAV+SA YR+LS
Sbjct  67    TATTSKELVEDPFKSMERSKRWKIRSCYGDVGLKYTDDETVAYVASRMPAVFSACYRILS  126

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             EV+RR+P FSP KVLDFGAGTGSAFWAMR+VWP+S++KVNLVEPS SMQRAG+ L + LK
Sbjct  127   EVKRRLPGFSPTKVLDFGAGTGSAFWAMRQVWPKSVEKVNLVEPSPSMQRAGRSLIQDLK  186

Query  1448  NLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVL  1269
             +LPLIH Y+S+QALS+ I KS R+HDLVIASYVLGEIPSLKDRIT+VRQLWDLTGD+LVL
Sbjct  187   DLPLIHGYNSIQALSKTISKSEREHDLVIASYVLGEIPSLKDRITIVRQLWDLTGDVLVL  246

Query  1268  VEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPC  1089
             VEPGTP GSNIISQ+RSHILWME+RK RK K  + ++CK L ++KSGAF+VAPC HDG C
Sbjct  247   VEPGTPHGSNIISQMRSHILWMEKRKHRKSKAQNNEACKELVSIKSGAFVVAPCAHDGYC  306

Query  1088  PLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGM  909
             PLEKSGKYCHF QRL+RT+SQRAYKRS G  LRGFEDEKFS+V FRRGQRPR +WPL+GM
Sbjct  307   PLEKSGKYCHFAQRLQRTSSQRAYKRSKGEPLRGFEDEKFSFVAFRRGQRPRASWPLDGM  366

Query  908   KFETLKEQHARRNPEDLEIDYE--DQFPseneddlneeeiiSYNSddtevdtvtdneele  735
             KFETLKEQ A R  EDLEIDYE  D+          E + + Y+SD  E D V +N+  E
Sbjct  367   KFETLKEQRAERKLEDLEIDYEDVDEQDEAGVVPYEEMDPLDYDSDAIETDGVDNNDGDE  426

Query  734   deqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPT  555
              E+++     ADLG GWGRI++SP+ RG+++ +DVCR+ + + ++GSF+RI++T+SKNP 
Sbjct  427   KEEQDE-TGHADLGGGWGRIIFSPVRRGRQVSLDVCRSVNRDSSEGSFERIVVTRSKNPA  485

Query  554   LHHHARRSLWGDLWPF  507
             LHH A+RSLWGDLWPF
Sbjct  486   LHHQAKRSLWGDLWPF  501



>ref|XP_009359576.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Pyrus 
x bretschneideri]
Length=506

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/503 (69%), Positives = 419/503 (83%), Gaps = 4/503 (1%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  + E LR+AAKQS  C   P+RLRRAIKKY++EQ++PHMKRKVLRLSESF  
Sbjct  6     LPETAQKLLSQETLRSAAKQSQRCLTTPVRLRRAIKKYLREQDEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S+YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIKSSYGDIGLSYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRLPEFSPAKVLDFGAGTGSAFWALREVWPNSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q L +G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  186   QKLIQGQKNLPLIHSYDSLQSLTKSINKSEREHDLVIASYVLGEIPSLKDRITIVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ + ++ K L T KSGAFIVA
Sbjct  246   LTQDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGTDEASKDLVTQKSGAFIVA  305

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRP  936
             PC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFEDEKFS+V FRRGQRP
Sbjct  306   PCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFEDEKFSFVAFRRGQRP  365

Query  935   RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtv  756
             RE WPL+GMKFETLKEQHA+R+PEDLEID ++   S+  D +  EE+   N D   ++  
Sbjct  366   REPWPLDGMKFETLKEQHAKRSPEDLEIDIDELISSQQVDLVPFEELNPVNYDSDVMEPD  425

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
               +E  EDE++ETG   ADLG GWGRI+Y P+ RGK++ MDVCR++  +G++G   R+++
Sbjct  426   VVDENNEDEEDETGH--ADLGGGWGRIIYMPVRRGKQVTMDVCRSTKLDGSEGELQRVVV  483

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             TKSKNPTLH  AR+S+WGDLWPF
Sbjct  484   TKSKNPTLHLQARKSMWGDLWPF  506



>ref|XP_010055995.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Eucalyptus 
grandis]
 gb|KCW72562.1| hypothetical protein EUGRSUZ_E01030 [Eucalyptus grandis]
Length=505

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/506 (67%), Positives = 417/506 (82%), Gaps = 2/506 (0%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MA+ + ETV + FT E LRAAAKQS  C  VP+RLRRAIKKY++E E+P++KRKVLRLS 
Sbjct  1     MAALVPETVQRAFTPETLRAAAKQSSGCLTVPVRLRRAIKKYLRELEEPYLKRKVLRLSA  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL+L  +TS+E+VEDPLKS E S+RWKI+SAYGDIGL+Y +DE  AYVASRM
Sbjct  61    SFSEIKDVNLMLTASTSRELVEDPLKSAESSRRWKIKSAYGDIGLKYSDDETAAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA +RVL E+RRR+PDFSPA+VLDFGAGTGSAFWA+REVWP+S++KVNL+EPSQSM
Sbjct  121   PAVYSACHRVLREIRRRLPDFSPARVLDFGAGTGSAFWALREVWPQSVEKVNLIEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L + +KNLPLIHSY S+Q+LS+NI KS R+HDLVIASYVLGEIPSLKDRIT VR
Sbjct  181   QRAGRSLIQCMKNLPLIHSYDSIQSLSKNISKSERKHDLVIASYVLGEIPSLKDRITTVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVLVEPGTP GS II+Q+RSHILWME RK RK  + S   CK L  LKSG 
Sbjct  241   QLWDLTEDVLVLVEPGTPHGSKIIAQMRSHILWMENRKLRKAAKLS-HDCKDLVALKSGV  299

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FIVAPCPHDG CPLE +GKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKF YV FRRG
Sbjct  300   FIVAPCPHDGRCPLENTGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFCYVAFRRG  359

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtev  765
             QRPR  WPL+ MKFETLKE HA+RNPEDLEID ED    ++ +    EEI   + D   +
Sbjct  360   QRPRGAWPLDDMKFETLKELHAKRNPEDLEIDLEDYMKMQSVETPPHEEIDPVSYDSDVI  419

Query  764   dtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDR  585
             ++   +E++++E +E  +  ADLG GWGRI+++P+ RG+++ M+VCR++  +G++G+F+R
Sbjct  420   ESDAIDEDIDEEGDEEKSVRADLGGGWGRIIFTPVRRGRQVAMNVCRSTKRDGSEGAFER  479

Query  584   IIITKSKNPTLHHHARRSLWGDLWPF  507
             +++TKSKNP LHH A+RSLWGDLWP+
Sbjct  480   VVVTKSKNPNLHHQAKRSLWGDLWPY  505



>ref|XP_007133679.1| hypothetical protein PHAVU_011G200000g [Phaseolus vulgaris]
 ref|XP_007133680.1| hypothetical protein PHAVU_011G200000g [Phaseolus vulgaris]
 gb|ESW05673.1| hypothetical protein PHAVU_011G200000g [Phaseolus vulgaris]
 gb|ESW05674.1| hypothetical protein PHAVU_011G200000g [Phaseolus vulgaris]
Length=523

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/525 (67%), Positives = 424/525 (81%), Gaps = 22/525 (4%)
 Frame = -1

Query  2021  MASR-LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLS  1848
             MA++ ++ET  K  T EALR AAKQS+ C V+P+RLRRAIKKY+KEQE+P M+ KVLRLS
Sbjct  1     MATQTIAETAQKIVTPEALRYAAKQSERCLVIPVRLRRAIKKYLKEQEEPFMRSKVLRLS  60

Query  1847  ESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASR  1668
             +SF  IK+ NL L +TT+K+IVEDP+KS E SKRWKI S+YGDIGL Y +DE IAYVASR
Sbjct  61    QSFNQIKDVNLQLASTTAKKIVEDPVKSFEQSKRWKITSSYGDIGLMYRDDETIAYVASR  120

Query  1667  MPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQS  1488
             MPAVYSA YRVL EVRRR+P FSP++VLDFGAGTGSAFWA++EVWP+SL+KVNL+EPSQS
Sbjct  121   MPAVYSACYRVLKEVRRRLPGFSPSRVLDFGAGTGSAFWAIQEVWPKSLEKVNLIEPSQS  180

Query  1487  MQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVV  1308
             MQRAG+ L +GLKNLPLIHSY S+QALS++I KS+R HDLVIASYVLGEIPS+KDRIT+V
Sbjct  181   MQRAGRSLIQGLKNLPLIHSYDSIQALSKSIGKSDRGHDLVIASYVLGEIPSIKDRITIV  240

Query  1307  RQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSG  1128
             RQLWDLT D+LVLVEPGTP GSNII+Q+RSHILWME RK RK    + + CK L T K+G
Sbjct  241   RQLWDLTSDVLVLVEPGTPHGSNIIAQMRSHILWMEERKYRKGSNKNNEVCKDLITQKAG  300

Query  1127  AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             AF+VAPCPHDG CPL KSGKYCHF QRLERT+SQR YKRS G  LRGFEDEKFSYVVFRR
Sbjct  301   AFVVAPCPHDGICPLVKSGKYCHFAQRLERTSSQRVYKRSKGDPLRGFEDEKFSYVVFRR  360

Query  947   GQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl--------------  810
             G RPRE WPL+G++FE+LKEQ A+RNPEDLEIDYED    +  DD               
Sbjct  361   GPRPREPWPLDGVEFESLKEQRAKRNPEDLEIDYEDWLKLQQGDDTLDEVADAVDDLETG  420

Query  809   ----neeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRI  642
                    + ++Y+SDD E D   D+++  + +EE G  +ADLG GWGRIV+ PI RG+++
Sbjct  421   DTPLEAVKAVTYDSDDVETDGADDSDDDNERREERG--SADLGGGWGRIVFMPIRRGRQV  478

Query  641   EMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              M+VCR++  + ++GS+DRI++TKSKNPTLHH A+RS+WGDLWPF
Sbjct  479   TMNVCRSTKKDASEGSYDRIVVTKSKNPTLHHQAKRSIWGDLWPF  523



>ref|XP_008390311.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Malus 
domestica]
Length=506

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/503 (69%), Positives = 419/503 (83%), Gaps = 4/503 (1%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  + E LR+AAKQS  C   P+RLRRAIKKY++EQ++PHMKRKVLRLSESF  
Sbjct  6     LPETAQKLLSQETLRSAAKQSQRCLTTPVRLRRAIKKYLREQDEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S+YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIKSSYGDIGLSYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+ SPAKVLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRLPELSPAKVLDFGAGTGSAFWALREVWPNSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q L +G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  186   QKLIQGQKNLPLIHSYDSLQSLTKSINKSEREHDLVIASYVLGEIPSLKDRITIVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ + ++ K L T KSGAFIVA
Sbjct  246   LTRDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGTDEASKDLVTQKSGAFIVA  305

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRP  936
             PC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFEDEKFS+V FRRGQRP
Sbjct  306   PCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFEDEKFSFVAFRRGQRP  365

Query  935   RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtv  756
             RE WPL+GMKFETLKEQHA+R+PEDLEID ++   S+  D +  EE+   N D   ++  
Sbjct  366   REPWPLDGMKFETLKEQHAKRSPEDLEIDVDELISSQQVDLVPFEELNPVNYDSDVMEPD  425

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
               +E  EDE++ETG   A+LG GWGRI+Y P+ RGK++ MDVCR+++ +G++G   R+++
Sbjct  426   VVDENNEDEEDETGH--ANLGGGWGRIIYMPVRRGKQVTMDVCRSTERDGSEGELQRVVV  483

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             TKSKNPTLH  AR+++WGDLWPF
Sbjct  484   TKSKNPTLHLQARKAIWGDLWPF  506



>gb|EYU33507.1| hypothetical protein MIMGU_mgv1a004118mg [Erythranthe guttata]
Length=543

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/534 (64%), Positives = 428/534 (80%), Gaps = 30/534 (6%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SET+PKFTAE L+ AAKQS++CRV+PLRLRRAIKKYI+EQ+   M+R VL L  S
Sbjct  1     MASFISETIPKFTAETLKFAAKQSEACRVIPLRLRRAIKKYIREQDVTDMRRNVLSLCRS  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKEANLLLP++TSKE+VEDPLK++E S+RWK+ ++Y D+GL+Y+E++A+AYVA+RMP
Sbjct  61    FNDIKEANLLLPSSTSKELVEDPLKAMESSQRWKLSTSYRDVGLKYQEEQAVAYVAARMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRRVPDF+PAKVLDFGAGT SA WAM EVWP S++++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRVPDFTPAKVLDFGAGTSSALWAMMEVWPGSVERINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAGQ L + LK LPL+ SY+S+Q+LS++I KS R+HDLVIASYVLGE+PSL+DRIT+VRQ
Sbjct  181   RAGQSLFKDLKKLPLVQSYNSIQSLSKHINKSGRRHDLVIASYVLGEVPSLQDRITLVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LWDLT DILVLVEPG+PQGSNIISQ+RSHILWME R+ RKL+ ++ K+   L  LK+GAF
Sbjct  241   LWDLTDDILVLVEPGSPQGSNIISQMRSHILWMENRRTRKLQNAANKASTELVPLKTGAF  300

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             +VAPCPHDGPCPL+ + KYCHFVQRL+RT+SQR YKR+ G  LRG+EDEKFSYV FRRG 
Sbjct  301   VVAPCPHDGPCPLQNTNKYCHFVQRLQRTSSQRVYKRTKG-PLRGYEDEKFSYVAFRRGT  359

Query  941   RPRETWPLNGMKFETLKEQHARRNPE----DLEIDYE-------------------DQFP  831
             RPRE WPL+GMKF+TLKE HA+R PE    D+E  +E                   DQ  
Sbjct  360   RPREPWPLDGMKFDTLKEMHAKRIPENYDIDVESQFERGEVQLLAESQLGSDEVQVDQSE  419

Query  830   seneddlneeeiiSYNSddtevdtvtdneeled------eqeETGAATADLGTGWGRIVY  669
              E +   +  +   Y SD +E +  TDN+  ++      E+EE  + +ADLG+GWGRI+Y
Sbjct  420   EEEKQKDDRIKRKRYESDCSETEEETDNDNADEGIEEKEEEEEEESPSADLGSGWGRIIY  479

Query  668   SPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              P+ RGKR+E+DVCR+++ EGT+GSFDR++ITKSK+P LHH ARRSLWGDLWP 
Sbjct  480   MPLRRGKRVELDVCRSTNEEGTEGSFDRVVITKSKSPALHHQARRSLWGDLWPL  533



>ref|XP_009344049.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=506

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/503 (69%), Positives = 418/503 (83%), Gaps = 4/503 (1%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  + E LR+AAKQS  C   P+RLRRAIKKY++EQ++PHMKRKVLRLSESF  
Sbjct  6     LPETAQKLLSQETLRSAAKQSQRCLTTPVRLRRAIKKYLREQDEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S+YGDIGL Y +DE +AYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIKSSYGDIGLSYRDDETVAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA++EVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRLPEFSPAKVLDFGAGTGSAFWALQEVWPNSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q L +G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  186   QKLIQGQKNLPLIHSYDSLQSLTKSINKSEREHDLVIASYVLGEIPSLKDRITIVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ + ++ K L T KSGAFIVA
Sbjct  246   LTQDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGTDEASKDLVTQKSGAFIVA  305

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRP  936
             PC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFEDEKFS+V FRRGQRP
Sbjct  306   PCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFEDEKFSFVAFRRGQRP  365

Query  935   RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtv  756
             RE WPL+GMKFETLKEQHA+R+ EDLEID ++   S+  D +  EE+   N D   ++  
Sbjct  366   REPWPLDGMKFETLKEQHAKRSTEDLEIDIDELINSQQVDLVPFEELNPVNYDSDVMEPD  425

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
               +E  EDE++ETG   ADLG GWGRI+Y P+ RGK++ MDVCR++  +G++G   R+++
Sbjct  426   LVDENNEDEEDETGH--ADLGGGWGRIIYMPVRRGKQVTMDVCRSTKLDGSEGELQRVVV  483

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             TKSKNPTLH  AR+S+WGDLWPF
Sbjct  484   TKSKNPTLHLQARKSIWGDLWPF  506



>ref|XP_010676849.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=502

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/507 (67%), Positives = 421/507 (83%), Gaps = 7/507 (1%)
 Frame = -1

Query  2021  MASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             M++ + ET  +  T E +R AAKQS  C V+P RLRRAI+KY++EQE  H+K+KVLRL+E
Sbjct  1     MSALVPETSRRLITPETIRLAAKQSSKCNVIPDRLRRAIEKYLQEQEMGHIKKKVLRLTE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ N LLP + SKE+VEDPLKS+E +KRWKI+S YGDIGL Y +DE +AYVASRM
Sbjct  61    SFAEIKDVNRLLPLSISKELVEDPLKSMEQTKRWKIKSEYGDIGLTYTDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA +R+L E+RRRVPDF+PAKVLDFG+GTGSAFWA+REVWPR++++ NLVEPSQSM
Sbjct  121   PAVYSACFRILREIRRRVPDFAPAKVLDFGSGTGSAFWALREVWPRTMERFNLVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG  L R +KNLPLIHSYS++Q+L+Q+IKK+ R+HDLVIASYVLGEIPSLKDRI +VR
Sbjct  181   QRAGVSLVRDIKNLPLIHSYSNIQSLTQDIKKAEREHDLVIASYVLGEIPSLKDRIAIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW LT DILVLVEPGTP+GSNIISQ+RSHILWME+RKCRK K++S  + +     + GA
Sbjct  241   QLWGLTRDILVLVEPGTPEGSNIISQMRSHILWMEKRKCRKRKDTSDDAPEKRGASRDGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             ++VAPCPHDGPCPL  +GKYCHFVQRLERT SQRA+KRS+G  LRGFEDEKFSYV  RRG
Sbjct  301   YVVAPCPHDGPCPLANTGKYCHFVQRLERTESQRAFKRSSGAPLRGFEDEKFSYVALRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl-neeeiiSYNSddte  768
             +RP+E WPL+G+KF+TLKE HA+R PEDLEIDYEDQ+  E +D +  E    SY+SD TE
Sbjct  361   KRPQEPWPLDGIKFDTLKELHAKRKPEDLEIDYEDQYEQETDDIVPYEAHHSSYDSDATE  420

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
              D VTD+EE E++     A  ADLG+GWGRI++ P  RG+R+ MDVCRA+  +G++GSFD
Sbjct  421   SDAVTDHEEEEEQ-----AGRADLGSGWGRIIFMPQRRGRRVAMDVCRATKRDGSEGSFD  475

Query  587   RIIITKSKNPTLHHHARRSLWGDLWPF  507
              ++IT++KNPTLHH AR+SLWGDLWPF
Sbjct  476   HMVITRAKNPTLHHQARKSLWGDLWPF  502



>ref|XP_004161453.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Cucumis sativus]
Length=508

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/509 (69%), Positives = 417/509 (82%), Gaps = 5/509 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS L ET  K  T E LR+AAKQS  C VVP+RLRRAIKKY+++ E  H+KRKVLRLS+
Sbjct  1     MASLLQETSQKVLTPEILRSAAKQSQGCLVVPVRLRRAIKKYLRDHEVSHLKRKVLRLSQ  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L   TSKE+VEDPLKSVE SKRWKI+S YGDIG +Y +DE IAYVASRM
Sbjct  61    SFSGIKDVNLQLAAATSKELVEDPLKSVEQSKRWKIKSVYGDIGFQYTDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV+SA YRVL+EVRRR+PDFSP  VLDFGAGTGS FWA+REVWP S+QKVN+VEPSQSM
Sbjct  121   PAVFSACYRVLNEVRRRLPDFSPTSVLDFGAGTGSGFWALREVWPHSIQKVNIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L +GLKNLPLIH Y S+Q+L+++I KS R+HDLVIASYVLGEIPSL+DR+T+VR
Sbjct  181   QRAGQSLIQGLKNLPLIHGYDSIQSLNKDISKSEREHDLVIASYVLGEIPSLQDRVTIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTPQGSNIISQ+RSHILWME+RK +K +     + K L T   GA
Sbjct  241   QLWNLTKDVLVLVEPGTPQGSNIISQMRSHILWMEKRKWKKNENKKNIASKDLVTQTCGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             ++VAPCPHDG CPLEKSGKYCHFVQRLERTT+QR YKRS G SLRGFEDEKFS+V FRRG
Sbjct  301   YVVAPCPHDGKCPLEKSGKYCHFVQRLERTTTQRIYKRSKGESLRGFEDEKFSFVAFRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSdd  774
             QRPR+ WPL+GM+FETLKEQHA+RNPEDLEIDYED    EN+  +    E + +SY+SD 
Sbjct  361   QRPRDPWPLDGMRFETLKEQHAKRNPEDLEIDYEDLLKMENQVQVVPYQEVDPVSYDSDV  420

Query  773   tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGS  594
              E + + D EE E E++    A ADLG GWGRIV+SP  RG  I M++CR++  + ++GS
Sbjct  421   METEVLDDGEEEEGEEQGE-PALADLGGGWGRIVFSPRRRGNHITMNICRSTKRDASEGS  479

Query  593   FDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             FD++++T+S+NPTLHH AR+S+WGDLWPF
Sbjct  480   FDQVVVTQSQNPTLHHQARKSIWGDLWPF  508



>ref|XP_004143852.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Cucumis sativus]
 gb|KGN49998.1| hypothetical protein Csa_5G148690 [Cucumis sativus]
Length=508

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/509 (68%), Positives = 417/509 (82%), Gaps = 5/509 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS L E+  K  T E LR+AAKQS  C VVP+RLRRAIKKY+++ E  H+KRKVLRLS+
Sbjct  1     MASLLQESSQKVLTPEILRSAAKQSQGCLVVPVRLRRAIKKYLRDHEVSHLKRKVLRLSQ  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L   TSKE+VEDPLKSVE SKRWKI+S YGDIG +Y +DE IAYVASRM
Sbjct  61    SFSGIKDVNLQLAAATSKELVEDPLKSVEQSKRWKIKSVYGDIGFQYTDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV+SA YRVL+EVRRR+PDFSP  VLDFGAGTGS FWA+REVWP S+QKVN+VEPSQSM
Sbjct  121   PAVFSACYRVLNEVRRRLPDFSPTSVLDFGAGTGSGFWALREVWPHSIQKVNIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L +GLKNLPLIH Y S+Q+L+++I KS R+HDLVIASYVLGEIPSL+DR+T+VR
Sbjct  181   QRAGQSLIQGLKNLPLIHGYDSIQSLNKDISKSEREHDLVIASYVLGEIPSLQDRVTIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTPQGSNIISQ+RSHILWME+RK +K +     + K L T   GA
Sbjct  241   QLWNLTKDVLVLVEPGTPQGSNIISQMRSHILWMEKRKWKKNENKKNIASKDLVTQTCGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             ++VAPCPHDG CPLEKSGKYCHFVQRLERTT+QR YKRS G SLRGFEDEKFS+V FRRG
Sbjct  301   YVVAPCPHDGKCPLEKSGKYCHFVQRLERTTTQRIYKRSKGESLRGFEDEKFSFVAFRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSdd  774
             QRPR+ WPL+GM+FETLKEQHA+RNPEDLEIDYED    EN+  +    E + +SY+SD 
Sbjct  361   QRPRDPWPLDGMRFETLKEQHAKRNPEDLEIDYEDLLKMENQVQVVPYQEVDPVSYDSDV  420

Query  773   tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGS  594
              E + + D EE E E++    A ADLG GWGRIV+SP  RG  I M++CR++  + ++GS
Sbjct  421   METEVLDDGEEEEGEEQGE-PALADLGGGWGRIVFSPRRRGNHITMNICRSTKRDASEGS  479

Query  593   FDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             FD++++T+S+NPTLHH AR+S+WGDLWPF
Sbjct  480   FDQVVVTQSQNPTLHHQARKSIWGDLWPF  508



>ref|XP_010278481.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Nelumbo nucifera]
Length=502

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/506 (69%), Positives = 427/506 (84%), Gaps = 5/506 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + E   K FT E LR+AAKQS+   +VP+RLRRAIKK ++EQE PHMKRKVL LSE
Sbjct  1     MASLIPEAAHKVFTPETLRSAAKQSERIHIVPVRLRRAIKKILREQEKPHMKRKVLSLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L T+TSKE+VEDPLKS+E SKRWKI+++YGDIGL+Y +DE +AYVASRM
Sbjct  61    SFSEIKDVNLQLATSTSKELVEDPLKSMERSKRWKIKTSYGDIGLKYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV SA +RVL EVRRR+P FSPA+VLDFG+GTGS  WA+RE+WPRSL+++NLVEPS+SM
Sbjct  121   PAVCSACHRVLREVRRRLPGFSPARVLDFGSGTGSVLWALREIWPRSLERINLVEPSKSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L + LK+LPLIHSY S+QAL+QN++KS+R+HDLV+ASYVLGE+PSLKDRIT+VR
Sbjct  181   QRAGQSLLQDLKDLPLIHSYDSIQALTQNLEKSDREHDLVVASYVLGEVPSLKDRITMVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVL+EPGTP G NIISQ+RSHILWM +RKCRK  ++  ++ K L  LKSGA
Sbjct  241   QLWDLTRDVLVLIEPGTPHGFNIISQMRSHILWMTKRKCRKSDDACNEASKDLVGLKSGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             F+VAPCPHDGPCPLE S KYCHFVQRLERT+SQRAYKRS G  LRGFEDEKF +V  RRG
Sbjct  301   FVVAPCPHDGPCPLENSSKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFCFVALRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtev  765
             QRPRE WPL+GMKF+TLKEQHA+RNPEDLEID+EDQF SE+ED   EE+ +SY+S     
Sbjct  361   QRPREPWPLDGMKFDTLKEQHAKRNPEDLEIDFEDQFESEDEDIPYEEDPVSYDS----D  416

Query  764   dtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDR  585
              T  D  +  +E+E+  AA ADLG+GWGRI+++P+ RGK++ MDVCR++  +G++GSF+R
Sbjct  417   ITEVDAIDEHEEEEDQEAAHADLGSGWGRIIFTPVRRGKQVAMDVCRSTKRDGSEGSFER  476

Query  584   IIITKSKNPTLHHHARRSLWGDLWPF  507
             ++IT+SKNPTLH  ARRSLWGDLWPF
Sbjct  477   VVITRSKNPTLHRQARRSLWGDLWPF  502



>ref|XP_004300486.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=512

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/505 (68%), Positives = 416/505 (82%), Gaps = 4/505 (1%)
 Frame = -1

Query  2009  LSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  T EA+R+AAKQS  C  VP++LRRAIKKY++EQE+PHMKRKVLRLSESF  
Sbjct  6     LPETAQKVLTQEAIRSAAKQSQRCLTVPVKLRRAIKKYLREQEEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L  +TSK++VEDPL+ V+ S+RWKI+S+YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLIASTSKQLVEDPLQGVDQSQRWKIKSSYGDIGLTYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRLPEFSPAKVLDFGAGTGSAFWALREVWPNSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q L +G KNLPLIHSY +LQ+L+++I KS R+HDLVIASYVLGEIPSLKDRITVVRQLWD
Sbjct  186   QSLIQGQKNLPLIHSYGTLQSLTKSINKSEREHDLVIASYVLGEIPSLKDRITVVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTL-KSGAFIV  1116
             LT D+L+L+EPGTPQGSNIISQ+RSHILWME+RK RK K    ++ K L    K+GA+IV
Sbjct  246   LTRDVLILIEPGTPQGSNIISQMRSHILWMEKRKIRKSKAPIDETSKDLVVARKNGAYIV  305

Query  1115  APCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQR  939
             APC HDG CPLEK+GKYCHFVQRLERT++QRAYKRS GG  LRGFEDEKFS++  RRGQR
Sbjct  306   APCSHDGACPLEKAGKYCHFVQRLERTSTQRAYKRSKGGQPLRGFEDEKFSFIAVRRGQR  365

Query  938   PRETWPLNGMKFETLKEQHARRNPEDLEIDYED-QFPseneddlneeeiiSYNSddtevd  762
             PRE WPL+G+KFETLKEQHA+R  +DLEIDYE+ + PS ++            + D++V 
Sbjct  366   PREPWPLDGVKFETLKEQHAKRTLQDLEIDYEEPEEPSSSQQASLIPFEKPDATYDSDVM  425

Query  761   tvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRI  582
              V D+E+ E+E+E+     ADLG GWGRI+Y P+ RGK + MDVCR+++ + ++G+  RI
Sbjct  426   EVDDHEDNEEEEEDDDTGHADLGGGWGRIIYMPVRRGKHVTMDVCRSTNEDASEGTLQRI  485

Query  581   IITKSKNPTLHHHARRSLWGDLWPF  507
             ++TK+KNPTLH+ AR+SLWGDLWPF
Sbjct  486   VVTKNKNPTLHNQARKSLWGDLWPF  510



>ref|XP_008437428.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Cucumis 
melo]
Length=508

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/509 (67%), Positives = 412/509 (81%), Gaps = 5/509 (1%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS L ET  K  T E LR+AAKQS  C VVP+RLRRAIKKY+ +QE  H+KRKVLRLS+
Sbjct  1     MASLLQETSQKVLTPEILRSAAKQSQGCLVVPVRLRRAIKKYLGDQEVSHLKRKVLRLSK  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             +F  IK+ NL L  TTSKE+VEDPLKSVE S+RWKI+S YGDIG +Y +DE IAYVASRM
Sbjct  61    TFSGIKDVNLQLAATTSKELVEDPLKSVEQSQRWKIKSVYGDIGFQYTDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV+SA YRVL+EVRRR+PDFSP  VLDFGAGTGS FWA+REVWP S+QKVN+VEPSQSM
Sbjct  121   PAVFSACYRVLNEVRRRLPDFSPTSVLDFGAGTGSGFWALREVWPHSIQKVNIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L +GLKNLPLIH Y S+Q+L+++I KS R+HDLVIASYVLGEIPS +DR+T+VR
Sbjct  181   QRAGQSLIQGLKNLPLIHGYDSIQSLNKDISKSEREHDLVIASYVLGEIPSFQDRVTIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTPQGSNIISQ+RSHILWME+RK +K +     + K L T   GA
Sbjct  241   QLWNLTKDVLVLVEPGTPQGSNIISQMRSHILWMEKRKWKKYENKKNIASKDLVTQTCGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             ++VAPCPHDG CPLE SGKYCHFVQRL+RTT+QR YK S G SLRGFEDEKFS+V FRRG
Sbjct  301   YVVAPCPHDGKCPLENSGKYCHFVQRLQRTTTQRTYKHSKGKSLRGFEDEKFSFVAFRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSdd  774
             QRPRE WPL+GM+FETLKEQ A+RNPEDLEIDY D    EN+  +    E + +SY+SD 
Sbjct  361   QRPREPWPLDGMRFETLKEQRAKRNPEDLEIDYGDLVKMENQLQVVPYQEADPVSYDSDV  420

Query  773   tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGS  594
              E + +  +EE E E++    A ADL  GWGRIV+ P  RG+ I M++CR++  + ++GS
Sbjct  421   METEVLDVDEEEEGEEQGE-PALADLSGGWGRIVFPPRRRGRHITMNICRSTKRDASEGS  479

Query  593   FDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             F+++++T+S+NPTLHH ARRS+WGDLWP+
Sbjct  480   FEQVVVTQSQNPTLHHQARRSIWGDLWPY  508



>ref|XP_007209115.1| hypothetical protein PRUPE_ppa005403mg [Prunus persica]
 gb|EMJ10314.1| hypothetical protein PRUPE_ppa005403mg [Prunus persica]
Length=463

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/503 (65%), Positives = 393/503 (78%), Gaps = 47/503 (9%)
 Frame = -1

Query  2009  LSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  T E LR+AAKQS  C   P+RLRRAIKKY+KEQE+PHMKRKVLRLSESF  
Sbjct  6     LPETAQKVLTQETLRSAAKQSQRCLTTPVRLRRAIKKYLKEQEEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S+YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLQSVDQSQRWKIKSSYGDIGLTYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPA+VLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRLPEFSPARVLDFGAGTGSAFWALREVWPHSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q L +G K+LPLIHSY S+Q+L+++IKKS+R+HDLVIASYVLGEIPSLKDRITVVRQLWD
Sbjct  186   QKLIQGQKDLPLIHSYDSIQSLTKSIKKSDREHDLVIASYVLGEIPSLKDRITVVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVL+EPGTPQGSNIISQ+RSHILWME+RKCRK K+ + ++ K L T K+GAFIVA
Sbjct  246   LTRDVLVLIEPGTPQGSNIISQMRSHILWMEKRKCRKSKDGADETTKDLVTQKNGAFIVA  305

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRP  936
             PC HDG CPLEK+ KYCHFVQRLERT+ QR +KRS GG  LRGFEDEKFS++  RRGQRP
Sbjct  306   PCSHDGQCPLEKAEKYCHFVQRLERTSIQRTFKRSKGGQPLRGFEDEKFSFIAVRRGQRP  365

Query  935   RETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtv  756
             +E WPL+G+KF+TLKEQ A+R+PEDLEID                               
Sbjct  366   QEPWPLDGLKFDTLKEQQAKRSPEDLEIDL------------------------------  395

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
                              ADLG GWGRI+Y P+ RGK++ MDVCR++  +G++G   R+++
Sbjct  396   ---------------GHADLGGGWGRIIYMPVRRGKQVTMDVCRSTKRDGSEGQLQRVVV  440

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             TKSKNP LH  AR+S+WGDLWPF
Sbjct  441   TKSKNPALHQQARKSIWGDLWPF  463



>ref|XP_006594363.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Glycine max]
Length=525

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/525 (65%), Positives = 405/525 (77%), Gaps = 25/525 (5%)
 Frame = -1

Query  2018  ASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A  ++ET  K  T E LR AAKQS  C VVP+RLRRAIKKY++EQE+P+MKRKVLRLS++
Sbjct  3     AQTIAETAQKILTPETLRYAAKQSARCLVVPVRLRRAIKKYLREQEEPYMKRKVLRLSQT  62

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IK+ NL L +TT+K+IVEDP    E SKRWKI S+YGDIGL Y ++E  AYVASRMP
Sbjct  63    FNQIKDVNLQLASTTAKKIVEDPF---EQSKRWKITSSYGDIGLIYRDEETNAYVASRMP  119

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSA YRVL EVRRR+P FSP+KVLDFGAGTGSAFWA++EVWP+SL+KVNL+EPSQSMQ
Sbjct  120   AVYSACYRVLKEVRRRLPGFSPSKVLDFGAGTGSAFWALQEVWPKSLEKVNLIEPSQSMQ  179

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAG+ L +GLKNLPLIHSY S+Q+LS++I KS R+HDLVIASYVLGEIPS+KDRIT+VRQ
Sbjct  180   RAGRSLMQGLKNLPLIHSYDSIQSLSKSITKSEREHDLVIASYVLGEIPSIKDRITIVRQ  239

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LWDLT DILVLVEPGTP GSNII+Q+RSHILWME RK RK    + + CK L T K+GAF
Sbjct  240   LWDLTRDILVLVEPGTPHGSNIIAQMRSHILWMEERKYRKSSRKNNEVCKDLITEKAGAF  299

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             +VAPCPHDG CPL KSGKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKFSYVVFRRG 
Sbjct  300   VVAPCPHDGACPLVKSGKYCHFVQRLERTSSQRAYKRSKGDPLRGFEDEKFSYVVFRRGS  359

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQF--------PseneddlneeeiiSY  786
             RP + WPL+GM+FETLKEQHA+RNPEDLEIDYED          P E  D   +      
Sbjct  360   RPSDPWPLDGMEFETLKEQHAKRNPEDLEIDYEDWLKLQQSDDTPHEVADAETDIADDLE  419

Query  785   NSddtevdtvtdneeledeqeETG-------------AATADLGTGWGRIVYSPICRGKR  645
               D           + +D  E  G               +ADLG GWGRIV+ P+ RG++
Sbjct  420   TDDAPREVVNAVTYDSDDAVETDGPIDSEEDEEREEERGSADLGGGWGRIVFMPVRRGRQ  479

Query  644   IEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWP  510
             + M+VCR++  + ++GS+DRI++T++KNPTLH  A+RS+WGDLWP
Sbjct  480   VTMNVCRSTKRDASEGSYDRIVVTRTKNPTLHQQAKRSIWGDLWP  524



>gb|KHN37711.1| Methyltransferase-like protein 17, mitochondrial [Glycine soja]
Length=527

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/527 (65%), Positives = 406/527 (77%), Gaps = 27/527 (5%)
 Frame = -1

Query  2018  ASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A  ++ET  K  T E LR AAKQS  C VVP+RLRRAIKKY++EQE+P+MKRKVLRLS++
Sbjct  3     AQTIAETAQKILTPETLRYAAKQSARCLVVPVRLRRAIKKYLREQEEPYMKRKVLRLSQT  62

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IK+ NL L +TT+K+IVEDP    E SKRWKI S+YGDIGL Y ++E  AYVASRMP
Sbjct  63    FNQIKDVNLQLASTTAKKIVEDPF---EQSKRWKITSSYGDIGLIYRDEETNAYVASRMP  119

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSA YRVL EVRRR+P FSP+KVLDFGAGTGSAFWA++EVWP+SL+KVNL+EPSQSMQ
Sbjct  120   AVYSACYRVLKEVRRRLPGFSPSKVLDFGAGTGSAFWALQEVWPKSLEKVNLIEPSQSMQ  179

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAG+ L +GLKNLPLIHSY S+Q+LS++I KS R+HDLVIASYVLGEIPS+KDRIT+VRQ
Sbjct  180   RAGRSLMQGLKNLPLIHSYDSIQSLSKSITKSEREHDLVIASYVLGEIPSIKDRITIVRQ  239

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAF  1122
             LWDLT DILVLVEPGTP GSNII+Q+RSHILWME RK RK    + + CK L T K+GAF
Sbjct  240   LWDLTRDILVLVEPGTPHGSNIIAQMRSHILWMEERKYRKSSRKNNEVCKDLITEKAGAF  299

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             +VAPCPHDG CPL KSGKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKFSYVVFRRG 
Sbjct  300   VVAPCPHDGACPLVKSGKYCHFVQRLERTSSQRAYKRSKGDPLRGFEDEKFSYVVFRRGS  359

Query  941   RPRET--WPLNGMKFETLKEQHARRNPEDLEIDYEDQF--------Pseneddlneeeii  792
             RPR+   WPL+GM+FETLKEQHA+RNPEDLEIDYED          P E  D   +    
Sbjct  360   RPRQVDPWPLDGMEFETLKEQHAKRNPEDLEIDYEDWLKLQQSDDTPHEVADAETDIADD  419

Query  791   SYNSddtevdtvtdneeledeqeETG-------------AATADLGTGWGRIVYSPICRG  651
                 D           + +D  E  G               +ADLG GWGRIV+ P+ RG
Sbjct  420   LETDDAPREVVNAVTYDSDDAVETDGPIDSEEDEEREEERGSADLGGGWGRIVFMPVRRG  479

Query  650   KRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWP  510
             +++ M+VCR++  + ++GS+DRI++T++KNPTLH  A+RS+WGDLWP
Sbjct  480   RQVTMNVCRSTKRDASEGSYDRIVVTRTKNPTLHQQAKRSIWGDLWP  526



>gb|AET02450.2| ribosomal methyltransferase [Medicago truncatula]
Length=510

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/496 (68%), Positives = 398/496 (80%), Gaps = 3/496 (1%)
 Frame = -1

Query  1985  TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLP  1806
             T E L  AAKQS  C  VPL LRRAIKKY++EQE+P+MKRKVLRLS+SF  IK  NL L 
Sbjct  15    TPETLIYAAKQSQRCLTVPLPLRRAIKKYLREQEEPYMKRKVLRLSQSFNEIKNVNLQLA  74

Query  1805  TTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSE  1626
             TTTS+EIVE PLKS+E SKRWKI S+YGDIGL Y ++E IAYVASRMPAVYSA YRVL E
Sbjct  75    TTTSREIVEHPLKSLEQSKRWKITSSYGDIGLTYRDEETIAYVASRMPAVYSACYRVLKE  134

Query  1625  VRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKN  1446
             V RR+P FSP KVLDFGAGTGSAFWA++EVWP+SL+KVN++EPSQSMQRAGQ L +GLK+
Sbjct  135   VSRRLPGFSPTKVLDFGAGTGSAFWALQEVWPKSLEKVNIIEPSQSMQRAGQRLIQGLKD  194

Query  1445  LPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLV  1266
             LPLIHSY S+QALS++I KS R HDLVIASYVLGEIPS+KDRIT++RQLWD T D+LVLV
Sbjct  195   LPLIHSYDSIQALSKDISKSERGHDLVIASYVLGEIPSIKDRITILRQLWDQTQDVLVLV  254

Query  1265  EPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCP  1086
             EPGTP GS+II+Q+RS+ILWME RK RK  + + + CK L T K+GAF+VAPCPHDG CP
Sbjct  255   EPGTPHGSSIIAQMRSYILWMEERKHRKSSKKNNEVCKDLITEKAGAFVVAPCPHDGTCP  314

Query  1085  LEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMK  906
             L KSGKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKFSYVVFRRG RPRE WPL+G+ 
Sbjct  315   LVKSGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFSYVVFRRGPRPREPWPLDGIT  374

Query  905   FETLKEQHARRNPEDLEIDYEDQFPseneddln---eeeiiSYNSddtevdtvtdneele  735
             F+TLKEQ A+RNPEDLEIDYED    +  DD      + I  Y SD  E D   +++  E
Sbjct  375   FDTLKEQQAKRNPEDLEIDYEDWLKLQEADDDAPREVDAIRRYESDGLETDGDGEDDNEE  434

Query  734   deqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPT  555
              ++ E     ADLG GWGRIV+ PI RGK++ M+VCR+   + ++G F R+++TKSKNP 
Sbjct  435   VKETEEETEIADLGGGWGRIVFMPIRRGKQVTMNVCRSIKRDASEGEFARMVVTKSKNPA  494

Query  554   LHHHARRSLWGDLWPF  507
             LH  A+RS+WGDLWPF
Sbjct  495   LHRQAKRSIWGDLWPF  510



>ref|XP_004511080.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
isoform X3 [Cicer arietinum]
Length=492

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/468 (69%), Positives = 387/468 (83%), Gaps = 7/468 (1%)
 Frame = -1

Query  1889  QEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGL  1710
             +E+P+MKRKVLRLS+SF  IK  NL L TTTS+EIVEDPLKS E SKRWKI+S+YGDIGL
Sbjct  25    EEEPYMKRKVLRLSQSFNEIKNVNLQLTTTTSREIVEDPLKSSEQSKRWKIKSSYGDIGL  84

Query  1709  RYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWP  1530
              Y +DE IAYVASRMPAVYSA +RVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWP
Sbjct  85    TYRDDETIAYVASRMPAVYSACFRVLKEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWP  144

Query  1529  RSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYV  1350
             +SL+KVNL+EPSQSMQRAGQGL +GLKNLPLIHSY S+QALS+NI KS R HDLVIASYV
Sbjct  145   KSLEKVNLIEPSQSMQRAGQGLIQGLKNLPLIHSYDSIQALSKNIGKSERGHDLVIASYV  204

Query  1349  LGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKES  1170
             LGEIPSLKDRIT+VRQLWDLT D+LVLVEPGTP GS+II+Q+RSHILWME RK RK    
Sbjct  205   LGEIPSLKDRITIVRQLWDLTQDVLVLVEPGTPHGSSIIAQMRSHILWMEERKHRKSSNK  264

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLR  990
             + + CK L T K+GAF+VAPCPHDG CPL KSGKYCHFVQRLERT+SQRAYKRS G  LR
Sbjct  265   NNEVCKDLITEKAGAFVVAPCPHDGTCPLVKSGKYCHFVQRLERTSSQRAYKRSKGEPLR  324

Query  989   GFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFP-----se  825
             GFEDEKFSYV FRRG+RP E WPL+G+ F++LKEQHA+RNPEDLEIDYED         +
Sbjct  325   GFEDEKFSYVAFRRGRRPSEPWPLDGITFDSLKEQHAKRNPEDLEIDYEDWLKLQQADDD  384

Query  824   neddlneeeiiSYNSddtevdtvtd--neeledeqeETGAATADLGTGWGRIVYSPICRG  651
             ++      + + Y+SD  E D+  +  ++  E E+ E    +ADLG GWGRIV+ P+ RG
Sbjct  385   DDASREVVKAVKYDSDTIETDSDENGEDDNEEAEEMEEETDSADLGGGWGRIVFMPVRRG  444

Query  650   KRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +++ M+VCR++  + ++GS+DRI++TKSKNPTLHH A++S+WGDLWPF
Sbjct  445   RQVTMNVCRSTKRDASEGSYDRIVVTKSKNPTLHHQAKKSIWGDLWPF  492



>ref|XP_003627974.1| RSM22-like protein [Medicago truncatula]
Length=536

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/491 (68%), Positives = 392/491 (80%), Gaps = 3/491 (1%)
 Frame = -1

Query  1985  TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLP  1806
             T E L  AAKQS  C  VPL LRRAIKKY++EQE+P+MKRKVLRLS+SF  IK  NL L 
Sbjct  15    TPETLIYAAKQSQRCLTVPLPLRRAIKKYLREQEEPYMKRKVLRLSQSFNEIKNVNLQLA  74

Query  1805  TTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSE  1626
             TTTS+EIVE PLKS+E SKRWKI S+YGDIGL Y ++E IAYVASRMPAVYSA YRVL E
Sbjct  75    TTTSREIVEHPLKSLEQSKRWKITSSYGDIGLTYRDEETIAYVASRMPAVYSACYRVLKE  134

Query  1625  VRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKN  1446
             V RR+P FSP KVLDFGAGTGSAFWA++EVWP+SL+KVN++EPSQSMQRAGQ L +GLK+
Sbjct  135   VSRRLPGFSPTKVLDFGAGTGSAFWALQEVWPKSLEKVNIIEPSQSMQRAGQRLIQGLKD  194

Query  1445  LPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLV  1266
             LPLIHSY S+QALS++I KS R HDLVIASYVLGEIPS+KDRIT++RQLWD T D+LVLV
Sbjct  195   LPLIHSYDSIQALSKDISKSERGHDLVIASYVLGEIPSIKDRITILRQLWDQTQDVLVLV  254

Query  1265  EPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCP  1086
             EPGTP GS+II+Q+RS+ILWME RK RK  + + + CK L T K+GAF+VAPCPHDG CP
Sbjct  255   EPGTPHGSSIIAQMRSYILWMEERKHRKSSKKNNEVCKDLITEKAGAFVVAPCPHDGTCP  314

Query  1085  LEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMK  906
             L KSGKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKFSYVVFRRG RPRE WPL+G+ 
Sbjct  315   LVKSGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFSYVVFRRGPRPREPWPLDGIT  374

Query  905   FETLKEQHARRNPEDLEIDYEDQFPseneddln---eeeiiSYNSddtevdtvtdneele  735
             F+TLKEQ A+RNPEDLEIDYED    +  DD      + I  Y SD  E D   +++  E
Sbjct  375   FDTLKEQQAKRNPEDLEIDYEDWLKLQEADDDAPREVDAIRRYESDGLETDGDGEDDNEE  434

Query  734   deqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPT  555
              ++ E     ADLG GWGRIV+ PI RGK++ M+VCR+   + ++G F R+++TKSKNP 
Sbjct  435   VKETEEETEIADLGGGWGRIVFMPIRRGKQVTMNVCRSIKRDASEGEFARMVVTKSKNPA  494

Query  554   LHHHARRSLWG  522
             LH  A+RS+W 
Sbjct  495   LHRQAKRSIWA  505



>gb|EPS63995.1| hypothetical protein M569_10786, partial [Genlisea aurea]
Length=497

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/507 (64%), Positives = 402/507 (79%), Gaps = 15/507 (3%)
 Frame = -1

Query  2021  MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             MAS +SE +PKFTAE L+ AAKQS  C ++P  LR A++KYI+EQE  HM+RKVL LS+S
Sbjct  1     MASLISEALPKFTAETLKLAAKQSQRCHLIPDSLRLAVEKYIREQEVMHMRRKVLSLSQS  60

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F  IKEANLLLP++TS+ +V+DP K++  S+RWK++S+YGDIG RY+ED+A+AYVA+RMP
Sbjct  61    FNEIKEANLLLPSSTSRILVDDPPKAMAISQRWKMRSSYGDIGFRYQEDQAVAYVAARMP  120

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVYSALYRVLSEVRRRVPDF+P KVLDFGAGTGSA WAM EVWP  L+++NLVEPSQSMQ
Sbjct  121   AVYSALYRVLSEVRRRVPDFTPTKVLDFGAGTGSALWAMMEVWPGCLKRINLVEPSQSMQ  180

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAG  L + L+ LPLI  Y S+++L++NIKK +RQH+LVIASYVLGEIPSLKDRIT+VRQ
Sbjct  181   RAGLSLAKDLEGLPLIQGYDSIESLTKNIKKPDRQHNLVIASYVLGEIPSLKDRITLVRQ  240

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLK-SGA  1125
             LW+LT DILVLVEPGTPQGSNIISQ+RSHILW E+R+ RKL+++S  +CK L   K +GA
Sbjct  241   LWNLTDDILVLVEPGTPQGSNIISQMRSHILWAEKRRTRKLQKAS--TCKDLMLPKTTGA  298

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             F+VAPCPHDGPCPL+ + KYCHFVQRLERT SQR YKRS  G LRGFEDEKF YV  RRG
Sbjct  299   FVVAPCPHDGPCPLQNTDKYCHFVQRLERTPSQRIYKRSK-GPLRGFEDEKFCYVALRRG  357

Query  944   QRPR-ETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddte  768
              RPR E WPL+GMKFETLKE  A+R PED  I Y          D  EEE    + D  +
Sbjct  358   TRPRLEAWPLDGMKFETLKELQAKRAPED-SIVY---------ADHEEEEEDEGDDDRMD  407

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
                  + ++ +D++       ADLG+GWGRI+Y P  RGKR+E+D+CRA+D +G  GSF+
Sbjct  408   SVATCNGDDDDDDEGGGDEPRADLGSGWGRIIYMPFRRGKRVELDICRATDRDGAHGSFN  467

Query  587   RIIITKSKNPTLHHHARRSLWGDLWPF  507
             R+++T+ +NPTLHH ARRS+WGDLWP 
Sbjct  468   RVVVTQRQNPTLHHQARRSMWGDLWPL  494



>ref|XP_010106345.1| Methyltransferase-like protein 17 [Morus notabilis]
 gb|EXC52362.1| Methyltransferase-like protein 17 [Morus notabilis]
Length=502

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/502 (66%), Positives = 406/502 (81%), Gaps = 6/502 (1%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             + ET  K  T E LR+AAKQS  C VVP+R RRAIKKYI+EQEDPH + KVLRLS+S   
Sbjct  6     IPETAKKLLTPETLRSAAKQSVGCLVVPVRFRRAIKKYIREQEDPHTRNKVLRLSQSLNE  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK A+L +    SK++V++       S+RWKIQS+YGDIGL+Y +D+ IAYVASRMPAV+
Sbjct  66    IKGASLQITAAASKDLVDE-----RQSRRWKIQSSYGDIGLKYRDDQTIAYVASRMPAVF  120

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA YRVLSEVRRR+P FSP+ VLDFGAGTGSAFWA+REVWP+SL+KVNL+EPSQSMQRAG
Sbjct  121   SACYRVLSEVRRRLPSFSPSTVLDFGAGTGSAFWALREVWPQSLEKVNLIEPSQSMQRAG  180

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             + L +GLKNLPLIHSY S++ALS+ IKKS R+HD+VIASYVLGEIPS +DRIT+VRQLW+
Sbjct  181   RSLIQGLKNLPLIHSYESIEALSKKIKKSERKHDIVIASYVLGEIPSFQDRITIVRQLWE  240

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RKLK  +G++ K L   KSGA+IVA
Sbjct  241   LTQDVLVLVEPGTPQGSSIISQMRSHILWMEKRKLRKLKGKNGEASKDLLDPKSGAYIVA  300

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PC HDG CPLEK+G YCHFVQRLERTT+QR YKRS G  LRGFEDEKFS+V FRRGQRP+
Sbjct  301   PCAHDGACPLEKTGTYCHFVQRLERTTTQRTYKRSKGKVLRGFEDEKFSFVAFRRGQRPK  360

Query  932   ETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvt  753
             E WPL+G+KFETLKEQ A+R PED+E+DY+D    + E  +   E     + D+E   +T
Sbjct  361   EAWPLDGVKFETLKEQLAKRKPEDVEVDYDDLVKQQEELAVVPSEEPDPITYDSEETEIT  420

Query  752   dneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIIT  573
             D E+ ++ +EE     ADLG GWGRI++SPI RGK++ ++VCR+   +G++GS++RIIIT
Sbjct  421   DVEDNDEAEEEEETNRADLGGGWGRIIFSPIRRGKQVSLNVCRSMKQDGSEGSYERIIIT  480

Query  572   KSKNPTLHHHARRSLWGDLWPF  507
             K+KNP LH  AR+SLWGDLWPF
Sbjct  481   KNKNPILHRQARKSLWGDLWPF  502



>ref|XP_008388378.1| PREDICTED: rsm22-cox11 tandem protein 2, mitochondrial-like isoform 
X2 [Malus domestica]
Length=457

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/457 (70%), Positives = 381/457 (83%), Gaps = 1/457 (0%)
 Frame = -1

Query  1874  MKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEED  1695
             MKRKVLRLSESF  IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S YGDIGL Y +D
Sbjct  1     MKRKVLRLSESFSQIKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIRSNYGDIGLTYRDD  60

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E IAYVASRMPAV+SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA+REVWP SL+K
Sbjct  61    ETIAYVASRMPAVFSACHRVLKEVRRRIPEFSPAKVLDFGAGTGSAFWALREVWPHSLEK  120

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
             VNLVEPSQSMQRAGQ LT+G KNLPLIHSY SLQ+L+++  KS R+HDLVIASYVLGEIP
Sbjct  121   VNLVEPSQSMQRAGQKLTQGQKNLPLIHSYDSLQSLTKSXTKSEREHDLVIASYVLGEIP  180

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
             SLKDRIT+VRQLWDLT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ S ++ 
Sbjct  181   SLKDRITIVRQLWDLTRDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGSEETS  240

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFED  978
             K L T KSGAFIVAPC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFED
Sbjct  241   KDLVTQKSGAFIVAPCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFED  300

Query  977   EKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneee  798
             EKFS+V FRRGQRPRE WPL+GMKFETLKEQHA+R+PEDLEID ++   S+  D +  EE
Sbjct  301   EKFSFVAFRRGQRPREPWPLDGMKFETLKEQHAKRSPEDLEIDLDESISSQQADLVPFEE  360

Query  797   iiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRAS  618
                 N D   ++T   +E  ++ +EE     ADLG GWGRI+Y P+ RGK++ MDVCR++
Sbjct  361   PNPVNYDSDVMETDMVDENDKNNEEEDETGHADLGGGWGRIIYMPVRRGKQVTMDVCRST  420

Query  617   DHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
               +G++G   R+++TKSKNPTLH  AR+S+WGDLWPF
Sbjct  421   KRDGSEGELQRVVVTKSKNPTLHLQARKSIWGDLWPF  457



>ref|XP_006439272.1| hypothetical protein CICLE_v10019764mg [Citrus clementina]
 gb|ESR52512.1| hypothetical protein CICLE_v10019764mg [Citrus clementina]
Length=462

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/464 (70%), Positives = 391/464 (84%), Gaps = 10/464 (2%)
 Frame = -1

Query  1874  MKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEED  1695
             MKRKVLRLSESF  IK  NL L  +TSKE+ EDPLKSVE SKRWKI+SAYGDIGL+Y +D
Sbjct  1     MKRKVLRLSESFNAIKGVNLTLTESTSKELFEDPLKSVEQSKRWKIKSAYGDIGLKYRDD  60

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E IAYVASRMPAVYSA YRVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL+K
Sbjct  61    ETIAYVASRMPAVYSACYRVLCEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLEK  120

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
             VNLVEPSQSMQRAGQ L +GLK+LPLIHSY+S+QAL+++I KS R+HDLVIASYVLGE+P
Sbjct  121   VNLVEPSQSMQRAGQSLMQGLKDLPLIHSYNSIQALNKDISKSEREHDLVIASYVLGEVP  180

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL-----KES  1170
             SL+DRIT+VRQLWDLT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RK      K++
Sbjct  181   SLQDRITIVRQLWDLTRDVLVLVEPGTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDT  240

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLR  990
             + ++ K L TL+SG  IVAPCPH+G CPLE SGKYCHFVQRL+RTTSQRAYKRS    LR
Sbjct  241   NKETSKDLVTLRSGVHIVAPCPHEGRCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLR  300

Query  989   GFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl  810
             GFEDEKFS+V FRRG+RPRE WPL+GMKF+TLKEQHA+RNPEDLEIDYED    + E ++
Sbjct  301   GFEDEKFSFVAFRRGERPRERWPLDGMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEV  360

Query  809   ---neeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIE  639
                 +E++++Y SD+ + DTV  +++ E  +EET    ADLG GWGRI++SP+ RG+++ 
Sbjct  361   EPCKKEDLVNYESDEVQDDTVDSDKDQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVA  418

Query  638   MDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             MDVCR+   +G++GSF  ++ T+SKNPTLH  A++SLWGDLWPF
Sbjct  419   MDVCRSIKRDGSEGSFQHLVFTRSKNPTLHRLAKKSLWGDLWPF  462



>gb|KDO76648.1| hypothetical protein CISIN_1g012511mg [Citrus sinensis]
 gb|KDO76649.1| hypothetical protein CISIN_1g012511mg [Citrus sinensis]
Length=462

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/464 (70%), Positives = 390/464 (84%), Gaps = 10/464 (2%)
 Frame = -1

Query  1874  MKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEED  1695
             MKRKVLRLSESF  IK  NL L  +TSKE+ EDPLKSVE SKRWKI+SAYGDIGL+Y +D
Sbjct  1     MKRKVLRLSESFNAIKGVNLTLTESTSKELFEDPLKSVEQSKRWKIKSAYGDIGLKYRDD  60

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E IAYVASRMPAVYSA YRVL EVRRR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL+K
Sbjct  61    ETIAYVASRMPAVYSACYRVLCEVRRRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLEK  120

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
             VNLVEPSQSMQRAGQ L +G K+LPLIHSY+S+QAL+++I KS R+HDLVIASYVLGE+P
Sbjct  121   VNLVEPSQSMQRAGQSLMQGPKDLPLIHSYNSIQALNKDISKSEREHDLVIASYVLGEVP  180

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL-----KES  1170
             SL+DRIT+VRQLWDLT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RK      K++
Sbjct  181   SLQDRITIVRQLWDLTRDVLVLVEPGTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDT  240

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLR  990
             + ++ K L TL+SG  IVAPCPH+G CPLE SGKYCHFVQRL+RTTSQRAYKRS    LR
Sbjct  241   NKETSKDLVTLRSGVHIVAPCPHEGRCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLR  300

Query  989   GFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl  810
             GFEDEKFS+V FRRG+RPRE WPL+GMKF+TLKEQHA+RNPEDLEIDYED    + E ++
Sbjct  301   GFEDEKFSFVAFRRGERPRERWPLDGMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEV  360

Query  809   ---neeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIE  639
                 +E++++Y SD+ + DTV  +++ E  +EET    ADLG GWGRI++SP+ RG+++ 
Sbjct  361   EPCKKEDLVNYESDEVQDDTVDSDKDQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVA  418

Query  638   MDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             MDVCR+   +G++GSF  ++ T+SKNPTLH  A++SLWGDLWPF
Sbjct  419   MDVCRSIKRDGSEGSFQHLVFTRSKNPTLHRLAKKSLWGDLWPF  462



>ref|XP_009344050.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=455

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/457 (70%), Positives = 384/457 (84%), Gaps = 3/457 (1%)
 Frame = -1

Query  1874  MKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEED  1695
             MKRKVLRLSESF  IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S+YGDIGL Y +D
Sbjct  1     MKRKVLRLSESFSQIKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIKSSYGDIGLSYRDD  60

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E +AYVASRMPAV+SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA++EVWP SL+K
Sbjct  61    ETVAYVASRMPAVFSACHRVLKEVRRRLPEFSPAKVLDFGAGTGSAFWALQEVWPNSLEK  120

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
             VNLVEPSQSMQRAGQ L +G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIP
Sbjct  121   VNLVEPSQSMQRAGQKLIQGQKNLPLIHSYDSLQSLTKSINKSEREHDLVIASYVLGEIP  180

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
             SLKDRIT+VRQLWDLT D+LVL+EPGTPQGS+IISQ+RSHILWME+RKCRK K+ + ++ 
Sbjct  181   SLKDRITIVRQLWDLTQDVLVLIEPGTPQGSSIISQMRSHILWMEKRKCRKSKDGTDEAS  240

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFED  978
             K L T KSGAFIVAPC HDG CPLEK+GKYCHFVQRLERT+ QRA+KRS GG  LRGFED
Sbjct  241   KDLVTQKSGAFIVAPCSHDGQCPLEKAGKYCHFVQRLERTSVQRAFKRSKGGQPLRGFED  300

Query  977   EKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneee  798
             EKFS+V FRRGQRPRE WPL+GMKFETLKEQHA+R+ EDLEID ++   S+  D +  EE
Sbjct  301   EKFSFVAFRRGQRPREPWPLDGMKFETLKEQHAKRSTEDLEIDIDELINSQQVDLVPFEE  360

Query  797   iiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRAS  618
             +   N D   ++    +E  EDE++ETG   ADLG GWGRI+Y P+ RGK++ MDVCR++
Sbjct  361   LNPVNYDSDVMEPDLVDENNEDEEDETGH--ADLGGGWGRIIYMPVRRGKQVTMDVCRST  418

Query  617   DHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
               +G++G   R+++TKSKNPTLH  AR+S+WGDLWPF
Sbjct  419   KLDGSEGELQRVVVTKSKNPTLHLQARKSIWGDLWPF  455



>ref|XP_009358659.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=485

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/462 (67%), Positives = 381/462 (82%), Gaps = 1/462 (0%)
 Frame = -1

Query  1889  QEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGL  1710
             +++PHMK+KVLRLSESF  IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S YGDIGL
Sbjct  24    EDEPHMKKKVLRLSESFSQIKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIRSNYGDIGL  83

Query  1709  RYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWP  1530
              Y +DE IAYVASR+PAV+SA +RVL +VRRR+PDFSPAKVL+FGAGTGSAFWA+REVWP
Sbjct  84    TYRDDETIAYVASRIPAVFSACHRVLKKVRRRIPDFSPAKVLNFGAGTGSAFWALREVWP  143

Query  1529  RSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYV  1350
              SL+KVNLVEPSQSMQRAGQ LT+G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYV
Sbjct  144   HSLEKVNLVEPSQSMQRAGQKLTQGQKNLPLIHSYDSLQSLTKSITKSEREHDLVIASYV  203

Query  1349  LGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKES  1170
             LGEIP LKDRI +VRQLWDLT D+LVL+EPGT QGSNIISQ+RSHILWME+RKCRK K+ 
Sbjct  204   LGEIPLLKDRINIVRQLWDLTWDVLVLIEPGTLQGSNIISQMRSHILWMEKRKCRKSKDG  263

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-L  993
             S ++ + L T KSGAFIVAPC HDG CPLE +GKYCHFVQR+ERT+ Q A+KRS GG  L
Sbjct  264   SEETSRDLVTQKSGAFIVAPCSHDGQCPLENAGKYCHFVQRMERTSVQCAFKRSKGGQPL  323

Query  992   RGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPsenedd  813
              GFEDEKFS+V FRRGQRPRE WPL+GMKFETLKEQ+A+R+PEDLEID ++   S+  D 
Sbjct  324   HGFEDEKFSFVAFRRGQRPREPWPLDGMKFETLKEQYAKRSPEDLEIDLDELISSQQADL  383

Query  812   lneeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMD  633
             +  EE    N D   ++T   +E  ++ +EE     ADLG GWGRI+Y P+ RGK++ MD
Sbjct  384   IPFEEPNPVNYDSDVMETDVVDENDKNNEEEDETGHADLGGGWGRIIYMPVRRGKQVTMD  443

Query  632   VCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             VC+++  +G++G   R+++TKSKNPTLH  AR+S+WGDLWPF
Sbjct  444   VCQSTKRDGSEGELQRVVVTKSKNPTLHLQARKSIWGDLWPF  485



>ref|XP_002299443.2| hypothetical protein POPTR_0001s11080g [Populus trichocarpa]
 gb|EEE84248.2| hypothetical protein POPTR_0001s11080g [Populus trichocarpa]
Length=473

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/509 (64%), Positives = 390/509 (77%), Gaps = 40/509 (8%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + ET  K FTAE LR+A KQSD C +VP+RLRRAIKKY++EQE+PHMK+KVLRLSE
Sbjct  1     MASLIPETTKKLFTAENLRSATKQSDRCLIVPVRLRRAIKKYLREQEEPHMKKKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ N++L   TSKE+VEDP KS+E SKRWKI+S+YGDIGL Y +DE IAYVASRM
Sbjct  61    SFSDIKDKNMMLAINTSKELVEDPFKSMERSKRWKIKSSYGDIGLSYRDDETIAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV+SA YRVLSEVRRR+P FSP K+LDFGAGTGSAFWA+REVWP+SLQKVNLVEPSQSM
Sbjct  121   PAVFSACYRVLSEVRRRLPGFSPTKILDFGAGTGSAFWAIREVWPKSLQKVNLVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L + LKNLPLIHSY+SLQ LS++I+KS R+HDLVIASYVLGEIPSLKDRIT+VR
Sbjct  181   QRAGRSLIQDLKNLPLIHSYNSLQDLSKSIRKSERKHDLVIASYVLGEIPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LTGD+LVLVEPGTP G  IISQ+RSHILWME+RKC K +    + CK L   K GA
Sbjct  241   QLWELTGDVLVLVEPGTPHGFGIISQMRSHILWMEKRKCGKAEGKINEPCKDLVPYKGGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             F++AP                                RS G +LRGFEDEKFS+V FRRG
Sbjct  301   FVIAP--------------------------------RSKGETLRGFEDEKFSFVAFRRG  328

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYED---QFPseneddlneeeiiSYNSdd  774
             QRPR+ WPL+GM+FETLKEQHA+RNP DLEIDYED   Q   E E    E + + Y+S  
Sbjct  329   QRPRKPWPLDGMRFETLKEQHAKRNPVDLEIDYEDLIEQNQPEEEVPYEEVDPVYYDS--  386

Query  773   tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGS  594
                   TD  +  DE+E+   A ADLG GWGRIV+SP  RG+++ +DVCR+++ + ++GS
Sbjct  387   --DVIETDTNDDNDEEEQEEEAHADLGGGWGRIVFSPFKRGRQVTLDVCRSNNRDNSEGS  444

Query  593   FDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             F+RI++TKSK+P LH+ ARRS WGDLWPF
Sbjct  445   FERIVVTKSKSPALHYQARRSHWGDLWPF  473



>ref|XP_008775004.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Phoenix dactylifera]
Length=511

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/503 (64%), Positives = 406/503 (81%), Gaps = 14/503 (3%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
              T E LR+AAKQS+   +VPL LRRA+KK+++E+++ HM RKVL LSESF  IK+ANL L
Sbjct  14    LTPETLRSAAKQSEGIHLVPLSLRRAVKKFLRERQEAHMNRKVLLLSESFSRIKDANLQL  73

Query  1808  PTTTSKEIVEDPLKSVEC-SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVL  1632
               ++S+++V+DP + V+  S RWKIQSAYGDIGL+Y EDE +AYVASRMPAVYSA +RVL
Sbjct  74    MASSSRDLVDDPHRPVDHRSARWKIQSAYGDIGLKYREDETVAYVASRMPAVYSACHRVL  133

Query  1631  SEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGL  1452
              EVRRR+P+FSPA+VLDFGAG GS  WAMREVWPRSL++VNLVEPS+SMQRA Q L + L
Sbjct  134   REVRRRLPEFSPARVLDFGAGPGSVLWAMREVWPRSLERVNLVEPSKSMQRACQSLLQDL  193

Query  1451  KNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
             KNLPLIHSY S+QAL++N+ K +R+HDLVI+SY LGEIPSL DRITVVRQLWDLT D+LV
Sbjct  194   KNLPLIHSYDSIQALNRNLDKRDREHDLVISSYALGEIPSLSDRITVVRQLWDLTRDVLV  253

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS---GKSCKAL----TTLKSGAFIVA  1113
             L+EPGTP GS II+Q+RS+ILWME+RKCRK  +SS       K++     +LKSGAF+VA
Sbjct  254   LLEPGTPHGSKIITQMRSYILWMEKRKCRKSNDSSREVSSDVKSIAVERASLKSGAFVVA  313

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PCPHDG CPLE +GKYCHFVQRLERT+SQRAYKRS G  LRGFEDEKF +V  RRG+RPR
Sbjct  314   PCPHDGRCPLENTGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFCFVALRRGKRPR  373

Query  932   ETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiS-YNSddtevdtv  756
             E WPL+ M+FETLKE+ A+RNPEDL +D+EDQF +E +++   E+ +  Y SD  E    
Sbjct  374   EAWPLDSMEFETLKERLAKRNPEDLIVDFEDQFETEADEESTFEDALVPYASDIAETSMF  433

Query  755   tdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIII  576
               +++ E+EQ       ADLG GWGRI+Y+P+ RG++++MDVCR++  +G++G+ +R+++
Sbjct  434   HQDDDDEEEQ-----VRADLGGGWGRIIYTPLRRGRQVQMDVCRSTKRDGSEGALERVVV  488

Query  575   TKSKNPTLHHHARRSLWGDLWPF  507
             T++KNPTLH  ARRSLWGDLWPF
Sbjct  489   TQTKNPTLHLQARRSLWGDLWPF  511



>ref|XP_006857863.1| hypothetical protein AMTR_s00069p00083920 [Amborella trichopoda]
 gb|ERN19330.1| hypothetical protein AMTR_s00069p00083920 [Amborella trichopoda]
Length=562

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/532 (61%), Positives = 404/532 (76%), Gaps = 12/532 (2%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS L ETVPK FTAE L++AAKQS    +VP RLRRAIKK+I+EQE  +MKRKVLRLS+
Sbjct  1     MASVLPETVPKLFTAETLKSAAKQSQKIVLVPHRLRRAIKKFIQEQEKENMKRKVLRLSQ  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK ANLL+  + S+E+V +PL S+E SKRWKI+S+YGDIGL+Y +DE +AYVA+RM
Sbjct  61    SFNEIKGANLLMGDSVSRELVNNPLGSMETSKRWKIKSSYGDIGLKYMDDETVAYVAARM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVL EVRRR+PDFSP++VLDFG+G GSA WA+RE WP SL++VNLVEPS +M
Sbjct  121   PAVYSACYRVLKEVRRRLPDFSPSRVLDFGSGPGSALWALRENWPHSLERVNLVEPSPAM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
              RA   L + +K LP I  Y S+Q L Q ++KS+++HDLVIASYVLGEIPS+KDRITV R
Sbjct  181   LRASGSLLQDVKGLPRIQGYDSIQTLRQGVRKSDQEHDLVIASYVLGEIPSVKDRITVAR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTT-LKSG  1128
             QLWDLT D+LVL+EPGTPQGS+II Q+RSHILWM +RK RK++     + K L    K G
Sbjct  241   QLWDLTRDVLVLIEPGTPQGSSIIRQMRSHILWMAKRKLRKVENMPNAASKDLMIRSKYG  300

Query  1127  AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             AF+VAPC HDGPCPLE S KYCHFVQRLERT+SQRAYKRS    LRGFEDEKF YV  RR
Sbjct  301   AFVVAPCAHDGPCPLENSEKYCHFVQRLERTSSQRAYKRSRDQPLRGFEDEKFCYVALRR  360

Query  947   GQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddte  768
             G+RP   WPL+GMKFETLKE+HA+RNPEDLEIDYEDQF  + + +  +     Y S D  
Sbjct  361   GERPGAAWPLDGMKFETLKERHAKRNPEDLEIDYEDQF--KFDTEAEDVPYEEYLSSDAS  418

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
             V       E E+E E+     ADLG+GWGRI+++P+ RGK+I MDVCR++  +G++G+F 
Sbjct  419   VTETDTPLEEEEEVEQDDQP-ADLGSGWGRIIFTPLRRGKQITMDVCRSTALDGSQGAFQ  477

Query  587   RIIITKSKNPTLHHHARRSLWGDLWPF*TTM-----IASKFCYSLKIFYINF  447
             R+++T+SKNPTLHH ARR+  G +    T M     IA   C+ ++I +  F
Sbjct  478   RVVVTQSKNPTLHHQARRT--GKIVVLKTLMDLVHPIAEITCHLVQIRFWIF  527



>ref|XP_009397843.1| PREDICTED: 37S ribosomal protein S22, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/514 (63%), Positives = 412/514 (80%), Gaps = 15/514 (3%)
 Frame = -1

Query  2018  ASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             AS L E   K FT E LR+AAKQS+   +VPL LRRAIKK+++++++ HM RKVL LSES
Sbjct  3     ASLLPEAAQKVFTPETLRSAAKQSEGIHLVPLSLRRAIKKFLRDRDNSHMNRKVLLLSES  62

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVE-CSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             F  IK+ANL L  +  +++V+DP + VE  + RWKIQSAYGDIGL+Y EDE +AYVASRM
Sbjct  63    FNRIKDANLQLAASAYRDLVDDPFRPVEHLAGRWKIQSAYGDIGLKYREDETVAYVASRM  122

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA +RVL EVRRR+PDFSP+KVLDFGAG GSA WAMREVWPRSL+++NLVEPS+SM
Sbjct  123   PAVYSACHRVLREVRRRLPDFSPSKVLDFGAGPGSALWAMREVWPRSLERINLVEPSKSM  182

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRA Q L + LK LP+IHSY S+QAL++N+ K +R+HDLVI+SY LGEIPSL DRIT+VR
Sbjct  183   QRAAQSLLQDLKGLPIIHSYDSIQALNRNLDKHDRKHDLVISSYALGEIPSLSDRITIVR  242

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC---KALTT--  1140
             QLWDLT D+LVL+EPGTP GS II+Q+RS+ILWM +RKCRK  ESS  +    K++    
Sbjct  243   QLWDLTRDVLVLLEPGTPHGSKIITQMRSYILWMAKRKCRKNGESSNVASSDEKSIVQPK  302

Query  1139  --LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFS  966
               LK+GAF+VAPCPHDG CPLE + KYCHFVQRLERT+SQRAYKRS G  LRGFEDEKF 
Sbjct  303   GLLKNGAFVVAPCPHDGRCPLENTSKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFC  362

Query  965   YVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl-neeeiiS  789
             +V  RRG+RP+E WPL+GM+FETLKE+ A+RNPEDL ID+EDQF +E++ +   E+ ++ 
Sbjct  363   FVALRRGKRPQEAWPLDGMEFETLKERLAKRNPEDLIIDFEDQFATEDDAESPFEDALVP  422

Query  788   YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHE  609
             Y SD  E +   +NE  E+EQ       ADLG+GWGRI+++P+ RG++I+MD+CR++  +
Sbjct  423   YASDIAETNMFHENENEEEEQ-----THADLGSGWGRIIFTPMRRGRQIQMDICRSTKRD  477

Query  608   GTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             G+ G+F+R+++T++KNPTLH  ARRSLWGDLWPF
Sbjct  478   GSVGAFERMVVTQAKNPTLHLQARRSLWGDLWPF  511



>ref|XP_010919278.1| PREDICTED: LOW QUALITY PROTEIN: methyltransferase-like protein 
17, mitochondrial [Elaeis guineensis]
Length=511

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/516 (63%), Positives = 409/516 (79%), Gaps = 16/516 (3%)
 Frame = -1

Query  2021  MASRL-SETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLS  1848
             MAS L  E  PK  T E LR+AAKQS+   +VPL LRRAIKK+++E++  HM RKVL LS
Sbjct  1     MASALIPEAAPKLLTPETLRSAAKQSEGIHLVPLSLRRAIKKFLRERQKAHMNRKVLLLS  60

Query  1847  ESFRHIKEANLLLPTTTSKEIVEDPLKSVEC-SKRWKIQSAYGDIGLRYEEDEAIAYVAS  1671
             ESF  IK+ANL L  ++S+++V+DP + V+  S RWKIQSAYGDIGL+Y EDE  AYVAS
Sbjct  61    ESFSRIKDANLQLIASSSRDLVDDPYRPVDHRSARWKIQSAYGDIGLKYREDETEAYVAS  120

Query  1670  RMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQ  1491
             RMPAVYSA +RVL EVRRR+P+FSP +VLDFGAG GSA WAMR+VWPRSL++VNLVEPS+
Sbjct  121   RMPAVYSACHRVLREVRRRLPEFSPGRVLDFGAGPGSALWAMRDVWPRSLERVNLVEPSK  180

Query  1490  SMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITV  1311
             SMQRA Q L + LK+LPLIHSY S+QAL++N+ K +R+HDLVI+SY LGEIPSL DRITV
Sbjct  181   SMQRACQSLLQDLKDLPLIHSYDSIQALNRNLDKGDREHDLVISSYALGEIPSLSDRITV  240

Query  1310  VRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL-----  1146
             +RQLWDLT D+LVL+EPGTP GS II+Q+RS+ILWME+RKCRK  +SS +    +     
Sbjct  241   LRQLWDLTRDVLVLLEPGTPHGSKIITQMRSYILWMEKRKCRKSTDSSREVLSDVKSIAV  300

Query  1145  --TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEK  972
                +LKSGAF+VAPCPHDG CPLE +GKYCHFVQRLERT+SQRAYKRS G  LRGFEDEK
Sbjct  301   ERASLKSGAFVVAPCPHDGRCPLENTGKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEK  360

Query  971   FSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl-neeei  795
             F +V  RRG+RPRE WPL+ M+FETLKE+ A+RNPEDL +D+EDQ  +E +++   E+ +
Sbjct  361   FCFVALRRGKRPREAWPLDSMEFETLKERLAKRNPEDLIVDFEDQSETEADEESPFEDAL  420

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
             + Y S     D    +   +DE+EE     ADLG GWGRI+Y+P+ RG++I+MDVCR++ 
Sbjct  421   VPYAS-----DISESSMFHQDEEEEEEEVRADLGGGWGRIIYTPVRRGRQIQMDVCRSTK  475

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              +G++G+F+R+++T+SKNP LH  ARRSLWGDLWPF
Sbjct  476   RDGSEGAFERVVVTQSKNPALHLQARRSLWGDLWPF  511



>ref|XP_010533560.1| PREDICTED: uncharacterized protein LOC104809314 isoform X2 [Tarenaya 
hassleriana]
Length=517

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/499 (65%), Positives = 400/499 (80%), Gaps = 8/499 (2%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FTAE LRAAAKQS  C VVP+RLRRAIKK+++E +DPHM++KV++LSESF+ IK+ NLLL
Sbjct  8     FTAETLRAAAKQSLRCLVVPVRLRRAIKKFLREHDDPHMRKKVIQLSESFKEIKDTNLLL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+KE+V DP+KSV  SKRWKIQ+ YGD GL Y + E  AYVASRMPAV+SA YRVL+
Sbjct  68    PETTAKELV-DPMKSV-GSKRWKIQTVYGDSGLEYRDGETAAYVASRMPAVFSACYRVLT  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+PDF+P KVLDFGAGTGS FWA++EVWP+S++K+NLVEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRLPDFAPEKVLDFGAGTGSGFWAVKEVWPKSVEKINLVEPSQSMQRAGRSLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVL  1269
             ++PLIH Y+SL ALS++I  S R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LVL
Sbjct  186   DVPLIHGYTSLLALSKDISSSERKHDLVIASYVLGEIPSLKDRITVVRQLWDLTQDVLVL  245

Query  1268  VEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK--SCKALTTLKSGAFIVAPCPHDG  1095
             +EPGTP G+NIISQ+RSHILWME+RK RKL++   K    K L  LK+GA++VAPCPHDG
Sbjct  246   LEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKEPESKDLLDLKAGAYVVAPCPHDG  305

Query  1094  PCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLN  915
              CPLE +GKYCHFVQRL+RT+SQRAYKR+ G  LRGFEDEKF +V FRRG RPRE WPL+
Sbjct  306   KCPLENTGKYCHFVQRLQRTSSQRAYKRTKGEPLRGFEDEKFCFVAFRRGLRPREPWPLD  365

Query  914   GMKFETLKEQHARRNPEDLEIDYED----QFPseneddlneeeiiSYNSddtevdtvtdn  747
             G+KFETLKE+HA+R PEDLEIDYED    Q       D  E +     SD  +     + 
Sbjct  366   GIKFETLKEKHAKRKPEDLEIDYEDFIKTQIVEVPYIDPREYDSDIVESDAIDDTDNEEE  425

Query  746   eeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKS  567
             E  E E+ E   A A +G GWGRI++ P+ RGK++++D+C  ++ +G++G F+R +IT+S
Sbjct  426   ETCEGEEGEEMGARAGMGGGWGRIIFPPMRRGKQVQLDLCMPTNEDGSEGKFERRVITQS  485

Query  566   KNPTLHHHARRSLWGDLWP  510
             KNP LH  A+RS WGDLWP
Sbjct  486   KNPDLHFQAKRSFWGDLWP  504



>ref|XP_010418535.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010473728.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Camelina sativa]
Length=551

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/533 (60%), Positives = 402/533 (75%), Gaps = 27/533 (5%)
 Frame = -1

Query  2009  LSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             ++  VPK FT E LR+AAKQS    VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ 
Sbjct  1     MAANVPKVFTVETLRSAAKQSLRLLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQE  60

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ NL LP +T+K +  D + SVE +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+
Sbjct  61    IKDTNLQLPESTAKSLA-DCMNSVE-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVF  118

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             S  YRVL E+RRR+PDF P +VLDFGAGTGS FWA++EVWP+S+++VN+VEPSQSMQRAG
Sbjct  119   SVCYRVLIEIRRRIPDFRPTRVLDFGAGTGSGFWAVQEVWPKSVERVNIVEPSQSMQRAG  178

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNI--------KKSNRQHDLVIASYVLGEIPSLKDRI  1317
             + L +GLK+LPLIH Y+SL ALS+ I        +KS R+HDLVIASYVLGEIPSLKDRI
Sbjct  179   RNLIQGLKDLPLIHGYTSLLALSKEINKQCKEINEKSQRKHDLVIASYVLGEIPSLKDRI  238

Query  1316  TVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC--KALT  1143
             TVVRQLWDLT D+LVLVEPGTP G+NIISQ+RSHILWME+RK RKL+    K+   KA+ 
Sbjct  239   TVVRQLWDLTDDLLVLVEPGTPHGANIISQMRSHILWMEKRKLRKLENKMKKAGAEKAVL  298

Query  1142  TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
              LKSGA IVAPCPHDG CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+
Sbjct  299   DLKSGAHIVAPCPHDGKCPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSF  358

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN  783
             VVFRRGQRPRE WPL+GMK ETLKE+ + + PEDLEIDYED F      ++      +Y+
Sbjct  359   VVFRRGQRPRELWPLDGMKLETLKERRSNKKPEDLEIDYED-FIKSQVVEVPYINPRAYD  417

Query  782   SddtevdtvtdneeledeqeETGAAT-------------ADLGTGWGRIVYSPICRGKRI  642
             SD  + +   ++ E  DE  E    T             A +G GWGRI++ P  +GK++
Sbjct  418   SDTMDEEEEQEDGEGTDEDVEDTTDTTEEGDQEEEESERACVGGGWGRIIFPPFRKGKQV  477

Query  641   EMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF*TTMIASK  483
              +D+C  +  +G++G+F+R +ITKSKNP LH  A++S WGDLWP  T   + K
Sbjct  478   TLDMCVPTKEDGSEGAFERRVITKSKNPDLHLQAKKSFWGDLWPLTTQQESGK  530



>ref|XP_010430603.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X1 [Camelina sativa]
Length=545

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/527 (60%), Positives = 399/527 (76%), Gaps = 21/527 (4%)
 Frame = -1

Query  2009  LSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             ++  VPK FT E LR+AAKQS    VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ 
Sbjct  1     MAAKVPKVFTVETLRSAAKQSLRLLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQE  60

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ NL LP +T+K +  D + SV+ +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+
Sbjct  61    IKDTNLQLPESTAKSLA-DCMNSVD-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVF  118

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             S  YRVL E+RRR+P+F P +VLDFGAGTGS FWA++EVWP+S+++VN+VEPSQSMQRAG
Sbjct  119   SVCYRVLIEIRRRIPEFRPTRVLDFGAGTGSGFWAVQEVWPKSVERVNIVEPSQSMQRAG  178

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNI--------KKSNRQHDLVIASYVLGEIPSLKDRI  1317
             + L +GLK+LPLIH Y+SL ALS+ I        +KS R+HDLVIASYVLGEIPSLKDRI
Sbjct  179   RNLIQGLKDLPLIHGYTSLLALSKEINKQCKEINEKSARKHDLVIASYVLGEIPSLKDRI  238

Query  1316  TVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC--KALT  1143
             TVVRQLWDLT D+LVLVEPGTP G+NIISQ+RSHILWME+RK RKL+    K+   KA+ 
Sbjct  239   TVVRQLWDLTDDLLVLVEPGTPHGANIISQMRSHILWMEKRKLRKLENKMKKAGADKAVL  298

Query  1142  TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
              LKSGA IVAPCPHDG CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+
Sbjct  299   DLKSGAHIVAPCPHDGKCPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSF  358

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN  783
             VVFRRGQRPRE WPL+GMK ETLKE+ A + PEDLEIDYED F      ++   +  +Y+
Sbjct  359   VVFRRGQRPRELWPLDGMKLETLKERRANKKPEDLEIDYED-FIKLQVVEVPYIDPRAYD  417

Query  782   SddtevdtvtdneeledeqeETGAAT-------ADLGTGWGRIVYSPICRGKRIEMDVCR  624
             SD  E     +  + + E               A +G GWGRI++ P  +GK++ +D+C 
Sbjct  418   SDTEEEQEDGEGTDEDVEDTIEEEDQEEEESERASVGGGWGRIIFPPFRKGKQVTLDMCV  477

Query  623   ASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF*TTMIASK  483
              +  +G++G+F+R +ITKSKNP LH  A++S WGDLWP  T   + K
Sbjct  478   PTKEDGSEGAFERRVITKSKNPDLHLQAKKSFWGDLWPLTTQQESGK  524



>ref|XP_010533559.1| PREDICTED: uncharacterized protein LOC104809314 isoform X1 [Tarenaya 
hassleriana]
Length=518

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/500 (65%), Positives = 400/500 (80%), Gaps = 9/500 (2%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FTAE LRAAAKQS  C VVP+RLRRAIKK+++E +DPHM++KV++LSESF+ IK+ NLLL
Sbjct  8     FTAETLRAAAKQSLRCLVVPVRLRRAIKKFLREHDDPHMRKKVIQLSESFKEIKDTNLLL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+KE+V DP+KSV  SKRWKIQ+ YGD GL Y + E  AYVASRMPAV+SA YRVL+
Sbjct  68    PETTAKELV-DPMKSV-GSKRWKIQTVYGDSGLEYRDGETAAYVASRMPAVFSACYRVLT  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+PDF+P KVLDFGAGTGS FWA++EVWP+S++K+NLVEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRLPDFAPEKVLDFGAGTGSGFWAVKEVWPKSVEKINLVEPSQSMQRAGRSLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVL  1269
             ++PLIH Y+SL ALS++I  S R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LVL
Sbjct  186   DVPLIHGYTSLLALSKDISSSERKHDLVIASYVLGEIPSLKDRITVVRQLWDLTQDVLVL  245

Query  1268  VEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK--SCKALTTLKSGAFIVAPCPHDG  1095
             +EPGTP G+NIISQ+RSHILWME+RK RKL++   K    K L  LK+GA++VAPCPHDG
Sbjct  246   LEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKEPESKDLLDLKAGAYVVAPCPHDG  305

Query  1094  PCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRP-RETWPL  918
              CPLE +GKYCHFVQRL+RT+SQRAYKR+ G  LRGFEDEKF +V FRRG RP RE WPL
Sbjct  306   KCPLENTGKYCHFVQRLQRTSSQRAYKRTKGEPLRGFEDEKFCFVAFRRGLRPRREPWPL  365

Query  917   NGMKFETLKEQHARRNPEDLEIDYED----QFPseneddlneeeiiSYNSddtevdtvtd  750
             +G+KFETLKE+HA+R PEDLEIDYED    Q       D  E +     SD  +     +
Sbjct  366   DGIKFETLKEKHAKRKPEDLEIDYEDFIKTQIVEVPYIDPREYDSDIVESDAIDDTDNEE  425

Query  749   neeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITK  570
              E  E E+ E   A A +G GWGRI++ P+ RGK++++D+C  ++ +G++G F+R +IT+
Sbjct  426   EETCEGEEGEEMGARAGMGGGWGRIIFPPMRRGKQVQLDLCMPTNEDGSEGKFERRVITQ  485

Query  569   SKNPTLHHHARRSLWGDLWP  510
             SKNP LH  A+RS WGDLWP
Sbjct  486   SKNPDLHFQAKRSFWGDLWP  505



>ref|XP_003571978.2| PREDICTED: 37S ribosomal protein S22, mitochondrial [Brachypodium 
distachyon]
Length=516

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/519 (60%), Positives = 386/519 (74%), Gaps = 20/519 (4%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E LR AAKQS    +VP+ LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETAPRLLTPEVLRTAAKQSQGIHLVPISLRRAIKRYLRDQDKTHMHRKVLMLSSS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + + RWK+QS+YGD GL+Y EDE +AYVA
Sbjct  63    FERAKGTGAELTAAATRGALLDDPHAPAGAEQRTARWKVQSSYGDTGLQYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR PDF+P KVLDFGAG  SA WAMR VWP+S+++VNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRSPDFAPKKVLDFGAGPSSALWAMRAVWPKSIERVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L++ I+K  R HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQTLLDNLKGLPLIHSYDSIQELNRTIEKHERGHDLVISSYALGEIPSLSDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKS-------C  1155
             +VRQLWDLT D+LVL+EPGTPQGS IISQ+RS+ILWME+RKCRK ++S+G +        
Sbjct  243   IVRQLWDLTKDVLVLLEPGTPQGSKIISQMRSYILWMEKRKCRKSEKSTGGAPSKTKNIV  302

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  LK+GAF+VAPCPHDG CPLE S KYCHFVQRLERT+SQR YKRS G  LRGFEDE
Sbjct  303   HQEALLKNGAFVVAPCPHDGRCPLENSDKYCHFVQRLERTSSQRIYKRSKGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKF+TLKE+HA+RNPEDL IDYE+QFPSE +++      
Sbjct  363   KFCYVALRRGKRPEEAWPLDGMKFDTLKERHAKRNPEDLIIDYEEQFPSEEDEETLAGHE  422

Query  794   iS---YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCR  624
              S   Y SD  E+    ++ E EDE        ADLG GWGRI+YSPI RG++++MDVCR
Sbjct  423   DSLVPYTSDTQELSLFHESREEEDE-----PIRADLGGGWGRIIYSPIRRGRQVQMDVCR  477

Query  623   ASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             A+  + ++G+F+R+++T+SKNP LH  ARRSLWGDLWPF
Sbjct  478   ATKRDASEGAFERVVVTQSKNPALHLQARRSLWGDLWPF  516



>gb|EMT26597.1| Protein RSM22-like protein, mitochondrial [Aegilops tauschii]
Length=517

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/516 (59%), Positives = 388/516 (75%), Gaps = 13/516 (3%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET  +  T E LR AAKQS     VP+ LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETASRLLTPETLRTAAKQSQGIHRVPISLRRAIKRYLRDQDKTHMHRKVLLLSSS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L   +++  + D    P  + + + RWK+QS+YGDIGLRY EDE +AYVA
Sbjct  63    FERAKGTGAELAAASTRSALLDDPHAPASAEQRTARWKVQSSYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR P F+P  VLDFGAG  SA WAMR VWP+S+++VNL+EPS
Sbjct  123   SRMPAIYAACHRVLREVRRRSPGFAPKNVLDFGAGPSSALWAMRAVWPKSIERVNLIEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L+++I+K  R+HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQTLLDNLKGLPLIHSYDSIQELNRSIEKHERRHDLVISSYALGEIPSLNDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTT--  1140
             +VRQLWDLT D+LVL+EPGTPQGS IISQ+RS+ILWME+RKCRK ++S+G +   + +  
Sbjct  243   IVRQLWDLTKDVLVLLEPGTPQGSKIISQMRSYILWMEKRKCRKSEKSTGAAPSKMKSMV  302

Query  1139  -----LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  LK GAF+VAPCPHDG CPLE S KYCHFVQRLERT+SQR YKRS G  LRGFEDE
Sbjct  303   VQEDLLKDGAFVVAPCPHDGRCPLENSDKYCHFVQRLERTSSQRIYKRSKGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKF+TLKE+HA+RNPEDL IDY+DQFPSE +++  + + 
Sbjct  363   KFCYVALRRGKRPEEAWPLDGMKFDTLKERHAKRNPEDLIIDYDDQFPSEEDEEAPDGDE  422

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
              S     ++   ++   E  +E+EE     ADLG GWGRI+YSPI RG++++MDVCRA+ 
Sbjct  423   DSLVPYASDTQELSLFHESGEEEEEE-PIRADLGGGWGRIIYSPIRRGRQVQMDVCRATK  481

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              + ++G+F+R+++T+SKNP LH  AR+SLWGDLWPF
Sbjct  482   RDASEGAFERVVVTQSKNPALHLQARKSLWGDLWPF  517



>dbj|BAK06673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/516 (59%), Positives = 386/516 (75%), Gaps = 13/516 (3%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET  +  T E LR AAKQS     VP+ LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  10    AALLPETASRLLTPETLRTAAKQSQGIHRVPISLRRAIKRYLRDQDKTHMHRKVLLLSSS  69

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + + RWK+QS+YGDIGLRY EDE +AYVA
Sbjct  70    FERAKGTGTELAAAATRSALLDDPHAPASAEQRTARWKVQSSYGDIGLRYREDETVAYVA  129

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR PDF+P  VLDFGAG  SA WAMR VWP+S+++VNL+EPS
Sbjct  130   SRMPAIYAACHRVLREVRRRSPDFAPKNVLDFGAGPSSALWAMRAVWPKSIERVNLIEPS  189

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY  +Q L+++I+K  R+HDLVI+SY LGEIPSL DRIT
Sbjct  190   KEMQRAGQTLLDNLKGLPLIHSYDGIQELNRSIEKHERRHDLVISSYALGEIPSLNDRIT  249

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTT--  1140
             + RQLWDLT D+LVL+EPGTPQGS IISQ+RS+ILWME+RKCRK ++S+G +   + +  
Sbjct  250   IARQLWDLTKDVLVLLEPGTPQGSKIISQMRSYILWMEKRKCRKSEKSTGAAPSKMKSIV  309

Query  1139  -----LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  LK GAF+VAPCPHDG CPLE S KYCHFVQRLERT+SQR YKRS G  LRGFEDE
Sbjct  310   AQEDLLKDGAFVVAPCPHDGQCPLENSDKYCHFVQRLERTSSQRIYKRSKGVPLRGFEDE  369

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKF+TLKE+HA+RNPEDL IDY+DQFPSE +++  + + 
Sbjct  370   KFCYVALRRGKRPEEAWPLDGMKFDTLKERHAKRNPEDLIIDYDDQFPSEEDEEAPDCDE  429

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
              S     ++   ++   E  +E+EE     ADLG GWGRI+YSPI RG++++MDVCRA+ 
Sbjct  430   DSLVPYASDTQELSLFHESGEEEEEE-PIRADLGGGWGRIIYSPIRRGRQVQMDVCRATK  488

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              + ++G+F+R+++T+SKNP LH  AR+SLWGDLWPF
Sbjct  489   RDASEGAFERVVVTQSKNPALHLQARKSLWGDLWPF  524



>ref|NP_176641.2| copper ion binding / methyltransferase [Arabidopsis thaliana]
 dbj|BAC43631.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64854.1| At1g64600 [Arabidopsis thaliana]
 gb|AEE34259.1| copper ion binding / methyltransferase [Arabidopsis thaliana]
Length=537

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/506 (61%), Positives = 391/506 (77%), Gaps = 13/506 (3%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E LR+A+KQ   C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK+ NL L
Sbjct  8     FTVETLRSASKQCLRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDTNLQL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + S+E +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+S  YRVL 
Sbjct  68    PETTAKSLA-DSMNSLE-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVFSVCYRVLI  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRRVP F+P +VLDFGAGTGS FWA++EVWP+S++KVN+VEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRVPGFTPTRVLDFGAGTGSGFWAVKEVWPKSVEKVNIVEPSQSMQRAGRNLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNI-KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
             +LPLIH Y+SL AL++ I KKS R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LV
Sbjct  186   DLPLIHGYTSLLALNKEINKKSERKHDLVIASYVLGEIPSLKDRITVVRQLWDLTDDLLV  245

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGP  1092
             LVEPGTP G+NIISQ+RSHILWME+RK RKL++   K  K +  LKSGA IVAPCPHDG 
Sbjct  246   LVEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKDGKEVLDLKSGAHIVAPCPHDGK  305

Query  1091  CPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNG  912
             CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKF +V FRRGQRPRE WPL+G
Sbjct  306   CPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVAFRRGQRPRELWPLDG  365

Query  911   MKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvtdneeled  732
             MK ETLKE+ A + PEDLEIDYED F      ++   +  +Y+SD  + +     +    
Sbjct  366   MKLETLKERRANKKPEDLEIDYED-FIKSQVVEVPYIDPRAYDSDTMDENEEEQEDGGGT  424

Query  731   eqeETGAAT---------ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRII  579
             +++E              A +G GWGRI++ P  +GK++ +D+C  +  +G++G+F+R +
Sbjct  425   DEDEEDKIEEEIEEESERASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFERRV  484

Query  578   ITKSKNPTLHHHARRSLWGDLWPF*T  501
             ITKSKNP LH  A++S WGDLWP  T
Sbjct  485   ITKSKNPDLHLQAKKSFWGDLWPLTT  510



>gb|KFK32955.1| hypothetical protein AALP_AA6G311300 [Arabis alpina]
Length=539

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/515 (60%), Positives = 387/515 (75%), Gaps = 15/515 (3%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
              T E LR AAKQS  C  VP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK+ NLLL
Sbjct  8     ITVENLRTAAKQSLRCLTVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQDIKDTNLLL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL Y + E  AY+ASRMPAV+S  YRVL 
Sbjct  68    PETTAKNLA-DSMNSVE-TKRWKIQTVYGDSGLEYRDGETAAYIASRMPAVFSVCYRVLI  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+PDF P +VLDFGAGTGS FWA++EVWP+S++K+N+VEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRLPDFEPTRVLDFGAGTGSGFWAVQEVWPKSVEKINIVEPSQSMQRAGRNLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNI-KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
             +LPLIH Y+SL AL + + KKS   H+LVIASYVLGEIPSLKDRITVVRQLWDLT D+LV
Sbjct  186   DLPLIHGYTSLLALRKELNKKSESNHNLVIASYVLGEIPSLKDRITVVRQLWDLTDDLLV  245

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKL--KESSGKSCKALTTLKSGAFIVAPCPHD  1098
             LVEPGTP G+NIISQ+RSHILWME RK RKL  K    ++ K +  LK GA IVAPCPHD
Sbjct  246   LVEPGTPHGANIISQMRSHILWMENRKMRKLGDKMKKNEAVKDVLDLKLGAHIVAPCPHD  305

Query  1097  GPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPL  918
             G CPL+ + KYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+VVF+RGQRPRE WPL
Sbjct  306   GKCPLQNTAKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSFVVFKRGQRPREPWPL  365

Query  917   NGMKFETLKEQHARRNPEDLEIDYED-------QFPse---neddlneeeiiSYNSddte  768
             + MK ETLKE+ A R PED EIDYED       Q P       D   +E+      D   
Sbjct  366   DSMKLETLKEKRANRKPEDREIDYEDFIKSQVVQMPYIDPRANDSDTDEDDEEEPEDKEV  425

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
              D   +  E+E+ +EE  +  A LG GWGRI++ P  +GK++ +D+C  +  +G++G+F+
Sbjct  426   TDEDENENEIEEREEEDESERASLGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFE  485

Query  587   RIIITKSKNPTLHHHARRSLWGDLWPF*TTMIASK  483
             R +ITKSKNP LH  A++S WGDLWP  T   +SK
Sbjct  486   RRVITKSKNPDLHAQAKKSFWGDLWPCTTQQDSSK  520



>ref|XP_007039453.1| Methyltransferases,copper ion binding isoform 2, partial [Theobroma 
cacao]
 gb|EOY23954.1| Methyltransferases,copper ion binding isoform 2, partial [Theobroma 
cacao]
Length=451

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/446 (69%), Positives = 365/446 (82%), Gaps = 13/446 (3%)
 Frame = -1

Query  1946  SCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLK  1767
             S  +  +RLRRAIKKY++EQEDP+M+RKVLRLSESF  IK+ NL L   TSKE+VEDPLK
Sbjct  7     STAINEVRLRRAIKKYLREQEDPYMRRKVLRLSESFSEIKDVNLHLTAETSKELVEDPLK  66

Query  1766  SVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKV  1587
             SVE SKRWKI+SAYGDIGL Y +DE +AYVASRMPAVYSA YRVL EVRRR+P FSP KV
Sbjct  67    SVEQSKRWKIKSAYGDIGLTYRDDETVAYVASRMPAVYSACYRVLGEVRRRLPGFSPTKV  126

Query  1586  LDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL  1407
             LDFGAGTGSAFWA+REVWP++++K+N+VEPSQSMQRAG+ L +GLKNLPLIHSY+SLQ L
Sbjct  127   LDFGAGTGSAFWAIREVWPKTVEKINIVEPSQSMQRAGRSLIQGLKNLPLIHSYASLQTL  186

Query  1406  SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQ  1227
             +++I KS R+HDLVIASYVLGE+PSLKDRIT+VRQLW+LT D+LVLVEPGTP GSNIISQ
Sbjct  187   TKDISKSEREHDLVIASYVLGEVPSLKDRITIVRQLWNLTRDVLVLVEPGTPHGSNIISQ  246

Query  1226  VRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQR  1047
             +RSHILWME+RKCRK K ++ +  K L  L+SGAFI+APCPHDG CPLEKSGKYCHFVQR
Sbjct  247   MRSHILWMEKRKCRKAK-ANKEGSKDLIDLRSGAFIIAPCPHDGCCPLEKSGKYCHFVQR  305

Query  1046  LERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRP-RETWPLNGMKFETLKEQHARRN  870
             L+RT+SQRAYKRS G  LRGFEDEKF +V FRRGQRP RE+WPL+G+KFETLKEQ A+RN
Sbjct  306   LQRTSSQRAYKRSKGDPLRGFEDEKFCFVAFRRGQRPRRESWPLDGIKFETLKEQRAKRN  365

Query  869   PEDLEIDYEDQFPseneddl---neeeiiSYNSddtevdtvtdneelede--------qe  723
             PEDLEIDYED    +   D+    E    +Y+SD  E D V+DN+E             +
Sbjct  366   PEDLEIDYEDLVNIKETADVIPYEEVHSSAYDSDVMETDLVSDNDEDHQVEEQDNDEEDQ  425

Query  722   ETGAATADLGTGWGRIVYSPICRGKR  645
             E   A ADLG GWGRI++ P+ RG++
Sbjct  426   EEETALADLGGGWGRIIFPPVRRGRQ  451



>ref|XP_002465050.1| hypothetical protein SORBIDRAFT_01g031290 [Sorghum bicolor]
 gb|EER92048.1| hypothetical protein SORBIDRAFT_01g031290 [Sorghum bicolor]
Length=518

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/516 (59%), Positives = 393/516 (76%), Gaps = 12/516 (2%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E LR AAKQS    +VPL LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETAPRLLTPETLRTAAKQSQGIHLVPLSLRRAIKRYLRDQDKAHMNRKVLLLSAS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + + RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FDRAKGTGAELAAAATRGALLDDPNAPSGAEQRAARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+PDF+PAKVLDFGAG  SA WAMR VWP+S+++VNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPDFAPAKVLDFGAGPSSALWAMRAVWPKSIERVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L++ I+K  R HDLV++SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQSLLDNLKGLPLIHSYDSIQELNRKIEKHERGHDLVVSSYALGEIPSLSDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL----  1146
             +VRQLWDLT D+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++SS +   ++    
Sbjct  243   IVRQLWDLTSDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSSSRPPSSMKSIV  302

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+G+F+VAPCPHDG CPLE S KYCHFVQRLERT+SQRAYKRS G  LRGFEDE
Sbjct  303   AQEASLKNGSFVVAPCPHDGRCPLENSDKYCHFVQRLERTSSQRAYKRSKGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+G+ FETLKE+HA+R PE+L IDY+DQFPSE ++++  +  
Sbjct  363   KFCYVALRRGKRPEEAWPLDGLNFETLKERHAKRKPEELIIDYDDQFPSEEDEEVPVDGG  422

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
              S     ++   ++   + E+ +EE     ADLG GWGRI+YSPI RG++++MDVCR++ 
Sbjct  423   DSLVPYASDEHELSLFHDSEEAEEEDQTIRADLGGGWGRIIYSPIRRGRQVQMDVCRSTK  482

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              + ++G+F+R+++T+SKNPTLH  ARRSLWGDLWPF
Sbjct  483   RDASEGAFERVVLTRSKNPTLHFQARRSLWGDLWPF  518



>ref|XP_009112845.1| PREDICTED: rsm22-cox11 tandem protein 2, mitochondrial [Brassica 
rapa]
Length=547

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/515 (60%), Positives = 389/515 (76%), Gaps = 23/515 (4%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E+LR  AKQS  C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK++NLLL
Sbjct  8     FTIESLRTLAKQSFRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDSNLLL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL+Y + E  AYVASRMPA YS  YRVL+
Sbjct  68    PETTAKRLA-DSMNSVE-AKRWKIQTVYGDSGLQYRDGETAAYVASRMPAAYSVCYRVLT  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+P F P +VLDFGAGTGS FWA++EVWP+  QKVN+VEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRLPGFKPTRVLDFGAGTGSGFWAVQEVWPKCAQKVNIVEPSQSMQRAGRDLLQGLK  185

Query  1448  NLPLIHSYSSLQALSQNIK--------KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             +LPLIH Y+SL +LSQ +         KS R+H+LVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  186   DLPLIHGYTSLLSLSQELNKKCRILNDKSERKHELVIASYVLGEIPSLKDRITMVRQLWD  245

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVLVEPGTP G+NIISQ+RS+ILWME RK R  K+   ++ K +  LKSGA IVA
Sbjct  246   LTDDLLVLVEPGTPHGANIISQMRSYILWMENRKLR--KKEKAEAGKEVLDLKSGAHIVA  303

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PCPHDG CPLE + KYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKF +VVFRRGQRPR
Sbjct  304   PCPHDGKCPLENTAKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVVFRRGQRPR  363

Query  932   ETWPLNGMKFETLKEQHARRNPEDLEIDYEDQF-----------PseneddlneeeiiSY  786
             E WPL+ +K ETLKE  A R PEDLEIDYE+             P   + D+ +E+    
Sbjct  364   EPWPLDNIKLETLKEMRANRKPEDLEIDYEEFIKTQVVEVPYIDPRAQDSDITDEDEDEL  423

Query  785   NSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEG  606
                + E +   ++E   +E EE G+  A +G GWGRI++ P  +GK++ +D+C  ++ EG
Sbjct  424   EKVEEEGEGTDEDEVEVEEAEEEGSGRASVGGGWGRIIFPPFRKGKQVTLDMCVPTNEEG  483

Query  605   TKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF*T  501
             ++G+F+R +ITKSKNP LH  A++S WGDLWP  T
Sbjct  484   SEGAFERRVITKSKNPHLHLQAKKSFWGDLWPLTT  518



>ref|XP_002887871.1| hypothetical protein ARALYDRAFT_474886 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64130.1| hypothetical protein ARALYDRAFT_474886 [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/514 (60%), Positives = 394/514 (77%), Gaps = 15/514 (3%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E LR+AAKQS  C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK+ NL L
Sbjct  8     FTVETLRSAAKQSLRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDTNLQL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + S+E +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+S  YRVL 
Sbjct  68    PETTAKSLA-DSMNSLE-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVFSVCYRVLI  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRRVP F+P +VLDFGAGTGS FWA++EVWP+S++KVN+VEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRVPGFAPTRVLDFGAGTGSGFWAVKEVWPKSVEKVNIVEPSQSMQRAGRDLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNI-KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
             +LPLIH Y+SL AL++ I KKS R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LV
Sbjct  186   DLPLIHGYTSLLALNKEINKKSERKHDLVIASYVLGEIPSLKDRITVVRQLWDLTDDLLV  245

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGP  1092
             L+EPGTP G+NIISQ+RSHILWME+RK RKL++   K  K +  LKSGA IVAPCPHDG 
Sbjct  246   LIEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKDGKDVLDLKSGAHIVAPCPHDGK  305

Query  1091  CPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNG  912
             CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKF +V FRRGQRPRE WPL+G
Sbjct  306   CPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVAFRRGQRPRELWPLDG  365

Query  911   MKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvtdneeled  732
             MK ETLKE+ A + PEDLE+DYED F      ++   +  +Y+SD  + +     +    
Sbjct  366   MKLETLKERRANKKPEDLEVDYED-FIKSQVVEVPYIDPRAYDSDTMDDEEEEQEDGEGT  424

Query  731   eqeETGAAT-----------ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDR  585
             ++++                A +G GWGRI++ P  +GK++ +D+C  +  +G++G+F+R
Sbjct  425   DEDDEDKIEEEIEEEEESERASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFER  484

Query  584   IIITKSKNPTLHHHARRSLWGDLWPF*TTMIASK  483
              +ITKSKNP LH  A++S WGDLWP  T   + K
Sbjct  485   RVITKSKNPDLHLQAKKSFWGDLWPLTTQQESGK  518



>ref|XP_006302082.1| hypothetical protein CARUB_v10020069mg, partial [Capsella rubella]
 gb|EOA34980.1| hypothetical protein CARUB_v10020069mg, partial [Capsella rubella]
Length=565

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/527 (59%), Positives = 394/527 (75%), Gaps = 28/527 (5%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E LR+AAKQS  C VVP+ LRRAIKKY++E++DPH+++KV +LSESF+ IK+ NL L
Sbjct  21    FTVETLRSAAKQSLRCLVVPVPLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDTNLQL  80

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL+YE+ E  AY+ASRMPAV+S  YRVL 
Sbjct  81    PETTAKSLA-DSMNSVE-TKRWKIQTVYGDSGLQYEDGETAAYIASRMPAVFSVCYRVLI  138

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+P F+P +VLDFGAGTGS FWA++EVWP+S++KVN+VEPSQSMQRAG+ L +GLK
Sbjct  139   EIRRRLPGFTPTRVLDFGAGTGSGFWAVKEVWPKSVEKVNIVEPSQSMQRAGRNLIQGLK  198

Query  1448  NLPLIHSYSSLQALSQNI--------KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             +LPLIH Y+SL ALS+ I        +KS R+HDLVIASYVLGEIPSLKDRITVVRQLWD
Sbjct  199   DLPLIHGYTSLLALSKEISKKCKEINEKSERKHDLVIASYVLGEIPSLKDRITVVRQLWD  258

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWM--ERRKCRKLKESSGKSCKALTTLKSGAFI  1119
             LT DILVL+EPGTP G+NIISQ+RSHILWM   + +  + K  +G+  K +  LKSGA I
Sbjct  259   LTDDILVLIEPGTPHGANIISQMRSHILWMEKRKLRKLEKKLKNGELGKDVLDLKSGAHI  318

Query  1118  VAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQR  939
             VAPCPHDG CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+V FRRGQR
Sbjct  319   VAPCPHDGKCPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSFVAFRRGQR  378

Query  938   PRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSdd-----  774
             PRE WPL+GMK ETLKE+ A + P DLEIDYED F      ++   +   Y+SD      
Sbjct  379   PRELWPLDGMKLETLKERRANKKPADLEIDYED-FIKSQVVEVPYIDPRKYDSDTVDEEE  437

Query  773   ----------tevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCR  624
                       T+ D   + EE + E+EE     A +G GWGRI++ P  +GK++ +D+C 
Sbjct  438   EQEYGEDGEGTDEDMEDNIEEEDQEEEEGEGERASVGGGWGRIIFPPFRKGKQVTLDMCV  497

Query  623   ASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF*TTMIASK  483
              +  +G++G+F+R +ITKSKNP LH  A++S WGDLWP  T   + K
Sbjct  498   PTKEDGSEGAFERRVITKSKNPDLHLQAKKSFWGDLWPLTTQQESGK  544



>emb|CDY08387.1| BnaC09g12090D [Brassica napus]
Length=891

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/513 (60%), Positives = 386/513 (75%), Gaps = 21/513 (4%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E+LR  AKQS  C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK++NLLL
Sbjct  353   FTIESLRTLAKQSFRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDSNLLL  412

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL Y + E  AYVASRMPA YS  YRVL+
Sbjct  413   PETTAKRLA-DSMNSVE-AKRWKIQTVYGDSGLEYRDGETAAYVASRMPAAYSVCYRVLT  470

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+P F+P +VLDFGAGTGS FWA++EVWP+  QKVN+VEPSQSMQRAG+ L +GLK
Sbjct  471   EIRRRLPGFNPTRVLDFGAGTGSGFWAVQEVWPKCAQKVNIVEPSQSMQRAGRDLLQGLK  530

Query  1448  NLPLIHSYSSLQALSQNIK--------KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             +LPLIH Y+SL +LSQ +         KS R+H+LVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  531   DLPLIHGYTSLLSLSQELNKKCRILNDKSERKHELVIASYVLGEIPSLKDRITMVRQLWD  590

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVLVEPGTP G+NIISQ+RS+ILWME RK R  K+   ++ K +  LKSGA IVA
Sbjct  591   LTDDLLVLVEPGTPHGANIISQMRSYILWMENRKLR--KKEKAEAGKEVLDLKSGAHIVA  648

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PCPHDG CPLE + KYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKF +VVFRRGQRPR
Sbjct  649   PCPHDGKCPLENTAKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVVFRRGQRPR  708

Query  932   ETWPLNGMKFETLKEQHARRNPEDLEIDYED---------QFPseneddlneeeiiSYNS  780
             E WPL+ +K ETLKE  A R PEDLEIDYE+          +      D +  +      
Sbjct  709   EPWPLDNIKLETLKEMRANRKPEDLEIDYEEFIKTQVVEVPYSDPRAQDSDITDEDEQEE  768

Query  779   ddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTK  600
             +     T  D  E+E+ +EE G+  A +G GWGRI++ P  +GK++ +D+C  ++ EG++
Sbjct  769   EGEGEGTDEDEVEVEEAEEEEGSGRASVGGGWGRIIFPPFRKGKQVTLDMCVPTNEEGSE  828

Query  599   GSFDRIIITKSKNPTLHHHARRSLWGDLWPF*T  501
             G+F+R +ITKSKNP LH  A++S WGDLWP  T
Sbjct  829   GAFERRVITKSKNPHLHLQAKKSFWGDLWPLTT  861



>emb|CDY47833.1| BnaA09g12120D [Brassica napus]
Length=891

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/513 (60%), Positives = 387/513 (75%), Gaps = 21/513 (4%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E+LR  AKQS  C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK++NLLL
Sbjct  354   FTIESLRTLAKQSFRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDSNLLL  413

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL+Y + E  AYVASRMPA YS  YRVL+
Sbjct  414   PETTAKRLA-DSMNSVE-AKRWKIQTVYGDSGLQYRDGETAAYVASRMPAAYSVCYRVLT  471

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+P F P +VLDFGAGTGS FWA++EVWP+  QKVN+VEPSQSMQRAG+ L +GLK
Sbjct  472   EIRRRLPGFKPTRVLDFGAGTGSGFWAVQEVWPKCAQKVNIVEPSQSMQRAGRDLLQGLK  531

Query  1448  NLPLIHSYSSLQALSQNIK--------KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             +LPLIH Y+SL +LSQ +         KS R+H+LVIASYVLGEIPSLKDRIT+VRQLWD
Sbjct  532   DLPLIHGYTSLLSLSQELNKKCRILNDKSERKHELVIASYVLGEIPSLKDRITMVRQLWD  591

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
             LT D+LVLVEPGTP G+NIISQ+RS+ILWME RK R  K+   ++ K +  LKSGA IVA
Sbjct  592   LTDDLLVLVEPGTPHGANIISQMRSYILWMENRKLR--KKEKAEAGKEVLDLKSGAHIVA  649

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PCPHDG CPLE + KYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKF +VVFRRGQRPR
Sbjct  650   PCPHDGKCPLENTAKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFCFVVFRRGQRPR  709

Query  932   ETWPLNGMKFETLKEQHARRNPEDLEIDYED---------QFPseneddlneeeiiSYNS  780
             E WPL+ +K ETLKE  A R PEDLEIDYE+          +      D +  +      
Sbjct  710   EPWPLDNIKLETLKEMRANRKPEDLEIDYEEFIKTQVVEVPYIDPRAQDSDITDEDEDEL  769

Query  779   ddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTK  600
             ++ E    TD E+  + +EE G+  A +G GWGRI++ P  +GK++ +D+C  ++ EG++
Sbjct  770   EEIEEGEGTDEEDEVEVEEEEGSGRASVGGGWGRIIFPPFRKGKQVTLDMCVPTNEEGSE  829

Query  599   GSFDRIIITKSKNPTLHHHARRSLWGDLWPF*T  501
             G+F+R +ITKSKNP LH  A++S WGDLWP  T
Sbjct  830   GAFERRVITKSKNPHLHLQAKKSFWGDLWPLTT  862



>ref|XP_010278482.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X2 [Nelumbo nucifera]
Length=402

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/393 (73%), Positives = 340/393 (87%), Gaps = 1/393 (0%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS + E   K FT E LR+AAKQS+   +VP+RLRRAIKK ++EQE PHMKRKVL LSE
Sbjct  1     MASLIPEAAHKVFTPETLRSAAKQSERIHIVPVRLRRAIKKILREQEKPHMKRKVLSLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L T+TSKE+VEDPLKS+E SKRWKI+++YGDIGL+Y +DE +AYVASRM
Sbjct  61    SFSEIKDVNLQLATSTSKELVEDPLKSMERSKRWKIKTSYGDIGLKYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAV SA +RVL EVRRR+P FSPA+VLDFG+GTGS  WA+RE+WPRSL+++NLVEPS+SM
Sbjct  121   PAVCSACHRVLREVRRRLPGFSPARVLDFGSGTGSVLWALREIWPRSLERINLVEPSKSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAGQ L + LK+LPLIHSY S+QAL+QN++KS+R+HDLV+ASYVLGE+PSLKDRIT+VR
Sbjct  181   QRAGQSLLQDLKDLPLIHSYDSIQALTQNLEKSDREHDLVVASYVLGEVPSLKDRITMVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLWDLT D+LVL+EPGTP G NIISQ+RSHILWM +RKCRK  ++  ++ K L  LKSGA
Sbjct  241   QLWDLTRDVLVLIEPGTPHGFNIISQMRSHILWMTKRKCRKSDDACNEASKDLVGLKSGA  300

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             F+VAPCPHDGPCPLE S KYCHFVQRLERT+SQRAYKRS G  LRGFEDEKF +V  RRG
Sbjct  301   FVVAPCPHDGPCPLENSSKYCHFVQRLERTSSQRAYKRSKGEPLRGFEDEKFCFVALRRG  360

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDY  846
             QRPRE WPL+GMKF+TLKEQHA+RNPEDLEID+
Sbjct  361   QRPREPWPLDGMKFDTLKEQHAKRNPEDLEIDF  393



>tpg|DAA45965.1| TPA: hypothetical protein ZEAMMB73_551244 [Zea mays]
Length=517

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/516 (59%), Positives = 392/516 (76%), Gaps = 13/516 (3%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E LR AAKQS    +VPL LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETAPRLLTPETLRTAAKQSQGIHLVPLSLRRAIKRYLRDQDRAHMNRKVLLLSAS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + S RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FDRAKGTGAELAAAATRAALLDDPNAPSGAEQRSARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+P+F+PAKVLDFGAG  SA WAMR VWP+S+++VNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPEFAPAKVLDFGAGPSSALWAMRAVWPKSIERVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L++ I+K  R HDLV++SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQSLLDNLKGLPLIHSYDSIQELNRKIEKHERGHDLVVSSYALGEIPSLSDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL----  1146
             +VRQLWDLT D+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++SS +   ++    
Sbjct  243   IVRQLWDLTSDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSSSRPPSSMKSIV  302

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+G+F+VAPCPHDG CPLE S KYCHFVQRLERT+SQRA+KRS G  LRGFEDE
Sbjct  303   AQKVSLKNGSFVVAPCPHDGRCPLENSDKYCHFVQRLERTSSQRAFKRSKGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+ + FETLKE++A+R PEDL IDY+DQFPSE +++++ +  
Sbjct  363   KFCYVALRRGKRPEEAWPLDDLNFETLKERNAKRKPEDLVIDYDDQFPSEEDEEVHVDGG  422

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
              S     ++   ++   + E+ + E     ADLG GWGRI+YSP+ RG++++MDVCR++ 
Sbjct  423   DSLVPYASDEHELSLFHDSEEAEAEQ-TVRADLGGGWGRIIYSPMRRGRQVQMDVCRSTK  481

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
              + ++G+F+R+++T+SKNPTLH  AR+SLWGDLWPF
Sbjct  482   RDASEGTFERVVVTRSKNPTLHFQARKSLWGDLWPF  517



>ref|XP_007039454.1| Methyltransferases,copper ion binding isoform 3 [Theobroma cacao]
 gb|EOY23955.1| Methyltransferases,copper ion binding isoform 3 [Theobroma cacao]
Length=471

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/517 (60%), Positives = 376/517 (73%), Gaps = 67/517 (13%)
 Frame = -1

Query  2021  MASRLSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSE  1845
             MAS +SET  K FT E+LRAAAKQS+ C  VP+RLRRAIKKY++EQEDP+M+RKVLRLSE
Sbjct  1     MASLISETTQKIFTPESLRAAAKQSERCLDVPVRLRRAIKKYLREQEDPYMRRKVLRLSE  60

Query  1844  SFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRM  1665
             SF  IK+ NL L   TSKE+VEDPLKSVE SKRWKI+SAYGDIGL Y +DE +AYVASRM
Sbjct  61    SFSEIKDVNLHLTAETSKELVEDPLKSVEQSKRWKIKSAYGDIGLTYRDDETVAYVASRM  120

Query  1664  PAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSM  1485
             PAVYSA YRVL EVRRR+P FSP KVLDFGAGTGSAFWA+REVWP++++K+N+VEPSQSM
Sbjct  121   PAVYSACYRVLGEVRRRLPGFSPTKVLDFGAGTGSAFWAIREVWPKTVEKINIVEPSQSM  180

Query  1484  QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVR  1305
             QRAG+ L +GLKNLPLIHSY+SLQ L+++I KS R+HDLVIASYVLGE+PSLKDRIT+VR
Sbjct  181   QRAGRSLIQGLKNLPLIHSYASLQTLTKDISKSEREHDLVIASYVLGEVPSLKDRITIVR  240

Query  1304  QLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGA  1125
             QLW+LT D+LVLVEPGTP GSNIISQ+RSHILWME +KCRK K ++ +  K L  L+SGA
Sbjct  241   QLWNLTRDVLVLVEPGTPHGSNIISQMRSHILWME-KKCRKAK-ANKEGSKDLIDLRSGA  298

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             FI+APCPHDG                                                  
Sbjct  299   FIIAPCPHDG--------------------------------------------------  308

Query  944   QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSdd  774
                RE+WPL+G+KFETLKEQ A+RNPEDLEIDYED    +   D+    E    +Y+SD 
Sbjct  309   ---RESWPLDGIKFETLKEQRAKRNPEDLEIDYEDLVNIKETADVIPYEEVHSSAYDSDV  365

Query  773   tevdtvtdneelede--------qeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRAS  618
              E D V+DN+E             +E   A ADLG GWGRI++ P+ RG+++ M++CR +
Sbjct  366   METDLVSDNDEDHQVEEQDNDEEDQEEETALADLGGGWGRIIFPPVRRGRQVHMNICRPT  425

Query  617   DHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             + + ++GSFD  +IT+SKNPTLHH ARRS WGDLWP 
Sbjct  426   NGDASEGSFDHEVITQSKNPTLHHQARRSFWGDLWPL  462



>ref|XP_010496921.1| PREDICTED: methyltransferase-like protein 17, mitochondrial, 
partial [Camelina sativa]
Length=475

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/477 (61%), Positives = 363/477 (76%), Gaps = 24/477 (5%)
 Frame = -1

Query  2009  LSETVPK-FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             ++  VPK FT E LR+AAKQS    VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ 
Sbjct  1     MAANVPKVFTVETLRSAAKQSLRLLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQE  60

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ NL LP +T+K +  D + SVE +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+
Sbjct  61    IKDTNLQLPESTAKSLA-DCMNSVE-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVF  118

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             S  YRVL E+RRR+PDF P +VLDFGAGTGS FWA++EVWP+S+++VN+VEPSQSMQRAG
Sbjct  119   SVCYRVLIEIRRRIPDFRPTRVLDFGAGTGSGFWAVQEVWPKSVERVNIVEPSQSMQRAG  178

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNI--------KKSNRQHDLVIASYVLGEIPSLKDRI  1317
             + L +GLK+LPLIH Y+SL ALS+ I        +KS R+HDLVIASYVLGEIPSLKDRI
Sbjct  179   RNLIQGLKDLPLIHGYTSLLALSKEINKQCKEINEKSQRKHDLVIASYVLGEIPSLKDRI  238

Query  1316  TVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC--KALT  1143
             TVVRQLWDLT D+LVLVEPGTP G+NIISQ+RSHILWME+RK RKL+    K+   KA+ 
Sbjct  239   TVVRQLWDLTDDLLVLVEPGTPHGANIISQMRSHILWMEKRKLRKLENKMKKAGAEKAVL  298

Query  1142  TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
              LKSGA IVAPCPHDG CPLE +G YCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+
Sbjct  299   DLKSGAHIVAPCPHDGKCPLENTGNYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSF  358

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN  783
             VVFRRGQRPRE WPL+GMK ETLKE+ A + PEDLEIDYED F      ++   +  +Y+
Sbjct  359   VVFRRGQRPRELWPLDGMKLETLKERRANKKPEDLEIDYED-FIKSQVVEVPYIDPRAYD  417

Query  782   SddtevdtvtdneeledeqeETGAAT----------ADLGTGWGRIVYSPICRGKRI  642
             SD  + +   +  E  DE  E               A +G GWGRI++ P  +GK++
Sbjct  418   SDTMDEEEEQEGGEGTDEDVEDTIEEEHQEEEESERASVGGGWGRIIFPPFRKGKQV  474



>ref|XP_006661965.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Oryza brachyantha]
Length=469

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/512 (57%), Positives = 367/512 (72%), Gaps = 53/512 (10%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E +RAAAKQS   ++VPL LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETAPRLLTPETIRAAAKQSQGIQIVPLSLRRAIKRYLRDQDRTHMNRKVLLLSAS  62

Query  1841  FRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMP  1662
             F   K                    + + + RWK++SAYGDIGLRY EDE +AYVASRMP
Sbjct  63    FERAKAG------------------AEQRAARWKVRSAYGDIGLRYREDETVAYVASRMP  104

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             A+Y+A YRVL EVRRR+PDF+PA VLDFGAG  SA WAMR VWP+S+++VNLVEPS+ MQ
Sbjct  105   AIYAACYRVLREVRRRLPDFAPASVLDFGAGPSSALWAMRAVWPKSIERVNLVEPSKEMQ  164

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
             RAG+ L   LK LPLIHSY S+Q L++NIKK  R+HDLVI+SY LGEIPSL DRIT+VRQ
Sbjct  165   RAGKNLLDNLKGLPLIHSYDSIQELNRNIKKHERRHDLVISSYALGEIPSLNDRITIVRQ  224

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTT------  1140
             LWDLT D+L                           KCRK+++S+  +   + +      
Sbjct  225   LWDLTSDVL---------------------------KCRKIEKSTRAAPSEMKSIVSQES  257

Query  1139  -LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
              LK+GAF+VAPCPHDG CPL+ + KYCHFVQRLERT+SQRAYKRSNG  LRGFEDEKF Y
Sbjct  258   PLKNGAFVVAPCPHDGRCPLKNTDKYCHFVQRLERTSSQRAYKRSNGVPLRGFEDEKFCY  317

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYN  783
             V  RRG+RP E WPL+GMKFETLKE+HA+RNPEDL IDYE+QF S+ ++++  +   S  
Sbjct  318   VALRRGKRPEEAWPLDGMKFETLKERHAKRNPEDLIIDYEEQFLSDGDEEVPADAEDSLV  377

Query  782   SddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGT  603
               D++   ++   E E+E+ E     ADLG GWGRI+YSP+ RG++++MDVCRA+  + +
Sbjct  378   PYDSDAQELSLFHETEEEELEEQPVRADLGGGWGRIIYSPLRRGRQVQMDVCRATKRDAS  437

Query  602   KGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +G+F+RI+IT+SKNPT+HH ARRSLWGDLWPF
Sbjct  438   EGAFERIVITQSKNPTMHHQARRSLWGDLWPF  469



>gb|EEC81814.1| hypothetical protein OsI_25549 [Oryza sativa Indica Group]
Length=478

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 361/474 (76%), Gaps = 19/474 (4%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E +RAAAKQS   ++VPL LRRAIK+Y+++Q+  HM RKVL+LS S
Sbjct  3     AALLPETAPRLLTPETIRAAAKQSQGIQLVPLSLRRAIKRYLRDQDKAHMNRKVLQLSAS  62

Query  1841  FRHIKEANLLLPTTTSK-EIVEDPLK---SVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L     +  I++DP     + + + RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FERAKGTGTELAAAAMRGAIIDDPRAPSGAEQRAARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+PDF+PAKVLDFGAG  SA WAMR VWP+S++KVNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPDFAPAKVLDFGAGPSSALWAMRAVWPKSIEKVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAG+ L   LK LPLIHSY S+Q L++NI+K  R HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGKNLLDNLKGLPLIHSYDSIQELNRNIEKHERWHDLVISSYALGEIPSLNDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL----  1146
             +VRQLWDLTGD+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++S+  +   +    
Sbjct  243   IVRQLWDLTGDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSTHAAPSEMKSIV  302

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+GAF+VAPCPHDG CPLE + KYCHFVQRLERT+SQRAYKRSNG  LRGFEDE
Sbjct  303   CQEASLKNGAFVVAPCPHDGRCPLENTDKYCHFVQRLERTSSQRAYKRSNGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKFETLKE+HA+RNPEDL IDY++QFPSE +++      
Sbjct  363   KFCYVALRRGKRPEEAWPLDGMKFETLKERHAKRNPEDLIIDYDEQFPSEEDEEAPVNAE  422

Query  794   iS---YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRI  642
              S   Y+SD  E+    + EE   EQ    +  ADLG GWGRI+YSPI RG+++
Sbjct  423   DSLVPYDSDAQELGLFHETEEEFKEQ----SVRADLGGGWGRIIYSPIRRGRQV  472



>gb|EEE58133.1| hypothetical protein OsJ_09036 [Oryza sativa Japonica Group]
Length=474

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/474 (61%), Positives = 363/474 (77%), Gaps = 19/474 (4%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E +RAAAKQS   ++VPL LRRAIK+Y+++Q+  HM RKVL+LS S
Sbjct  3     AALLPETAPRLLTPETIRAAAKQSQGIQLVPLSLRRAIKRYLRDQDKAHMNRKVLQLSAS  62

Query  1841  FRHIKEANLLLPTTTSK-EIVEDPLK---SVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L     +  +++DP     + + + RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FERAKGTGTELAAAAMRGALIDDPRAPSGAEQRAARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+PDF+PAKVLDFGAG  SA WAMR VWP+S++KVNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPDFAPAKVLDFGAGPSSALWAMRAVWPKSIEKVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAG+ L   LK LPLIHSY S+Q L++NI+K  R+HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGKNLLDNLKGLPLIHSYDSIQELNRNIEKHERRHDLVISSYALGEIPSLNDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL----  1146
             +VRQLWDLTGD+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++S+  +   +    
Sbjct  243   IVRQLWDLTGDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSTRAAPSEMKSIV  302

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+GAF+VAPCPHDG CPLE + KYCHFVQRLERT+SQRAYKRSNG  LRGFEDE
Sbjct  303   CQEASLKNGAFVVAPCPHDGRCPLENTDKYCHFVQRLERTSSQRAYKRSNGVPLRGFEDE  362

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKFETLKE+HA+RNPEDL IDY++QFPSE +++      
Sbjct  363   KFCYVALRRGKRPEEAWPLDGMKFETLKERHAKRNPEDLIIDYDEQFPSEEDEEAPVNAE  422

Query  794   ---iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRI  642
                + Y+SD  E+    + EE  +EQ    +  ADLG GWGRI+YSPI RG+++
Sbjct  423   DCLVPYDSDAQELGLFHETEEEFEEQ----SVRADLGGGWGRIIYSPIRRGRQV  472



>ref|XP_006391603.1| hypothetical protein EUTSA_v10023366mg [Eutrema salsugineum]
 gb|ESQ28889.1| hypothetical protein EUTSA_v10023366mg [Eutrema salsugineum]
Length=592

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/394 (68%), Positives = 321/394 (81%), Gaps = 13/394 (3%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E LR AAKQS  C VVP+RLRR+IKKY++E++DPH++++V +LSESF+ IK+ NLLL
Sbjct  8     FTVETLRTAAKQSLRCLVVPVRLRRSIKKYLREEDDPHIRKRVRQLSESFKEIKDTNLLL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + SVE +KRWKIQ+ YGD GL Y + E  AY+ASRMPAV+S  YRVL 
Sbjct  68    PETTAKSLA-DSINSVE-TKRWKIQTVYGDSGLEYRDGETAAYIASRMPAVFSVCYRVLI  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRR+PDF+P KVLDFGAGTGS FWA++EVWP+S +K+N+VEPS SMQRAG+ L +GLK
Sbjct  126   EIRRRLPDFAPTKVLDFGAGTGSGFWAVQEVWPKSAEKINIVEPSPSMQRAGRNLIQGLK  185

Query  1448  NLPLIHSYSSLQALS---------QNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLW  1296
             +LPLIH Y+SLQALS         + +K   R+HDLVIASYVLGEIPSLKDRITVVRQLW
Sbjct  186   DLPLIHGYTSLQALSKEICKKIKDKKLKNKERKHDLVIASYVLGEIPSLKDRITVVRQLW  245

Query  1295  DLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL--KESSGKSCKALTTLKSGAF  1122
             DLT D+LVL+EPGTP G+NIISQ+RSHILWME+RK  KL  K    ++ K +  LKSGA 
Sbjct  246   DLTDDLLVLIEPGTPHGANIISQMRSHILWMEKRKLSKLEKKTKEDEAGKDVLDLKSGAH  305

Query  1121  IVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQ  942
             IVAPCPHDG CPLE +GKYCHFVQRL+RT+SQR+YKR+ G  LRGFEDEKFS+V FRRGQ
Sbjct  306   IVAPCPHDGKCPLENTGKYCHFVQRLQRTSSQRSYKRTKGVPLRGFEDEKFSFVAFRRGQ  365

Query  941   RPRETWPLNGMKFETLKEQHARRNPEDLEIDYED  840
             RPRE WPL+GMK E+LKE  A R PEDLEIDYED
Sbjct  366   RPREPWPLDGMKLESLKELRASRKPEDLEIDYED  399


 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = -1

Query  713  AATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARR  534
            +A A +G GWGRI++ P  +GK++ +D+C  ++ EG++G+F+R +ITKSKNP LH  A++
Sbjct  494  SARASVGGGWGRIIFPPFRKGKQVTLDLCVPTNEEGSEGAFERRVITKSKNPHLHLQAKK  553

Query  533  SLWGDLWPF*TTMIASK  483
            S WGDLWP  T   + K
Sbjct  554  SFWGDLWPLTTQQDSRK  570



>ref|NP_001059414.2| Os07g0297300 [Oryza sativa Japonica Group]
 dbj|BAF21328.2| Os07g0297300 [Oryza sativa Japonica Group]
Length=544

 Score =   539 bits (1388),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 287/509 (56%), Positives = 368/509 (72%), Gaps = 46/509 (9%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E +RAAAKQS   ++VPL LRRAIK+Y+++Q+  HM RKVL+LS S
Sbjct  3     AALLPETAPRLLTPETIRAAAKQSQGIQLVPLSLRRAIKRYLRDQDKAHMNRKVLQLSAS  62

Query  1841  FRHIKEANLLLPTTTSK-EIVEDPLK---SVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L     +  +++DP     + + + RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FERAKGTGTELAAAAMRGALIDDPRAPSGAEQRAARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+PDF+PAKVLDFGAG  SA WAMR VWP+S++KVNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPDFAPAKVLDFGAGPSSALWAMRAVWPKSIEKVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAG+ L   LK LPLIHSY S+Q L++NI+K  R+HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGKNLLDNLKGLPLIHSYDSIQELNRNIEKHERRHDLVISSYALGEIPSLNDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL----  1146
             +VRQLWDLTGD+L                           KCRK+++S+  +   +    
Sbjct  243   IVRQLWDLTGDVL---------------------------KCRKIEKSTRAAPSEMKSIV  275

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+GAF+VAPCPHDG CPLE + KYCHFVQRLERT+SQRAYKRSNG  LRGFEDE
Sbjct  276   CQEASLKNGAFVVAPCPHDGRCPLENTDKYCHFVQRLERTSSQRAYKRSNGVPLRGFEDE  335

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKFETLKE+HA+RNPEDL IDY++QFPSE +++      
Sbjct  336   KFCYVALRRGKRPEEAWPLDGMKFETLKERHAKRNPEDLIIDYDEQFPSEEDEEAPVNAE  395

Query  794   ---iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCR  624
                + Y+SD  E+    + EE  +EQ    +  ADLG GWGRI+YSPI RG+++++DVCR
Sbjct  396   DCLVPYDSDAQELGLFHETEEEFEEQ----SVRADLGGGWGRIIYSPIRRGRQVQLDVCR  451

Query  623   ASDHEGTKGSFDRIIITKSKNPTLHHHAR  537
             A+  + ++G+F+R++IT+SKNPT+HH AR
Sbjct  452   ATKRDASEGAFERVVITQSKNPTMHHQAR  480



>gb|EMS55405.1| Rsm22-cox11 tandem protein 2, mitochondrial [Triticum urartu]
Length=594

 Score =   538 bits (1385),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 295/607 (49%), Positives = 377/607 (62%), Gaps = 108/607 (18%)
 Frame = -1

Query  2042  LSEAPIP-MASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIK---------  1893
             ++ A +P MASRL       T E LR AAKQS     VP+ LRRAIK+Y++         
Sbjct  1     MAAALLPEMASRL------LTPETLRTAAKQSQGIHRVPISLRRAIKRYLRGNSPTHPSL  54

Query  1892  ----------------------EQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVE  1779
                                   +Q+  HM RKVL LS SF   K     L   +++  + 
Sbjct  55    PPTTCSTNCSALTLHGCRRARADQDKTHMHRKVLLLSSSFERAKGTGAELAAASTRSALL  114

Query  1778  D----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRV  1611
             D    P  + + + RWK+QS+YGD GL Y EDE +AYVASRMPA+Y+A +RVL EVR   
Sbjct  115   DDPHAPASAEQRTARWKVQSSYGDTGLLYREDETVAYVASRMPAIYAACHRVLREVREPP  174

Query  1610  -PDFSPAKVLDFGAGTGSAFW---------------------------------------  1551
              P F  + + +    TG   W                                       
Sbjct  175   GPLFVVSVLSELNLPTGMFSWTEAWLRCRFVVGLQVLHLRTCWTLERGQAQHFVFSSHNL  234

Query  1550  -------AMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
                    AMR VWP+S+++VNL+EPS+ MQRAGQ L   LK LPLIHSY S+Q L+++I+
Sbjct  235   MSLQECRAMRAVWPKSIERVNLIEPSKEMQRAGQTLLDNLKGLPLIHSYDSIQELNRSIE  294

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             K  R+HDLVI+SY LGEIPSL DRIT+VRQLWDLT D+LVL+EPGTPQGS IISQ+RS+I
Sbjct  295   KHERRHDLVISSYALGEIPSLNDRITIVRQLWDLTRDVLVLLEPGTPQGSKIISQMRSYI  354

Query  1211  LWMERRKCRKLKESSGKSCKALTT-------LKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
             LWME+RKCRK ++S+  +   + +       LK GAF+VAPCPHDG CPLE S KYCHFV
Sbjct  355   LWMEKRKCRKSEKSTAAAPSKMKSMVLQEDLLKDGAFVVAPCPHDGRCPLENSDKYCHFV  414

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARR  873
             QRLERT+SQR YKRS G  LRGFEDEKF YV  RRG+RP E WPL+GMKF+TLKE+HA+R
Sbjct  415   QRLERTSSQRIYKRSKGVPLRGFEDEKFCYVALRRGKRPEEAWPLDGMKFDTLKERHAKR  474

Query  872   NPEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvtdneeledeqeETGAAT----  705
             NPEDL IDY+DQFPSE +++          SD+  +     + +      E+G       
Sbjct  475   NPEDLIIDYDDQFPSEEDEEAP-------GSDEDSLVPYASDTQELSLFHESGEEEEEPI  527

Query  704   -ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSL  528
              ADLG GWGRI+YSPI RG++++MDVCRA+  + ++G+F+R+++T+SKNP LH  AR+SL
Sbjct  528   RADLGGGWGRIIYSPIRRGRQVQMDVCRATKRDASEGAFERVVVTQSKNPALHLQARKSL  587

Query  527   WGDLWPF  507
             WGDLWPF
Sbjct  588   WGDLWPF  594



>dbj|BAC84790.1| unknown protein [Oryza sativa Japonica Group]
Length=711

 Score =   541 bits (1395),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 292/526 (56%), Positives = 377/526 (72%), Gaps = 51/526 (10%)
 Frame = -1

Query  2039  SEAPIPMASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRK  1863
             SE+    A+ L ET P+  T E +RAAAKQS   ++VPL LRRAIK+Y+++Q+  HM RK
Sbjct  222   SESGDMAAALLPETAPRLLTPETIRAAAKQSQGIQLVPLSLRRAIKRYLRDQDKAHMNRK  281

Query  1862  VLRLSESFRHIKEANLLLPTTTSK-EIVEDPLK---SVECSKRWKIQSAYGDIGLRYEED  1695
             VL+LS SF   K     L     +  +++DP     + + + RWK++SAYGDIGLRY ED
Sbjct  282   VLQLSASFERAKGTGTELAAAAMRGALIDDPRAPSGAEQRAARWKVRSAYGDIGLRYRED  341

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E +AYVASRMPA+Y+A +RVL EVRRR+PDF+PAKVLDFGAG  SA WAMR VWP+S++K
Sbjct  342   ETVAYVASRMPAIYAACHRVLREVRRRLPDFAPAKVLDFGAGPSSALWAMRAVWPKSIEK  401

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
             VNLVEPS+ MQRAG+ L   LK LPLIHSY S+Q L++NI+K  R+HDLVI+SY LGEIP
Sbjct  402   VNLVEPSKEMQRAGKNLLDNLKGLPLIHSYDSIQELNRNIEKHERRHDLVISSYALGEIP  461

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
             SL DRIT+VRQLWDLTGD+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++S+  + 
Sbjct  462   SLNDRITIVRQLWDLTGDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSTRAAP  521

Query  1154  KAL-------TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS  996
               +        +LK+GAF+VAP                                RSNG  
Sbjct  522   SEMKSIVCQEASLKNGAFVVAP--------------------------------RSNGVP  549

Query  995   LRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPsened  816
             LRGFEDEKF YV  RRG+RP E WPL+GMKFETLKE+HA+RNPEDL IDY++QFPSE ++
Sbjct  550   LRGFEDEKFCYVALRRGKRPEEAWPLDGMKFETLKERHAKRNPEDLIIDYDEQFPSEEDE  609

Query  815   dlneeei---iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKR  645
             +         + Y+SD  E+    + EE  +EQ    +  ADLG GWGRI+YSPI RG++
Sbjct  610   EAPVNAEDCLVPYDSDAQELGLFHETEEEFEEQ----SVRADLGGGWGRIIYSPIRRGRQ  665

Query  644   IEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +++DVCRA+  + ++G+F+R++IT+SKNPT+HH ARRSLWGDLWP 
Sbjct  666   VQLDVCRATKRDASEGAFERVVITQSKNPTMHHQARRSLWGDLWPV  711



>ref|XP_009358660.1| PREDICTED: methyltransferase-like protein 17, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=398

 Score =   523 bits (1348),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 257/394 (65%), Positives = 315/394 (80%), Gaps = 1/394 (0%)
 Frame = -1

Query  1685  AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNL  1506
              Y+ S +P    +    + +VRRR+PDFSPAKVL+FGAGTGSAFWA+REVWP SL+KVNL
Sbjct  5     GYLLSSLPVTEFSRRVAVLQVRRRIPDFSPAKVLNFGAGTGSAFWALREVWPHSLEKVNL  64

Query  1505  VEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLK  1326
             VEPSQSMQRAGQ LT+G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIP LK
Sbjct  65    VEPSQSMQRAGQKLTQGQKNLPLIHSYDSLQSLTKSITKSEREHDLVIASYVLGEIPLLK  124

Query  1325  DRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKAL  1146
             DRI +VRQLWDLT D+LVL+EPGT QGSNIISQ+RSHILWME+RKCRK K+ S ++ + L
Sbjct  125   DRINIVRQLWDLTWDVLVLIEPGTLQGSNIISQMRSHILWMEKRKCRKSKDGSEETSRDL  184

Query  1145  TTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKF  969
              T KSGAFIVAPC HDG CPLE +GKYCHFVQR+ERT+ Q A+KRS GG  L GFEDEKF
Sbjct  185   VTQKSGAFIVAPCSHDGQCPLENAGKYCHFVQRMERTSVQCAFKRSKGGQPLHGFEDEKF  244

Query  968   SYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiS  789
             S+V FRRGQRPRE WPL+GMKFETLKEQ+A+R+PEDLEID ++   S+  D +  EE   
Sbjct  245   SFVAFRRGQRPREPWPLDGMKFETLKEQYAKRSPEDLEIDLDELISSQQADLIPFEEPNP  304

Query  788   YNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHE  609
              N D   ++T   +E  ++ +EE     ADLG GWGRI+Y P+ RGK++ MDVC+++  +
Sbjct  305   VNYDSDVMETDVVDENDKNNEEEDETGHADLGGGWGRIIYMPVRRGKQVTMDVCQSTKRD  364

Query  608   GTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             G++G   R+++TKSKNPTLH  AR+S+WGDLWPF
Sbjct  365   GSEGELQRVVVTKSKNPTLHLQARKSIWGDLWPF  398



>gb|KDO76650.1| hypothetical protein CISIN_1g012511mg [Citrus sinensis]
Length=400

 Score =   520 bits (1339),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 318/379 (84%), Gaps = 10/379 (3%)
 Frame = -1

Query  1619  RRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLP  1440
             RR+P FSPAKVLDFGAGTGSAFWA+REVWPRSL+KVNLVEPSQSMQRAGQ L +G K+LP
Sbjct  24    RRLPGFSPAKVLDFGAGTGSAFWALREVWPRSLEKVNLVEPSQSMQRAGQSLMQGPKDLP  83

Query  1439  LIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEP  1260
             LIHSY+S+QAL+++I KS R+HDLVIASYVLGE+PSL+DRIT+VRQLWDLT D+LVLVEP
Sbjct  84    LIHSYNSIQALNKDISKSEREHDLVIASYVLGEVPSLQDRITIVRQLWDLTRDVLVLVEP  143

Query  1259  GTPQGSNIISQVRSHILWMERRKCRKL-----KESSGKSCKALTTLKSGAFIVAPCPHDG  1095
             GTPQGS+IISQ+RSHILWME+RK RK      K+++ ++ K L TL+SG  IVAPCPH+G
Sbjct  144   GTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDTNKETSKDLVTLRSGVHIVAPCPHEG  203

Query  1094  PCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLN  915
              CPLE SGKYCHFVQRL+RTTSQRAYKRS    LRGFEDEKFS+V FRRG+RPRE WPL+
Sbjct  204   RCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLRGFEDEKFSFVAFRRGERPRERWPLD  263

Query  914   GMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeiiSYNSddtevdtvtdne  744
             GMKF+TLKEQHA+RNPEDLEIDYED    + E ++    +E++++Y SD+ + DTV  ++
Sbjct  264   GMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEVEPCKKEDLVNYESDEVQDDTVDSDK  323

Query  743   eledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSK  564
             + E  +EET    ADLG GWGRI++SP+ RG+++ MDVCR+   +G++GSF  ++ T+SK
Sbjct  324   DQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVAMDVCRSIKRDGSEGSFQHLVFTRSK  381

Query  563   NPTLHHHARRSLWGDLWPF  507
             NPTLH  A++SLWGDLWPF
Sbjct  382   NPTLHRLAKKSLWGDLWPF  400



>ref|XP_004986868.1| PREDICTED: LOW QUALITY PROTEIN: 5-oxoprolinase-like [Setaria 
italica]
Length=1675

 Score =   523 bits (1347),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 280/508 (55%), Positives = 359/508 (71%), Gaps = 39/508 (8%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ + ET  +  T E LR AAKQS    +VPL LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALVPETAQRLLTPETLRTAAKQSQGIHLVPLSLRRAIKRYLRDQDKAHMNRKVLLLSAS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + + RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FDRAKGTGAELAAAATRGALLDDPNAPSGAEQRAARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+P+F+PAKVLDFGAG  SA WAMR VWP+S+++VNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPEFAPAKVLDFGAGPSSALWAMRAVWPKSIERVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L++NI+K  R HDLVI+SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQSLLDNLKGLPLIHSYDSIQELNRNIEKHERGHDLVISSYALGEIPSLSDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK---SCKALT  1143
             +VRQLWDLT D+L                           KCRK ++SS +   + K++ 
Sbjct  243   IVRQLWDLTSDVL---------------------------KCRKSEKSSSRPPSNVKSIV  275

Query  1142  ----TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                 +LK+G+F+VAPCPHDG CPLE S KYCHFVQRLERT+SQRAYKRS G  LRGFEDE
Sbjct  276   AHEASLKNGSFVVAPCPHDGQCPLENSDKYCHFVQRLERTSSQRAYKRSKGVPLRGFEDE  335

Query  974   KFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeei  795
             KF YV  RRG+RP E WPL+GMKFETLKE+ A+R PEDL IDY+DQFPSE ++++  +  
Sbjct  336   KFCYVALRRGKRPEEAWPLDGMKFETLKERRAKRKPEDLSIDYDDQFPSEQDEEVPNDGG  395

Query  794   iSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASD  615
              S     ++   ++   + E+ +EE     ADLG GWGRI+YSPI RGK+++MDVCR++ 
Sbjct  396   DSLVPYASDEHELSLFHDSEEAEEEEQTIRADLGGGWGRIIYSPIRRGKQVQMDVCRSTK  455

Query  614   HEGTKGSFDRIIITKSKNPTLHHHARRS  531
              + ++G+F+R+++T+SKNPTLH  AR S
Sbjct  456   RDASEGAFERVVVTRSKNPTLHFQARSS  483



>gb|AAF19677.1|AC009519_11 F1N19.17 [Arabidopsis thaliana]
Length=555

 Score =   475 bits (1223),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 273/529 (52%), Positives = 357/529 (67%), Gaps = 41/529 (8%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT E LR+A+KQ   C VVP+RLRRAIKKY++E++DPH+++KV +LSESF+ IK+ NL L
Sbjct  8     FTVETLRSASKQCLRCLVVPVRLRRAIKKYLREEDDPHIRKKVRQLSESFQEIKDTNLQL  67

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
             P TT+K +  D + S+E +KRWKIQ+ YGD GL+Y + E  AY+ASRMPAV+S  YRVL 
Sbjct  68    PETTAKSLA-DSMNSLE-TKRWKIQTVYGDSGLQYRDGETAAYIASRMPAVFSVCYRVLI  125

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+RRRVP F+P +VLDFGAGTGS FWA++EVWP+S++KVN+VEPSQSMQRAG+ L +GLK
Sbjct  126   EIRRRVPGFTPTRVLDFGAGTGSGFWAVKEVWPKSVEKVNIVEPSQSMQRAGRNLIQGLK  185

Query  1448  NLPLIHSYSSLQALSQNI-KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
             +LPLIH Y+SL AL++ I KKS R+HDLVIA   +GEIPSLKDRITVVRQLWDLT D+LV
Sbjct  186   DLPLIHGYTSLLALNKEINKKSERKHDLVIA---VGEIPSLKDRITVVRQLWDLTDDLLV  242

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAP------  1110
             LVEPGTP G+NIISQ+RSHILWME+RK RKL++   K  K +  LKSGA IVAP      
Sbjct  243   LVEPGTPHGANIISQMRSHILWMEKRKLRKLEKKMKKDGKEVLDLKSGAHIVAPVSINIL  302

Query  1109  -------CPHDGP------CPLEKSGKYCHF--VQRLERTTSQRAYKRSNGGSLRGFEDE  975
                    C   G       C L       +F  VQR+      R   RS    L G    
Sbjct  303   PEKLSSSCQTLGHELDSALCLLMIPNPKLYFCSVQRVSPYVGLRM--RSFVLWLSGEVSA  360

Query  974   KFSYVVFRRG--QRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlnee  801
               + +  + G   + RE WPL+GMK ETLKE+ A + PEDLEIDYED F      ++   
Sbjct  361   HETLLRIKLGLCLQFRELWPLDGMKLETLKERRANKKPEDLEIDYED-FIKSQVVEVPYI  419

Query  800   eiiSYNSddtevdtvtdneeledeqeETGAAT---------ADLGTGWGRIVYSPICRGK  648
             +  +Y+SD  + +     +    +++E              A +G GWGRI++ P  +GK
Sbjct  420   DPRAYDSDTMDENEEEQEDGGGTDEDEEDKIEEEIEEESERASVGGGWGRIIFPPFRKGK  479

Query  647   RIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF*T  501
             ++ +D+C  +  +G++G+F+R +ITKSKNP LH  A++S WGDLWP  T
Sbjct  480   QVTLDMCVPTKEDGSEGAFERRVITKSKNPDLHLQAKKSFWGDLWPLTT  528



>ref|XP_008775005.1| PREDICTED: rsm22-cox11 tandem protein 2, mitochondrial isoform 
X2 [Phoenix dactylifera]
Length=379

 Score =   459 bits (1181),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 228/365 (62%), Positives = 289/365 (79%), Gaps = 15/365 (4%)
 Frame = -1

Query  1571  GTGSAFW--AMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQN  1398
             G G   W  AMREVWPRSL++VNLVEPS+SMQRA Q L + LKNLPLIHSY S+QAL++N
Sbjct  20    GLGFRCWTRAMREVWPRSLERVNLVEPSKSMQRACQSLLQDLKNLPLIHSYDSIQALNRN  79

Query  1397  IKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRS  1218
             + K +R+HDLVI+SY LGEIPSL DRITVVRQLWDLT D+LVL+EPGTP GS II+Q+RS
Sbjct  80    LDKRDREHDLVISSYALGEIPSLSDRITVVRQLWDLTRDVLVLLEPGTPHGSKIITQMRS  139

Query  1217  HILWMERRKCRKLKESS---GKSCKAL----TTLKSGAFIVAPCPHDGPCPLEKSGKYCH  1059
             +ILWME+RKCRK  +SS       K++     +LKSGAF+VAPCPHDG CPLE +GKYCH
Sbjct  140   YILWMEKRKCRKSNDSSREVSSDVKSIAVERASLKSGAFVVAPCPHDGRCPLENTGKYCH  199

Query  1058  FVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHA  879
             FVQRLERT+SQRAYKRS G  LRGFEDEKF +V  RRG+RPRE WPL+ M+FETLKE+ A
Sbjct  200   FVQRLERTSSQRAYKRSKGEPLRGFEDEKFCFVALRRGKRPREAWPLDSMEFETLKERLA  259

Query  878   RRNPEDLEIDYEDQFPseneddlneeeiiS-YNSddtevdtvtdneeledeqeETGAATA  702
             +RNPEDL +D+EDQF +E +++   E+ +  Y SD  E      +++ E+EQ       A
Sbjct  260   KRNPEDLIVDFEDQFETEADEESTFEDALVPYASDIAETSMFHQDDDDEEEQ-----VRA  314

Query  701   DLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWG  522
             DLG GWGRI+Y+P+ RG++++MDVCR++  +G++G+ +R+++T++KNPTLH  ARRSLWG
Sbjct  315   DLGGGWGRIIYTPLRRGRQVQMDVCRSTKRDGSEGALERVVVTQTKNPTLHLQARRSLWG  374

Query  521   DLWPF  507
             DLWPF
Sbjct  375   DLWPF  379



>gb|KDO76651.1| hypothetical protein CISIN_1g012511mg [Citrus sinensis]
Length=333

 Score =   435 bits (1119),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 275/335 (82%), Gaps = 10/335 (3%)
 Frame = -1

Query  1487  MQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVV  1308
             MQRAGQ L +G K+LPLIHSY+S+QAL+++I KS R+HDLVIASYVLGE+PSL+DRIT+V
Sbjct  1     MQRAGQSLMQGPKDLPLIHSYNSIQALNKDISKSEREHDLVIASYVLGEVPSLQDRITIV  60

Query  1307  RQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL-----KESSGKSCKALT  1143
             RQLWDLT D+LVLVEPGTPQGS+IISQ+RSHILWME+RK RK      K+++ ++ K L 
Sbjct  61    RQLWDLTRDVLVLVEPGTPQGSSIISQMRSHILWMEKRKSRKYEARKSKDTNKETSKDLV  120

Query  1142  TLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSY  963
             TL+SG  IVAPCPH+G CPLE SGKYCHFVQRL+RTTSQRAYKRS    LRGFEDEKFS+
Sbjct  121   TLRSGVHIVAPCPHEGRCPLENSGKYCHFVQRLQRTTSQRAYKRSKSEPLRGFEDEKFSF  180

Query  962   VVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddl---neeeii  792
             V FRRG+RPRE WPL+GMKF+TLKEQHA+RNPEDLEIDYED    + E ++    +E+++
Sbjct  181   VAFRRGERPRERWPLDGMKFDTLKEQHAKRNPEDLEIDYEDLLRLQAEAEVEPCKKEDLV  240

Query  791   SYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDH  612
             +Y SD+ + DTV  +++ E  +EET    ADLG GWGRI++SP+ RG+++ MDVCR+   
Sbjct  241   NYESDEVQDDTVDSDKDQEKGEEET--IPADLGGGWGRIIFSPVRRGRQVAMDVCRSIKR  298

Query  611   EGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             +G++GSF  ++ T+SKNPTLH  A++SLWGDLWPF
Sbjct  299   DGSEGSFQHLVFTRSKNPTLHRLAKKSLWGDLWPF  333



>ref|XP_010430604.1| PREDICTED: uncharacterized protein LOC104714829 isoform X2 [Camelina 
sativa]
Length=448

 Score =   434 bits (1117),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/376 (59%), Positives = 276/376 (73%), Gaps = 18/376 (5%)
 Frame = -1

Query  1559  AFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI-----  1395
             A   + EVWP+S+++VN+VEPSQSMQRAG+ L +GLK+LPLIH Y+SL ALS+ I     
Sbjct  53    ALVQVSEVWPKSVERVNIVEPSQSMQRAGRNLIQGLKDLPLIHGYTSLLALSKEINKQCK  112

Query  1394  ---KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQV  1224
                +KS R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LVLVEPGTP G+NIISQ+
Sbjct  113   EINEKSARKHDLVIASYVLGEIPSLKDRITVVRQLWDLTDDLLVLVEPGTPHGANIISQM  172

Query  1223  RSHILWMERRKCRKLKESSGKSC--KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQ  1050
             RSHILWME+RK RKL+    K+   KA+  LKSGA IVAPCPHDG CPLE +GKYCHFVQ
Sbjct  173   RSHILWMEKRKLRKLENKMKKAGADKAVLDLKSGAHIVAPCPHDGKCPLENTGKYCHFVQ  232

Query  1049  RLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRN  870
             RL+RT+SQR+YKR+ G  LRGFEDEKFS+VVFRRGQRPRE WPL+GMK ETLKE+ A + 
Sbjct  233   RLQRTSSQRSYKRTKGVPLRGFEDEKFSFVVFRRGQRPRELWPLDGMKLETLKERRANKK  292

Query  869   PEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvtdneeledeqeETGAAT-----  705
             PEDLEIDYED F      ++   +  +Y+SD  E     +  + + E             
Sbjct  293   PEDLEIDYED-FIKLQVVEVPYIDPRAYDSDTEEEQEDGEGTDEDVEDTIEEEDQEEEES  351

Query  704   --ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRS  531
               A +G GWGRI++ P  +GK++ +D+C  +  +G++G+F+R +ITKSKNP LH  A++S
Sbjct  352   ERASVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFERRVITKSKNPDLHLQAKKS  411

Query  530   LWGDLWPF*TTMIASK  483
              WGDLWP  T   + K
Sbjct  412   FWGDLWPLTTQQESGK  427



>ref|XP_010418536.1| PREDICTED: uncharacterized protein LOC104704097 isoform X2 [Camelina 
sativa]
 ref|XP_010473729.1| PREDICTED: uncharacterized protein LOC104753131 isoform X2 [Camelina 
sativa]
Length=454

 Score =   432 bits (1111),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/382 (58%), Positives = 279/382 (73%), Gaps = 24/382 (6%)
 Frame = -1

Query  1559  AFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI-----  1395
             A   + EVWP+S+++VN+VEPSQSMQRAG+ L +GLK+LPLIH Y+SL ALS+ I     
Sbjct  53    ALVQVSEVWPKSVERVNIVEPSQSMQRAGRNLIQGLKDLPLIHGYTSLLALSKEINKQCK  112

Query  1394  ---KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQV  1224
                +KS R+HDLVIASYVLGEIPSLKDRITVVRQLWDLT D+LVLVEPGTP G+NIISQ+
Sbjct  113   EINEKSQRKHDLVIASYVLGEIPSLKDRITVVRQLWDLTDDLLVLVEPGTPHGANIISQM  172

Query  1223  RSHILWMERRKCRKLKESSGKSC--KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQ  1050
             RSHILWME+RK RKL+    K+   KA+  LKSGA IVAPCPHDG CPLE +GKYCHFVQ
Sbjct  173   RSHILWMEKRKLRKLENKMKKAGAEKAVLDLKSGAHIVAPCPHDGKCPLENTGKYCHFVQ  232

Query  1049  RLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRN  870
             RL+RT+SQR+YKR+ G  LRGFEDEKFS+VVFRRGQRPRE WPL+GMK ETLKE+ + + 
Sbjct  233   RLQRTSSQRSYKRTKGVPLRGFEDEKFSFVVFRRGQRPRELWPLDGMKLETLKERRSNKK  292

Query  869   PEDLEIDYEDQFPseneddlneeeiiSYNSddtevdtvtdneeledeqeETGAAT-----  705
             PEDLEIDYED F      ++      +Y+SD  + +   ++ E  DE  E    T     
Sbjct  293   PEDLEIDYED-FIKSQVVEVPYINPRAYDSDTMDEEEEQEDGEGTDEDVEDTTDTTEEGD  351

Query  704   --------ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLH  549
                     A +G GWGRI++ P  +GK++ +D+C  +  +G++G+F+R +ITKSKNP LH
Sbjct  352   QEEEESERACVGGGWGRIIFPPFRKGKQVTLDMCVPTKEDGSEGAFERRVITKSKNPDLH  411

Query  548   HHARRSLWGDLWPF*TTMIASK  483
               A++S WGDLWP  T   + K
Sbjct  412   LQAKKSFWGDLWPLTTQQESGK  433



>ref|XP_001777377.1| predicted protein [Physcomitrella patens]
 gb|EDQ57781.1| predicted protein [Physcomitrella patens]
Length=500

 Score =   389 bits (1000),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 218/507 (43%), Positives = 313/507 (62%), Gaps = 27/507 (5%)
 Frame = -1

Query  1988  FTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             FT   LRAA+ Q+     +P  L+ AI  +I +     +K+ V +L+ + +  KEA  ++
Sbjct  6     FTLAGLRAASCQTQGLLRLPNSLQAAIAAFIGDIPTREVKQSVAKLTSNMKVRKEAARIV  65

Query  1808  PTTTSKEIVEDPLKSVE--CSKRWKIQS-------AYGDIGLRYEEDE--AIAYVASRMP  1662
               T + E  +D   +VE    K    Q        A     +RYE DE    AYVA+RMP
Sbjct  66    VGTQAVEGSDDARAAVEEYLGKTTATQVRLNKELFAPAQAPVRYEYDEKNVAAYVAARMP  125

Query  1661  AVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQ  1482
             AVY A+YRVLSE+  R+PDF+P +VLDFG+G G+  WAMRE+WP+ ++ VNLVEPS++M 
Sbjct  126   AVYGAVYRVLSEISTRLPDFTPTRVLDFGSGPGTVLWAMRELWPQGVEHVNLVEPSRAMA  185

Query  1481  RAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQ  1302
              A + L + L+N+PL+  + SL   ++ ++K  R HDLVI+SY LGE+ +  +RIT VRQ
Sbjct  186   AACRTLLQDLENIPLVKVHPSLSLYTRGLRKDRRLHDLVISSYALGELLTPAERITTVRQ  245

Query  1301  LWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS-GKSCKALTTLKSGA  1125
             LW LT D+LVL+EPGTPQGS+I+ ++R+HIL ME++K R+  +S  G      +  + GA
Sbjct  246   LWALTSDVLVLIEPGTPQGSSIVREMRAHILHMEKKKLRRSAQSDQGDGFLLESEERPGA  305

Query  1124  FIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS-LRGFEDEKFSYVVFRR  948
             F+VAPCPHDG CP++K+  +CHFVQRLERTTSQR  KR    + LR +EDEKFS+V+ RR
Sbjct  306   FVVAPCPHDGQCPMDKTSNWCHFVQRLERTTSQRVTKRHTKPTPLRAYEDEKFSFVILRR  365

Query  947   GQRPRETWPLNGMKFETLKEQHARRNPEDLEIDYEDQFPseneddlneeeiiSYNSddte  768
             G RP   +PL G+  E          P + E     + P    D +  ++    + +   
Sbjct  366   GSRPNVPYPLEGLTIE----------PAEEEDFEFIEDPMGKLDAVATDDA---DEESGN  412

Query  767   vdtvtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFD  588
                 +D  E E++    G +TAD+G+GW RIV +PI RG+R  +D+C A++ +G++G   
Sbjct  413   DSHESDEFEEEEDDVIVGNSTADVGSGWARIVRTPIRRGRRTILDLCAATERDGSRGEVT  472

Query  587   RIIITKSKNPT-LHHHARRSLWGDLWP  510
             RII ++  N   LH  AR+S WGDLWP
Sbjct  473   RIICSRKGNAAPLHPQARKSRWGDLWP  499



>ref|XP_008366924.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Malus 
domestica]
Length=286

 Score =   373 bits (957),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/243 (75%), Positives = 210/243 (86%), Gaps = 1/243 (0%)
 Frame = -1

Query  2009  LSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRH  1833
             L ET  K  T EALR+AAKQS  C   P+RLRRAIKKY++EQ++PHMKRKVLRLSESF  
Sbjct  6     LPETAQKLLTREALRSAAKQSQRCLTTPVRLRRAIKKYLREQDEPHMKRKVLRLSESFSQ  65

Query  1832  IKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVY  1653
             IK+ N  L T TS+++VEDPL+SV+ S+RWKI+S YGDIGL Y +DE IAYVASRMPAV+
Sbjct  66    IKDVNSQLVTATSQQLVEDPLRSVDQSQRWKIRSNYGDIGLTYRDDETIAYVASRMPAVF  125

Query  1652  SALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAG  1473
             SA +RVL EVRRR+P+FSPAKVLDFGAGTGSAFWA+REVWP SL+KVNLVEPSQSMQRAG
Sbjct  126   SACHRVLKEVRRRIPEFSPAKVLDFGAGTGSAFWALREVWPHSLEKVNLVEPSQSMQRAG  185

Query  1472  QGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             Q LT+G KNLPLIHSY SLQ+L+++I KS R+HDLVIASYVLGEIPSLKDRIT+VRQLW 
Sbjct  186   QKLTQGQKNLPLIHSYDSLQSLTKSITKSEREHDLVIASYVLGEIPSLKDRITIVRQLWI  245

Query  1292  LTG  1284
             L G
Sbjct  246   LHG  248



>tpg|DAA45964.1| TPA: hypothetical protein ZEAMMB73_551244 [Zea mays]
Length=342

 Score =   357 bits (916),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 193/333 (58%), Positives = 244/333 (73%), Gaps = 20/333 (6%)
 Frame = -1

Query  2018  ASRLSETVPKF-TAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSES  1842
             A+ L ET P+  T E LR AAKQS    +VPL LRRAIK+Y+++Q+  HM RKVL LS S
Sbjct  3     AALLPETAPRLLTPETLRTAAKQSQGIHLVPLSLRRAIKRYLRDQDRAHMNRKVLLLSAS  62

Query  1841  FRHIKEANLLLPTTTSKEIVED----PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             F   K     L    ++  + D    P  + + S RWK++SAYGDIGLRY EDE +AYVA
Sbjct  63    FDRAKGTGAELAAAATRAALLDDPNAPSGAEQRSARWKVRSAYGDIGLRYREDETVAYVA  122

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             SRMPA+Y+A +RVL EVRRR+P+F+PAKVLDFGAG  SA WAMR VWP+S+++VNLVEPS
Sbjct  123   SRMPAIYAACHRVLREVRRRLPEFAPAKVLDFGAGPSSALWAMRAVWPKSIERVNLVEPS  182

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + MQRAGQ L   LK LPLIHSY S+Q L++ I+K  R HDLV++SY LGEIPSL DRIT
Sbjct  183   KEMQRAGQSLLDNLKGLPLIHSYDSIQELNRKIEKHERGHDLVVSSYALGEIPSLSDRIT  242

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK---SCKAL-  1146
             +VRQLWDLT D+LVL+EPGTPQG+ IISQ+RS+ILWME+RKCRK+++SS +   S K++ 
Sbjct  243   IVRQLWDLTSDVLVLLEPGTPQGAKIISQMRSYILWMEKRKCRKIEKSSSRPPSSMKSIV  302

Query  1145  ---TTLKSGAFIVAPCPHDGPCPLEKSGKYCHF  1056
                 +LK+G+F+VAP   D         KYC +
Sbjct  303   AQKVSLKNGSFVVAPVSWD--------HKYCIY  327



>ref|XP_008246152.1| PREDICTED: methyltransferase-like protein 17, mitochondrial, 
partial [Prunus mume]
Length=179

 Score =   300 bits (769),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -1

Query  1550  AMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHD  1371
             A+REVWP SL+KVNLVEPSQSMQRAGQ L +G K+LPLIHSY S+Q+L+++IKKS+R+HD
Sbjct  1     ALREVWPHSLEKVNLVEPSQSMQRAGQKLIQGQKDLPLIHSYDSIQSLTKSIKKSDREHD  60

Query  1370  LVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRK  1191
             LVIASYVLGEIPSLKDRITVVRQLWDLT D+LVL+EPGTPQGSNIISQ+RSHILWME+RK
Sbjct  61    LVIASYVLGEIPSLKDRITVVRQLWDLTRDVLVLIEPGTPQGSNIISQMRSHILWMEKRK  120

Query  1190  CRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
             CRK K+ + ++ K L T KSGAFIVAPC HDG CPLEK+GKYCHFVQRLERT+ QR +K
Sbjct  121   CRKSKDGADETTKDLVTQKSGAFIVAPCSHDGQCPLEKAGKYCHFVQRLERTSIQRIFK  179



>ref|XP_002970612.1| hypothetical protein SELMODRAFT_93775 [Selaginella moellendorffii]
 gb|EFJ28742.1| hypothetical protein SELMODRAFT_93775 [Selaginella moellendorffii]
Length=308

 Score =   279 bits (713),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/259 (49%), Positives = 186/259 (72%), Gaps = 2/259 (1%)
 Frame = -1

Query  1709  RYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWP  1530
             RY+E +  AYVA++MPAVYS ++ VLSEV RR+PDF P  VLD+G+G G++ WAM +VWP
Sbjct  52    RYDEKQVAAYVAAKMPAVYSVIHTVLSEVARRLPDFKPENVLDYGSGPGTSIWAMSQVWP  111

Query  1529  RSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYV  1350
             ++++ VN+VE S SM  A + +   L++ P++H++ +L+ LS+  + S   HD+VIA + 
Sbjct  112   KTVKLVNMVETSPSMLAASKKILEDLEDPPVMHNHKTLRILSKKTRHSG--HDIVIACHA  169

Query  1349  LGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKES  1170
             +GE+P+++++IT  RQLW LT DILV+VEPGT +GS  +  +R+HIL +ER+       S
Sbjct  170   IGELPTVEEQITTARQLWALTRDILVIVEPGTSEGSLTVRGIRAHILALERKASISFVSS  229

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLR  990
             +  S + +     GA ++APCPHDG CP++ +  +CHFVQRLERT +QR  K+ +   LR
Sbjct  230   NIHSEEEVEIPGGGAHVIAPCPHDGVCPMDGTTVFCHFVQRLERTFTQRMAKKHSRTMLR  289

Query  989   GFEDEKFSYVVFRRGQRPR  933
             G+EDEK+SYVV RRG RPR
Sbjct  290   GYEDEKYSYVVLRRGHRPR  308



>ref|XP_002968446.1| hypothetical protein SELMODRAFT_409261 [Selaginella moellendorffii]
 gb|EFJ30700.1| hypothetical protein SELMODRAFT_409261 [Selaginella moellendorffii]
Length=611

 Score =   273 bits (699),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 234/404 (58%), Gaps = 52/404 (13%)
 Frame = -1

Query  1961  AKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIV  1782
             AKQ+   + VP  L+ +IK Y+ +  +  +++ V   +      K     +  T S E  
Sbjct  15    AKQTVGLKRVPEPLQESIKGYLADYSNHQIRQHVFNYTLMLSG-KSEEPPIAVTPSFEPS  73

Query  1781  EDPLKSVE-----------CSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRV  1635
                L +VE             K+++       +  RY+E +  AYVA++MPAVYS ++ V
Sbjct  74    AKVLAAVEDYFSNKGPFAPVPKKYRA----ARLKPRYDEKQVAAYVAAKMPAVYSVIHTV  129

Query  1634  LSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRG  1455
             LSEV RR+PDF P  VLD+G+G G++ WAM +VWP++++ VN+VE S SM  A + +   
Sbjct  130   LSEVARRLPDFKPENVLDYGSGPGTSIWAMSQVWPKTVKLVNMVETSPSMLAASKKILED  189

Query  1454  LKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDIL  1275
             L++ P++H++ +L+ LS+  + S   HD+VIA + +GE+P+++++IT  RQLW LT DIL
Sbjct  190   LEDPPVMHNHKTLRILSKKTRHSG--HDIVIACHAIGELPTVEEQITTARQLWALTRDIL  247

Query  1274  VLVEPGTPQGSNIISQVRSHILWMERRKC-------RKLKESSGKSCKALTTLKS-----  1131
             V+VEPGT +GS  +  +R+HIL +ER+         R+ K  +G +      + +     
Sbjct  248   VIVEPGTSEGSLTVRGIRAHILALERKATFASQKLRRRRKFLTGSTSTDTPMIGTSEEDG  307

Query  1130  ----------------------GAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAY  1017
                                   GA ++APCPHDG CP++ +  +CHFVQRLERT +QR  
Sbjct  308   SKRNLGEQLVVHSEEEVEIPGGGAHVIAPCPHDGVCPMDGTTLFCHFVQRLERTFTQRMA  367

Query  1016  KRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQ  885
             K+ +   LRG+EDEK+SYVV RRG RPR  WPL+ ++ +  K++
Sbjct  368   KKHSRTMLRGYEDEKYSYVVLRRGHRPRVDWPLDHVELQLDKDE  411


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -1

Query  704  ADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLW  525
            A++ +GWGR+++ P  RGK + +DVCR++  +G+ GSFDR+ +T++K+  LH  A++  W
Sbjct  487  ANMSSGWGRVIFKPFRRGKHVTLDVCRSTSPDGSSGSFDRLTVTRAKHRVLHKEAKKVRW  546

Query  524  GDLW  513
            GDLW
Sbjct  547  GDLW  550



>ref|NP_001182916.1| uncharacterized protein LOC100501202 [Zea mays]
 gb|ACR35118.1| unknown [Zea mays]
Length=178

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 131/171 (77%), Gaps = 15/171 (9%)
 Frame = -1

Query  1547  MREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDL  1368
             MR VWP+S+++VNLVEPS+ MQRAGQ L   LK LPLIHSY S+Q L++ I+K  R HDL
Sbjct  1     MRAVWPKSIERVNLVEPSKEMQRAGQSLLDNLKGLPLIHSYDSIQELNRKIEKHERGHDL  60

Query  1367  VIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKC  1188
             V++SY LGEIPSL DRIT+VRQLWDLT D+LVL+EPGTPQG+ IISQ+RS+ILWME+RKC
Sbjct  61    VVSSYALGEIPSLSDRITIVRQLWDLTSDVLVLLEPGTPQGAKIISQMRSYILWMEKRKC  120

Query  1187  RKLKESSGK---SCKAL----TTLKSGAFIVAPCPHDGPCPLEKSGKYCHF  1056
             RK+++SS +   S K++     +LK+G+F+VAP   D         KYC +
Sbjct  121   RKIEKSSSRPPSSMKSIVAQKVSLKNGSFVVAPVSWD--------HKYCIY  163



>ref|XP_002981304.1| hypothetical protein SELMODRAFT_444842 [Selaginella moellendorffii]
 gb|EFJ17492.1| hypothetical protein SELMODRAFT_444842 [Selaginella moellendorffii]
Length=644

 Score =   206 bits (524),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 118/358 (33%), Positives = 195/358 (54%), Gaps = 36/358 (10%)
 Frame = -1

Query  1940  RVVPLR----LRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEI-VED  1776
             RV P+R    L+  ++K ++E  +  + + + R+        +  L      S+++   +
Sbjct  155   RVPPVRIPDLLQSQVEKLLREHPEVDLDKSITRMEAVKSFWADEEL----ACSRQLRTLN  210

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             P    E  K W + +  G +  +Y  D+A+A+ A  MP+ Y+ALYRVLSEV+RR+PDF P
Sbjct  211   PGAQKEKVKSWILATEQGPV--KYLMDDAVAFAARSMPSTYAALYRVLSEVKRRIPDFRP  268

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
              +VLDFG+G G++ WA+RE+WP   +   L+E S +M    + L  G++ +PL+   + L
Sbjct  269   RQVLDFGSGPGTSLWAIRELWPEQTKTAFLIETSAAMTSVCKSLAEGVETMPLLKYRTVL  328

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNI  1236
                 ++ ++  + +DLVI S+ + E+PS+  R+ VV  LW LT ++LV++EPGT  GS +
Sbjct  329   PNAGRSPRRDEKTNDLVICSFAMNEVPSMAHRMAVVNYLWTLTHNMLVIIEPGTLHGSAL  388

Query  1235  ISQVRSHILWMERRKCRK------LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEK-  1077
             + ++R  ++  E  + R       L  S  K+   L     GA +VAPC HDG CP+ + 
Sbjct  389   VRRLRDRVMTTENHRVRGQYRGLYLPASDPKAHSDL-----GAHVVAPCAHDGTCPMSRN  443

Query  1076  -SGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMK  906
              +G  C  +Q ++   +++  K S            FS+VV RRG R    WPL+  K
Sbjct  444   VNGGICGLIQAIQAQEAKKLDKVS------------FSFVVMRRGFRKWGAWPLDRYK  489



>ref|XP_002969697.1| hypothetical protein SELMODRAFT_410587 [Selaginella moellendorffii]
 gb|EFJ28821.1| hypothetical protein SELMODRAFT_410587 [Selaginella moellendorffii]
Length=652

 Score =   206 bits (524),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 117/358 (33%), Positives = 196/358 (55%), Gaps = 36/358 (10%)
 Frame = -1

Query  1940  RVVPLR----LRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEI-VED  1776
             RV P+R    L+  +++ ++E  +  + + + R+        +  L      S+++   +
Sbjct  127   RVPPVRIPDLLQSQVERLLREHPEVDIDKSITRMEAVKSFWADEEL----ACSRQLRTLN  182

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             P    E  K W + +  G +  +Y  D+A+A+ A  MP+ Y+ALYRVLSEV+RR+PDF P
Sbjct  183   PGAQKEKVKSWILATEQGPV--KYLMDDAVAFAARSMPSTYAALYRVLSEVKRRIPDFRP  240

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
              +VLDFG+G G++ WA+RE+WP  ++   L+E S +M    + L  G++ +PL+   + L
Sbjct  241   RQVLDFGSGPGTSLWAIRELWPEQMKTAFLIETSAAMTSVCKSLAEGVETMPLLKYRTVL  300

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNI  1236
                 ++ ++  + +DLVI S+ + E+PS+  R+ VV  LW LT ++LV++EPGT  GS +
Sbjct  301   PNAGRSPRRDEKTNDLVICSFAMNEVPSMAHRMAVVNYLWTLTHNMLVIIEPGTLHGSAL  360

Query  1235  ISQVRSHILWMERRKCRK------LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEK-  1077
             + ++R  ++  E  + R       L  S  K+   L     GA +VAPC HDG CP+ + 
Sbjct  361   VRRLRDRVMTTENHRVRGQYRGLYLPASDPKAHSDL-----GAHVVAPCAHDGTCPMSRN  415

Query  1076  -SGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMK  906
              +G  C  +Q ++   +++  K S            FS+VV RRG R    WPL+  K
Sbjct  416   VNGGICGLIQAIQAQEAKKLDKVS------------FSFVVMRRGFRKWGAWPLDRYK  461



>gb|EXX74933.1| hypothetical protein RirG_046430 [Rhizophagus irregularis DAOM 
197198w]
Length=471

 Score =   194 bits (494),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 172/336 (51%), Gaps = 19/336 (6%)
 Frame = -1

Query  1937  VVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVE  1758
             ++P  L  A+ + +KE +   +K    R+ +S R     +        K+ +  P KS  
Sbjct  103   ILPDWLNEAVLEIVKEHDKEMIKHDANRIYQSLRSTTGYDPKF-DVDFKDPIMGPCKSAR  161

Query  1757  CS-KRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLD  1581
              + KR+ +++      L Y   EA+AY+A  +P  Y  ++ VL+E++ R+PDFSP  V+D
Sbjct  162   NAFKRFVLENEVKPHVLEYGTREAMAYIAGYLPISYGPIFNVLTELKSRIPDFSPQSVMD  221

Query  1580  FGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQ  1401
             FG G G+A W    +W + +     ++ S+SM R  + L         I +    + LS 
Sbjct  222   FGTGPGTAIWVSHNIWDKHVPNFLGIDISESMLRTAEKLLSFQPKEDRIKNIEFKRYLSY  281

Query  1400  NIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVR  1221
               +    +HDLVI+++ L E+P+   R TV+  LW+ T D+LVL+E GTP G  II++ R
Sbjct  282   --EPHQLKHDLVISAFTLNELPNDNIRETVLESLWNRTNDLLVLIENGTPAGFKIIAEAR  339

Query  1220  SHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLE  1041
               IL            +  K    +   K GA +VAPCPHDG CPL KS  +CHF QR+ 
Sbjct  340   KRIL------------NINKQNNEVDITKHGAHVVAPCPHDGICPLVKSRNWCHFSQRIN  387

Query  1040  RTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             R       K         FED K+ YV+ R+GQRP+
Sbjct  388   RPLYLMQTKNVKN---HNFEDSKYCYVILRKGQRPK  420



>gb|ESA05301.1| hypothetical protein GLOINDRAFT_4133 [Rhizophagus irregularis 
DAOM 181602]
Length=555

 Score =   196 bits (499),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 174/336 (52%), Gaps = 7/336 (2%)
 Frame = -1

Query  1937  VVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVE  1758
             ++P  L  A+ + +KE +   +K    R+ +S R     +        K+ +  P KS  
Sbjct  103   ILPDWLNEAVLEIVKEHDKEMIKHDANRIYQSLRSTTGYDPKF-DVDFKDPIMGPCKSAR  161

Query  1757  CS-KRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLD  1581
              + KR+ +++      L Y   EA+AY+A  +P  Y  ++ VL+E++ R+PDFSP  V+D
Sbjct  162   NAFKRFVLENEVKPHVLEYGTREAMAYIAGYLPISYGPIFNVLTELKSRIPDFSPQSVMD  221

Query  1580  FGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQ  1401
             FG G G+A W    +W + +     ++ S+SM R  + L         I +    + LS 
Sbjct  222   FGTGPGTAIWVSHNIWDKHVPNFLGIDISESMLRTAEKLLSFQPKEDRIKNIEFKRYLS-  280

Query  1400  NIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVR  1221
               +    +HDLVI+++ L E+P+   R TV+  LW+ T D+LVL+E GTP G  II++ R
Sbjct  281   -YEPHQLKHDLVISAFTLNELPNDNIRETVLESLWNRTNDLLVLIENGTPAGFKIIAEAR  339

Query  1220  SHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLE  1041
               IL + ++             +  +  K GA +VAPCPHDG CPL KS  +CHF QR+ 
Sbjct  340   KRILNINKQNNEVESTIDNLEDETKSITKHGAHVVAPCPHDGICPLVKSRNWCHFSQRIN  399

Query  1040  RTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             R       K         FED K+ YV+ R+GQRP+
Sbjct  400   RPLYLMQTKNVKN---HNFEDSKYCYVILRKGQRPK  432



>ref|XP_008239203.1| PREDICTED: uncharacterized protein LOC103337812 [Prunus mume]
Length=180

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -1

Query  1028  QRAYKRSNGGS-LRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLKEQHARRNPEDLEI  852
             + A KRS GG  LRGFEDEKFS++  RRGQRP+E+WPL+G+ FETLKEQ A+R+PEDLEI
Sbjct  8     ETAQKRSKGGQPLRGFEDEKFSFIAVRRGQRPQESWPLDGLNFETLKEQQAKRSPEDLEI  67

Query  851   DYEDQFPseneddlneeeiiSYNSddtevdtvtdneeledeqeETGAATADLGTGWGRIV  672
             D E+   S+  D +  EE    N D   ++T   NE  E+E++ETG   ADLG GWGRI+
Sbjct  68    DLEELNSSQQADLIPFEEPDPVNYDSDVMETDVANENDEEEEDETGH--ADLGGGWGRII  125

Query  671   YSPICRGKRIEMDVCRASDHEGTKGSFDRIIITKSKNPTLHHHARRSLWGDLWPF  507
             Y P+ RGK++ MDVCR++  +G++G   R+++TKSKNP LH  AR+S+WGDLWPF
Sbjct  126   YMPVRRGKQVTMDVCRSTKRDGSEGELQRVVVTKSKNPALHQQARKSIWGDLWPF  180



>ref|XP_005649270.1| Rsm22-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE24726.1| Rsm22-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=612

 Score =   180 bits (457),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 99/248 (40%), Positives = 143/248 (58%), Gaps = 26/248 (10%)
 Frame = -1

Query  1655  YSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRA  1476
             Y+A+Y ++ E+  R+P F P  +LDFG+G G+A WA +EVW  SL  V  VE S +M   
Sbjct  97    YAAIYNIMDELSVRLPLFRPRSMLDFGSGPGTAVWAAQEVWDGSLHDVLAVEASPAMAAF  156

Query  1475  GQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLW  1296
             GQ +    +        SSL+  +Q+ ++   Q+D+V  +YV+GE+ S ++R + V  LW
Sbjct  157   GQSIQAARQ--------SSLEEPAQHSQRG--QYDMVTGAYVIGELDSEEERQSTVDALW  206

Query  1295  DLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIV  1116
               T  +++LVEPGTP G   I   R+ +L         L+E  G         K GA +V
Sbjct  207   ASTKHLMILVEPGTPTGYANIMAARTQVLEA------SLQEEGG---------KMGAHVV  251

Query  1115  APCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK-RSNGGSLRGFEDEKFSYVVFRRGQR  939
             APCPHDG CP+E +  +CHF QR ER+  QR  K R +GG  R ++DE++SYVV R+  R
Sbjct  252   APCPHDGVCPMEGTKSWCHFTQRFERSGLQRVTKIRPDGGLARTYQDERYSYVVIRKEPR  311

Query  938   PRETWPLN  915
             P    PL+
Sbjct  312   PEMGSPLS  319



>ref|XP_002683531.1| predicted protein [Naegleria gruberi]
 gb|EFC50787.1| predicted protein [Naegleria gruberi]
Length=1028

 Score =   183 bits (465),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/253 (36%), Positives = 142/253 (56%), Gaps = 27/253 (11%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPR  1527
             Y+E E+ AY+A R+PA+Y   YRV SE   R+PDF P  +LDFG G G+  WA  E +  
Sbjct  671   YKELESAAYIAHRLPAIYGTSYRVFSEAVMRMPDFEPKTMLDFGTGPGTTIWAAHEAFGG  730

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVL  1347
             S+++V  VEPS +M      L   + N P I     L       + S++Q+DLV+AS+V+
Sbjct  731   SVKEVMAVEPSTAMMDVASRLFEYMNNKPHITWRRFLN------EHSSKQYDLVVASFVM  784

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              E+ + ++R  +V+ LW LT  +L+++EPGTP G + I + RS +L              
Sbjct  785   NELSNSQERERIVKALWKLTSGVLIIIEPGTPVGFDFIREARSTVL--------------  830

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                 +    +     I+APCPHD  CP+  + K+CHF QR+ER   Q+  K++     + 
Sbjct  831   ---TQKYININDKPTILAPCPHDSVCPMAGTPKWCHFAQRVEREEFQKLTKQAK----KQ  883

Query  986   FEDEKFSYVVFRR  948
             +E+E +S++ F+R
Sbjct  884   YENENYSFIAFKR  896



>gb|KFH64042.1| hypothetical protein MVEG_09867 [Mortierella verticillata NRRL 
6337]
Length=687

 Score =   179 bits (454),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 139/503 (28%), Positives = 222/503 (44%), Gaps = 99/503 (20%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVEC  1755
             +P  L+ AI+  + E++   ++   LRL  S R            ++  + ED    VE 
Sbjct  175   MPKPLQDAIRSVLDEEDKSLIRTDALRLYGSLR------------STGSLDED--HYVEA  220

Query  1754  SKRWKIQSAYGDIG-----------LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVP  1608
             S + +I+S  GD+            L Y   E+ AY+A+  P  YSA+  VL EV RRVP
Sbjct  221   STK-RIKSGSGDLSSKGDRVIPAHILEYGHRESTAYIAAMSPTTYSAVRNVLEEVNRRVP  279

Query  1607  DFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHS  1428
             D  P  +LDFG G G+A WA  EVW + +     V+ S +M    + +   L        
Sbjct  280   DLDPKTILDFGTGPGTAIWAANEVWQKPIHYTG-VDTSMAMLETAEVILDSLSTSGEAIE  338

Query  1427  YSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQ  1248
               + +    +  K+ ++ D+V++++VL E+ +   R + +  LW+ T D+LVL++ GTP 
Sbjct  339   NVTFKPFMSHGPKA-QKFDVVMSAFVLSELTTPALRRSTLEHLWNSTNDMLVLIDRGTPS  397

Query  1247  GSNIISQVRSHILWMERR--KCRKLKESSGKSC-KALTTLKSGAFIVAPCPHDGPCP---  1086
             G   +++ R  IL ++    K +   ++ G    +   T    A ++APCPHD  CP   
Sbjct  398   GFKTLAEAREQILGLDADLFKPKPKYDNFGNILPEEKPTPPEPAHVLAPCPHDKICPMYA  457

Query  1085  -LEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRET------  927
              L K+ ++CHF Q+++R    R  K S       FED K++YVV R+G RP  T      
Sbjct  458   SLAKNTQWCHFSQKVQRPDFLRKTKHSK----ENFEDAKYTYVVLRKGSRPVPTAAPQPV  513

Query  926   -WPLNGMKFETLKEQHARRNPEDLEIDY---EDQFPseneddlneeeiiSYNSddtevdt  759
               P N  +    K    +R P    + Y   ED F + +                     
Sbjct  514   VAPTNLTEEAPSKGGKHKRQPPPPPVTYDNFEDMFKASH---------------------  552

Query  758   vtdneeledeqeETGAATADLGTGWGRIVYSPICRGKRIEMDVCRASDHEGTKGSFDRII  579
                                     W R+V  PI +   + MD C      G  G  +R++
Sbjct  553   -----------------------SWSRLVVPPIKKDGHVVMDTC------GPDGFLERMV  583

Query  578   ITKSKNPTLHHHARRSLWGDLWP  510
             I +S+    +  AR++ WGDL+P
Sbjct  584   IPRSQGKIPYRDARKATWGDLFP  606



>ref|WP_025747529.1| ribosomal small subunit Rsm22 [Caldicoprobacter oshimai]
Length=323

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 144/252 (57%), Gaps = 37/252 (15%)
 Frame = -1

Query  1697  DEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQ  1518
             +EA+AY+A R+PA ++A Y VLS+V+ R+PD SP  +LD GAG G+A WA   VWP  L+
Sbjct  50    EEALAYMAFRLPATFAAAYFVLSQVKGRLPDLSPNTLLDVGAGPGTAMWAATMVWPE-LE  108

Query  1517  KVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI--KKSNRQHDLVIASYVLG  1344
             ++ L+E  Q+M   G+ L +       +HS    + +  ++  + +  +HD+VIASYVL 
Sbjct  109   RITLIERDQNMIDIGKKLAKYAS----LHSIREAEWIKADVMGEWNVPKHDVVIASYVLN  164

Query  1343  EIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSG  1164
             E+P  +   + + +LW+ T  IL+ +EPGTP G ++I QVR  +                
Sbjct  165   ELPP-QSIGSFILKLWESTASILIFIEPGTPAGFSLIRQVRERL----------------  207

Query  1163  KSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGF  984
                     L  GA I APCPH   CP+ +   +CHF QRL RT   R +++  GG+L  +
Sbjct  208   --------LGEGASIAAPCPHSSSCPIAED-DWCHFSQRLNRT---RLHRQIKGGTL-SY  254

Query  983   EDEKFSYVVFRR  948
             EDEKFS+V   R
Sbjct  255   EDEKFSFVCLSR  266



>emb|CDH49418.1| ribosomal small subunit rsm22 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=444

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 120/361 (33%), Positives = 174/361 (48%), Gaps = 69/361 (19%)
 Frame = -1

Query  1976  ALRAAAKQSDSCRV----VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLL  1809
             A R+AA +    R+    +P  L   I + ++E +   ++   LR+ ES R         
Sbjct  57    ARRSAAAEYGRKRIGAVPLPKPLIDGISEIVQESDKKLIRTDALRIYESLR---------  107

Query  1808  PTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLS  1629
               +TS+   ED  K            AYG         E++AY+A  MP+ Y+A + VL 
Sbjct  108   --STSRIPTEDTTKEPHTV-------AYG-------PRESLAYLAGAMPSAYAATFNVLH  151

Query  1628  EVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK  1449
             E+  R+ DF P  +LDFG G G+A WA  +V+   +Q    V+ S+ M    + L   + 
Sbjct  152   EISHRLSDFKPKTILDFGTGPGTALWASHQVY-EDIQHCTGVDLSEDMLSIAERLQDNVA  210

Query  1448  -NLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILV  1272
               LP+   +    AL     K     DLVI+++ LG+IPS   + ++VRQLWD+TGD+LV
Sbjct  211   PQLPI--DFKRYLALGPEASKP----DLVISAFTLGDIPSTALQKSIVRQLWDMTGDVLV  264

Query  1271  LVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGP  1092
             L++ GTP G + I++ R ++L                             +VAPCPHD P
Sbjct  265   LIDRGTPIGFSNIARARQYVL----------------------DTNEDVHVVAPCPHDKP  302

Query  1091  CPLEKSGK------YCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             CPL  S        +CHF QR++R       K S   S    ED K+SYVV RRGQRP+ 
Sbjct  303   CPLLYSPDAKPDRLWCHFSQRVQRPQFLMKTKHSKSNS----EDAKYSYVVLRRGQRPKV  358

Query  929   T  927
             T
Sbjct  359   T  359



>ref|WP_031458500.1| ribosomal small subunit Rsm22 [Chloroflexus sp. MS-G]
Length=323

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 153/307 (50%), Gaps = 49/307 (16%)
 Frame = -1

Query  1811  LPTTTSKEIVEDPLKSVE-----CSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSA  1647
             L  T  + I E PL ++E      S R++ Q   G I +     +A+AY A RMPA Y+A
Sbjct  7     LQHTLERVIAEQPLTALERAALELSTRYREQGT-GSIPVINTPLDAVAYAAWRMPATYAA  65

Query  1646  LYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQG  1467
             L  V   +    PDF+P ++LD GAG+G+A WA  E WP SLQ V  +E   +M R G+ 
Sbjct  66    LRSVFRRLAESQPDFAPKRMLDIGAGSGAAIWAAAEQWP-SLQHVVAIERQPAMVRLGKQ  124

Query  1466  LTRGLKNLPLIHSYSSLQALSQNIKKSNR--QHDLVIASYVLGEIPSLKDRITVVRQLWD  1293
             LT    NLP      ++    Q++   +R  + DLV+A YV GEI +    + + R LW 
Sbjct  125   LTIS-TNLP------TVVWQQQDVMTLDRLPESDLVVAGYVYGEIEATARNLFLSR-LWK  176

Query  1292  LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVA  1113
              T   LVLVEPGTP G   I   R  +                        +K  A+++A
Sbjct  177   ATSGALVLVEPGTPAGHTTILHARGEL------------------------IKRDAYLLA  212

Query  1112  PCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPR  933
             PCPH   CPL +   +CHF QR+ R   QR  K    G+   FEDEKF+Y++  R    R
Sbjct  213   PCPHTASCPLAERNDWCHFSQRIARPAFQRRLK----GASAPFEDEKFAYLIVSR----R  264

Query  932   ETWPLNG  912
                P+NG
Sbjct  265   PALPVNG  271



>ref|WP_012257997.1| MULTISPECIES: ribosomal small subunit Rsm22 [Chloroflexus]
 ref|YP_001635732.1| ribosomal small subunit Rsm22 [Chloroflexus aurantiacus J-10-fl]
 ref|YP_002570018.1| Ribosomal small subunit Rsm22 [Chloroflexus sp. Y-400-fl]
 gb|ABY35343.1| Ribosomal small subunit Rsm22 [Chloroflexus aurantiacus J-10-fl]
 gb|ACM53692.1| Ribosomal small subunit Rsm22 [Chloroflexus sp. Y-400-fl]
Length=331

 Score =   161 bits (407),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 109/331 (33%), Positives = 151/331 (46%), Gaps = 73/331 (22%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVEC  1755
             +P  L+ A+++ I  Q    ++R  L+LS  +R       ++ TT               
Sbjct  3     LPTTLQNALERMIAAQPASALERTALQLSARYRETGTDAPVIATTI--------------  48

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
                                 EA+AY A RMPA Y+AL  V   +    PDF+P ++LD G
Sbjct  49    --------------------EAVAYAAWRMPATYAALRAVFRRLAEAQPDFTPKRMLDIG  88

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI  1395
             AG+G+A WA  E WP SLQ+V  +E   +M R G+ LT    +LP I          Q++
Sbjct  89    AGSGAAIWAATEQWP-SLQQVVAIERQPAMARIGKQLTAN-ADLPAIVWQ------QQDV  140

Query  1394  KKSNR--QHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVR  1221
                +R  + DLV+A YV GEI     R  V+ +LW   G  LVLVEPGTP G   I   R
Sbjct  141   LTLDRLAESDLVVAGYVYGEIEPTA-RTLVLSRLWKAAGGALVLVEPGTPTGHTTILHAR  199

Query  1220  SHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLE  1041
             S +                        +K  A ++APCPH   CPL +   +CHF QR+ 
Sbjct  200   SEL------------------------IKRNAHLLAPCPHTAACPLAEGNDWCHFAQRIA  235

Query  1040  RTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             R    R  K +       FEDEKF+Y++  R
Sbjct  236   RPAFLRRLKAAEA----PFEDEKFAYLIASR  262



>ref|XP_003293336.1| hypothetical protein DICPUDRAFT_90205 [Dictyostelium purpureum]
 gb|EGC30128.1| hypothetical protein DICPUDRAFT_90205 [Dictyostelium purpureum]
Length=1078

 Score =   169 bits (428),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 142/260 (55%), Gaps = 22/260 (8%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             + Y + EA+AY++ RMP VY+  +RV SE++ RVP+F+P  +LD+G+G G+  W+   +W
Sbjct  482   ITYGKGEAMAYISHRMPGVYACTHRVFSEIKTRVPNFNPTTLLDYGSGPGTVLWSASTMW  541

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKK--SNRQHDLVIA  1359
                L+++  VEPS  M    + L  G  N     +Y + +   +       +  ++LV A
Sbjct  542   GEHLKRIRAVEPSPFMIEIAKKLMEGNTNHIKWTNYLNTEQHERRDGSLPESEMNELVTA  601

Query  1358  SYVLGEIPSLKDRITVVRQLWDLT--GDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             SYVL E+P    R T+V+ LW       +LV++EPGTP G  II ++R  +L        
Sbjct  602   SYVLSELPDQLSRFTLVKDLWRNVKPSGMLVIIEPGTPIGFGIIKEIRQMLL--------  653

Query  1184  KLKESSGKSCKALTTLKSG-AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRS  1008
                    +  + LT  KS  A +VAPCPH G CPL     +CHF QR+ER   Q+  K  
Sbjct  654   ------DEGEEQLTIHKSTKAQVVAPCPHSGKCPL-GFNSWCHFSQRVERPNFQKLAK--  704

Query  1007  NGGSLRGFEDEKFSYVVFRR  948
               GS   FEDEK+SY+V  +
Sbjct  705   GPGSTMPFEDEKYSYIVLSK  724



>ref|WP_028457992.1| ribosomal small subunit Rsm22 [Chloroflexus sp. Y-396-1]
Length=335

 Score =   160 bits (405),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 145/287 (51%), Gaps = 44/287 (15%)
 Frame = -1

Query  1766  SVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKV  1587
             ++E S R++ ++  G   +      A+AY A RMPA Y+AL  V   +    PDF+P ++
Sbjct  27    AIELSTRYR-KTGTGSTPVISTPIAAVAYAAWRMPATYAALRSVFRRLAESQPDFAPKRM  85

Query  1586  LDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL  1407
             LD GAG+G+A WA  E WP SLQ V  +E   +M R G+ LT    +LP +  +      
Sbjct  86    LDIGAGSGAAIWAAAEQWP-SLQHVVAIERQPAMARLGRQLTTS-TDLPTVVWH------  137

Query  1406  SQNIKKSNR--QHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
              Q++   +R  + DLV+A YV GEI S    I + R LW  T   LVLVEPGTP G   I
Sbjct  138   QQDVLTLDRLPESDLVVAGYVYGEIESTARNILLSR-LWKATSGALVLVEPGTPAGHATI  196

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
                R  +                        +K  A +VAPCPH   CPL +   +CHF 
Sbjct  197   LHARGEL------------------------IKRAAHLVAPCPHTASCPLAERNDWCHFS  232

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNG  912
             QR+ R   QR  K    G+   FEDEKF+Y++   G+ P    P+NG
Sbjct  233   QRIARPAFQRRLK----GASAPFEDEKFAYLIV--GRYP--ALPVNG  271



>emb|CDS03966.1| hypothetical protein LRAMOSA06921 [Absidia idahoensis var. thermophila]
Length=441

 Score =   162 bits (411),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 112/343 (33%), Positives = 165/343 (48%), Gaps = 65/343 (19%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVEC  1755
             +P  L   I + ++E +   ++   LR+ ES R           +TS+   ED  K    
Sbjct  72    LPKSLIDGISEIVQESDKKLIRTDALRIYESLR-----------STSRIPKEDATKEPHT  120

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
                     AYG         E++AY+A  MP+ Y+A + VL E+  R+ DF P  +LDFG
Sbjct  121   V-------AYG-------PRESLAYLAGAMPSAYAATFNVLHEISHRLSDFKPKTILDFG  166

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLK-NLPLIHSYSSLQALSQN  1398
              G G+A WA  +V+  ++Q    V+ S+ M    + L   +   LP+   +     L   
Sbjct  167   TGPGTALWASHQVY-ENIQHCTGVDLSEDMLSIAERLQDSVAPQLPI--DFKRYLGLGPE  223

Query  1397  IKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRS  1218
               K     DLV++++ LG+IPS   + ++VRQLWD+TGD+LVL++ GTP G + I++ R 
Sbjct  224   ASKP----DLVVSAFTLGDIPSAALQKSIVRQLWDMTGDVLVLIDRGTPIGFSNIARARQ  279

Query  1217  HILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGK------YCHF  1056
              +L                             +VAPCPHD PCPL  S        +CHF
Sbjct  280   IVL----------------------DTNEEVHVVAPCPHDKPCPLLYSPDAKPDKLWCHF  317

Query  1055  VQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRET  927
              QR++R +     K S   S    ED K+SYVV RRG RP+ T
Sbjct  318   SQRVQRPSFLMKTKHSKSNS----EDSKYSYVVLRRGPRPKVT  356



>ref|XP_629675.1| hypothetical protein DDB_G0292286 [Dictyostelium discoideum AX4]
 gb|EAL61267.1| hypothetical protein DDB_G0292286 [Dictyostelium discoideum AX4]
Length=1241

 Score =   168 bits (425),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/264 (37%), Positives = 145/264 (55%), Gaps = 30/264 (11%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             + Y + + +AY++ RMP VY+  +RV SE+  R+P+F P  +LD+G+G G+  W+   +W
Sbjct  618   ITYGKGQVLAYISHRMPGVYACTHRVFSEINSRLPNFKPTSLLDYGSGPGTVLWSADTIW  677

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKK------SNRQHD  1371
               S++++  VEPS  M    + L  G  N      Y +    + N+K+      S   ++
Sbjct  678   GDSIKRIRAVEPSTYMSDVAKKLLEGNTNRVKWSPYLN----TANLKRQDGTIPSTELNE  733

Query  1370  LVIASYVLGEIPSLKDRITVVRQLWDLT--GDILVLVEPGTPQGSNIISQVRSHILWMER  1197
             +V ASYVL E+PS + R  +VR+LW       ILVL+EPGTP G NII + R  IL    
Sbjct  734   MVTASYVLSELPSQEARNDLVRELWSHVKPSGILVLIEPGTPIGFNIIKEARQLIL----  789

Query  1196  RKCRKLKESSGKSCKALTTLKSG-AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRA  1020
                        +  + L+  KS  A +VAPCPH G CP+  S  +CHF QR+ER   Q+ 
Sbjct  790   ----------DEEPEILSIYKSTKAQVVAPCPHSGKCPM-GSLSWCHFSQRVERPVFQKL  838

Query  1019  YKRSNGGSLRGFEDEKFSYVVFRR  948
              K  +  S   +EDEK+SY+V  +
Sbjct  839   AKGPH--STMPYEDEKYSYIVLSK  860



>ref|XP_006676364.1| hypothetical protein BATDEDRAFT_85388 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84182.1| hypothetical protein BATDEDRAFT_85388 [Batrachochytrium dendrobatidis 
JAM81]
Length=467

 Score =   162 bits (411),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 146/274 (53%), Gaps = 42/274 (15%)
 Frame = -1

Query  1715  GLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
              +RY++  + AY++SR  A Y A   V  ++ RR+PDF P  +LDFG G G+A WA +  
Sbjct  110   AIRYDKVSSKAYLSSRAHAAYGAADFVFRDISRRIPDFQPTSILDFGTGPGTAIWAAKNS  169

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPL--IHSYSSLQALSQNIKKS---NRQHD  1371
             WP+SL+    ++ S+ M      L+    N+P   I  Y  ++ L  N K+S   + +HD
Sbjct  170   WPKSLETAVGIDSSEEMLEHADKLS----NMPDSGIKDYKGMRYL--NYKESFLEHEKHD  223

Query  1370  LVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRK  1191
             LV+AS+V+GE+ S       ++ LWD T  +LVL++ GTP G   I++ R+ IL M    
Sbjct  224   LVVASFVIGELTSDLIIKATLKALWDQTRGMLVLIDRGTPNGFRHIAEARAAILEM----  279

Query  1190  CRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGK-YCHFVQRLERTTSQRAYK  1014
                          A +  + GA +V+PC H+  CPL  +GK +CHF        SQR Y+
Sbjct  280   -------------ANSNEQLGAHVVSPCSHEKLCPLLVNGKSWCHF--------SQRVYR  318

Query  1013  RSNGGSLRGF-----EDEKFSYVVFRRGQRPRET  927
                  S+ GF     ED KFSYV  RRG RP  T
Sbjct  319   NEVVRSITGFKSADHEDIKFSYVAIRRGARPAVT  352



>ref|WP_015940294.1| Ribosomal small subunit Rsm22 [Chloroflexus aggregans]
 ref|YP_002462871.1| Ribosomal small subunit Rsm22 [Chloroflexus aggregans DSM 9485]
 gb|ACL24435.1| Ribosomal small subunit Rsm22 [Chloroflexus aggregans DSM 9485]
Length=336

 Score =   157 bits (397),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 130/254 (51%), Gaps = 37/254 (15%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             EA+AY A RMPA Y+A+  V   +    P F+P K+LD GAG+G+A WA  E WP SLQ+
Sbjct  50    EAVAYAAWRMPATYAAVRAVFRRLAEAQPTFAPTKMLDVGAGSGAAIWAAAEQWP-SLQR  108

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEI-  1338
             V  +E   +M R G+ L  G   LP +          + + +S    DLV+ASYV GEI 
Sbjct  109   VIAIERQLAMARIGEQLMAG-AGLPKVTWQHGDVLTIERLPES----DLVVASYVYGEIE  163

Query  1337  PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKS  1158
             PS+  R+T++ +LW  T   L+ +EPGTP G   I  +R  +                  
Sbjct  164   PSM--RLTLLSRLWKATKGALIFIEPGTPTGYTTILSIRDEL------------------  203

Query  1157  CKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFED  978
                   +K    IVAPCPH   CPL +   +CHF QR+ R   QR  K    G+   FED
Sbjct  204   ------IKRDIPIVAPCPHTAACPLAEQHDWCHFAQRIARPAFQRRLK----GATAPFED  253

Query  977   EKFSYVVFRRGQRP  936
             EKFSY+   R   P
Sbjct  254   EKFSYLTAARQGTP  267



>dbj|GAM26921.1| hypothetical protein SAMD00019534_100960 [Acytostelium subglobosum 
LB1]
Length=1084

 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 101/261 (39%), Positives = 144/261 (55%), Gaps = 30/261 (11%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             + Y + EA+AY+A RMP VY+  +RV SE+  R+P+F P  +LD+G+G G+  W+ R+VW
Sbjct  491   ISYGKGEALAYIAHRMPGVYACTHRVFSEIATRLPNFKPTTLLDYGSGPGTVIWSARQVW  550

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQA--LSQNIKKSNRQHDLVIA  1359
               SL+ +  VEPS  M    + +  G  N  +  S   +Q   LS+++     Q DLV+A
Sbjct  551   GESLKSIRAVEPSTFMSDISKKMLEGNTN-EIKWSQFLMQPPHLSESM-----QSDLVVA  604

Query  1358  SYVLGEIPSLKDRITVVRQLW---DLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKC  1188
             SYVL E+P  + R  V+  LW     TG +LVLVEPGTP G ++I  +R  +L +     
Sbjct  605   SYVLSELPDQETREKVINDLWRNVKPTG-MLVLVEPGTPIGFSLIRAMRQMLLDL-----  658

Query  1187  RKLKESSGKSCKALTTLKS-GAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKR  1011
                          +T  KS  A +VAPCPH G CP+     +CHF QR+ R   Q+  K 
Sbjct  659   ---------PADQVTPQKSYRAQVVAPCPHSGRCPM-GFNSWCHFSQRVARPVFQKLAK-  707

Query  1010  SNGGSLRGFEDEKFSYVVFRR  948
                 S   FEDEK+SY+V  +
Sbjct  708   -GPKSTVPFEDEKYSYIVMSK  727



>dbj|GAA93920.1| hypothetical protein E5Q_00566 [Mixia osmundae IAM 14324]
 gb|KEI42747.1| hypothetical protein L969DRAFT_84622 [Mixia osmundae IAM 14324]
Length=575

 Score =   160 bits (405),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/368 (29%), Positives = 170/368 (46%), Gaps = 49/368 (13%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVEC  1755
             +PL L++A+ + ++E + P +++  L+L   +  + E++        K  +    +S   
Sbjct  84    LPLPLQQAVTQLVQESDRPLLRQDALKL---YARMGESSRQGQQDRKKGRLPRDQRSPAS  140

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRV------PDFSPA  1593
              +  + +       + Y+   A+AY A  MP+VY+A   VL E R+R+        + P 
Sbjct  141   VRDQRTK-------MVYDHRSALAYAAGVMPSVYAATQSVLQETRKRLEASASQAGWRPG  193

Query  1592  KVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSY----  1425
             +++DFG+GT S  WA   VWP        ++ S SM      L   L +  L  S+    
Sbjct  194   RIIDFGSGTASTAWAANAVWPEHKIAYTALDASPSMTHTAAKLLAYLPDEHLDRSFHTTR  253

Query  1424  ---SSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGT  1254
                S   +++QN    + QH L I+++ L E+ S  DR   +R +W+    ++VL+E GT
Sbjct  254   IPTSDSSSITQNAIGEDAQHTLAISAFALDELGSTSDRRDCIRAMWESGAQVIVLIERGT  313

Query  1253  PQGSNIISQVRSHILWMERRK----------------------CRKLKESSGKSCKALTT  1140
              +G   I++ R  +L + RR+                         L     K       
Sbjct  314   AKGFMHIAKAREQLLNLGRRRPDEQPLGADDPVESDADVLHIGGNTLVADDAKVPDGSAL  373

Query  1139  LKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYV  960
                G+++VAPCPHDG CPL +    CHF QR+ R +    Y R    +  G ED KFSYV
Sbjct  374   QAEGSYVVAPCPHDGECPLHREKDICHFSQRVSRPS----YLRRTKHARVGEEDSKFSYV  429

Query  959   VFRRGQRP  936
             V RRG RP
Sbjct  430   VIRRGPRP  437



>ref|WP_015311170.1| ribosomal methyltransferase Rsm22 [Thermoanaerobacterium thermosaccharolyticum]
 ref|YP_007298151.1| ribosomal methyltransferase Rsm22 [Thermoanaerobacterium thermosaccharolyticum 
M0795]
 gb|AGB18454.1| ribosomal methyltransferase Rsm22 [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=321

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 95/274 (35%), Positives = 143/274 (52%), Gaps = 48/274 (18%)
 Frame = -1

Query  1742  KIQSAYGDIGLRYEE-----------DEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             K+ +   DI  RY +           DE IAYV  RMPA Y A+Y VL+ V+    DF P
Sbjct  22    KLAALVSDISKRYRDKNYSDKFLNGYDETIAYVVYRMPATYGAIYTVLNHVKEVYNDFRP  81

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               +LD GAG G+A WA   +W   + ++ L+E  ++M   G+ L+          S  + 
Sbjct  82    KSLLDVGAGPGTAMWAATAIW-HDIDQITLLEKDENMINIGKKLSSN----SHYDSIKNA  136

Query  1415  QALSQNIKKS--NRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGS  1242
             + L  ++ +S   R+HD+VIASY +GE+     +  ++++LW+   DIL+++EPGT  G 
Sbjct  137   KWLKIDLNRSFDTRRHDIVIASYSIGELNE-DVQSKIIKKLWESANDILIIIEPGTKIGF  195

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + I + R                      +AL +L  GA ++APCPHD  CP+ K   +C
Sbjct  196   SRIKRAR----------------------EALISL--GAHVIAPCPHDKECPI-KDNDWC  230

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYV  960
             HF  R++RT+  R  K    G L  +EDEKFSY+
Sbjct  231   HFSSRIQRTSLHRKVK---NGEL-PYEDEKFSYI  260



>ref|XP_004360080.1| hypothetical protein DFA_04347 [Dictyostelium fasciculatum]
 gb|EGG22229.1| hypothetical protein DFA_04347 [Dictyostelium fasciculatum]
Length=1448

 Score =   162 bits (410),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 108/341 (32%), Positives = 169/341 (50%), Gaps = 48/341 (14%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIV--EDPLKSV  1761
             +P++L+R I + +K      ++     LS+  R+           T  E++  E P K  
Sbjct  735   IPIQLKRKITQQLKGNSTAKLRADAAMLSDRLRN----------RTRSEVIDKETPFKVA  784

Query  1760  ECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLD  1581
                K            + Y   EA+AY A RMP VYS  +RV  E+  R+P+F P  ++D
Sbjct  785   PEEKPV----------INYGPGEALAYAAHRMPGVYSCTHRVFQEIADRIPNFQPKTMMD  834

Query  1580  FGAGTGSAFWAMREVW----PRSLQKVNLVEPSQSM----QRAGQGLTRGLKNLPLIHSY  1425
             +G+G G+  W+ R++W      SLQ +  VEPS  M    ++  +G T G++    +   
Sbjct  835   YGSGPGTVIWSARQIWGEEGTNSLQSIRAVEPSTFMTDIAKKMLEGSTDGIQWSQFLLQP  894

Query  1424  SSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLT--GDILVLVEPGTP  1251
             +  Q  S        Q DLV+ASYVL E+P  + R T+V  LW       +LVL+EPGTP
Sbjct  895   NRHQMTSYGHIHEGLQSDLVVASYVLSELPDQESRRTLVADLWRHVKPSGMLVLLEPGTP  954

Query  1250  QGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSG  1071
              G +++ ++R  +L +   +      ++ K+C+A         +VAPCPH   CP+  + 
Sbjct  955   IGFSLVREMRQMLLDLPTDRL-----TNEKTCQAQ--------VVAPCPHSERCPMGHNS  1001

Query  1070  KYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
              +CHF QR+ER   Q+  K     S   FEDEK+SY+   +
Sbjct  1002  -WCHFSQRVERPIFQKLAK--GPKSTVSFEDEKYSYIAMSK  1039



>ref|WP_013297344.1| ribosomal small subunit Rsm22 [Thermoanaerobacterium thermosaccharolyticum]
 ref|YP_003851459.1| ribosomal small subunit Rsm22 [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL68375.1| Ribosomal small subunit Rsm22 [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=321

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/278 (34%), Positives = 143/278 (51%), Gaps = 48/278 (17%)
 Frame = -1

Query  1742  KIQSAYGDIGLRYEE-----------DEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             K+ +   DI  RY +           DE IAYV  RMPA Y A+Y VL+ V+    DF P
Sbjct  22    KLAALVSDISKRYRDKNYSDKFLNGYDETIAYVVYRMPATYGAIYTVLNHVKEVYNDFRP  81

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               +LD GAG G+A WA   +W   + ++ L+E  ++M   G+ L+          S  + 
Sbjct  82    KSLLDVGAGPGTAMWAATAIW-HDIDQITLLEKDENMINIGKKLSSN----SHYDSIKNA  136

Query  1415  QALSQNIKKS--NRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGS  1242
             + L  ++ +S    +HD+VIASY +GE+     +  ++++LW+   DIL+++EPGT  G 
Sbjct  137   KWLKIDLNRSFDAHRHDIVIASYSIGELNE-DVQSKIIKKLWESANDILIIIEPGTKIGF  195

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + I + R                      +AL +L  GA ++APCPHD  CP+ K   +C
Sbjct  196   SRIKRAR----------------------EALISL--GAHVIAPCPHDKKCPI-KDNDWC  230

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             HF  R++RT+  R  K    G L  +EDEKFSY+   +
Sbjct  231   HFSSRIQRTSLHRKVK---NGEL-PYEDEKFSYICVSK  264



>ref|WP_028338649.1| SAM-dependent methyltransferase [Bradyrhizobium elkanii]
Length=331

 Score =   152 bits (385),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 139/251 (55%), Gaps = 34/251 (14%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             +A+AY  +RMPA Y+A+   L+ +    PDF+PA++LD GAG G+A WA  E +  SL++
Sbjct  51    DALAYALARMPATYAAVVASLNALTEIRPDFAPARLLDVGAGPGTATWAAAEAF-TSLRE  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
              +L++ + +++   + L  G   L   H  S     ++ +       DLV+ASY++GE+ 
Sbjct  110   FSLLDANSALRSLAEELFHGSIRL---HDTSYELGQARALLDKAEAADLVVASYMIGEL-  165

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
             S  +R  +   LW  TGD L++VEPGTP G   I  +R+ +                   
Sbjct  166   SEAERAALADALWAKTGDTLLVVEPGTPAGYARIIALRARL-------------------  206

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  + +GA +VAPCPHDG CPL  +  +CHF QRL+R+   RA+K+  G  L  FEDE
Sbjct  207   -----IAAGAHVVAPCPHDGGCPL-VAPDWCHFSQRLQRS---RAHKQVKGAEL-PFEDE  256

Query  974   KFSYVVFRRGQ  942
             +F+YV   R +
Sbjct  257   RFAYVALSRAR  267



>ref|WP_028334783.1| SAM-dependent methyltransferase [Bradyrhizobium elkanii]
Length=321

 Score =   152 bits (384),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 137/251 (55%), Gaps = 34/251 (14%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +A+AY  +RMPA Y+A+   L+ +    PDF+PA++LD GAG G+A WA  E +  SL
Sbjct  49    ETDALAYALARMPATYAAVVACLNALTEIRPDFAPARLLDVGAGPGTATWAAAEAF-TSL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             +   L++ + ++Q   +GL  G   L   H  S     ++ +       DLV+ASY++GE
Sbjct  108   RDFTLLDANGALQTLAEGLFHGSIRL---HDISYELGQARALLGKAEPADLVVASYMIGE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +    +R  +   LW  T D L++VEPGTP G   I  +R+ +                 
Sbjct  165   LGD-AERGALADALWSKTSDTLLVVEPGTPAGYARIIALRARL-----------------  206

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    + +GA +VAPCPHDG CPL  +  +CHF QRL+R+   RA+K+  G ++  FE
Sbjct  207   -------IAAGAHVVAPCPHDGGCPL-VAPDWCHFSQRLQRS---RAHKQLKGANVP-FE  254

Query  980   DEKFSYVVFRR  948
             DE+F+YV   R
Sbjct  255   DERFAYVALSR  265



>ref|WP_026871664.1| hypothetical protein [Inquilinus limosus]
Length=326

 Score =   152 bits (383),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 98/265 (37%), Positives = 136/265 (51%), Gaps = 40/265 (15%)
 Frame = -1

Query  1703  EEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPR  1527
             ++D A+ AY+A+R+PA Y+A+   L  +  R PDF+PA +LD GAG G+A WA    WP 
Sbjct  46    DDDRAVQAYLATRLPATYAAIRACLEAITLRRPDFAPASLLDAGAGPGTALWAAAGTWP-  104

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVL  1347
              L    L+E S + +  G  LT G    P     + L      +      HDLVI SYVL
Sbjct  105   DLAAATLLEGSAAFRDRGARLTEGAALPPAEWRAADLARPLPELPA----HDLVILSYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              E+   + R  +V  LW  TGD+L++VEPGTP G   I   R  +               
Sbjct  161   DELAPDR-RGALVDGLWAATGDVLLIVEPGTPAGYRRILDARDRL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      + SG  +VAPCPHD  CPL +   +CHF QR+ R+   R ++++ GG +  
Sbjct  205   ---------IASGGHVVAPCPHDRACPLVEP-DWCHFAQRVARS---RLHRQAKGGEV-P  250

Query  986   FEDEKFSYVVFRRGQRPRETWPLNG  912
             +EDEKFSYV   R    R+  P+ G
Sbjct  251   WEDEKFSYVAVSR----RQAAPIAG  271



>ref|WP_007008136.1| methyltransferase type 11 [Nitratireductor aquibiodomus]
 gb|EIM75529.1| type 11 methyltransferase [Nitratireductor aquibiodomus RA22]
Length=319

 Score =   149 bits (377),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 148/276 (54%), Gaps = 40/276 (14%)
 Frame = -1

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
             SKR++ ++  G + +  +   A AY+A+R+PA Y+A+ + LSE   R  DF+P+++LD G
Sbjct  31    SKRYRAETRDGSLHV-GDALAAKAYLATRLPATYAAIRQCLSETAARREDFAPSRMLDVG  89

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI  1395
             AG G+A WA R  WP  L    LVE S +M+  G  L   L      H+ S    L+ +I
Sbjct  90    AGPGTALWAARAEWP-ELDTATLVETSATMRETGARLAEALPVEARWHAASVEDGLT-DI  147

Query  1394  KKSNRQHDLVIASYVLGEI-PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRS  1218
               +    DLV   YVL E+ P++++  T++ +LW LT D LV+VEPGTP G   I   R 
Sbjct  148   APA----DLVTLCYVLDELAPAVRE--TLIDRLWALTADTLVIVEPGTPAGWQRILAARD  201

Query  1217  HILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLER  1038
              ++ +                        G  I+APCPH  PCP+  +  +CHF +R+ R
Sbjct  202   RLIAL------------------------GGHILAPCPHHAPCPV-TAPDWCHFSRRVAR  236

Query  1037  TTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             +   R ++ + GG +  +EDEKFSY+   R  +P E
Sbjct  237   S---RLHRTAKGGEV-PWEDEKFSYLAVSR-HKPDE  267



>ref|WP_014102941.1| hypothetical protein [Micavibrio aeruginosavorus]
 ref|YP_004865720.1| hypothetical protein MICA_1400 [Micavibrio aeruginosavorus ARL-13]
 gb|AEP09718.1| conserved hypothetical protein [Micavibrio aeruginosavorus ARL-13]
Length=320

 Score =   149 bits (377),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (52%), Gaps = 50/293 (17%)
 Frame = -1

Query  1811  LPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRY---EEDEAIAYVASRMPAVYSALY  1641
             L   T    V D  ++V  S R++ + ++   G      +  EA+AYV +R+PA Y A  
Sbjct  14    LMAGTGLNAVRDAAEAV--STRYRREGSFAKEGANLQIRDGAEALAYVGTRLPATYGAAE  71

Query  1640  RVLSEVRRRVPD-FSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGL  1464
              VL     R+PD F+P  +LD GAG G+   A  + +  SL++V L+EP+  ++  G   
Sbjct  72    HVLG----RLPDDFTPRTMLDVGAGPGTVALAALDHF-DSLRQVTLIEPNAHLRGIGA--  124

Query  1463  TRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTG  1284
                     L+ + + +      ++   +  DLV A YVL E+ + + R  V+ +LW    
Sbjct  125   -------SLVPNGNWINGDLVGVEMPGKDFDLVTAGYVLNEL-NARARAAVIDKLWAACS  176

Query  1283  DILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCP  1104
               LV++EPGTP+GS ++  VR H+                        L+ GA+I APCP
Sbjct  177   GTLVIIEPGTPEGSAVVQGVRDHL------------------------LEKGAYIAAPCP  212

Query  1103  HDGPCPLEKSGK-YCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
               G CPL  +GK +CHF QR+ER+   R+ K   GG+L G+EDEKFSY+ F R
Sbjct  213   QMGTCPLHDAGKRWCHFSQRVERSKLHRSLK---GGAL-GYEDEKFSYIAFSR  261



>ref|WP_025029960.1| methyltransferase type 11 [Nitratireductor aquibiodomus]
Length=319

 Score =   149 bits (376),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 98/276 (36%), Positives = 148/276 (54%), Gaps = 40/276 (14%)
 Frame = -1

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
             SKR++ ++  G + +  +   A AY+A+R+PA Y+A+ + LSE   R  DF+P+++LD G
Sbjct  31    SKRYRAETRDGSLHV-GDALAAKAYLATRLPATYAAIRQCLSETAARREDFAPSRMLDVG  89

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI  1395
             AG G+A WA R  WP  L    LVE S +M+  G  L   L      H+ S    L+ +I
Sbjct  90    AGPGTALWAARAEWP-ELDTATLVETSATMRETGARLAEALPVEARWHAASVEDGLT-DI  147

Query  1394  KKSNRQHDLVIASYVLGEI-PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRS  1218
               +    DLV   YVL E+ P++++  T++ +LW LT D LV+VEPGTP G   I   R 
Sbjct  148   APA----DLVTLCYVLDELAPAVRE--TLIDRLWALTADTLVIVEPGTPAGWQRILAARD  201

Query  1217  HILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLER  1038
              ++ +                        G  I+APCPH  PCP+  +  +CHF +R+ R
Sbjct  202   RLIAL------------------------GGHILAPCPHHAPCPV-TAPDWCHFSRRVAR  236

Query  1037  TTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             +   R ++ + GG +  +EDEKFSY+   R  +P E
Sbjct  237   S---RLHRTAKGGEV-PWEDEKFSYLAVSR-HKPDE  267



>gb|EFA75703.1| hypothetical protein PPL_10756 [Polysphondylium pallidum PN500]
Length=1108

 Score =   157 bits (396),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 142/262 (54%), Gaps = 35/262 (13%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             + Y + +A+AY+A RMP VY+  +RV  EV  R+P+F P  +LD+G+G G+  W+ RE W
Sbjct  507   ITYGKGQALAYIAHRMPGVYACTHRVFQEVATRLPNFKPETMLDYGSGPGTVIWSARETW  566

Query  1532  PRSLQKVNLVEPSQSM----QRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
             P SL+ +  +EPS  M    ++  +G T G+    L+ S  + QA          Q D+V
Sbjct  567   P-SLKSIRAIEPSGFMIDTAKKMLEGSTNGIVWSQLV-SPPTTQAY---------QSDIV  615

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLT--GDILVLVEPGTPQGSNIISQVRSHILWMERRK  1191
             +ASYVL E+P    R  VV +LW       ILVLVEPGTP G ++I  +R  +L +    
Sbjct  616   VASYVLSELPDEATREKVVTELWKNVKPSGILVLVEPGTPIGFSLIRSMRQLLLDL----  671

Query  1190  CRKLKESSGKSCKALTTLKSG-AFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                         + +T  K   A +++PCPH G CP+  +  +CHF QR+ R   Q+  K
Sbjct  672   ----------PAEPVTIHKQNYAQVLSPCPHSGRCPMGHNS-WCHFSQRVVRPLFQKLAK  720

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
                  S   FEDEK+SY+V  +
Sbjct  721   --GPRSTVSFEDEKYSYIVMSK  740



>ref|XP_009494599.1| hypothetical protein H696_02422 [Fonticula alba]
 gb|KCV71476.1| hypothetical protein H696_02422 [Fonticula alba]
Length=1672

 Score =   157 bits (397),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 94/279 (34%), Positives = 141/279 (51%), Gaps = 47/279 (17%)
 Frame = -1

Query  1709  RYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW-  1533
             RY + +   Y+A+R  + Y+   RV +E+R+RVP+F+P  +LDFG G G++ WA   +W 
Sbjct  960   RYTDLQVATYLATRFSSTYNVNRRVFNEIRKRVPNFAPVSMLDFGTGPGTSIWAATHIWR  1019

Query  1532  ---PRSLQKVNLVEPSQSMQRAGQGLT--------------RGLKNLPLIHSYSSLQA--  1410
                  SL  V+ ++ S +M RA + +                G   + LI     LQ   
Sbjct  1020  STVDGSLTYVDGIDASDTMLRAARRMHPEKVAFNIIMPTGREGENAVGLIDQRRPLQLRF  1079

Query  1409  -LSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
               +  I +     DLV+ASY L E+PS + R  ++++LW+ T D LV++EPGTP G + I
Sbjct  1080  HQAHGIPERLSSADLVVASYSLSELPSFEARQYMIKRLWEHTKDTLVIIEPGTPTGFDNI  1139

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
                R  +                     +T    G  I+APCPH+  CP+  +  +CHFV
Sbjct  1140  LMARDLL---------------------ITGDLPGGHILAPCPHEAECPM-GAASWCHFV  1177

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRP  936
             QR +R    R  ++S        EDEKFSY+V RRG+RP
Sbjct  1178  QRGQRVVENREVRQSPN----TLEDEKFSYLVLRRGRRP  1212



>ref|WP_011523832.1| hypothetical protein [Candidatus Koribacter versatilis]
 ref|YP_592105.1| hypothetical protein Acid345_3030 [Candidatus Koribacter versatilis 
Ellin345]
 gb|ABF42031.1| conserved hypothetical protein [Candidatus Koribacter versatilis 
Ellin345]
Length=318

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 132/244 (54%), Gaps = 38/244 (16%)
 Frame = -1

Query  1688  IAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVN  1509
             +AY+  RMPA Y+A   V  + + ++P F+P  +LD GAG G+A WA  E++P S+QKV 
Sbjct  49    LAYLQVRMPATYAACRHVFQKTQEKMPGFAPESLLDLGAGPGTACWAAVELFP-SIQKVA  107

Query  1508  LVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKK-SNRQHDLVIASYVLGEIPS  1332
             LVE    + R G+ L +  + L       +   LS +I+  +   HDLV+ SY LGE+ +
Sbjct  108   LVERDLELLRMGKSLAQSCEPL------KNANWLSADIRAFTPDAHDLVVISYTLGELKA  161

Query  1331  LKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCK  1152
              + +  +VR  W +   +L+L+EPGTP+    ++ +R  +                    
Sbjct  162   AEAQ-RLVRAAWKV-AKLLILIEPGTPKAFARMADLRKQL--------------------  199

Query  1151  ALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEK  972
                 +  GA + APCPH+  CPL   G +CHF +RLERT   R   R  GGSL G+EDEK
Sbjct  200   ----IADGATMAAPCPHERECPLLVRGDWCHFSERLERTAEHR---RIKGGSL-GYEDEK  251

Query  971   FSYV  960
             F Y+
Sbjct  252   FCYL  255



>ref|WP_037318191.1| rRNA methyltransferase [Amycolatopsis orientalis]
Length=331

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 127/251 (51%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP SL
Sbjct  50    EVDIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDVGGGTGAAIWAAADVWP-SL  108

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             +K  +VE        G+ L       P +   +  + L      +  + DLV  SYVLGE
Sbjct  109   EKSTVVEQVAGAIALGRRLAEHAAG-PAVRGSTWQRGLIDPAAPAP-EADLVTLSYVLGE  166

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R  VVR L    G +LVL+EPGTP G   I Q R  I+ +              
Sbjct  167   LPEAR-RTDVVRWLSAKAG-MLVLIEPGTPAGYERIVQARDEIVEL--------------  210

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  211   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLK---AGTL-GFE  256

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  257   DEKFSYVVASR  267



>ref|WP_014758265.1| MULTISPECIES: Ribosomal small subunit Rsm22 [Thermoanaerobacterium]
 ref|YP_006391990.1| Ribosomal small subunit Rsm22 [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|AFK86391.1| Ribosomal small subunit Rsm22 [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|ETO38487.1| Ribosomal small subunit Rsm22 [Thermoanaerobacterium aotearoense 
SCUT27]
Length=320

 Score =   148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 154/306 (50%), Gaps = 62/306 (20%)
 Frame = -1

Query  1742  KIQSAYGDIGLRYEE---------DEAIAYVASRMPAVYSALYRVLSEVRRRV-PDFSPA  1593
             K+ S   DI  RY           +EAIAYV+ RMPA + A+Y VL +V+     D  P 
Sbjct  22    KLISLVSDISNRYRNTDEKHILSYEEAIAYVSYRMPATFEAIYTVLKDVKDICGDDLKPK  81

Query  1592  KVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSY---S  1422
              +LD GAG G+A WA   +W   L K+ L+E + +M + G+ L+    N  + +S    +
Sbjct  82    SILDVGAGPGTAIWAATSIW-NDLDKITLLERNINMIKIGKKLSANSNNRSIKNSIWMEA  140

Query  1421  SLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRI--TVVRQLWDLTGDILVLVEPGTPQ  1248
              L++LS+  K     HD+VIASY +GE   L D +   ++++LW+   D+L+++EPGT  
Sbjct  141   DLESLSELPK-----HDIVIASYSIGE---LNDDVHGEIIKKLWESANDMLIIIEPGTKI  192

Query  1247  G-SNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSG  1071
             G SNI                        ++ + L  L  GA ++APCPHD  CP++   
Sbjct  193   GFSNI-----------------------KRALEILMPL--GAHVIAPCPHDKECPID-FD  226

Query  1070  KYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETWPLNGMKFETLK  891
              +CHF  R++RT   R  K    G L  +EDEKFSY+   +        P N +K   ++
Sbjct  227   DWCHFSSRVQRTNIHRKVK---NGQL-SYEDEKFSYICVSKS-------PCNMIKSRIIR  275

Query  890   EQHARR  873
                 R+
Sbjct  276   HPQIRK  281



>ref|WP_009755668.1| methyltransferase type 11 [Nitratireductor indicus]
 gb|EKF44421.1| type 11 methyltransferase [Nitratireductor indicus C115]
Length=320

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/270 (34%), Positives = 148/270 (55%), Gaps = 38/270 (14%)
 Frame = -1

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
             S+R++ ++  G + +  ++  A AY+A+R+PA ++A+ + L EV  R   FSPA +LD G
Sbjct  31    SRRYRAETRDGRLHV-ADDLAAKAYLATRLPATFAAVRQALGEVAMRREGFSPATLLDVG  89

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI  1395
             AG G+A WA R+ W + +    +VE S +M+ AG  L +    + +    + ++    ++
Sbjct  90    AGPGTALWATRDKW-QGIASATMVEASPAMREAGIRLAQAATGIAVSWKAAKVEDGLSDL  148

Query  1394  KKSNRQHDLVIASYVLGEI-PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRS  1218
             +K+    DLV   YVL E+ P+ +D +  V +LW L  D LV+VEPGTP G   I  VR 
Sbjct  149   EKA----DLVTLCYVLDELAPAARDML--VDRLWTLASDTLVIVEPGTPAGWQRIVAVRK  202

Query  1217  HILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLER  1038
              +                        + +GA ++APCPH+ PCP+  +  +CHF +R+ R
Sbjct  203   RL------------------------IAAGAHVIAPCPHEAPCPI-AAPDWCHFSRRVAR  237

Query  1037  TTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             +   R ++ + GG +  +EDEKFSYV   R
Sbjct  238   S---RLHRTAKGGEV-PWEDEKFSYVAVSR  263



>ref|WP_006563275.1| Ribosomal small subunit Rsm22 [Oscillochloris trichoides]
 gb|EFO79586.1| Ribosomal small subunit Rsm22 [Oscillochloris trichoides DG-6]
Length=328

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/252 (37%), Positives = 128/252 (51%), Gaps = 37/252 (15%)
 Frame = -1

Query  1670  RMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQ  1491
             RMPA Y+A+   LS +  R PD+ P  +LD GAG G+A WA    W   L   +++E + 
Sbjct  63    RMPATYAAVCAALSALAARFPDWQPRSLLDVGAGLGAALWATATTW-EDLGHADMIEAAP  121

Query  1490  SMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITV  1311
             +M   G+ L     + P I S +   A        ++ HDLV A+YVLGE+P +  R  +
Sbjct  122   AMLHLGRQLAARSPH-PAI-SSAHWHAADLLGAWHSQPHDLVTATYVLGELP-VSGRARL  178

Query  1310  VRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKS  1131
             + QLW  +   L+LVEPGTPQG  II   R  +                          +
Sbjct  179   ITQLWQQSSHALLLVEPGTPQGWAIIRAAREQL------------------------RAA  214

Query  1130  GAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFR  951
             GA++VAPCPH   CPL  +  +CHF QR+ RT  QR+ K    G+  G+EDEKF+Y+   
Sbjct  215   GAYVVAPCPHQDGCPL-AADDWCHFAQRVARTKLQRSVK----GAALGYEDEKFAYIAVA  269

Query  950   RGQRPRETWPLN  915
             R    R   P+N
Sbjct  270   R----RPGLPIN  277



>ref|WP_018273382.1| hypothetical protein [Bradyrhizobium elkanii]
Length=321

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 136/253 (54%), Gaps = 34/253 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +A+AY  +RMPA Y+A+   L+ +    PDF+PA++LD GAG G+A WA  E +  SL
Sbjct  49    ETDALAYALARMPATYAAVVASLNALTEIRPDFAPARLLDVGAGPGTATWAAAEAF-TSL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             +  +L++ + +++   + L  G   L   H  S     ++ +       DLV+ASY++GE
Sbjct  108   RAFSLLDANSALRSLAEDLFHGSIRL---HDTSYELGQARALLDKAEPADLVVASYMIGE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +    +R  +   LW  T D L++VEPG P G   I  +R+ +                 
Sbjct  165   LGD-AERGALADALWSKTSDTLLVVEPGMPAGYARIIALRARL-----------------  206

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    + +GA +VAPCPHDG CPL  +  +CHF QRL+R+   RA+K+  G  L  FE
Sbjct  207   -------IAAGAHVVAPCPHDGGCPL-VAPDWCHFSQRLQRS---RAHKQVKGAELP-FE  254

Query  980   DEKFSYVVFRRGQ  942
             DE+F+YV   R +
Sbjct  255   DERFAYVALSRAR  267



>ref|WP_023711948.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESX46615.1| methyltransferase type 11 [Mesorhizobium sp. LSHC426A00]
 gb|ESX54301.1| methyltransferase type 11 [Mesorhizobium sp. LSHC424B00]
 gb|ESX72250.1| methyltransferase type 11 [Mesorhizobium sp. LSHC416B00]
Length=324

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 134/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYAQPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YVV  R   P
Sbjct  251   WEDEKFIYVVASRQPAP  267



>ref|WP_027048809.1| methyltransferase type 11 [Mesorhizobium sp. URHB0007]
Length=325

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 132/257 (51%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI        VVR LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEIAPASLPKLVVR-LWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023831142.1| methyltransferase type 11 [Mesorhizobium sp. L103C119B0]
 gb|ESZ71546.1| methyltransferase type 11 [Mesorhizobium sp. L103C119B0]
Length=324

 Score =   147 bits (370),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 94/257 (37%), Positives = 134/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YVV  R   P
Sbjct  251   WEDEKFIYVVASRQPAP  267



>ref|WP_023672718.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESW72086.1| methyltransferase type 11 [Mesorhizobium sp. LSJC285A00]
 gb|ESX12693.1| methyltransferase type 11 [Mesorhizobium sp. LSJC264A00]
 gb|ESZ47693.1| methyltransferase type 11 [Mesorhizobium sp. L103C565B0]
Length=325

 Score =   146 bits (369),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 132/257 (51%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI        VVR LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEIAPASLPKLVVR-LWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_008594811.1| methyltransferase type 11 [Nitratireductor pacificus]
 gb|EKF20077.1| type 11 methyltransferase [Nitratireductor pacificus pht-3B]
Length=321

 Score =   146 bits (368),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 89/248 (36%), Positives = 130/248 (52%), Gaps = 36/248 (15%)
 Frame = -1

Query  1691  AIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKV  1512
             A AY+A+R+PA Y+A+ R + ++  R   F+P ++LD GAG G+AFWA  + WP  L+  
Sbjct  51    AKAYLATRLPATYAAVRRAMDDLAERRASFAPQRLLDIGAGPGTAFWAALDRWP-DLRAA  109

Query  1511  NLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPS  1332
              +VE S +M++AGQ L             S    L         + DLV   YVL E+ +
Sbjct  110   EMVEASPAMRQAGQNLAASAGAALSWRDASVEDGL-----PGAGEADLVTLCYVLDEL-A  163

Query  1331  LKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCK  1152
                R  ++ +LW LTGD L++VEPGTP G   I   RS ++ +                 
Sbjct  164   PATRAALIDRLWHLTGDTLLIVEPGTPTGWQRILAARSRLIAL-----------------  206

Query  1151  ALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEK  972
                    GA +VAPCPH  PCP+     +CHF +R+ R+   R ++R+ GG +  +EDEK
Sbjct  207   -------GAHVVAPCPHHAPCPVSPP-DWCHFSRRVARS---RLHRRAKGGEV-PWEDEK  254

Query  971   FSYVVFRR  948
             FSY+   R
Sbjct  255   FSYIAVSR  262



>gb|EAR83105.2| small ribosomal subunit Rsm22 [Tetrahymena thermophila SB210]
Length=544

 Score =   150 bits (378),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 85/276 (31%), Positives = 146/276 (53%), Gaps = 38/276 (14%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
               Y ++ ++AY+  + P  +S   R+L+E+R R+P+F+P   LDFGAG GS   A ++++
Sbjct  222   FEYSQNSSVAYLLRKAPHTFSVACRILTEIRYRMPNFNPQTFLDFGAGLGSGSLAFQDIF  281

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
             P   + +   EPS++M++ G+ +T+ + NL  + + +   +L   +     + D+V  S+
Sbjct  282   P-ECKNIVACEPSKNMRKLGKHMTQDIPNLVYVENLAQTISLPYAV-----EFDIVFISH  335

Query  1352  VLGEIPSLKDRITVVRQLWDLT--GDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL  1179
             VL E+PS++ R  ++  LW+    G I++ VE GTP+G       R +IL  E +K    
Sbjct  336   VLQEVPSVEARKLIIDSLWNKVKKGGIMIFVENGTPKGFRFAHDFRRYIL--ENKKS---  390

Query  1178  KESSGKSCKALTTLKSGAFIVAPCPHDGPCPL-EKSGKYCHFVQRLERTTSQRAYKRSNG  1002
                               +IVAPCPH GPCPL  K+  +CHF Q++ +      Y +S  
Sbjct  391   ---------------DDPYIVAPCPHQGPCPLAAKADTWCHFEQKVGK------YPKSVF  429

Query  1001  GSL---RGFEDEKFSYVVFRRGQRPRETWPLNGMKF  903
               L   + F++EKF ++V ++G +  E    N   F
Sbjct  430   SKLPTEKQFDNEKFCFMVIQKGVKQEERDEDNSQTF  465



>ref|WP_021076035.1| serine O-acetyltransferase [Bradyrhizobium sp. DFCI-1]
 gb|ERF86372.1| serine O-acetyltransferase [Bradyrhizobium sp. DFCI-1]
Length=335

 Score =   146 bits (368),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 138/261 (53%), Gaps = 34/261 (13%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GAG G+A WA 
Sbjct  41    GGSGTIRTETDALAYAVARMPATYAAVVASLNALTEIRPDFAPTSLLDVGAGPGTASWAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              E +P SL +  L++ +++++     LTR    L  I +Y   QA  +         DLV
Sbjct  101   AEAFP-SLHEFTLLDANEALRTLALDLTRRSDRLRRI-TYELGQA--RVYAAHAEAADLV  156

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             IASY++ E+    +R  +   +W+ T D L++VEPGTP G   I  +R+ +         
Sbjct  157   IASYIINELGD-AERNALTDVMWEQTKDTLLVVEPGTPAGYARIIALRARL---------  206

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            + +GA ++APCPHDG CPL  +  +CHF QRL+R+   RA+K+  
Sbjct  207   ---------------IAAGAHVIAPCPHDGDCPL-VAPDWCHFSQRLQRS---RAHKQVK  247

Query  1004  GGSLRGFEDEKFSYVVFRRGQ  942
             G     FEDE+F+YV   R +
Sbjct  248   GADA-PFEDERFAYVALSRAR  267



>ref|WP_027581283.1| SAM-dependent methyltransferase [Bradyrhizobium sp. Ai1a-2]
Length=322

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/263 (35%), Positives = 139/263 (53%), Gaps = 36/263 (14%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G  G    E +A+AYV +RMPA Y+A+   L+      PDF+P+ +LD GAG G+A WA 
Sbjct  41    GGSGTIKSETDALAYVLARMPATYAAIVASLNAFVEIRPDFAPSSLLDIGAGPGTASWAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              + +P SLQ+  L++ + ++    + L   L    L  +   L   ++ +       DLV
Sbjct  101   AQTFP-SLQRFVLLDANATL----RALALELAGTRLRDARYELGP-ARKLLADAEPADLV  154

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             +ASY++GEI    +R  +   +W+ TG++LV+VEPGTP G   I  +R+ +         
Sbjct  155   VASYMVGEIDE-AERTALAGLMWEKTGEVLVIVEPGTPAGYARIIALRAQL---------  204

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            + +GA +VAPCPHD  CPLE +  +CHF QRL R+   RA+ +  
Sbjct  205   ---------------IAAGAHVVAPCPHDEECPLE-APDWCHFSQRLSRS---RAHMQVK  245

Query  1004  GGSLRGFEDEKFSYVVFRRGQRP  936
             G  +  FEDE+F+YV   R   P
Sbjct  246   GAEVP-FEDERFAYVALTRTPAP  267



>ref|WP_023715067.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESX59625.1| methyltransferase type 11 [Mesorhizobium sp. LSHC422A00]
 gb|ESY54265.1| methyltransferase type 11 [Mesorhizobium sp. LNJC374B00]
 gb|ESY59405.1| methyltransferase type 11 [Mesorhizobium sp. LNJC372A00]
Length=325

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023738601.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESY12298.1| methyltransferase type 11 [Mesorhizobium sp. LNJC398B00]
 gb|ESY30183.1| methyltransferase type 11 [Mesorhizobium sp. LNJC386A00]
Length=325

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_016839703.1| hypothetical protein [Bradyrhizobium elkanii]
Length=324

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/255 (35%), Positives = 136/255 (53%), Gaps = 35/255 (14%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWP--R  1527
             E +A+AY  +RMPA Y+A+   L+ +    PDF+PA++LD GAG G+A WA  E +   +
Sbjct  49    ETDALAYALARMPATYAAVVASLNALTEIRPDFAPARLLDVGAGPGTATWAAAEAFTKKK  108

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVL  1347
              L+  +L++ + +++   + L  G   L   H  S     ++ +       DLV+ASY++
Sbjct  109   KLRAFSLLDANSALRSLAEDLFHGSIRL---HDTSYELGQARALLDKAEPADLVVASYMI  165

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
             GE+    +R  +   LW  T D L++VEPG P G   I  +R+ +               
Sbjct  166   GELGD-AERGALADALWSKTSDTLLVVEPGMPAGYARIIALRARL---------------  209

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      + +GA +VAPCPHDG CPL  +  +CHF QRL+R+   RA+K+  G  L  
Sbjct  210   ---------IAAGAHVVAPCPHDGGCPL-VAPDWCHFSQRLQRS---RAHKQVKGAEL-P  255

Query  986   FEDEKFSYVVFRRGQ  942
             FEDE+F+YV   R +
Sbjct  256   FEDERFAYVALSRAR  270



>ref|WP_023727354.1| methyltransferase type 11 [Mesorhizobium sp. LSHC412B00]
 gb|ESX84543.1| methyltransferase type 11 [Mesorhizobium sp. LSHC412B00]
Length=325

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_028134864.1| SAM-dependent methyltransferase [Bradyrhizobium japonicum]
Length=325

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 132/268 (49%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  32    KISTAYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALSEIAPDFAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L RG   L        L   +    
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARGSSRL---AECRHLPGDAGGNL  147

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
                 Q DLVIASY++GE+    D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  148   AEVSQADLVIASYIIGEL-GEADQRKLAEAMWAKARQALVVIEPGTPAGYGRILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IAAGAYVAAPCPHERPCPL-IAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  242   AHRQIK----GAEVPFEDERFIYVALTR  265



>ref|WP_023805668.1| methyltransferase type 11 [Mesorhizobium sp. L2C089B000]
 gb|ESZ06119.1| methyltransferase type 11 [Mesorhizobium sp. L2C089B000]
Length=325

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023731143.1| methyltransferase type 11 [Mesorhizobium sp. LNJC405B00]
 gb|ESX92439.1| methyltransferase type 11 [Mesorhizobium sp. LNJC405B00]
Length=325

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWPH-  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023733856.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESX91933.1| methyltransferase type 11 [Mesorhizobium sp. LNJC403B00]
 gb|ESY29351.1| methyltransferase type 11 [Mesorhizobium sp. LNJC391B00]
 gb|ESY45561.1| methyltransferase type 11 [Mesorhizobium sp. LNJC380A00]
 gb|ESZ60598.1| methyltransferase type 11 [Mesorhizobium sp. L103C120A0]
Length=325

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>gb|EPB84449.1| hypothetical protein HMPREF1544_08813 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=465

 Score =   148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 172/346 (50%), Gaps = 50/346 (14%)
 Frame = -1

Query  1943  CRVVPLRLRRAIKKYIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKS  1764
             C  +P  L + I + I+ Q+   ++   LRL ++ R    +   +P    KE  ED    
Sbjct  71    CVELPKPLVQGITELIEGQDKRLIRTDALRLYDALR----STARIP----KESNED-FDG  121

Query  1763  VECSKRWKIQSAYGDI---GLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPA  1593
                +K+ +  SA   +    L Y   E++AY A  +P+ ++A+  V+ E+  R+ DF P 
Sbjct  122   SRKAKKLRNSSAKALVEPHKLSYGPRESVAYAAGVLPSTFAAITNVMHEIFSRMIDFKPR  181

Query  1592  KVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQ  1413
              +LDFG G G+A WA +E++   L     V+ S+ M R  + L   +K+     S ++++
Sbjct  182   SMLDFGTGPGTAIWAAKEIF--KLDTCVGVDLSEDMLRVAEHLEESVKS----ESDAAIE  235

Query  1412  ALSQ-NIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNI  1236
                         + DLV++++ LG+I S   + + + QLW+ TGD+LVL++ GTP G + 
Sbjct  236   FKRYLGFDPKAPKTDLVVSAFTLGDIASAALQKSTIEQLWEQTGDVLVLIDRGTPIGFSN  295

Query  1235  ISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGK----  1068
             I++ R  IL +E                      + A +VAPC HD PCPL  S +    
Sbjct  296   IARARQWILDLE---------------------GANAHVVAPCSHDRPCPLLFSPQAKPD  334

Query  1067  --YCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRP  936
               +CHF QR++R T     K S   +    ED K+SYVV RRG RP
Sbjct  335   DIWCHFSQRVQRPTFLMKTKHSKFNT----EDSKYSYVVLRRGSRP  376



>ref|WP_023695601.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESX14031.1| methyltransferase type 11 [Mesorhizobium sp. LSJC265A00]
 gb|ESZ74386.1| methyltransferase type 11 [Mesorhizobium sp. L103C105A0]
Length=321

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>gb|EJN13843.1| ribosomal methyltransferase Rsm22 [Bradyrhizobium sp. YR681]
Length=325

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 138/268 (51%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    P+ +P  +LD GA
Sbjct  35    KISTAYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPNLAPETLLDVGA  94

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  95    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALDLARDSTRLAECR-YLPGDA-GGNLA  151

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             +++ Q DLV+ASY++GE+ +  D+  +   +W      L+++EPGTP G   I  +R H+
Sbjct  152   EAS-QADLVVASYIIGEL-NEGDQRKLAETMWAKARHALLVIEPGTPAGYARILALRQHL  209

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GAF+VAPCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  210   ------------------------IAAGAFVVAPCPHEKPCPL-TAPDWCHFSQRLPRSQ  244

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  245   AHRQIK----GADVPFEDERFIYVALTR  268



>ref|WP_038386043.1| SAM-dependent methyltransferase [Bradyrhizobium elkanii]
Length=331

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/253 (35%), Positives = 135/253 (53%), Gaps = 34/253 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +A+AY  +RMPA Y+A+   L+ +    PDF+P ++LD GAG G+A WA  E +  SL
Sbjct  49    ETDALAYALARMPATYAAVAASLNALTEIRPDFAPVRLLDVGAGPGTATWAAAEAF-TSL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             +   L++ + +++   + L  G   L   H        ++ +       DLV+ASY++GE
Sbjct  108   RDFTLLDANGALRTLAEELFHGSIRL---HDTRYELGQARALLDKAEAADLVVASYMIGE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +    +R  +   LW  TGD L++VEPGTP G   I  +R+ +                 
Sbjct  165   LGD-TERGALADALWAKTGDTLLVVEPGTPAGYARIIALRARL-----------------  206

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    + +GA +VAPCPHDG CPL  +  +CHF QRL+R+   RA+K+  G  +  FE
Sbjct  207   -------IAAGAHVVAPCPHDGGCPL-VAPDWCHFSQRLQRS---RAHKQVKGADVP-FE  254

Query  980   DEKFSYVVFRRGQ  942
             DE+F+YV   R +
Sbjct  255   DERFAYVALSRAR  267



>ref|WP_035965373.1| SAM-dependent methyltransferase [Bradyrhizobium sp. YR681]
Length=323

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 138/268 (51%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    P+ +P  +LD GA
Sbjct  33    KISTAYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPNLAPETLLDVGA  92

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  93    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALDLARDSTRLAECR-YLPGDA-GGNLA  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             +++ Q DLV+ASY++GE+ +  D+  +   +W      L+++EPGTP G   I  +R H+
Sbjct  150   EAS-QADLVVASYIIGEL-NEGDQRKLAETMWAKARHALLVIEPGTPAGYARILALRQHL  207

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GAF+VAPCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  208   ------------------------IAAGAFVVAPCPHEKPCPL-TAPDWCHFSQRLPRSQ  242

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  243   AHRQIK----GADVPFEDERFIYVALTR  266



>ref|WP_023689116.1| methyltransferase type 11 [Mesorhizobium sp. LSJC269B00]
 gb|ESW86019.1| methyltransferase type 11 [Mesorhizobium sp. LSJC269B00]
Length=325

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 132/257 (51%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L+ VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLTVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023693971.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESW99240.1| methyltransferase type 11 [Mesorhizobium sp. LSJC268A00]
 gb|ESZ12830.1| methyltransferase type 11 [Mesorhizobium sp. L2C085B000]
 gb|ESZ49064.1| methyltransferase type 11 [Mesorhizobium sp. L2C054A000]
Length=325

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  L+E S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLLEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023685683.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESW63361.1| methyltransferase type 11 [Mesorhizobium sp. LSJC277A00]
 gb|ESY05830.1| methyltransferase type 11 [Mesorhizobium sp. LNJC399B00]
Length=325

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 132/257 (51%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I   R  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAARRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQPAP  267



>ref|WP_023742311.1| methyltransferase type 11 [Mesorhizobium sp. LNJC395A00]
 gb|ESY16496.1| methyltransferase type 11 [Mesorhizobium sp. LNJC395A00]
Length=325

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 132/257 (51%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L         I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLAHH-----TIAARMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRLHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQAAP  267



>ref|WP_011315812.1| hypothetical protein [Nitrobacter winogradskyi]
 ref|YP_319214.1| hypothetical protein Nwi_2609 [Nitrobacter winogradskyi Nb-255]
 gb|ABA05862.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
Length=348

 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 100/288 (35%), Positives = 144/288 (50%), Gaps = 53/288 (18%)
 Frame = -1

Query  1736  QSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSA  1557
             +S  G   +R E D A+AY  +RMPA Y+A+   L+ +R   P F+P  +LD GAG G+A
Sbjct  38    RSGGGSNTIRNESD-ALAYALARMPATYAAVVASLNALRETRPKFTPLSLLDIGAGPGTA  96

Query  1556  FWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ  1377
              WA  + +  SL   + ++ + +++     L R   +L L     + +  S  ++ +   
Sbjct  97    TWAAAQAF-ESLDAFSAIDSNPALRSLALDLVR--DDLRLAGLRYAQREASAGLRDAPES  153

Query  1376  HDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMER  1197
              DLVIASYVLGE+  ++ +  +   +W  T D LV+VEPGTP G   I  +R  +     
Sbjct  154   ADLVIASYVLGEM-RMERQAALAELMWAATRDTLVVVEPGTPAGYQRILGLRRQL-----  207

Query  1196  RKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPL----EKSG--------------  1071
                                +  GA ++APCPHDG CPL    +++G              
Sbjct  208   -------------------IAQGAHVIAPCPHDGECPLAAFPDETGAASPRGNASRQNAT  248

Query  1070  -KYCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRG-QRPR  933
               +CHFVQRL R+   RA+K   G  L  FEDEKFSYVV  R   RPR
Sbjct  249   PDWCHFVQRLPRS---RAHKHIKGAEL-PFEDEKFSYVVLARTPDRPR  292



>ref|XP_002787836.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER19632.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=484

 Score =   146 bits (368),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 100/338 (30%), Positives = 169/338 (50%), Gaps = 52/338 (15%)
 Frame = -1

Query  1901  YIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYG  1722
             ++ E+E+   K ++ R+++  +H +E    +P       + DP +S E S+  ++  A+ 
Sbjct  57    FLPEKEEDKEKSRLDRITKG-QHFQELKHTMPE------LFDPERSQEISELQRLSIAHA  109

Query  1721  DIGLR------YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGS  1560
             +          Y  + A+AY+A R P  Y+  +RVL EV +R PDF P  +LD+G+G   
Sbjct  110   EDSRHRLYQQFYSPEAAVAYLAHRFPPAYAVNFRVLHEVMKRCPDFKPTSILDYGSGPAP  169

Query  1559  AFWAMREVW-PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSS-LQALSQNIKKS  1386
             +  A  +VW  R +++V  VEPS  M++ G+          ++  YS+ ++  SQ     
Sbjct  170   SVCAAADVWGQRLIKRVICVEPSLHMKQMGKY---------ILSDYSANVEWSSQLYDGK  220

Query  1385  NRQHDLVIASYVLGEIPSLKDRITVVRQLWDL--TGDILVLVEPGTPQGSNIISQVRSHI  1212
             N++  ++  SYVL  +   + R  ++R LW+    G +LV++E GTP G   I  +R   
Sbjct  221   NQRQSIITVSYVLMHLKGQEARDLLIRNLWNRLEDGGVLVVIEAGTPTGFRFIHHIRELF  280

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAF-IVAPCPHDGPCPLEKSGK-YCHFVQRLER  1038
                                  +  L + AF  VAPCPH+  CPL  +G+ +CHF Q ++R
Sbjct  281   ---------------------IMQLPNKAFHFVAPCPHESMCPLATTGRDWCHFHQGVKR  319

Query  1037  TTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETW  924
                   Y  + G   R  E EKFS++V R+G+ PR+ +
Sbjct  320   LPH---YVYNKGSQARHVEWEKFSFLVVRKGEGPRQKY  354



>ref|WP_029083726.1| SAM-dependent methyltransferase [Bradyrhizobium sp. th.b2]
Length=322

 Score =   143 bits (360),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 94/259 (36%), Positives = 133/259 (51%), Gaps = 34/259 (13%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G  G    E +A AY  +RMPA Y+A+   L+ +     DF+P  +LD GAG G+A WA 
Sbjct  42    GSGGTIKSESDAQAYALARMPATYAAVVASLNALTEIRSDFAPTSLLDVGAGPGTASWAA  101

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              E +P SLQ   L++ +++++     LTR    L  +  Y   QA +          DLV
Sbjct  102   AETFP-SLQDFALLDANEALRTLALDLTRKSSRLRGVR-YELGQARTYVTHADT--ADLV  157

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             IASYV+ EI    +R  +   +WD T D L++VEPGTP G   I  +R+ +         
Sbjct  158   IASYVINEIGD-AERAALTDAMWDKTRDTLLVVEPGTPAGYARIIALRARL---------  207

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            + +GA + APC HDG CPL  +  +CHF QRL+R+   RA+K+  
Sbjct  208   ---------------IAAGAHVAAPCAHDGACPL-VAPDWCHFSQRLQRS---RAHKQVK  248

Query  1004  GGSLRGFEDEKFSYVVFRR  948
             G  L  FEDE+F+YV   R
Sbjct  249   GAELP-FEDERFAYVALSR  266



>ref|WP_024508263.1| SAM-dependent methyltransferase [Bradyrhizobium sp. ARR65]
Length=325

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 132/259 (51%), Gaps = 34/259 (13%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G  G    E +A+AY  +RMPA Y+A+   L+ +    PDFSP  +LD GAG G+  +A 
Sbjct  41    GGSGTIRTEADALAYALARMPATYAAVVASLNALSEIRPDFSPRTLLDIGAGPGTGSFAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              EV+  SL++  L++ +++++     L R     P ++ ++   + ++         DLV
Sbjct  101   AEVFA-SLERFVLLDRNETLRALALELAR---QFPRLNEWTYSSSDARTGLTQTDVADLV  156

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             IASYV+GE+ S  DR  + R +W  T D L++VEPGTP G   I   R  +         
Sbjct  157   IASYVIGEL-SDADRNELTRLMWSKTTDTLLIVEPGTPAGYARIIGARQQL---------  206

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            +  GA + APCPHD  CPL     +CHF QRL R+   RA+K   
Sbjct  207   ---------------IARGAHVAAPCPHDSACPLTPP-DWCHFAQRLARS---RAHKEVK  247

Query  1004  GGSLRGFEDEKFSYVVFRR  948
             G  L  FEDEKFSYV   R
Sbjct  248   GAEL-PFEDEKFSYVAVTR  265



>ref|XP_002786781.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER18577.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=654

 Score =   147 bits (371),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 101/338 (30%), Positives = 169/338 (50%), Gaps = 52/338 (15%)
 Frame = -1

Query  1901  YIKEQEDPHMKRKVLRLSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYG  1722
             ++ E+E+   K ++ R+++  +H +E    +P       + DP KS E S+  ++  A+ 
Sbjct  227   FLPEKEEDKEKSRLDRITKG-QHFQELKHTMPE------LFDPEKSQEISELQRLSIAHA  279

Query  1721  DIGLR------YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGS  1560
             +          Y  + A+AY+A R P  Y+  +RVL EV +R PDF P  +LD+G+G   
Sbjct  280   EDSRHRLYQQFYSPEAAVAYLAHRFPPAYAVNFRVLHEVMKRCPDFKPTSILDYGSGPAP  339

Query  1559  AFWAMREVW-PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSS-LQALSQNIKKS  1386
             +  A  +VW  R +++V  VEPS  M++ G+          ++  YS+ ++  SQ     
Sbjct  340   SVCAAADVWGQRLIKRVVCVEPSLHMKQMGKY---------ILSDYSANVEWSSQLYDGK  390

Query  1385  NRQHDLVIASYVLGEIPSLKDRITVVRQLWDL--TGDILVLVEPGTPQGSNIISQVRSHI  1212
             N++  ++  SYVL  +   + R  ++R LW+    G +LV++E GTP G   I  +R   
Sbjct  391   NQRQSIITVSYVLMHLKGQEARDLLIRNLWNRLEDGGVLVVIEAGTPTGFRFIHHIRELF  450

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAF-IVAPCPHDGPCPLEKSGK-YCHFVQRLER  1038
                                  +  L + AF  VAPCPH+  CPL  +G+ +CHF Q ++R
Sbjct  451   ---------------------IMQLPNKAFHFVAPCPHESMCPLATTGRDWCHFHQGVKR  489

Query  1037  TTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRETW  924
                   Y  + G   R  E EKFS++V R+G+ PR+ +
Sbjct  490   LPH---YVYNKGSQARHVEWEKFSFLVVRKGEGPRQKY  524



>ref|WP_028158226.1| SAM-dependent methyltransferase [Bradyrhizobium japonicum]
 gb|KGT73859.1| SAM-dependent methyltransferase [Bradyrhizobium japonicum]
Length=325

 Score =   142 bits (358),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 135/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    PD +P  +LD GA
Sbjct  32    KISTAYRAGGTSGTIKSEADALAYALARMPATYAAVAASLNALTETAPDLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARDSTRLADCR-YLPGDA-GANLA  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLV+ASYV+GE+ S  D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  149   EVS-QADLVVASYVIGEL-SETDQRKLAETMWAKARHALVVIEPGTPAGYARILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
             + +                        GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   IAL------------------------GAYVAAPCPHEKPCPL-TAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F Y+   R
Sbjct  242   AHRQIK----GADVPFEDERFIYIALTR  265



>gb|ETI38572.1| hypothetical protein F443_15726 [Phytophthora parasitica P1569]
 gb|ETK78776.1| hypothetical protein L915_15269 [Phytophthora parasitica]
 gb|ETL85462.1| hypothetical protein L917_14989 [Phytophthora parasitica]
 gb|ETP08479.1| hypothetical protein F441_15546 [Phytophthora parasitica CJ01A1]
Length=452

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 142/284 (50%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF+P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAFEMEATYACTHAVFTELQKRLPDFNP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFGAG G+A W  ++ + +SL K  +VEPSQSM  A + L  G   L +     S+
Sbjct  178   KSVLDFGAGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVLLEGFPGLSM---RRSI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DL++ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   ADLSRDIDAGNK-YDLIVVSYVFSDITNDFERVATTSALWELLSENGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L                S       K G  I+APCPH   CP+  S  +C
Sbjct  294   HHVRSARQFVL---------------DSVAEDEDSKEGVRILAPCPHHDECPVGGS-TWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R    +      G +  KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPR---EATTKRWHGQKGSKFSYMIMQKTRKGSE  378



>gb|ETL32239.1| hypothetical protein L916_15159 [Phytophthora parasitica]
Length=452

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 142/284 (50%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF+P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAFEMEATYACTHAVFTELQKRLPDFNP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFGAG G+A W  ++ + +SL K  +VEPSQSM  A + L  G   L +     S+
Sbjct  178   KSVLDFGAGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVLLEGFPGLSM---RRSI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DL++ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   ADLSRDIDAGNK-YDLIVVSYVFSDITNDFERVATTSALWELLSENGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L                S       K G  I+APCPH   CP+  S  +C
Sbjct  294   HHVRSARQFVL---------------DSVAEDEDSKEGVRILAPCPHHDECPVGGS-TWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R    +      G +  KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPR---EATTKRWHGQKGSKFSYMIMQKTRKGSE  378



>emb|CEG70544.1| hypothetical protein RMATCC62417_06421 [Rhizopus microsporus]
Length=440

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 91/265 (34%), Positives = 137/265 (52%), Gaps = 38/265 (14%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             L Y   E++AY AS M   Y+A+Y VL E++ RV  FSP  +LDFG G G+A WA ++++
Sbjct  124   LTYGPRESVAYTASVMSGNYAAIYNVLKELKSRVSSFSPNSMLDFGTGPGTAIWAAKQLF  183

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
                ++    V+ S+ M    + L + +K      S    + LS N   +  + DLVI+++
Sbjct  184   --DVEAYTAVDLSEDMLNVAEQLEKSVKT-DKCQSIEFKRYLSYN--PTAPKTDLVISAF  238

Query  1352  VLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
              LG+I S   + + V QLW  TGDILVL++ GTP G   I++ R  IL            
Sbjct  239   TLGDITSEALQKSTVEQLWSQTGDILVLMDRGTPVGFQNIAKARQWIL------------  286

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGK------YCHFVQRLERTTSQRAYKR  1011
                         +  A +VAPC HD PCP+  S +      +CH+ QR++R +     K 
Sbjct  287   -----------DEQDAHVVAPCSHDKPCPMLFSAESKPNQMWCHYSQRVQRPSFLMKTKH  335

Query  1010  SNGGSLRGFEDEKFSYVVFRRGQRP  936
             +        ED K+SYV+ R+G+RP
Sbjct  336   AKN----NIEDIKYSYVILRKGKRP  356



>ref|WP_018454932.1| ribosomal methyltransferase Rsm22 [Bradyrhizobium sp. WSM4349]
Length=326

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 137/275 (50%), Gaps = 39/275 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PD  P  +LD GA
Sbjct  33    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEVAPDLGPETLLDVGA  92

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  93    GPGTASWAAAEAFP-SLQSFTLLDANATLSRLALELARDSTRLANCR-YLPGDA-GANLA  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLV+ASYV+GE+ S  D+  +   +W     +LV++EPGTP G   I  +R  +
Sbjct  150   EVS-QADLVVASYVIGEL-SEGDQRKLAEAMWAKARHVLVVIEPGTPAGYARILTLRQQL  207

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  208   ------------------------IAAGAYVAAPCPHEKPCPL-TAPDWCHFSQRLPRSQ  242

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRET  927
             + R  K    G+   FEDE+F YV   R  RP  T
Sbjct  243   AHRQIK----GAEVPFEDERFIYVALTR--RPPAT  271



>emb|CEJ04110.1| hypothetical protein RMCBS344292_18078 [Rhizopus microsporus]
Length=440

 Score =   144 bits (362),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 137/265 (52%), Gaps = 38/265 (14%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             L Y   E++AY AS M   Y+A+Y VL E++ RV  FSP  +LDFG G G+A WA ++++
Sbjct  124   LTYGPRESVAYTASVMSGNYAAIYNVLKELKSRVSSFSPNSMLDFGTGPGTAIWAAKQLF  183

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
                ++    V+ S+ M    + L + +K      S    + LS N   +  + DLVI+++
Sbjct  184   --DVEAYTAVDLSEDMLNVAEQLEKSVKT-DKCQSIEFKRYLSYN--PTAPKTDLVISAF  238

Query  1352  VLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
              LG+I S   + + V QLW  TGDILVL++ GTP G   I++ R  IL            
Sbjct  239   TLGDITSEALQKSTVEQLWSQTGDILVLMDRGTPVGFQNIAKARQWIL------------  286

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGK------YCHFVQRLERTTSQRAYKR  1011
                         +  A ++APC HD PCP+  S +      +CH+ QR++R +     K 
Sbjct  287   -----------NEQDAHVIAPCSHDKPCPMLFSAESKPNQMWCHYSQRVQRPSFLMKTKH  335

Query  1010  SNGGSLRGFEDEKFSYVVFRRGQRP  936
             +        ED K+SYV+ R+G+RP
Sbjct  336   AKN----NIEDIKYSYVILRKGKRP  356



>ref|WP_028150715.1| SAM-dependent methyltransferase [Bradyrhizobium japonicum]
Length=326

 Score =   141 bits (356),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/275 (34%), Positives = 135/275 (49%), Gaps = 51/275 (19%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  33    KISTTYRAGGTSGTIKSEADALAYALARMPATYAAVAASLNALTEMAPDFAPETLLDVGA  92

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL-----  1407
             G G+A WA  E +P SLQ   L++ + ++ R           L L H  + L        
Sbjct  93    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLA---------LELAHDSTRLADCRYLPG  142

Query  1406  --SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
                 N+ + + Q DLV+ASYV+GE+ S  D+  +   +W      LV++EPGTP G   I
Sbjct  143   DAGANLAEVS-QADLVVASYVVGEL-SETDQRKLAETMWAKARHALVVIEPGTPAGYARI  200

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
               +R  ++ +                        GA++ APCPH+ PCPL  +  +CHF 
Sbjct  201   LALRQQLIAL------------------------GAYVAAPCPHEKPCPL-TAPDWCHFS  235

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             QRL R+ + R  K    G+   FEDE+F YV   R
Sbjct  236   QRLPRSQAHRQIK----GAEVPFEDERFIYVALTR  266



>ref|XP_008895281.1| hypothetical protein PPTG_04748 [Phytophthora parasitica INRA-310]
 gb|ETM38606.1| hypothetical protein L914_15123 [Phytophthora parasitica]
 gb|ETN19430.1| hypothetical protein PPTG_04748 [Phytophthora parasitica INRA-310]
 gb|ETP36521.1| hypothetical protein F442_15560 [Phytophthora parasitica P10297]
Length=452

 Score =   144 bits (362),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 90/284 (32%), Positives = 142/284 (50%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF+P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAFEMEATYACTHAVFTELQKRLPDFNP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFGAG G+A W  ++ + +SL K  +VEPSQSM  A + L  G   L +     S+
Sbjct  178   KSVLDFGAGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVLLEGFPGLSM---RRSI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DL++ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   ADLSRDIDAGNK-YDLIVVSYVFSDIINDFERVATTSALWELLSENGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L                S       K G  I+APCPH   CP+  S  +C
Sbjct  294   HHVRSARQFVL---------------DSVAEDEDSKEGVRILAPCPHHDECPVGGS-TWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R    +      G +  KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPR---EATTKRWHGQKGSKFSYMIMQKTRKGSE  378



>ref|WP_027516415.1| SAM-dependent methyltransferase [Bradyrhizobium sp. WSM1417]
Length=325

 Score =   141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 135/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +   VPD +P  +LD GA
Sbjct  32    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIVPDLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +  SLQ   L++ + ++ R    L R    L   H Y    A   N+ 
Sbjct  92    GPGTASWAAAEAF-SSLQGFTLLDANATLSRLALELARDSTRLTDCH-YLPGDA-GANLA  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLV+ASYV+GE+ S  D+      +W      LV++EPGTP G   I  +R  +
Sbjct  149   EVS-QADLVVASYVIGEL-SEGDQRKFAEAMWAKARHALVVIEPGTPAGYARIIALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IAAGAYVAAPCPHEKPCPL-TAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K   GG +  FEDE+F YV   R
Sbjct  242   AHRQIK---GGEVP-FEDERFIYVALTR  265



>gb|EIE89802.1| hypothetical protein RO3G_14513 [Rhizopus delemar RA 99-880]
Length=441

 Score =   143 bits (361),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 135/262 (52%), Gaps = 44/262 (17%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E++AY A  M + Y+A+Y VLSEVR R+ DF P  +LDFG G G+A WA +E++   ++ 
Sbjct  128   ESVAYAAGVMSSNYAAIYNVLSEVRERISDFKPTSMLDFGTGPGTAIWATKELF--KIES  185

Query  1514  VNLVEPSQSMQRAGQGLTRGLK---NLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLG  1344
                ++ S+ M    + L +  K   + P+   +      +    KS    +LVI+++ LG
Sbjct  186   CTGIDLSEDMLNVAEQLEQSTKPEADKPI--EFKRYLTYNPTAPKS----ELVISAFTLG  239

Query  1343  EIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSG  1164
             +I S   + + V QLW  TGDIL+L++ GTP G   I++ R  IL              G
Sbjct  240   DIASEALQKSAVEQLWAQTGDILILMDRGTPTGFTNIAKARQWIL-------------EG  286

Query  1163  KSCKALTTLKSGAFIVAPCPHDGPCPL------EKSGKYCHFVQRLERTTSQRAYKRSNG  1002
             K             +VAPC HD PCP+      + +  +CH+ QR++R       K S  
Sbjct  287   KE----------GHVVAPCSHDKPCPMLFSPEAKPNSMWCHYSQRVQRPPFLMKTKHSKM  336

Query  1001  GSLRGFEDEKFSYVVFRRGQRP  936
              +    ED K+SYVVFR+G RP
Sbjct  337   NT----EDAKYSYVVFRKGPRP  354



>ref|XP_002905473.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY68314.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=452

 Score =   143 bits (361),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 144/284 (51%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAYEMEATYACTHAVFTELQKRLPDFKP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFG+G G+A W  ++ + +SL K  +VEPSQSM  A + +  G   L +     ++
Sbjct  178   KSVLDFGSGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVVLEGFPGLSM---RRNI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DLV+ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   TDLSRDIDAGNK-YDLVVVSYVFSDITNDFERVATTSALWELLSEDGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L +        K+++G         K G  IVAPCPH   CP+     +C
Sbjct  294   HHVRSARQFVLDL------VAKDANG---------KEGVRIVAPCPHHDECPV-GGNTWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R          +G    KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPREVTTKRWHGQKG---SKFSYMIMQKTRKGSE  378



>ref|WP_035699865.1| SAM-dependent methyltransferase [Bradyrhizobium sp. CCBAU 43298]
Length=325

 Score =   140 bits (354),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 135/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    P  +P  +LD GA
Sbjct  32    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPSLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L RG   L     Y    A   N+ 
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALDLARGSSRLAECR-YLPGDA-GGNLA  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLV+ASYV+GE+ S  D+  ++  +W      LV++EPGTP G   I  +R  +
Sbjct  149   EVS-QADLVVASYVIGEL-SEADQRKLIDAMWAKARHALVVIEPGTPAGYARIIALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IAAGAYVAAPCPHEKPCPL-VAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  242   AHRQIK----GAEVPFEDERFIYVALTR  265



>ref|XP_003890042.1| hypothetical protein, variant [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 ref|XP_003325263.2| hypothetical protein PGTG_07096 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EHS62959.1| hypothetical protein, variant [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP80844.2| hypothetical protein PGTG_07096 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=607

 Score =   145 bits (365),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/361 (28%), Positives = 165/361 (46%), Gaps = 81/361 (22%)
 Frame = -1

Query  1820  NLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALY  1641
             N L+ T  S++  ED  K V+     K+++ Y  +        +I++ A  MP+ Y A  
Sbjct  139   NDLMDTFFSEKTTEDGKKFVKP----KLRTTYDHL-------TSISFAAGAMPSAYGATL  187

Query  1640  RVLSEVRRRV----------PDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQ  1491
             +VL E++RR+           +++P  ++D+G+GTGSA WA  EVWP SL++   ++ S 
Sbjct  188   KVLLELKRRLNSDRIRRSLESEWTPKTLVDYGSGTGSALWAALEVWPDSLKEYTGLDKSS  247

Query  1490  SMQRAGQGLTRGLKNLPLI-HSYSSLQALSQNIKKSNRQHD-------------------  1371
             SM    + L +   N P +    S L+A  + I  S  Q +                   
Sbjct  248   SMIWLNETLLKKRSNRPFLGQEASDLKASFRRITISPTQAERLKHATTTSTDWLNQIEKE  307

Query  1370  -------------------------LVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLV  1266
                                      L I S+ L ++P+   R   +  +W+   + +V++
Sbjct  308   EAKEKRPEIELEPSKFDWTGDSDGLLAIMSFTLSDLPNQAARREAIEGMWNSGAETMVII  367

Query  1265  EPGTPQGSNIISQVRSHILWMERRKCRK--------LKESSGKSCKALTTLKSGAFIVAP  1110
             + GTP G  +++  R  +L + RR+ R+        +   + +      +   G++++AP
Sbjct  368   DRGTPAGFQVVADARQQLLMLGRRQLRRARYEREVAISSENNEDEYPDNSAALGSWVLAP  427

Query  1109  CPHDGPCPLEKSGK---YCHFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQR  939
             CPHD PCPL  S     +CHF QR+ER      + +    + R  ED KFSYVV RRGQR
Sbjct  428   CPHDKPCPLHLSDNPKHFCHFSQRIERP----KFLKDTKHTTRHEEDAKFSYVVIRRGQR  483

Query  938   P  936
             P
Sbjct  484   P  484



>ref|WP_020631958.1| hypothetical protein [Amycolatopsis alba]
Length=324

 Score =   140 bits (354),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 125/251 (50%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  EVWP SL
Sbjct  49    EADIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDIGGGTGAAIWAAAEVWP-SL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L  G      +   +  Q L      +    DLV  SYVLGE
Sbjct  108   EESTVVEQVSGAIALGRRLA-GSAIAQAVRGSTWRQGLIDP-AAAAPDADLVTLSYVLGE  165

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R  VVR L      +LVL+EPGTP G   I + R  ++ +              
Sbjct  166   LPEPR-RADVVRWL-SAKAAMLVLIEPGTPAGYERIVEARDQLVEL--------------  209

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  210   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLK---SGTL-GFE  255

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  256   DEKFSYVVASR  266



>ref|XP_002900712.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY59519.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=452

 Score =   143 bits (360),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 144/284 (51%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAYEMEATYACTHAVFTELQKRLPDFKP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFG+G G+A W  ++ + +SL K  +VEPSQSM  A + +  G   L +     ++
Sbjct  178   KSVLDFGSGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVVLEGFPGLSM---RRNI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DLV+ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   TDLSRDIDAGNK-YDLVVVSYVFSDITNDFERVATTSALWELLSEDGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L +        K+++G         K G  IVAPCPH   CP+     +C
Sbjct  294   HHVRSARQFVLDL------VAKDANG---------KEGVRIVAPCPHHDECPV-GGNTWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R          +G    KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPREVTTKRWHGQKG---SKFSYMIMQKTRKGSE  378



>ref|WP_027045352.1| methyltransferase type 11 [Mesorhizobium sp. URHC0008]
Length=325

 Score =   140 bits (353),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 130/257 (51%), Gaps = 38/257 (15%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  EV
Sbjct  43    LHMAQDMAVKAYLATRLPATYAAVRASLDTLNAARPDFMPKTLLDVGAGPGTVLWATSEV  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ-HDLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +  QA       +N Q  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGETLAAD-----AITAQTVWQAGDVTTDLANLQPADLVTC  156

Query  1358  SYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL  1179
             +YVL EI +      +V +LW LT D L++VEPGTP G   I  VR+ +           
Sbjct  157   AYVLDEI-APASLAKMVDRLWQLTADTLLIVEPGTPAGWQRILAVRAQL-----------  204

Query  1178  KESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGG  999
                          + +GA ++APCPH+ PCPL     +CHF +R+ R+   R  K +   
Sbjct  205   -------------VAAGAHLLAPCPHEAPCPLNPP-DWCHFSRRVARSRLHRLAKDAE--  248

Query  998   SLRGFEDEKFSYVVFRR  948
                 +EDEKF YV   R
Sbjct  249   --VPWEDEKFIYVAASR  263



>emb|CEI92948.1| hypothetical protein RMCBS344292_07193 [Rhizopus microsporus]
Length=440

 Score =   142 bits (359),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 110/372 (30%), Positives = 179/372 (48%), Gaps = 64/372 (17%)
 Frame = -1

Query  2030  PIPMASRLSETVPKFTAEALRAAAKQSDSCRVVPLRLRRAIKKYIKEQEDPHMKR-KVLR  1854
             P+   S  SE V + + EA  +  ++   C  +P  L + + + I+   D  + R   LR
Sbjct  42    PVQEVSVDSEPVVRGSEEA--SFGRKRIGCVELPRSLIQGVDQIIEHYPDKRLIRTDSLR  99

Query  1853  LSESFRHIKEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVA  1674
             L ++ R           +TS  + ++  ++VE  K            L Y   E++AY A
Sbjct  100   LFDALR-----------STSGRLPQNEKEAVEPHK------------LTYGPRESVAYTA  136

Query  1673  SRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPS  1494
             S M   Y+A+Y VL E++ RV  FSP  +LDFG G G+A WA ++++   ++    V+ S
Sbjct  137   SVMSGNYAAIYNVLKELKNRVSSFSPNSMLDFGTGPGTAIWAAKQLF--DVEAYTAVDLS  194

Query  1493  QSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLKDRIT  1314
             + M    + L + +K      S    + LS N   +  + DLVI+++ LG+I S   + +
Sbjct  195   EHMLNIAEQLEKFVKT-DKCQSIEFKRYLSYN--PTAPKTDLVISAFTLGDITSEALQKS  251

Query  1313  VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLK  1134
              V QLW  TGD+L+L++ GTP G   I++ R  IL                        +
Sbjct  252   TVEQLWAQTGDVLILMDRGTPVGFQNIAKARQWIL-----------------------DE  288

Query  1133  SGAFIVAPCPHDGPCPLEKSGK------YCHFVQRLERTTSQRAYKRSNGGSLRGFEDEK  972
               A ++APC HD PCP+  S +      +CH+ QR++R +     K +        ED K
Sbjct  289   QDAHVIAPCSHDKPCPMLFSAESKPNQMWCHYSQRVQRPSFLMKTKHAKN----NIEDIK  344

Query  971   FSYVVFRRGQRP  936
             +SYV+ R+G+RP
Sbjct  345   YSYVILRKGKRP  356



>gb|KDE09055.1| hypothetical protein MVLG_00773 [Microbotryum violaceum p1A1 
Lamole]
Length=1195

 Score =   147 bits (371),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 111/385 (29%), Positives = 173/385 (45%), Gaps = 86/385 (22%)
 Frame = -1

Query  1934  VPLRLRRAIKKYIKEQEDPHMKRKVLRLS--ESFRHIKEANLLLPT-TTSKEIVEDPLKS  1764
             +P+ L RA+ + + E E    ++  +R S  E + H++  + LLP   T+      PL S
Sbjct  70    LPIELVRAVDQLVDEYEG---EKSSIRTSALELYEHLRSTSSLLPNHVTTPSPSYTPLNS  126

Query  1763  VECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVP-------D  1605
                                      +AY++  MP++Y+A   VL   R+R+        +
Sbjct  127   -------------------------LAYLSGLMPSIYAATVHVLEMTRQRIGWLKGEEGE  161

Query  1604  FSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLV--EPSQSMQRAGQ-------------  1470
             + P +V++FG+GTGSA WA R VW  S  +V  +  +  +SM   G              
Sbjct  162   WVPDRVVEFGSGTGSAAWAARRVWKDSKVEVEYIGLDKDKSMVELGSRIIGALPKRMVDL  221

Query  1469  -------------------GLTRGLKNLPLIHSYSSLQAL-------SQNIKKSNRQHDL  1368
                                 ++  +  L +  S SS   L       SQ+ K  N+   L
Sbjct  222   DLRSDEIEVTDGGEDLSPTTMSAKMHQLAIPASVSSFARLGIPLNPKSQSSKSWNQT--L  279

Query  1367  VIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKC  1188
             V++S+ LG++ S + R   VR +W+    ++V+VE GTP+GS I+   R  +L    R  
Sbjct  280   VLSSFSLGDLSSREKRKEFVRSIWETGAKVIVIVERGTPRGSRIVKDAREQLLMYGARDA  339

Query  1187  RKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKS-GKYCHFVQRLERTTSQRAYKR  1011
              K+    G        +  G F++APC HDG CPL +S   +CHF QR+      RA K 
Sbjct  340   EKVVSEEGSEKDVDVDVDRGCFVLAPCAHDGACPLHRSTNMFCHFAQRVRSPAFHRATKH  399

Query  1010  SNGGSLRGFEDEKFSYVVFRRGQRP  936
             S+    +G E  +FSYVV +RG RP
Sbjct  400   SS----QGQEIARFSYVVIKRGTRP  420



>ref|WP_011474779.1| hypothetical protein [Rhodopseudomonas palustris]
 ref|YP_534217.1| hypothetical protein RPC_4375 [Rhodopseudomonas palustris BisB18]
 gb|ABD89898.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
Length=321

 Score =   140 bits (352),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 129/260 (50%), Gaps = 35/260 (13%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G + +R E D A+AY  +RMPA Y+A+   L  +  + PDF+P  +LD GAG G+A WA 
Sbjct  42    GSLAIRSEAD-ALAYALARMPATYAAVTACLDALSAQRPDFAPRSLLDCGAGPGTATWAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              E +  SLQ   L + + +++     L +G + L    +    Q  +  +       DL+
Sbjct  101   AEGFA-SLQTFALFDANAALRALAGDLMQGSQRL---AATCYTQGDAATLLAQAEPADLL  156

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             IASY++ E+ S   R       W  T D LV+VEPGTP G   I  +R+ +         
Sbjct  157   IASYMVNEL-SETQRNVFADLAWAKTTDTLVIVEPGTPAGYARILSLRARL---------  206

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            +  GA + APCPHDG CPL  +  +CHF QRL R+   RA++   
Sbjct  207   ---------------IAQGAQVAAPCPHDGACPL-VAPDWCHFTQRLPRS---RAHQHLK  247

Query  1004  GGSLRGFEDEKFSYVVFRRG  945
             G  L  +EDEKFSYV   R 
Sbjct  248   GAEL-AYEDEKFSYVALTRA  266



>ref|WP_015467675.1| hypothetical protein [Micavibrio aeruginosavorus]
 ref|YP_007642760.1| hypothetical protein A11S_1331 [Micavibrio aeruginosavorus EPB]
 gb|AGH98140.1| hypothetical protein A11S_1331 [Micavibrio aeruginosavorus EPB]
Length=320

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 131/251 (52%), Gaps = 45/251 (18%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPD-FSPAKVLDFGAGTGSAFWAMREVWPRSLQ  1518
             EA+AYV +R+PA Y A   VL     R+PD F+P  +LD GAG G+   A  + +  SL+
Sbjct  54    EALAYVCTRLPATYGAAEHVLG----RLPDDFAPRTMLDVGAGPGTVALAALDHF-DSLR  108

Query  1517  KVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEI  1338
             +V L+EP+  ++  G  L         + + + +      +    +  DL+ A YVL E+
Sbjct  109   QVTLIEPNAHLRGIGASL---------VPNGTWINGDLATVDMPGKDFDLITAGYVLNEL  159

Query  1337  PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKS  1158
              + + R  VV +LW     +LV++EPGTP+GS ++  VR  +                  
Sbjct  160   -NARARAAVVDKLWAACSGMLVIIEPGTPEGSAVVQDVRDQL------------------  200

Query  1157  CKALTTLKSGAFIVAPCPHDGPCPLEKSGK-YCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                   L+ G  I APCP  G CPL  + K +CHF QR+ER+   R+ K   GG+L G+E
Sbjct  201   ------LEKGGSIAAPCPQMGACPLHDAVKRWCHFSQRVERSKLHRSLK---GGAL-GYE  250

Query  980   DEKFSYVVFRR  948
             DEKFSY+ F R
Sbjct  251   DEKFSYIAFSR  261



>ref|XP_002156246.2| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Hydra vulgaris]
Length=524

 Score =   143 bits (361),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/281 (31%), Positives = 137/281 (49%), Gaps = 30/281 (11%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             +RY   E  AY+AS++P+VY A YR L E+++RVP++ P  +LDFG+G+G   W   ++W
Sbjct  169   IRYGGRETSAYIASQLPSVYGATYRALHEIKKRVPEYKPKTLLDFGSGSGMTVWTANQLW  228

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNL------PLIHSYSSLQALSQNIKKSNRQHD  1371
                +++   V+ S+ M  A + L RG  +L      P +  +     LS  +      +D
Sbjct  229   GNEIKEYQCVDASEKMIEAAEFLLRGSDDLNHPLKIPNVF-FKRFLPLSNKV-----LYD  282

Query  1370  LVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRK  1191
             +V++SY L E+P  K R+  ++ LW  T D LVLVEPG   G   +   R   L   +  
Sbjct  283   VVVSSYSLTEMPFRKQRLQAIKSLWKKTNDFLVLVEPGNNDGFEAVLLAR-QFLTEGKSS  341

Query  1190  CRKLKESSGKSCK----------ALTTLKSGAFIVAPCPHDGPCP---LEKSGKYCHFVQ  1050
                +  SS K              L        I APCPH+  C    +E     C+F Q
Sbjct  342   LNDMDTSSTKEFAYNGIFNEFDIHLNDDFEDGHIFAPCPHEMVCARAYVETRDHPCNFTQ  401

Query  1049  RLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRET  927
             ++E + SQ+  +        G+ +  FSYV+ R+G+  + +
Sbjct  402   KVELSFSQKYTELKQ----YGYYNNSFSYVILRKGKEAKNS  438



>ref|XP_004027486.1| mitochondrial ribosomal protein s22, putative [Ichthyophthirius 
multifiliis]
 gb|EGR28141.1| mitochondrial ribosomal protein s22, putative [Ichthyophthirius 
multifiliis]
Length=485

 Score =   142 bits (359),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/260 (31%), Positives = 138/260 (53%), Gaps = 34/260 (13%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             ++Y ++ ++AY+  + P  +    R+L+E++ R+P+F P   LDFGAG GS   A  + +
Sbjct  161   IQYTQNASVAYLLRKAPHTFGVACRILNEIKYRLPNFQPQTFLDFGAGIGSGSIAFNDTF  220

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK-KSNRQHDLVIAS  1356
             P + + +   EPS +M++ G+ +T+ +KNL  + +      L+Q I     +++D++   
Sbjct  221   P-NFKHIIACEPSTNMRKLGKHMTQDIKNLVFVEN------LAQTISFPFAQEYDIIYIG  273

Query  1355  YVLGEIPSLKDRITVVRQLWD--LTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRK  1182
             +VL E+PS + R+ ++  LW+    G ++V VE G+P+G       R +IL  E +K  K
Sbjct  274   HVLQEVPSPESRLVIIDSLWNKLKKGGLIVFVENGSPKGFRFAHDFRKYIL--EEKKDEK  331

Query  1181  LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPL-EKSGKYCHFVQRLERTTSQRAYKRSN  1005
                                 I+APCPH G CPL EK   +CHF Q++ +   +   K   
Sbjct  332   ------------------PLIIAPCPHHGSCPLSEKDDTWCHFEQKIGKYPKKIIAKDLK  373

Query  1004  GGSLRGFEDEKFSYVVFRRG  945
                 R F+DEKF Y+V ++ 
Sbjct  374   E---RQFDDEKFCYIVIQKN  390



>ref|XP_788426.2| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Strongylocentrotus purpuratus]
Length=499

 Score =   142 bits (359),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/282 (32%), Positives = 151/282 (54%), Gaps = 33/282 (12%)
 Frame = -1

Query  1715  GLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
              + Y++ +++AY+ +RMP  Y+ LYRVL+E+++  P++ P+ +LDFG+G G+  WA   V
Sbjct  169   SINYDDVKSLAYMLARMPPNYAVLYRVLNEIKQGDPEYRPSTILDFGSGLGTTTWAAHSV  228

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTR---GLKNLPLIHSY------SSLQALSQNIKKSN  1383
             W  ++++  +VE +++M +  + L R   G + L + + Y       SL+A         
Sbjct  229   WGDAVKEYYMVEVAKAMHQLSERLLRVEPGKEELLIPNVYFRFFMPVSLRA---------  279

Query  1382  RQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWM  1203
              ++ + +++Y L E+PS +DR+  VR LW LT D LVL+E G+ +    + + R  IL  
Sbjct  280   -RYSMTVSAYSLLELPSFQDRVKSVRSLWRLTDDYLVLIENGSYESYLALMEARDAILME  338

Query  1202  ERRKCRKLKESSGKSCKALTTLK-----SGAFIVAPCPHDGPCP--LEKSGKYCHFVQRL  1044
              + +      +     +    LK      G  + APCPHD PCP   + SG  C+F Q  
Sbjct  339   SQDQSEDSSNAEELENRFPDRLKPQIDRQGGHVFAPCPHDQPCPRLQDGSGIPCNFEQSY  398

Query  1043  ERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRP-RETWP  921
                T Q   KRS+  S      E+F+Y+V ++G R  + +WP
Sbjct  399   HPLT-QFIGKRSSMVST-----ERFTYMVLKKGSRTNKHSWP  434



>ref|WP_013788606.1| ribosomal small subunit Rsm22 [Thermoanaerobacterium xylanolyticum]
 ref|YP_004471545.1| ribosomal small subunit Rsm22 [Thermoanaerobacterium xylanolyticum 
LX-11]
 gb|AEF17873.1| Ribosomal small subunit Rsm22 [Thermoanaerobacterium xylanolyticum 
LX-11]
Length=320

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/275 (32%), Positives = 145/275 (53%), Gaps = 43/275 (16%)
 Frame = -1

Query  1742  KIQSAYGDIGLRYEE---------DEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAK  1590
             K+ S   DI  RY           +EAIAY++ RMPA ++ +Y VL +++    + +P  
Sbjct  22    KLISLVSDISNRYRNTDDKHISSYEEAIAYISYRMPATFAVIYAVLKDIKDICSNINPKS  81

Query  1589  VLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQA  1410
             +LD GAG G+A WA   +W   ++++ L+E +++M + G+ L+    N  +  +   L+A
Sbjct  82    ILDVGAGPGTAMWAATSIW-NDIEQITLLEKNKNMIKIGKNLSANSNNSSI-KNSIWLEA  139

Query  1409  LSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWD-LTGDILVLVEPGTPQGSNII  1233
               +N+ +  + HD+VIASY +GE+     +  ++++LW+    DIL+++EPGT  G +II
Sbjct  140   DLENLSELPK-HDIVIASYSIGELNE-DVQSKIIKKLWESAANDILIIIEPGTKIGFSII  197

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
              + R                         T +  GA ++APCPH   CP+     +CHF 
Sbjct  198   KRARE------------------------TLISLGAHVIAPCPHANECPI-NDNDWCHFS  232

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
              R++RT+  R  K    G L  +EDEKFSY+   +
Sbjct  233   SRVQRTSIHRKVK---NGQL-PYEDEKFSYICVSK  263



>ref|WP_018648826.1| ribosomal methyltransferase Rsm22 [Bradyrhizobium japonicum]
Length=323

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 134/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +   VP+ +P  +LD GA
Sbjct  33    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIVPNLAPETLLDVGA  92

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  93    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARDSTRLAECR-YLPGDA-GANLA  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLVIASY++GE+    D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  150   EVS-QADLVIASYIIGEL-GESDQRKLTEAMWTKARHALVVIEPGTPAGYARILALRQQL  207

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  208   ------------------------IGAGAYVAAPCPHENPCPL-AAPDWCHFSQRLPRSQ  242

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  243   AHRQIK----GADVPFEDERFIYVALTR  266



>ref|WP_023773387.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESY91694.1| methyltransferase type 11 [Mesorhizobium sp. LNHC229A00]
 gb|ESY95656.1| methyltransferase type 11 [Mesorhizobium sp. LNHC209A00]
Length=321

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 132/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+RMPA Y+A+   L  +    PDF+PA +LD GAG G+  WA  ++
Sbjct  43    LHMAQDMAVKAYLATRMPATYAAVRASLDALAEARPDFAPATLLDVGAGPGTVLWATSDL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQH-DLVIA  1359
             WP  L+   L+E S ++++ G+ L         I + +  +A       ++ Q  DLV  
Sbjct  103   WP-ELELATLLEASAAVRKVGETLAAD-----AITARTVWRAGDVTTDIADLQSADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P L DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIAPASLPKLVDR------LWQLTRDTLLIVEPGTPAGWLRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH+ PCPL K   +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHVLAPCPHEAPCPL-KPPDWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              +       +EDEKF YV   R
Sbjct  246   EAE----VPWEDEKFIYVAASR  263



>gb|KFD53044.1| hypothetical protein M513_06160 [Trichuris suis]
 gb|KHJ44799.1| hypothetical protein D918_05049 [Trichuris suis]
Length=479

 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 136/261 (52%), Gaps = 33/261 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E + + Y+ +R+   Y+   RVL E+++RVPDF P  V D+G+G G+  W  + +WP  +
Sbjct  173   EAKCLMYLIARLSPNYAVTLRVLREIKQRVPDFVPTTVFDYGSGLGTLHWVCQSLWPDVV  232

Query  1520  QKVNLVEPSQSMQRAGQGLTRG-LKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLG  1344
             +++ +V+ S  M      L +  L ++P     +  Q LS +   S+RQ+DLV ++Y L 
Sbjct  233   KEMYMVDTSSDMNDLAANLLKNDLGDIP--QEVTMRQFLSAS---SDRQYDLVFSAYSLM  287

Query  1343  EIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR-KCRKLKESS  1167
             E P  + R+ VV  LW  T + L++VE G+  G  +I + R H+L M ++ +C +     
Sbjct  288   ECPEAEQRLYVVENLWRKTSNFLIIVENGSKAGHRLILEARDHLLKMTKKSECVE-----  342

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                           FI APCPH+  CP  +S   C+F        +   Y     G+ R 
Sbjct  343   -------------NFIFAPCPHELLCPRAESRLPCNF--------AAPYYPFKFVGTKRD  381

Query  986   FEDEKFSYVVFRRGQRPRETW  924
                E FSY+VFR+GQ P+E++
Sbjct  382   SLCELFSYIVFRKGQGPKESF  402



>ref|WP_024576024.1| MULTISPECIES: SAM-dependent methyltransferase [Afipia]
Length=329

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 131/256 (51%), Gaps = 37/256 (14%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             +A+AY  +RMP  Y+A+   L+ +    P+F+P  +LD GAG G+A WA  E +  SL  
Sbjct  50    DALAYALARMPGTYAAIAASLNALTEVTPEFTPRSLLDVGAGPGTATWAASEAFA-SLDT  108

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
               L++ + +++     L +    L  +  ++     ++ +     + DLVIASYV+ E+ 
Sbjct  109   FTLLDANTALRDLATELAQSHPRLAAMRYHAG---HARKVVAEASEADLVIASYVINELG  165

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
                +R  +   +W  T D L++VEPGTP G   I  +R+ +                   
Sbjct  166   E-NERAALADAMWAKTSDTLLVVEPGTPAGYARIIDLRARL-------------------  205

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  +  GA ++APCPH+  CPL +   +CHF QRL+R+   RA+K   G  L  +EDE
Sbjct  206   -----IARGAHVIAPCPHEAACPLTRP-DWCHFTQRLQRS---RAHKHLKGAEL-PYEDE  255

Query  974   KFSYVVFRRG---QRP  936
             KFSYVV  R    QRP
Sbjct  256   KFSYVVLSRTAPVQRP  271



>ref|WP_012564120.1| type 11 methyltransferase [Oligotropha carboxidovorans]
 ref|YP_002289959.1| type 11 methyltransferase [Oligotropha carboxidovorans OM5]
 ref|YP_004632064.1| methylase [Oligotropha carboxidovorans OM5]
 ref|YP_005950128.1| putative methylase [Oligotropha carboxidovorans OM4]
 gb|ACI94094.1| methyltransferase type 11 [Oligotropha carboxidovorans OM5]
 gb|AEI02247.1| putative methylase [Oligotropha carboxidovorans OM4]
 gb|AEI05823.1| putative methylase [Oligotropha carboxidovorans OM5]
Length=326

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 131/259 (51%), Gaps = 43/259 (17%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +A+AY  +RMPA Y+A+   L+ +  R PDF+PA +LD GAG  +A WA    +  SL
Sbjct  49    EADALAYALTRMPATYAAIAASLNALSERRPDFTPATLLDVGAGPATASWAAARTF-DSL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHS-YSSLQALSQNI---KKSNRQHDLVIASY  1353
                  ++ + ++        R L    +  S  ++++ +  N+     +    DLVIASY
Sbjct  108   THFVAIDANAAL--------RALACDTVTDSRLAAMRYVEGNVLAGLAAMESADLVIASY  159

Query  1352  VLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
             V+ E+    DR T+   +W  T D L++VEPGTP G   I  +R+H+             
Sbjct  160   VINELGE-ADRTTLADLMWQKTRDTLLVVEPGTPAGYERILALRAHL-------------  205

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSL  993
                        +  GA ++APCPHD  CPL     +CHF QRL R+   RA+K+  G  L
Sbjct  206   -----------IAQGAHVIAPCPHDNACPLTPP-DWCHFSQRLARS---RAHKQIKGAEL  250

Query  992   RGFEDEKFSYVVFRRGQRP  936
               FEDE++SYV   R   P
Sbjct  251   -PFEDERYSYVALSRTLAP  268



>ref|WP_034308140.1| rRNA methyltransferase [Amycolatopsis lurida]
 gb|KFU81440.1| rRNA methyltransferase [Amycolatopsis lurida NRRL 2430]
Length=329

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/251 (37%), Positives = 124/251 (49%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP SL
Sbjct  49    EVDIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDVGGGTGAAIWAAADVWP-SL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L  G      +   +  + L      +  + DLV  SYVLGE
Sbjct  108   EESTVVEQVPGAIALGRRLA-GNAGDKAVRGSTWRRGLIDPAAPAP-EADLVTLSYVLGE  165

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R   VR L    G +LVL+EPGTP G   I + R  ++ +              
Sbjct  166   LPEAR-RSDAVRWLSAKAG-MLVLIEPGTPAGYERIVEARDQLVEL--------------  209

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K +      GFE
Sbjct  210   ----------GLSLVAPCPHEGTCPIPRGKDWCHFSARLPRTGLHRQLKSAT----LGFE  255

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  256   DEKFSYVVASR  266



>ref|WP_037335441.1| rRNA methyltransferase [Amycolatopsis sp. MJM2582]
 gb|KFZ84186.1| rRNA methyltransferase [Amycolatopsis sp. MJM2582]
Length=335

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 124/251 (49%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP +L
Sbjct  55    EADIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDIGGGTGAAIWAAADVWP-TL  113

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L     +   +   +  + L      +  + DLV  SYVLGE
Sbjct  114   EESTVVEQVPGAIALGRRLAENAGD-KAVRGSTWRRGLIDPAAPAP-EADLVTLSYVLGE  171

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R   VR L      +LVL+EPGTP G   I   R  ++ +              
Sbjct  172   LPEAR-RADTVRWL-SAKASMLVLIEPGTPAGYERIVAARDQLVGL--------------  215

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  216   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLK---SGTL-GFE  261

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  262   DEKFSYVVASR  272



>ref|WP_038520669.1| rRNA methyltransferase [Amycolatopsis japonica]
 gb|AIG80534.1| Hypothetical protein AJAP_38750 [Amycolatopsis japonica]
Length=335

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 124/251 (49%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP +L
Sbjct  55    EADIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDIGGGTGAAIWAATDVWP-TL  113

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L     +   +   +  + L      +  + DLV  SYVLGE
Sbjct  114   EESTVVEQVPGAIELGRRLAENAGD-KAVRGATWRRGLIDPAAPAP-EADLVTLSYVLGE  171

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R   VR L      +LVL+EPGTP G   I   R  ++ +              
Sbjct  172   LPEAR-RADTVRWL-SAKASMLVLIEPGTPAGYERIVAARDQLVEL--------------  215

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  216   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLK---SGTL-GFE  261

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  262   DEKFSYVVASR  272



>ref|WP_009735331.1| methyltransferase [Bradyrhizobiaceae bacterium SG-6C]
 gb|EGP08719.1| methyltransferase [Bradyrhizobiaceae bacterium SG-6C]
Length=330

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 90/256 (35%), Positives = 132/256 (52%), Gaps = 37/256 (14%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             +A+AY  +RMP  Y+A+   L+ +    PDF+P  +LD GAG G+A WA  E +  SL +
Sbjct  51    DALAYALARMPGTYAAVAASLNALMECDPDFAPQSLLDVGAGPGTATWAASEAF-ASLDR  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
               L++ + +++     L      L  +  Y+     ++       + DLV+ASYV+ E+ 
Sbjct  110   FTLLDANTALRDLATELVTSQPRLETLRYYAG---DARKALTDAPEADLVVASYVVNEL-  165

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
             S  +R      LW  T D+L++VEPG+P G        SHIL +  R             
Sbjct  166   SEGERAAFADALWAKTRDMLLVVEPGSPAG-------YSHILSLRDR-------------  205

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                  +  GA++VAPCPHD  C L  +  +CHF QRL+R+   RA+K     +L  +EDE
Sbjct  206   ----LIAQGAYVVAPCPHDAACAL-VAPDWCHFTQRLQRS---RAHKHLKAAAL-PYEDE  256

Query  974   KFSYVVFRR---GQRP  936
             KFSYVV  R    QRP
Sbjct  257   KFSYVVLSRKAPAQRP  272



>emb|CDW55232.1| Rsm22 domain containing protein [Trichuris trichiura]
Length=480

 Score =   142 bits (357),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 135/261 (52%), Gaps = 33/261 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E + + Y+ +R+P  Y+   RVL E+++RVPDF P  V D+G+G G+  W  + +WP ++
Sbjct  173   EAKCLMYLIARLPPNYAVTLRVLREIKQRVPDFVPTTVFDYGSGLGTLHWVCQSLWPDAM  232

Query  1520  QKVNLVEPSQSMQR-AGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLG  1344
             +++ +V+ S  M   A   L     ++P     +  Q L  +   S+RQ+DLV ++Y L 
Sbjct  233   KEMFMVDTSSDMNDLAASLLQNNFGDIP--KEITMRQFLPAS---SDRQYDLVFSAYSLM  287

Query  1343  EIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR-KCRKLKESS  1167
             E P  + R+ VV  LW  T D LV+VE G+  G ++I + R H+L + +  +C +     
Sbjct  288   ECPEAEQRVYVVENLWRKTSDFLVIVENGSKAGHHLILEARDHLLKLTKESECVR-----  342

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                           F+ APCPHD  CP  +    C+F        +   Y     G+ R 
Sbjct  343   -------------DFLFAPCPHDLLCPRAEGRLPCNF--------AAMYYPFKFVGTKRN  381

Query  986   FEDEKFSYVVFRRGQRPRETW  924
              + E FSY+VFR+GQ  ++++
Sbjct  382   SQCELFSYIVFRKGQGTKQSF  402



>ref|XP_002905459.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY68300.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=446

 Score =   141 bits (355),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 87/281 (31%), Positives = 142/281 (51%), Gaps = 25/281 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF P
Sbjct  112   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAYEMEATYACTHAVFTELQKRLPDFKP  171

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFG+G G+A W  ++ + +SL K  +VEPSQSM  A + +  G   L +     ++
Sbjct  172   KSVLDFGSGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVVLEGFPGLSM---RRNI  228

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DLV+ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  229   TDLSRDIDAGNK-YDLVVVSYVFSDITNDFERVATTSALWELLSEDGCLVIVDRGSPWGS  287

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L +        +++ G         K G  IVAPCPH   CP+     +C
Sbjct  288   HHVRSARQFVLDL------VAEDADG---------KEGVRIVAPCPHHDECPV-GGNTWC  331

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQR  939
             HFVQR       R          +G    KFSY++ ++ ++
Sbjct  332   HFVQRSPVVNRPREVTTKRWHGQKG---SKFSYMIMQKTRK  369



>ref|XP_008483408.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Diaphorina 
citri]
Length=466

 Score =   141 bits (356),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/266 (32%), Positives = 127/266 (48%), Gaps = 33/266 (12%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPR  1527
             Y E  +  Y+ SR    Y+ L +VL E+ +++PDF P  V DFG+G G+A WA    WP+
Sbjct  194   YTEHISRVYLWSRFVPDYAVLVKVLEEIYKQLPDFKPHSVFDFGSGIGTAIWATHSYWPK  253

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKN--LPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
             S+ +   V+ S  M      L +G +    P I      Q L  +   +  Q+ LVI +Y
Sbjct  254   SIGEFYCVDTSDHMLDLSSLLLQGGRQNKQPCISHVVYRQFLPSS---TTNQYSLVICAY  310

Query  1352  VLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
              L E+PS K RI  + +LW+ T D LV+V+ G+  G  ++ + R +IL    ++      
Sbjct  311   SLLELPSQKHRIQTIAKLWEKTEDFLVIVDLGSASGYQVVLEARDYILSTNNKR------  364

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSL  993
                            A + APCPHD  CP ++   +C F  + E    +R          
Sbjct  365   ------------PGSAHVFAPCPHDLACPKQQLANHCTFSVKYENMRFKRGE--------  404

Query  992   RGFEDEKFSYVVFRRGQR--PRETWP  921
             R    E FSYV+ RRG+R  P  +WP
Sbjct  405   RIILPENFSYVILRRGERRDPLTSWP  430



>ref|WP_027543649.1| SAM-dependent methyltransferase [Bradyrhizobium sp. WSM2254]
Length=325

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 132/268 (49%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +   VPD +P  +LD GA
Sbjct  32    KISNTYRGGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIVPDLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L      L     Y    A S   +
Sbjct  92    GPGTASWAAAEGFP-SLQDFTLLDANATLSRLALELAHDSTRLAECR-YLPGDAGSNLTE  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
              S  Q DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  150   VS--QADLVVASYIIGEL-GEADQRKLAEAMWAKARHALVVIEPGTPAGYARILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
             + +                        GAF+ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   IAL------------------------GAFVAAPCPHEKPCPL-AAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  242   AHRQIK----GAEVPFEDERFIYVAMTR  265



>ref|WP_027568583.1| SAM-dependent methyltransferase [Bradyrhizobium sp. URHA0013]
Length=325

 Score =   138 bits (348),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/268 (35%), Positives = 134/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +   VPD +P  +LD GA
Sbjct  32    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIVPDLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +  SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  92    GPGTASWAAAEAF-SSLQDFTLLDANATLSRLALELARDSTRLADCR-YLPGDA-GANLA  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLV+ASYV+GE+ S  D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  149   EVS-QADLVVASYVIGEL-SESDQRKLAEAMWAKARHALVVIEPGTPAGYARILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IAAGAYVAAPCPHEKPCPL-AAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F YV   R
Sbjct  242   AHRQIK----GAEVPFEDERFIYVALIR  265



>gb|ETO67343.1| hypothetical protein F444_15704 [Phytophthora parasitica P1976]
Length=452

 Score =   140 bits (354),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 141/284 (50%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+ DF+P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAFEMEATYACTHAVFTELQKRLLDFNP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDFGAG G+A W  ++ + +SL K  +VEPSQSM  A + L  G   L +     S+
Sbjct  178   KSVLDFGAGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVLLEGFPGLSM---RRSI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DL++ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   ADLSRDIDAGNK-YDLIVVSYVFSDITNDFERVATTSALWELLSENGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L                S       K G  I+APCPH   CP+  S  +C
Sbjct  294   HHVRSARQFVL---------------DSVAEDEDSKEGVRILAPCPHHDECPVGGS-TWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R    +      G +  KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPR---EATTKRWHGQKGSKFSYMIMQKTRKGSE  378



>ref|WP_015318512.1| methyltransferase type 11 [Mesorhizobium australicum]
 ref|YP_007306512.1| ribosomal methyltransferase Rsm22 [Mesorhizobium australicum 
WSM2073]
 gb|AGB47136.1| ribosomal methyltransferase Rsm22 [Mesorhizobium australicum 
WSM2073]
Length=321

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 131/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+RMPA Y+A+   L  +    PDF+PA +LD GAG G+  WA  ++
Sbjct  43    LHMAQDMAVKAYLATRMPATYAAVRASLDALAEARPDFTPATLLDVGAGPGTVLWATSDL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQH-DLVIA  1359
             WP  L+   L+E S ++++ G+ L         I + +  +A       ++ Q  DLV  
Sbjct  103   WP-DLELATLLEASAAVRKVGETLAAN-----AITAQTVWRAGDVTTDIADLQSADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P + DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIAPTSLPKMVDR------LWQLTKDTLLIVEPGTPAGWLRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH+ PCPL     +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHVLAPCPHEAPCPLNPP-DWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              +       +EDEKF YV   R
Sbjct  246   EAE----VPWEDEKFIYVAASR  263



>ref|WP_027577018.1| SAM-dependent methyltransferase [Bradyrhizobium sp. WSM1743]
Length=325

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/269 (35%), Positives = 131/269 (49%), Gaps = 37/269 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    PD +P  +LD GA
Sbjct  32    KISTAYRAGGGSGTIKSEADALAYALARMPATYAAVTASLNALTEIAPDLAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A S   +
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARDSSRLTECR-YLPGDAGSNLAQ  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
              S    DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  150   VS--PADLVVASYIIGELDE-ADQRKLTEAMWAKARHALVVIEPGTPAGYARILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + SGA + APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IASGAHVAAPCPHERPCPL-TAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             + R  K    G+   FEDE+F YV   R 
Sbjct  242   AHRQIK----GAEVPFEDERFIYVALTRA  266



>ref|WP_028346965.1| SAM-dependent methyltransferase [Bradyrhizobium elkanii]
Length=325

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 95/272 (35%), Positives = 140/272 (51%), Gaps = 50/272 (18%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G   +R E D A+AY  +RMPA Y+A+   L  +    PDF+P ++LD GAG G+A WA 
Sbjct  42    GSTTIRSETD-ALAYALARMPATYAAVTASLKALVENRPDFAPKRLLDVGAGPGTAAWAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ----  1377
              E +P SL+   L++ + +++            L L H  + L+ +   + ++       
Sbjct  101   AEAFP-SLRDFTLLDANAALRTLA---------LDLAHDSTRLRGIGYQLGEARAALAKA  150

Query  1376  --HDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWM  1203
                DLV+ASY++GEI     R  +   LW  T D L++VEPGTP G   I  +R+H++ +
Sbjct  151   DTADLVVASYMIGEIGEAAQR-ALAELLWQKTHDTLLVVEPGTPAGYARIIALRAHLIGL  209

Query  1202  ERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQR  1023
             +                        A + APCPHD  CPL+ +  +CHF QRL+R+   R
Sbjct  210   D------------------------AHVAAPCPHDSQCPLQ-APDWCHFTQRLQRS---R  241

Query  1022  AYKRSNGGSLRGFEDEKFSYVVFRRG---QRP  936
             A+K+  G  L  +EDEKFSYV   R    QRP
Sbjct  242   AHKQIKGAEL-PYEDEKFSYVALTRAAVEQRP  272



>ref|WP_023819180.1| methyltransferase type 11 [Mesorhizobium sp. L2C066B000]
 gb|ESZ38139.1| methyltransferase type 11 [Mesorhizobium sp. L2C066B000]
Length=325

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRRHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQAAP  267



>ref|WP_007033483.1| rRNA methylase [Amycolatopsis decaplanina]
 gb|EME54668.1| rRNA methylase [Amycolatopsis decaplanina DSM 44594]
Length=335

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 122/251 (49%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP SL
Sbjct  55    EADIAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDIGGGTGAAIWAAADVWP-SL  113

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE  Q     G+ L  G      +   +  + L           DLV  SYVLGE
Sbjct  114   EESTVVEQVQGAIALGRRLA-GNAGDKAVRGSTWRRGLIDP-AAPAPDADLVTLSYVLGE  171

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R   VR L    G +LVL+EPGTP G   I   R  ++ +              
Sbjct  172   LPEAR-RADTVRWLSAKAG-MLVLIEPGTPAGYERIVVARDQLVEL--------------  215

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K +      GFE
Sbjct  216   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLKSAT----LGFE  261

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  262   DEKFSYVVASR  272



>emb|CCA19192.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=459

 Score =   140 bits (353),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 87/259 (34%), Positives = 135/259 (52%), Gaps = 33/259 (13%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPR  1527
             Y   E +AY+A  + A Y+ LY    ++R +  DF P+ ++DFGAG G+A W  +E +  
Sbjct  146   YGPSETLAYLAYEIDANYATLYNAFRQLRNKDQDFQPSTMIDFGAGPGTASWVAKEFFND  205

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQA-LSQNIKKSNRQHDLVIASYV  1350
             S+QK  +VEPSQ+M  A Q L        +  S   L++ +  NIK     +D ++ +YV
Sbjct  206   SIQKYQIVEPSQAMTDAAQVLMEDFNGFSIRRSLDELRSEVLLNIK-----YDFIVMNYV  260

Query  1349  LGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLK  1176
             L E+ +  +R+ ++  LW+L  +   LV+V+ G+P GS+ +   R  IL         + 
Sbjct  261   LSEVTNDFERVKIMSVLWELLSENGYLVIVDRGSPWGSHQVRSARQFIL-------DSVN  313

Query  1175  ESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGS  996
             +S   S +          +VAPCPH+  CP  K G +CHFVQR     S    +  +G  
Sbjct  314   DSEDFSVR----------VVAPCPHNEKCPASK-GTWCHFVQR-----SPVVLRPRDGTP  357

Query  995   LR--GFEDEKFSYVVFRRG  945
              R  G +  KFSYVV ++G
Sbjct  358   RRWHGQKGSKFSYVVMKKG  376



>ref|WP_023743794.1| methyltransferase type 11 [Mesorhizobium sp. LNJC394B00]
 gb|ESY25301.1| methyltransferase type 11 [Mesorhizobium sp. LNJC394B00]
Length=325

 Score =   137 bits (346),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRRHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQAAP  267



>ref|WP_023705362.1| MULTISPECIES: methyltransferase type 11 [Mesorhizobium]
 gb|ESX17625.1| methyltransferase type 11 [Mesorhizobium sp. LSJC255A00]
 gb|ESX25245.1| methyltransferase type 11 [Mesorhizobium sp. LSHC440B00]
 gb|ESX36327.1| methyltransferase type 11 [Mesorhizobium sp. LSHC432A00]
 gb|ESX38280.1| methyltransferase type 11 [Mesorhizobium sp. LSHC440A00]
 gb|ESX74462.1| methyltransferase type 11 [Mesorhizobium sp. LSHC414A00]
 gb|ESY43361.1| methyltransferase type 11 [Mesorhizobium sp. LNJC384A00]
 gb|ESZ57192.1| methyltransferase type 11 [Mesorhizobium sp. L103C131B0]
Length=325

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWQLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRRHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQAAP  267



>ref|WP_002714702.1| hypothetical protein [Afipia clevelandensis]
 gb|EKS32855.1| hypothetical protein HMPREF9696_03832 [Afipia clevelandensis 
ATCC 49720]
Length=330

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 134/258 (52%), Gaps = 41/258 (16%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             +A+AY  +RMP  Y+A+   L+ +    PDF+P  +LD GAG G+A WA  E +  SL +
Sbjct  51    DALAYALARMPGTYAAVAASLNALMECDPDFAPQSLLDVGAGPGTATWAASEAF-ASLDR  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYS--SLQALSQNIKKSNRQHDLVIASYVLGE  1341
               L++ + +++     L      L  +  Y+  + +AL+        + DLV+ASYV+ E
Sbjct  110   FTLLDANTALRDLATELVTSQPRLETLRYYAGDARKALTD-----APEVDLVVASYVVNE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             + S  +R      LW  T D+L++VEPG+P G        SHIL +  R           
Sbjct  165   L-SESERAAFADALWAKTRDMLLVVEPGSPAG-------YSHILSLRDR-----------  205

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    +  GA + APCPHD  CPL  +  +CHF QRL+R+   RA+K     +L  +E
Sbjct  206   ------LIAQGAHVFAPCPHDTACPL-VAPDWCHFTQRLQRS---RAHKHLKAAAL-PYE  254

Query  980   DEKFSYVVFRR---GQRP  936
             DEKFSYVV  R    QRP
Sbjct  255   DEKFSYVVLSRKAPAQRP  272



>ref|WP_023814946.1| methyltransferase type 11 [Mesorhizobium sp. L2C067A000]
 gb|ESZ36148.1| methyltransferase type 11 [Mesorhizobium sp. L2C067A000]
Length=325

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 133/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L E+    PDF P  +LD GAG G+  WA  ++WP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRAGLDELAYARPDFQPTSLLDVGAGPGTVLWATTDLWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVL  1347
             L++  LVE S ++++ GQ L      L  I +    +A    I  ++ +  DLV  +YVL
Sbjct  106   LEEAVLVEASAAVRKVGQSLA-----LDTIATRMDWRAGDVTIDLADLKPADLVTCAYVL  160

Query  1346  GEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESS  1167
              EI +      +V +LW LTGD L++VEPGTP G   I  VR  +               
Sbjct  161   DEI-APASLPKLVGRLWHLTGDTLLIVEPGTPAGWQRILAVRRQL---------------  204

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                      L++GA ++APCPH+ PCPLE    +CHF +R+ R+   R  K ++      
Sbjct  205   ---------LEAGAHVLAPCPHEAPCPLEPP-DWCHFSRRVARSRRHRLAKDAD----VP  250

Query  986   FEDEKFSYVVFRRGQRP  936
             +EDEKF YV   R   P
Sbjct  251   WEDEKFIYVAASRQAAP  267



>ref|XP_009538787.1| hypothetical protein PHYSODRAFT_342126 [Phytophthora sojae]
 gb|EGZ05926.1| hypothetical protein PHYSODRAFT_342126 [Phytophthora sojae]
Length=743

 Score =   142 bits (359),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/261 (33%), Positives = 133/261 (51%), Gaps = 25/261 (10%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPR  1527
             Y   E +A+VA  M A Y+  + V +E+++R+PDF P  VLDFGAG G+A W  ++ + +
Sbjct  147   YGPAETLAFVAFEMEATYACTHAVFTELQKRLPDFKPKSVLDFGAGPGTASWVAKDFYDQ  206

Query  1526  SLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVL  1347
             SL K  +VEPSQSM  A + L   L   P +    S+  +S++I    + +DL++ SYV 
Sbjct  207   SLNKYRVVEPSQSMVDAAEVL---LDGFPGLSVRRSIADMSRDINTGTK-YDLIVVSYVF  262

Query  1346  GEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKE  1173
              +I +  +R+     LW+L  +   LV+V+ G+P GS+ +   R  +L            
Sbjct  263   SDITNDFERVATTSALWELLNENGCLVVVDRGSPWGSHQVRSARQFVL------------  310

Query  1172  SSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSL  993
                 S K     K G  I+APCPH   CP   S  +CHFVQR       R    +     
Sbjct  311   ---DSVKEDEDGKEGVRIIAPCPHHFECPAAGS-TWCHFVQRSPVVNRPR---EATTKRW  363

Query  992   RGFEDEKFSYVVFRRGQRPRE  930
              G +  KFSY++ ++  +  E
Sbjct  364   HGQKGSKFSYMIMQKTHKGSE  384



>ref|WP_024580463.1| SAM-dependent methyltransferase [Bradyrhizobium sp. OHSU_III]
Length=335

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 130/252 (52%), Gaps = 34/252 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +A+AY  +RMPA Y+A+   L+ +    PDF+PA +LD GAG G+A WA  E +   L
Sbjct  49    ETDALAYALARMPATYAAVVASLNALAEIRPDFAPASLLDVGAGPGTATWAAAETFA-PL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             +   L++ + +++     L R    L   HS S     ++ +       DLV+ASY++GE
Sbjct  108   RGFTLLDANGALRTLAVELFRDSARL---HSTSYELGEARALLDKAAPADLVVASYMIGE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +    +R  +   LW  T D L++VEPGTP G   I  +R  +                 
Sbjct  165   L-GETERTALADALWSKTRDTLLVVEPGTPAGYARIIALRGRL-----------------  206

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    + +GA + APCPHD  CPL  +  +CHF QRL+R+   RA+K+  G  L  FE
Sbjct  207   -------IAAGAHVAAPCPHDRGCPL-VAPDWCHFSQRLQRS---RAHKQVKGAEL-PFE  254

Query  980   DEKFSYVVFRRG  945
             DE+F+Y+   R 
Sbjct  255   DERFAYMALSRA  266



>ref|WP_028179393.1| MULTISPECIES: SAM-dependent methyltransferase [Bradyrhizobium]
Length=325

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 135/268 (50%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI +AY   G  G    E +A+AY  +RMPA Y+A+   L+ +    P+ +P  +LD GA
Sbjct  32    KISTAYRAGGTSGTIKSEADALAYALARMPATYAAVAASLNALSEISPNLAPESLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L     Y    A   N+ 
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARDSTRLAECR-YLPGDA-GANLP  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
             + + Q DLVIASYV+GE+   + R  +   +W      L+++EPGTP G+  I  +R  +
Sbjct  149   EVS-QADLVIASYVIGELGEAEQR-KLTEAMWAKARHALLVIEPGTPAGTARILALRQRL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA++ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IAAGAYVAAPCPHEKPCPL-VAPDWCHFSQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE+F Y+   R
Sbjct  242   AHRQIK----GAEVPFEDERFIYLALTR  265



>ref|XP_001030768.1| hypothetical protein TTHERM_01016080 [Tetrahymena thermophila]
Length=562

 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 147/294 (50%), Gaps = 56/294 (19%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
               Y ++ ++AY+  + P  +S   R+L+E+R R+P+F+P   LDFGAG GS   A ++++
Sbjct  222   FEYSQNSSVAYLLRKAPHTFSVACRILTEIRYRMPNFNPQTFLDFGAGLGSGSLAFQDIF  281

Query  1532  PRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASY  1353
             P   + +   EPS++M++ G+ +T+ + NL  + + +   +L   +     + D+V  S+
Sbjct  282   PEC-KNIVACEPSKNMRKLGKHMTQDIPNLVYVENLAQTISLPYAV-----EFDIVFISH  335

Query  1352  VLGEIPSLKDRI------------------TVVRQLWDLT--GDILVLVEPGTPQGSNII  1233
             VL E+PS++ +I                   ++  LW+    G I++ VE GTP+G    
Sbjct  336   VLQEVPSVEGKILQFLTLFSYFSQQNLARKLIIDSLWNKVKKGGIMIFVENGTPKGFRFA  395

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPL-EKSGKYCHF  1056
                R +IL  E +K                      +IVAPCPH GPCPL  K+  +CHF
Sbjct  396   HDFRRYIL--ENKKS------------------DDPYIVAPCPHQGPCPLAAKADTWCHF  435

Query  1055  VQRLERTTSQRAYKRSNGGSL---RGFEDEKFSYVVFRRGQRPRETWPLNGMKF  903
              Q++ +      Y +S    L   + F++EKF ++V ++G +  E    N   F
Sbjct  436   EQKVGK------YPKSVFSKLPTEKQFDNEKFCFMVIQKGVKQEERDEDNSQTF  483



>ref|WP_027034477.1| methyltransferase type 11 [Mesorhizobium loti]
Length=325

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 130/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+R+PA Y+A+   LS +    PDF P  +LD GAG G+  WA  E+
Sbjct  43    LHMAQDMAVKAYLATRLPATYAAVRASLSALNEARPDFMPKTLLDVGAGPGAVLWATSEL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ-HDLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +  +A       ++ Q  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGETLATD-----AIAARTEWRAGDVTTDLADLQPADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P + DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIVPASLPKMVDR------LWQLTADTLLIVEPGTPAGWQRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH  PCPL     +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHVLAPCPHQAPCPLNPP-DWCHFARRVARSRLHRMAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              +       +EDEKF +V   R
Sbjct  246   DAE----VPWEDEKFIFVAVSR  263



>ref|WP_016337675.1| rRNA methylase [Amycolatopsis orientalis]
 ref|YP_008016396.1| rRNA methylase [Amycolatopsis orientalis HCCB10007]
 gb|AGM09993.1| rRNA methylase [Amycolatopsis orientalis HCCB10007]
Length=335

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/251 (37%), Positives = 124/251 (49%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA  +VWP SL
Sbjct  55    EADVAAYAGYRMPATYAAVHAVLAEAALRAPGFAPRTQIDIGGGTGAAIWAAADVWP-SL  113

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L     +   +   +  + L      +  + DLV  SYVLGE
Sbjct  114   EESTVVEQVPGAIALGRRLAENAGD-KAVRGSTWRRGLIDPAAPAP-EADLVTLSYVLGE  171

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R   VR L   T  +LVL+EPGTP G   I   R  ++ +              
Sbjct  172   LPDAR-RADTVRWLSAKT-SMLVLIEPGTPAGYERIVAARDQLVEL--------------  215

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+  CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  216   ----------GLSLVAPCPHEDACPIPRGKDWCHFSARLPRTGLHRQLK---SGTL-GFE  261

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  262   DEKFSYVVASR  272



>emb|CDX41362.1| Ribosomal small subunit Rsm22 [Mesorhizobium sp. SOD10]
Length=321

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 129/261 (49%), Gaps = 38/261 (15%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   ED A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  + 
Sbjct  43    LHMGEDMAVKAYLATRLPATYAAVRASLIALADARPDFHPKTLLDIGAGPGTMLWATVDA  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIA  1359
             WP  L++  LVE S ++++ GQ L  G      I + +   A    I     +  DLV  
Sbjct  103   WP-ELEQAILVEASAAVRKVGQALASG-----TIAARAEWIAGDATIDLDGLKPADLVSI  156

Query  1358  SYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL  1179
             +YVL E+ +      +V +LW LT D L++VEPGTP G   I   R  +           
Sbjct  157   AYVLDEV-APASLPKLVHRLWQLTADTLLIVEPGTPAGWQRILAARQQL-----------  204

Query  1178  KESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGG  999
                          +++GA I+APCPH  PCPL K   +CHF +R+ R+   R  K ++  
Sbjct  205   -------------IEAGAHILAPCPHQAPCPL-KPPDWCHFSRRVARSRLHRLVKEAD--  248

Query  998   SLRGFEDEKFSYVVFRRGQRP  936
                 +EDEKF Y+   R   P
Sbjct  249   --VPWEDEKFIYLAASRQPTP  267



>ref|WP_023782883.1| methyltransferase type 11 [Mesorhizobium sp. LNHC220B00]
 gb|ESY85505.1| methyltransferase type 11 [Mesorhizobium sp. LNHC220B00]
Length=321

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 132/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+RMPA Y+A+   L  +    PDF+PA +LD GAG G+  WA  ++
Sbjct  43    LHMAQDMAVKAYLATRMPATYAAVRASLDALAEARPDFAPATLLDVGAGPGTVLWATSDL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQH-DLVIA  1359
             WP  L+   L+E S ++++ G+ L         I + +  +A       ++ Q  +LV  
Sbjct  103   WP-ELELATLLEASAAVRKVGETLAAD-----AITARTVWRAGDVTTDIADLQSAELVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P + DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIAPASLPKMVDR------LWQLTRDTLLIVEPGTPAGWLRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH+ PCPL K   +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHVLAPCPHEAPCPL-KPPDWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              +       +EDEKF YV   R
Sbjct  246   EAE----VPWEDEKFIYVAASR  263



>ref|WP_027529184.1| SAM-dependent methyltransferase [Bradyrhizobium sp. WSM3983]
Length=325

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 132/268 (49%), Gaps = 37/268 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PD +PA +LD GA
Sbjct  32    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALVEIAPDLAPATLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +  SLQ   L++ + ++ R    L R    L     Y    A S   +
Sbjct  92    GPGTASWAAAEAF-SSLQDFTLLDANATLSRLALELARDSSRLSDCR-YLPGDAASSLAE  149

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
              S  + DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I  +R  +
Sbjct  150   VS--EADLVVASYIIGELGE-ADQRKLAETMWTKARHALVVIEPGTPAGYARILALRQQL  206

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GAF+ APCPH+ PCPL  +  +CHF QRL R+ 
Sbjct  207   ------------------------IATGAFVAAPCPHEKPCPL-IAPDWCHFNQRLPRSQ  241

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             + R  K    G+   FEDE++ YV   R
Sbjct  242   AHRQIK----GAEVPFEDERYIYVALTR  265



>ref|XP_006012130.1| PREDICTED: methyltransferase-like protein 17, mitochondrial-like 
[Latimeria chalumnae]
Length=365

 Score =   137 bits (345),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/277 (33%), Positives = 138/277 (50%), Gaps = 32/277 (12%)
 Frame = -1

Query  1736  QSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSA  1557
             +S Y    L Y+ED ++ Y+A+R+   Y+A+ R   E+++R+P F P  +LDFG+GTGS 
Sbjct  34    KSTYHWKPLSYDEDLSLIYMAARLDGGYAAVSRAFQEIKKRIPQFEPLTLLDFGSGTGSV  93

Query  1556  FWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRG--LKNLPLIHSYSSLQALSQNIKKSN  1383
              WA  + W  S+++   V+ S +M +  + L  G      PLI+     Q L  + K   
Sbjct  94    AWAAHQFWGNSIREYMCVDSSSAMNKLAEFLLTGGDESQKPLINEVYFRQFLPVSPKV--  151

Query  1382  RQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWM  1203
              Q+DLV++++ L ++P+   RI  +  LW  T D LVLVE GT +G   + + R  +L  
Sbjct  152   -QYDLVVSAFSLMDLPNSATRIQTILTLWRKTRDFLVLVENGTKEGHQTLMEARDIVLEG  210

Query  1202  ERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCP--LEKSGKYCHFVQRLERTTS  1029
             E +               +    + A + APC HD PCP   EK    C+FVQ       
Sbjct  211   EEK---------------VPHTPNVAHVFAPCSHDLPCPKLAEKIVLPCNFVQ-------  248

Query  1028  QRAYKRSNGGSLRGFEDEKFSYVVFRRGQR-PRETWP  921
               AY           + EKFSY++ RR  R   E+WP
Sbjct  249   --AYHPLPFTWNPDVKLEKFSYLILRRQSRGSEESWP  283



>ref|XP_002905496.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY68337.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=412

 Score =   138 bits (347),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/284 (31%), Positives = 142/284 (50%), Gaps = 25/284 (9%)
 Frame = -1

Query  1775  PLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSP  1596
             PL   +    W +  +       Y   E +A++A  M A Y+  + V +E+++R+PDF P
Sbjct  118   PLDMSKTPLGWTMDRSQQIPPFAYGPAETLAFLAYEMEATYACTHAVFTELQKRLPDFKP  177

Query  1595  AKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSL  1416
               VLDF +G G+A W  ++ + +SL K  +VEPSQSM  A + +  G   L +     ++
Sbjct  178   KSVLDFVSGPGTASWVAKDFYDQSLDKYRVVEPSQSMVDAAEVVLEGFPGLSM---RRNI  234

Query  1415  QALSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGD--ILVLVEPGTPQGS  1242
               LS++I   N+ +DLV+ SYV  +I +  +R+     LW+L  +   LV+V+ G+P GS
Sbjct  235   TDLSRDIDAGNK-YDLVVVSYVFSDITNDFERVATTSALWELLSEDGCLVIVDRGSPWGS  293

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
             + +   R  +L +        +++ G         K G  IVAPCPH   CP+     +C
Sbjct  294   HHVRSARQFVLDL------VAEDADG---------KEGVRIVAPCPHHDECPV-GGNTWC  337

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRRGQRPRE  930
             HFVQR       R          +G    KFSY++ ++ ++  E
Sbjct  338   HFVQRSPVVNRPREVTTKRWHGQKG---SKFSYMIMQKTRKGSE  378



>ref|WP_028736064.1| methyltransferase type 11 [Rhizobium selenitireducens]
Length=332

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 125/247 (51%), Gaps = 42/247 (17%)
 Frame = -1

Query  1691  AIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKV  1512
             A AY+A+R+PA Y+A+   LS +    PDF P  +LDFGAG G+ FWA  + WP  L + 
Sbjct  51    AKAYLATRLPATYAAVRAALSMIEDASPDFQPTSLLDFGAGPGTVFWAASDAWPE-LDRA  109

Query  1511  NLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN---RQHDLVIASYVLGE  1341
              LVE S +++  G  L +        HS  +   L+ +I  +       DLV  +YVL E
Sbjct  110   TLVETSPAIRSVGSSLAK--------HSNIATNWLAGDITGTVPPLEPADLVTLAYVLDE  161

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             I        VV++LWDLT   +V+VEPGTP G   I   R                    
Sbjct  162   IAETA-IPNVVKRLWDLTAHTIVIVEPGTPAGWRRILAARQ-------------------  201

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                  T + +GA +VAPCPH   CP+  +  +CHF +R+ R+   R ++ S G  +  +E
Sbjct  202   -----TLIDAGAKVVAPCPHAQTCPI-TAPDWCHFSRRVARS---RVHRLSKGAEV-PWE  251

Query  980   DEKFSYV  960
             DEK+ ++
Sbjct  252   DEKYIFI  258



>ref|WP_014436240.1| hypothetical protein [Phycisphaera mikurensis]
 ref|YP_005444917.1| hypothetical protein PSMK_08610 [Phycisphaera mikurensis NBRC 
102666]
 dbj|BAM03020.1| hypothetical protein PSMK_08610 [Phycisphaera mikurensis NBRC 
102666]
Length=327

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 90/270 (33%), Positives = 130/270 (48%), Gaps = 37/270 (14%)
 Frame = -1

Query  1754  SKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFG  1575
             S+R++ QS  G I    E D+A+AY   RMP  ++A           +P F+PA +LD G
Sbjct  33    SERYRAQSGSGSI---VEPDDALAYAVVRMPGTFAATRAAAERAAEALPGFAPATLLDAG  89

Query  1574  AGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNI  1395
             AG G+   A R VWP       L      +  A +  + G  +     +    QAL+   
Sbjct  90    AGPGATTRACRAVWPSIRDATLLDHNPHLLAFAARSFSHGGDDAARTAAGRLPQALA---  146

Query  1394  KKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSH  1215
                 ++ DLV+A YVL E+ +  DR   + +LW LT  +L+LVEPGT  GS  + + R+ 
Sbjct  147   --VQQEADLVVAGYVLNEL-APADRAETLDRLWSLTRGVLLLVEPGTSAGSARLLEDRAR  203

Query  1214  ILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERT  1035
             ++ +                        GA +VAPC H G CPL +  ++CHF QRL R+
Sbjct  204   LIGL------------------------GARVVAPCSHAGRCPLLEHERWCHFAQRLPRS  239

Query  1034  TSQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
              + R  K    G    FEDEK+ Y+ F RG
Sbjct  240   RAHRDVK----GVDAAFEDEKYGYLAFSRG  265



>ref|WP_023813754.1| methyltransferase type 11 [Mesorhizobium sp. L2C084A000]
 gb|ESZ22773.1| methyltransferase type 11 [Mesorhizobium sp. L2C084A000]
Length=323

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/266 (35%), Positives = 133/266 (50%), Gaps = 49/266 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   ED A+ AY+A+R+PA Y+A+   L  +    P F P  +LD GAG G+A WA  E+
Sbjct  43    LHMAEDLAVKAYLATRLPATYAAIRTSLDALSDAKPAFQPKSLLDVGAGPGTALWATTEL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIA  1359
             WP  L++  L E S ++++ G+ L  G      I + +   A    I  ++ +  DLV  
Sbjct  103   WP-DLEQAVLFEASAAVRKVGETLAAG-----AIAAQTRWLAGDATIDLADLKSADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P L DR      LW LT D L++VEPGTP G   I  VR  +      
Sbjct  157   AYVLDEIAPASLPKLIDR------LWQLTADTLLVVEPGTPAGWQRILAVRRQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               +++GA ++APC H  PCPL +   +CHF +R+ R+   R  K
Sbjct  205   ------------------IEAGAHVLAPCAHQAPCPLIQP-DWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRRGQRP  936
              ++      +EDEKF YV   R +RP
Sbjct  246   DAD----VPWEDEKFIYVAASR-ERP  266



>ref|WP_006340740.1| hypothetical protein [Parachlamydia acanthamoebae]
 gb|EFB42091.1| hypothetical protein pah_c016o168 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=319

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 129/249 (52%), Gaps = 43/249 (17%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E ++Y+ +RMPA+Y    +V+  + +++P    + VLD GAG G+  WA   ++P  + K
Sbjct  55    ERMSYLVTRMPAIY----KVIEHILQQIPTTQISSVLDLGAGPGTGTWAATALFPHII-K  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
               LVE    + + GQ L     +     +    Q LS     +   HDLVI SYVLGE  
Sbjct  110   ATLVEQDAQLIKIGQRLA---THAAFPDTEWKPQCLSTF---TPFPHDLVIVSYVLGE--  161

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
              LKD   VV++ W  T   LV+VEPG+ +G   I Q R  IL +                
Sbjct  162   -LKDITEVVQKSWTSTEQFLVIVEPGSQRGFKTILQARQQILEL----------------  204

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                     G ++V PCP  G CP+ + G +CHF +R+ER+   R +++   G+L G+EDE
Sbjct  205   --------GGYLVGPCPQAGACPMSQ-GDWCHFFKRVERS---RIHRQCKEGAL-GYEDE  251

Query  974   KFSYVVFRR  948
             KFSYV+F R
Sbjct  252   KFSYVIFSR  260



>ref|WP_015687957.1| hypothetical protein [Bradyrhizobium sp. S23321]
 ref|YP_005452796.1| hypothetical protein S23_54920 [Bradyrhizobium sp. S23321]
 dbj|BAL78684.1| hypothetical protein S23_54920 [Bradyrhizobium sp. S23321]
Length=326

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 88/269 (33%), Positives = 127/269 (47%), Gaps = 37/269 (14%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PD +P  +LD GA
Sbjct  33    KISTTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPDLAPKTLLDVGA  92

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIK  1392
             G G+A WA  E +P SLQ   L++ + ++ R    L R    L        L   +    
Sbjct  93    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLALELARDSTRL---AECRYLPGEAGGNL  148

Query  1391  KSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHI  1212
                 Q DLV+ASY++GE+  +  R  +   +W      L+++EPGTP G   I  +R  +
Sbjct  149   AEVLQADLVVASYIIGELSEVDQR-KLAEAMWAKARHALIVIEPGTPAGYARILALRQQL  207

Query  1211  LWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTT  1032
                                     + +GA + APCPH+ PCPL     +CHF QRL R+ 
Sbjct  208   ------------------------ISAGAHVAAPCPHEKPCPLTPP-DWCHFSQRLPRSQ  242

Query  1031  SQRAYKRSNGGSLRGFEDEKFSYVVFRRG  945
             + R  K    G+   FEDE+F YV   R 
Sbjct  243   AHRQIK----GADVPFEDERFIYVALTRA  267



>gb|KFD69815.1| hypothetical protein M514_17937 [Trichuris suis]
Length=1138

 Score =   142 bits (358),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/261 (33%), Positives = 136/261 (52%), Gaps = 33/261 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E + + Y+ +R+   Y+   RVL E+++RVPDF P  V D+G+G G+  W  + +WP  +
Sbjct  457   EAKCLMYLIARLSPNYAVTLRVLREIKQRVPDFVPTTVFDYGSGLGTLHWVCQSLWPDVV  516

Query  1520  QKVNLVEPSQSMQR-AGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLG  1344
             +++ +V+ S  M   A   L   L ++P     +  Q LS +   S+RQ+DLV ++Y L 
Sbjct  517   KEMYMVDTSSDMNDLAANLLKNDLGDIP--QEVTMRQFLSAS---SDRQYDLVFSAYSLM  571

Query  1343  EIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR-KCRKLKESS  1167
             E P  + R+ VV  LW  T + L++VE G+  G  +I + R H+L M ++ +C +     
Sbjct  572   ECPEAEQRLYVVENLWRKTSNFLIIVENGSKAGHRLILEARDHLLKMTKKSECVE-----  626

Query  1166  GKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRG  987
                           FI APCPH+  CP  +S   C+F        +   Y     G+ R 
Sbjct  627   -------------NFIFAPCPHELLCPRAESRLPCNF--------AAPYYPFKFVGTKRD  665

Query  986   FEDEKFSYVVFRRGQRPRETW  924
                E FSY+VFR+GQ P+E++
Sbjct  666   SLCELFSYIVFRKGQGPKESF  686



>ref|XP_009824740.1| hypothetical protein, variant [Aphanomyces astaci]
 gb|ETV86268.1| hypothetical protein, variant [Aphanomyces astaci]
Length=397

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 129/258 (50%), Gaps = 18/258 (7%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVL---SEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             Y   E +AY+A  M  VYS+++ VL   ++       F P  +LDFG+G G+A W  +E 
Sbjct  112   YGPQETMAYMAFEMDGVYSSVHHVLRQMTDADGEATPFQPKSMLDFGSGPGTASWVAKEF  171

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIAS  1356
             +  SLQ+  LVEPSQSM  A   +  G + L       SL  + + I K  +Q+DL++AS
Sbjct  172   FDESLQEYRLVEPSQSMADAANVIMEGFRGLSF---RKSLGEMKREIAK-GKQYDLIMAS  227

Query  1355  YVLGEIPSLKDRITVVRQLWDLTGDI--LVLVEPGTPQGSNIISQVRSHILWMERRKCRK  1182
             +VL +I +  +RI +V  LW L  +   LVLV+ G   GS  +   R  IL        +
Sbjct  228   FVLSDITNDIERIAIVSTLWSLLAENGRLVLVDRGNSWGSLQVRSARQFILDSLTTNADE  287

Query  1181  LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNG  1002
             +  S   + +       G  ++ PCPH   CP+ K G++CHFVQR  R T  R       
Sbjct  288   VVVSDDATPRI-----QGGKVLGPCPHQKECPM-KEGEWCHFVQRTPRVTQPRLPTTQRW  341

Query  1001  GSLRGFEDEKFSYVVFRR  948
                 G+   KFSYV   +
Sbjct  342   A---GYTSMKFSYVTIEK  356



>ref|WP_029354405.1| methyltransferase type 11 [Mesorhizobium ciceri]
Length=320

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 88/261 (34%), Positives = 128/261 (49%), Gaps = 45/261 (17%)
 Frame = -1

Query  1703  EEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRS  1524
             EE    AY+A+R+PA Y+A+   L  +    PD++P  +LD GAG G+  WA  +VWP  
Sbjct  47    EEMAVKAYLATRLPATYAAVRASLDALSEARPDYAPKTLLDIGAGPGTVLWAALDVWP-D  105

Query  1523  LQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLG  1344
             LQ+  L+E S +++R G+ L        +      +     ++K +    +LV  +YVL 
Sbjct  106   LQQAVLIEASAAVRRVGEALATEAMTARVAWLAGDVTLDLADLKPA----ELVTCAYVLD  161

Query  1343  EI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKL  1179
             EI     P L DR      LW LT D L++VEPGTP G   I  VR  +           
Sbjct  162   EIGPASLPKLIDR------LWHLTDDTLLVVEPGTPAGWQRILAVRRQL-----------  204

Query  1178  KESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGG  999
                          +++GA ++APCPH+ PCPL     +CHF +R+ R+   R  K ++  
Sbjct  205   -------------IEAGAHVLAPCPHEAPCPLVPP-DWCHFSRRVARSRLHRLAKDAD--  248

Query  998   SLRGFEDEKFSYVVFRRGQRP  936
                 +EDEKF YV   R   P
Sbjct  249   --VPWEDEKFIYVAASRQAAP  267



>ref|WP_012920114.1| rRNA methyltransferase [Kribbella flavida]
 ref|YP_003380357.1| Ribosomal small subunit Rsm22 [Kribbella flavida DSM 17836]
 gb|ADB31558.1| Ribosomal small subunit Rsm22 [Kribbella flavida DSM 17836]
Length=331

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/283 (34%), Positives = 137/283 (48%), Gaps = 50/283 (18%)
 Frame = -1

Query  1742  KIQSAYGDIGLRYEEDEA------------IAYVASRMPAVYSALYRVLSEVRRRVPDFS  1599
             ++ +++  +  RY E++A            + Y A RMPA ++A+   L +V   +P+F 
Sbjct  23    ELSASFQRLSTRYREEQAATAPIMATPTDVVTYSAYRMPATFAAVRSALEQVAAVLPEFG  82

Query  1598  PAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSS  1419
             PA  LD G GTG+A WA  + WP SL  V ++E        G+ L RG  + P +   S 
Sbjct  83    PANQLDLGGGTGAAIWAAADTWP-SLSAVTVLEQVTEAIALGKKLARGAAS-PAVRGASW  140

Query  1418  LQA-LSQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGS  1242
             +   L Q+   +    DLV  SYVL E+ + + +  V R L    G ++VLVEPGTP G 
Sbjct  141   IPGRLDQS--AAFEPADLVTVSYVLSELSATQQQDLVAR-LCAQQG-LVVLVEPGTPGGY  196

Query  1241  NIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYC  1062
               I   R  +                        + +G  ++APCPHD  CP+ +   +C
Sbjct  197   ERIVAARDQL------------------------IAAGHSVIAPCPHDLACPIPRGRDWC  232

Query  1061  HFVQRLERTTSQRAYKRSNGGSLRGFEDEKFSYVV---FRRGQ  942
             HF  R+ R+   R   R+ G  L GFEDEKFSYVV     RGQ
Sbjct  233   HFTSRVNRSAVHR---RTKGAEL-GFEDEKFSYVVTSAVARGQ  271



>emb|CDX19175.1| Ribosomal small subunit Rsm22 [Mesorhizobium sp. ORS3324]
Length=321

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 92/258 (36%), Positives = 124/258 (48%), Gaps = 47/258 (18%)
 Frame = -1

Query  1691  AIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKV  1512
             A AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  + WP  L++ 
Sbjct  51    AKAYLATRLPATYAAVRSSLDALADARPDFQPKSLLDVGAGPGTMLWATADAWP-ELERA  109

Query  1511  NLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ-HDLVIASYVLGEI-  1338
              LVE S S+++ GQ L         I + +   A    I   + Q  DLV A+YVL EI 
Sbjct  110   VLVEASPSVRKVGQSLATD-----AIGARTDWIAGDATIDLDDLQPADLVSAAYVLDEIV  164

Query  1337  ----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKES  1170
                 P L DR      LW L+ D L+ VEPGTP G   I   R  +              
Sbjct  165   PASLPKLIDR------LWRLSADTLLFVEPGTPAGWQRILAARKQL--------------  204

Query  1169  SGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLR  990
                       + +GA+I APCPH+ PCPL     +CHF +R+ R+   R  K    G+  
Sbjct  205   ----------IDTGAYISAPCPHEAPCPLVPP-DWCHFARRVARSRLHRLAK----GADV  249

Query  989   GFEDEKFSYVVFRRGQRP  936
              +EDEKF Y+   R   P
Sbjct  250   PWEDEKFIYLAASRHPAP  267



>ref|WP_022090457.1| ribosomal small subunit Rsm22 [Clostridium sp. CAG:492]
 emb|CDA30232.1| ribosomal small subunit Rsm22 [Clostridium sp. CAG:492]
Length=319

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/259 (33%), Positives = 130/259 (50%), Gaps = 44/259 (17%)
 Frame = -1

Query  1712  LRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVW  1533
             L  E DEA+AY  SRMPA Y A Y  +++      +F+   V D GAGTGSA WA+ E+ 
Sbjct  45    LLTESDEAVAYALSRMPATYEADYSAINKTLEN-NNFNINTVFDIGAGTGSATWAITELV  103

Query  1532  PRSLQKVNLVEPSQSMQRAGQGL---TRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVI  1362
               S   +   E   SM + G+ L   +  LKN      +     +   I   N+  D ++
Sbjct  104   DNS-PNITCFEREDSMIKVGKKLMSYSEKLKNT----EWKKFDIVKDEI---NQTADFIM  155

Query  1361  ASYVLGEIPSLKDRIT-VVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
              SY++ E+P  K+ +  ++ +LW  T  IL+++EPGTP+G + I Q+RS +         
Sbjct  156   VSYMINELP--KNEVNKIISKLWKATNKILLVIEPGTPRGFSNIKQIRSQL---------  204

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                            L+  A I+APCPH+  C L +   +C F  R++R+   + +K   
Sbjct  205   ---------------LQENAHIIAPCPHENECKLPQDD-WCQFTARVQRSKIHKLFK---  245

Query  1004  GGSLRGFEDEKFSYVVFRR  948
              G L  +EDEKFSY+ F +
Sbjct  246   DGQL-SYEDEKFSYIAFSK  263



>ref|WP_027026335.1| methyltransferase type 11 [Mesorhizobium sp. URHA0056]
Length=320

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 128/252 (51%), Gaps = 47/252 (19%)
 Frame = -1

Query  1685  AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNL  1506
             AY+A+R+PA Y+A+   L  +    P+F+P  +LD GAG G+  WA  ++WP  L++  L
Sbjct  53    AYLATRLPATYAAVRASLDALNEARPEFAPKTLLDVGAGPGTVLWATSDLWP-ELEQATL  111

Query  1505  VEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIASYVLGEI---  1338
             +E S ++++ G+ L         I + +  QA    I  ++ R  DLV  +YVL EI   
Sbjct  112   LEASAAVRKVGETLAAD-----AIAARTVWQAGDVTIDLADLRPADLVTCAYVLDEIAPA  166

Query  1337  --PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSG  1164
               P + DR      LW LT D L++VEPGTP G   I  VR  +                
Sbjct  167   SLPKMVDR------LWQLTTDTLLIVEPGTPAGWQRILAVRRQL----------------  204

Query  1163  KSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGF  984
                     +++GA ++APCPH+ PCPL  +  +CHF +R+ R+   R  K +       +
Sbjct  205   --------IEAGAHVLAPCPHEAPCPL-IAPDWCHFSRRVARSRLHRLSKDAEV----PW  251

Query  983   EDEKFSYVVFRR  948
             EDEKF YV   R
Sbjct  252   EDEKFIYVAASR  263



>ref|WP_011085282.1| hypothetical protein [Bradyrhizobium diazoefficiens]
 ref|NP_769135.1| hypothetical protein bll2495 [Bradyrhizobium diazoefficiens USDA 
110]
 dbj|BAC47760.1| bll2495 [Bradyrhizobium diazoefficiens USDA 110]
Length=327

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/275 (33%), Positives = 133/275 (48%), Gaps = 51/275 (19%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  34    KISNTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPDFAPVTLLDVGA  93

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL-----  1407
             G G+A WA  E +P SLQ   L++ + ++ R           L L H  + L        
Sbjct  94    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLA---------LELAHDSTRLAGCRYLPG  143

Query  1406  --SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
                 N+ + +   DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I
Sbjct  144   DAGGNLAEVS-PADLVVASYIIGEL-GEADQRKLAETMWAKARHALVVIEPGTPAGYARI  201

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
               +R  +                        + +GA++ APCPH+ PCPL  +  +CHF 
Sbjct  202   LALRQQM------------------------IAAGAYVAAPCPHERPCPL-IAPDWCHFS  236

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             QRL R+ + R  K    G+   FEDE+F YV   R
Sbjct  237   QRLPRSQAHRQIK----GADVPFEDERFIYVALTR  267



>ref|WP_023761613.1| methyltransferase type 11 [Mesorhizobium sp. LNHC252B00]
 gb|ESY67938.1| methyltransferase type 11 [Mesorhizobium sp. LNHC252B00]
Length=325

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 131/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             +   ED A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  + 
Sbjct  43    MHMAEDLAVKAYLATRLPATYAAIRASLDALSDAKPDFQPRSLLDVGAGPGTVLWATTDQ  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQ-HDLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +S  A    I  +  +  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGEVLAGD-----AIAARTSWLAGDATIDLAGLEPADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P L DR      LW +TGD L++VEPGTP G   I  VR  +      
Sbjct  157   AYVLDEIVPASLPKLIDR------LWQVTGDTLLIVEPGTPAGWQRILAVRRQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               +++GA ++APCPH  PCPL +   +CHF +R+ R+   R  K
Sbjct  205   ------------------IEAGAHVLAPCPHQAPCPLAQP-DWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              ++      +EDEKF YV   R
Sbjct  246   DAD----VPWEDEKFIYVAASR  263



>ref|WP_011176435.1| hypothetical protein [Candidatus Protochlamydia amoebophila]
 ref|YP_008889.1| hypothetical protein pc1890 [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF24614.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila 
UWE25]
Length=323

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 131/251 (52%), Gaps = 34/251 (14%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             + + ++Y+A+R+PA Y+A+Y+ L+++++ V   S   +LD GAG G+  WA  +++P  L
Sbjct  46    DQQRLSYLATRLPATYAAVYQTLNQIKKTVNGISIHSLLDLGAGPGTTLWAAAQIFP--L  103

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             Q   L E  QS+   GQ L +  K L +  +    +     + +    HD+V  SY +GE
Sbjct  104   QTATLFEKDQSLALLGQKLAQR-KELAVFQN-CQWKIGDLELLEELPVHDMVTLSYSIGE  161

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             + S      V+++ W  T +ILV++EPGTP G   I  +R                    
Sbjct  162   LSS-ASIFPVLQKCWQATKEILVIIEPGTPTGFERIRLIRQ-------------------  201

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                  T +  G  IVAPC H   CP+ + G +CHF  R+ER++  R   R  GG+L  +E
Sbjct  202   -----TLIDMGGHIVAPCSHALKCPILR-GDWCHFTARIERSSFHR---RLKGGTL-NYE  251

Query  980   DEKFSYVVFRR  948
             DEKFSY+V  +
Sbjct  252   DEKFSYIVVSK  262



>ref|WP_038645711.1| methyltransferase type 11 [Mesorhizobium huakuii]
 gb|AID29099.1| small ribosomal subunit Rsm22 family protein [Mesorhizobium huakuii 
7653R]
Length=323

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 132/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  ++
Sbjct  43    LHMAQDMAVKAYLATRLPATYAAVRASLDALNATRPDFEPKTLLDVGAGPGTVLWATNDL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +  +A    I  ++ R  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGETLAAD-----AITTRTIWRAGDVTIDLADLRPADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P + DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIVPASLPKMVDR------LWQLTTDTLLIVEPGTPAGWQRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH+ PCPL     +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHLLAPCPHEAPCPLTPP-DWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              ++      +EDEKF +V   R
Sbjct  246   DAD----VPWEDEKFIFVAASR  263



>ref|XP_008113590.1| PREDICTED: methyltransferase-like protein 17, mitochondrial [Anolis 
carolinensis]
Length=507

 Score =   138 bits (347),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 136/277 (49%), Gaps = 32/277 (12%)
 Frame = -1

Query  1736  QSAYGDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSA  1557
             ++ Y    L Y E+ +  Y+A+RM  +++A+YR L E+++RVPDF P  +LDFG+GTG+ 
Sbjct  184   KTTYHWEALDYTEELSFLYMAARMDGMFAAVYRALHEIQKRVPDFQPRTLLDFGSGTGTV  243

Query  1556  FWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGL--KNLPLIHSYSSLQALSQNIKKSN  1383
              WA   +W  ++++   ++ S +M    + L +GL     PL       Q L  + K   
Sbjct  244   SWAAHSIWGETIKEYMNIDSSAAMLDLAEKLMKGLSENQDPLFPGVYFRQFLPVSPKV--  301

Query  1382  RQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWM  1203
              + DLV+++Y L E+ S  +R+  V+ LW  T   LVLVE GT +G  I+ + R  +L  
Sbjct  302   -KFDLVVSAYSLNELRSYSERVETVQTLWRKTDGFLVLVENGTKEGHQILMEARDVVL--  358

Query  1202  ERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKY--CHFVQRLERTTS  1029
                          K    +        + APCPH  PCPL  S +   C+F QR      
Sbjct  359   -------------KGTDKVVHDPREPHVFAPCPHHLPCPLLSSDRVLPCNFTQR------  399

Query  1028  QRAYKRSNGGSLRGFEDEKFSYVVFRRGQ-RPRETWP  921
                Y           ++E+FS+++ RRG     E WP
Sbjct  400   ---YYALPFSWNPAQKEERFSFLILRRGAGETEEPWP  433



>ref|WP_038967972.1| SAM-dependent methyltransferase [Bradyrhizobium sp. CCBAU 41267]
Length=325

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/275 (33%), Positives = 133/275 (48%), Gaps = 51/275 (19%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  32    KISNTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPDFAPVTLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL-----  1407
             G G+A WA  E +P SLQ   L++ + ++ R           L L H  + L        
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLA---------LELAHDSTRLAGCRYLPG  141

Query  1406  --SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
                 N+ + +   DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I
Sbjct  142   DAGGNLAEVS-PADLVVASYIIGEL-GEADQRKLAETMWAKARHALVVIEPGTPAGYARI  199

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
               +R  +                        + +GA++ APCPH+ PCPL  +  +CHF 
Sbjct  200   LALRQQM------------------------IAAGAYVAAPCPHERPCPL-IAPDWCHFS  234

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             QRL R+ + R  K    G+   FEDE+F YV   R
Sbjct  235   QRLPRSQAHRQIK----GADVPFEDERFIYVALTR  265



>ref|WP_027057636.1| methyltransferase type 11 [Mesorhizobium loti]
Length=325

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 132/258 (51%), Gaps = 40/258 (16%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  E+
Sbjct  43    LHMAQDMAVKAYLATRLPATYAAVRASLGALNEAWPDFMPKTLLDVGAGPGTVLWATSEL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQH-DLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +  +A       ++ Q  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGETLAAD-----AITARTEWRAGDVTTDLADLQSADLVTC  156

Query  1358  SYVLGEI-PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRK  1182
             +YVL EI P+   ++  V +LW LT D L++VEPGTP G   I  VR+ +          
Sbjct  157   AYVLDEIVPASLPKM--VARLWQLTTDTLLIVEPGTPAGWQRILAVRAQL----------  204

Query  1181  LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNG  1002
                           + +GA ++APCPH+ PCPL     +CHF +R+ R+   R  K +  
Sbjct  205   --------------IAAGAHVLAPCPHEAPCPLSPP-DWCHFARRVARSRLHRLAKDAE-  248

Query  1001  GSLRGFEDEKFSYVVFRR  948
                  +EDEKF +V   R
Sbjct  249   ---VPWEDEKFIFVAVSR  263



>ref|WP_019857262.1| methyltransferase type 11 [Mesorhizobium loti]
Length=323

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 132/262 (50%), Gaps = 48/262 (18%)
 Frame = -1

Query  1712  LRYEEDEAI-AYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             L   +D A+ AY+A+R+PA Y+A+   L  +    PDF P  +LD GAG G+  WA  ++
Sbjct  43    LHMAQDMAVKAYLATRLPATYAAVRASLDALNATRPDFEPKTLLDVGAGPGTVLWATNDL  102

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSN-RQHDLVIA  1359
             WP  L++  L+E S ++++ G+ L         I + +  +A    I  ++ R  DLV  
Sbjct  103   WP-DLEQAVLLEASAAVRKVGEMLAAD-----AITTRTIWRAGDVTIDLADLRPADLVTC  156

Query  1358  SYVLGEI-----PSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERR  1194
             +YVL EI     P + DR      LW LT D L++VEPGTP G   I  VR+ +      
Sbjct  157   AYVLDEIVPASLPKMVDR------LWQLTTDTLLIVEPGTPAGWQRILAVRAQL------  204

Query  1193  KCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYK  1014
                               + +GA ++APCPH+ PCPL     +CHF +R+ R+   R  K
Sbjct  205   ------------------IAAGAHLLAPCPHEAPCPLTPP-DWCHFSRRVARSRLHRLAK  245

Query  1013  RSNGGSLRGFEDEKFSYVVFRR  948
              ++      +EDEKF +V   R
Sbjct  246   DAD----VPWEDEKFIFVAASR  263



>ref|WP_013924087.1| hypothetical protein [Parachlamydia acanthamoebae]
 ref|YP_004650848.1| hypothetical protein PUV_00440 [Parachlamydia acanthamoebae UV-7]
 emb|CCB84994.1| putative uncharacterized protein [Parachlamydia acanthamoebae 
UV-7]
 gb|KIA76570.1| hypothetical protein DB43_AB00350 [Parachlamydia acanthamoebae]
Length=319

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 128/249 (51%), Gaps = 43/249 (17%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             E ++Y+ +RMPA Y    +V+  + +++P    + VLD GAG G+  WA   ++P  + K
Sbjct  55    ERMSYLVTRMPATY----KVIEHILQQIPTTQISSVLDLGAGPGTGTWAATALFPH-ITK  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIP  1335
               LVE    + + GQ L     +     +    Q LS     +   HDLVI SYVLGE  
Sbjct  110   ATLVEQDAQLIKIGQRLA---THAAFPDTEWKPQCLS---TFTPLPHDLVIVSYVLGE--  161

Query  1334  SLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSC  1155
              LKD   VV++ W  T   LV+VEPG+ +G   I Q R  IL +                
Sbjct  162   -LKDITEVVQKSWTSTEQFLVIVEPGSQRGFKTILQARQQILEL----------------  204

Query  1154  KALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFEDE  975
                     G ++V PCP  G CP+ + G +CHF +R+ER+   R +++   G+L G+EDE
Sbjct  205   --------GGYLVGPCPQAGACPMSQ-GDWCHFSKRVERS---RIHRQCKEGAL-GYEDE  251

Query  974   KFSYVVFRR  948
             KFSYV+F R
Sbjct  252   KFSYVIFSR  260



>ref|WP_007608918.1| methyltransferase type 11 [Rhizobium sp. PDO1-076]
 gb|EHS48690.1| Ribosomal small subunit Rsm22 [Rhizobium sp. PDO1-076]
Length=323

 Score =   135 bits (339),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 90/261 (34%), Positives = 131/261 (50%), Gaps = 47/261 (18%)
 Frame = -1

Query  1709  RYEEDEAIA---YVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMRE  1539
             R+  D+A+A   Y+A+RMPA Y+A+   LS V    PDF P   +D G+G G+AFWA ++
Sbjct  42    RFHIDDALAAKAYLATRMPATYAAVRAALSMVEDVAPDFEPRTQIDLGSGPGTAFWAAQD  101

Query  1538  VWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHS---YSSLQALSQNIKKSNRQHDL  1368
              WP+ +Q  ++VE S +++  G  L R    +   H+      + AL+          DL
Sbjct  102   AWPQ-MQSADMVEASAAIRSVGDALARHATVMARWHAGDVTGKIPALAPA--------DL  152

Query  1367  VIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKC  1188
             V  +YVL E+P       V  +LW LT D+LV++EPGT  G   I  VR           
Sbjct  153   VTLAYVLDELPPAT-IAAVTTKLWALTTDMLVIIEPGTTAGWQRILAVRE----------  201

Query  1187  RKLKESSGKSCKALTTLK-SGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKR  1011
                            TLK +GA +VAPC H+  CP+E    +CHF +R+ R+   R  K 
Sbjct  202   ---------------TLKAAGAHLVAPCSHEHDCPIEVP-DWCHFSRRVARSRVHRLAK-  244

Query  1010  SNGGSLRGFEDEKFSYVVFRR  948
                G+   +EDEKF ++   R
Sbjct  245   ---GAEVPWEDEKFIFIAASR  262



>ref|WP_005165201.1| Methyltransferase [Amycolatopsis azurea]
 gb|EMD23475.1| Methyltransferase [Amycolatopsis azurea DSM 43854]
Length=329

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 125/251 (50%), Gaps = 33/251 (13%)
 Frame = -1

Query  1700  EDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSL  1521
             E +  AY   RMPA Y+A++ VL+E   R P F+P   +D G GTG+A WA   VWP SL
Sbjct  49    EADIAAYAGYRMPATYAAVHAVLAEAALRTPGFAPRTQIDIGGGTGAAIWAAAGVWP-SL  107

Query  1520  QKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
             ++  +VE        G+ L  G      + + +  + L      +    DLV  SYVLGE
Sbjct  108   EESTVVEQVPGAIELGRRLA-GSAAERAVRTSTWRRGLIDPAAPAP-DADLVTLSYVLGE  165

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +P  + R  VV  L    G +LVL+EPGTP G   I + R  ++ +              
Sbjct  166   LPEAR-RADVVHWLSAKAG-MLVLIEPGTPAGYERIVEARDRLVEL--------------  209

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                       G  +VAPCPH+G CP+ +   +CHF  RL RT   R  K    G+L GFE
Sbjct  210   ----------GLSLVAPCPHEGACPIPRGKDWCHFSARLPRTGLHRQLK---SGTL-GFE  255

Query  980   DEKFSYVVFRR  948
             DEKFSYVV  R
Sbjct  256   DEKFSYVVASR  266



>gb|KGG52427.1| hypothetical protein DI09_173p10 [Microsporidia sp. UGP3]
Length=531

 Score =   138 bits (347),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 100/302 (33%), Positives = 145/302 (48%), Gaps = 44/302 (15%)
 Frame = -1

Query  1829  KEANLLLPTTTSKEIVEDPLKSVECSKRWKIQSAYGDIGLRYEEDEAIAYVASRMPAVYS  1650
             + AN +LP   S +  ++ + S  CSKR      +  +   Y E +A+AY   + P  Y+
Sbjct  117   QAANQILPP--SPDFRDNRILS-PCSKRLA-DVDFSHLSREYNERDALAYATVQSPLTYA  172

Query  1649  ALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQ  1470
              ++RV SE+ RR PD++P+ VLDFG G G+A WA + +W   L     V+ S++M     
Sbjct  173   PIFRVFSELTRRFPDWAPSSVLDFGCGPGTALWAAKAIWGNRLGTCTGVDLSEAMIDFAD  232

Query  1469  GLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIASYVLGEIPSLK----DRITV---  1311
              +T  L     I +         N K   + +++VIAS+VL E+ S+     DR  +   
Sbjct  233   KITSKLGGEHAIEAIYRRYLHFHNEK--GQFYEMVIASFVLNELDSVPTKEGDRPVLELT  290

Query  1310  VRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGKSCKALTTLKS  1131
             +  LW  T   LVLVE G+P GS +I Q R HIL                        K 
Sbjct  291   LNNLWKSTNSFLVLVERGSPLGSKLIIQARDHIL-----------------------AKG  327

Query  1130  GAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSL-RGFEDEKFSYVVF  954
              A +VAPCPH G CP+   G +CHF QR     SQ   +  +     R   D +FSYVV 
Sbjct  328   NAQVVAPCPHSGTCPM--LGSWCHFSQR-----SQLPREMMDSMKFKRNITDCRFSYVVL  380

Query  953   RR  948
             ++
Sbjct  381   QK  382



>gb|KGJ67969.1| hypothetical protein BJA5080_01132 [Bradyrhizobium diazoefficiens 
SEMIA 5080]
Length=327

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/275 (33%), Positives = 133/275 (48%), Gaps = 51/275 (19%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  34    KISNTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPDFAPETLLDVGA  93

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL-----  1407
             G G+A WA  E +P SLQ   L++ + ++ R           L L H  + L        
Sbjct  94    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLA---------LELAHDSTRLADCRYLPG  143

Query  1406  --SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
                 N+ + +   DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I
Sbjct  144   DAGGNLAEVS-PADLVVASYIIGEL-GEADQRKLAETMWAKARHALVVIEPGTPAGYARI  201

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
               +R  +                        + +GA++ APCPH+ PCPL  +  +CHF 
Sbjct  202   LALRQQV------------------------IAAGAYVAAPCPHERPCPL-IAPDWCHFS  236

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             QRL R+ + R  K    G+   FEDE+F YV   R
Sbjct  237   QRLPRSQAHRQIK----GADVPFEDERFIYVALTR  267



>ref|WP_024513745.1| SAM-dependent methyltransferase [Bradyrhizobium sp. Tv2a-2]
Length=325

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 132/260 (51%), Gaps = 34/260 (13%)
 Frame = -1

Query  1724  GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAM  1545
             G  G    E +A+AY  +RMPA Y+A+   L+ +    P F+P  +LD GAG G+A +A 
Sbjct  41    GGSGTIRTEVDALAYALARMPATYAAVTACLNALLEVRPHFTPHSLLDIGAGPGTASFAA  100

Query  1544  REVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLV  1365
              E +P SLQ   L++ + +++     L+R    +  + +Y++ +A S          DLV
Sbjct  101   AEAFP-SLQSFALLDRNSALRALANELSRETARMNQM-TYAAGEARSTLALAD--AADLV  156

Query  1364  IASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCR  1185
             +ASYV+GE+ +  +R  +V   W  T D L++VEPGTP G       R+ +         
Sbjct  157   VASYVIGEL-TEAERDELVALAWRKTSDTLLIVEPGTPAGYARAMAARAQL---------  206

Query  1184  KLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSN  1005
                               GA + APCPH+  CPL     +CHF QRL R+   RA+K+  
Sbjct  207   ---------------TAGGAHVAAPCPHESACPLAPP-DWCHFAQRLARS---RAHKQIK  247

Query  1004  GGSLRGFEDEKFSYVVFRRG  945
             G  L  FEDEKFSYV+  R 
Sbjct  248   GAEL-PFEDEKFSYVIMTRA  266



>ref|WP_028175023.1| MULTISPECIES: SAM-dependent methyltransferase [Bradyrhizobium]
Length=325

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/275 (33%), Positives = 133/275 (48%), Gaps = 51/275 (19%)
 Frame = -1

Query  1742  KIQSAY---GDIGLRYEEDEAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGA  1572
             KI + Y   G  G    E +A+AY  +RMPA Y+A+   L+ +    PDF+P  +LD GA
Sbjct  32    KISNTYRAGGGSGTIKSEADALAYALARMPATYAAVAASLNALTEIAPDFAPETLLDVGA  91

Query  1571  GTGSAFWAMREVWPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQAL-----  1407
             G G+A WA  E +P SLQ   L++ + ++ R           L L H  + L        
Sbjct  92    GPGTASWAAAEAFP-SLQDFTLLDANATLSRLA---------LELAHDSTRLADCRYLPG  141

Query  1406  --SQNIKKSNRQHDLVIASYVLGEIPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNII  1233
                 N+ + +   DLV+ASY++GE+    D+  +   +W      LV++EPGTP G   I
Sbjct  142   DAGGNLAEVS-PADLVVASYIIGEL-GEADQRKLAETMWAKARHALVVIEPGTPAGYARI  199

Query  1232  SQVRSHILWMERRKCRKLKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFV  1053
               +R  +                        + +GA++ APCPH+ PCPL  +  +CHF 
Sbjct  200   LALRQQV------------------------IAAGAYVAAPCPHERPCPL-IAPDWCHFS  234

Query  1052  QRLERTTSQRAYKRSNGGSLRGFEDEKFSYVVFRR  948
             QRL R+ + R  K    G+   FEDE+F YV   R
Sbjct  235   QRLPRSQAHRQIK----GADVPFEDERFIYVALTR  265



>ref|XP_009824739.1| hypothetical protein H257_02690 [Aphanomyces astaci]
 gb|ETV86267.1| hypothetical protein H257_02690 [Aphanomyces astaci]
Length=465

 Score =   137 bits (345),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 129/258 (50%), Gaps = 18/258 (7%)
 Frame = -1

Query  1706  YEEDEAIAYVASRMPAVYSALYRVL---SEVRRRVPDFSPAKVLDFGAGTGSAFWAMREV  1536
             Y   E +AY+A  M  VYS+++ VL   ++       F P  +LDFG+G G+A W  +E 
Sbjct  112   YGPQETMAYMAFEMDGVYSSVHHVLRQMTDADGEATPFQPKSMLDFGSGPGTASWVAKEF  171

Query  1535  WPRSLQKVNLVEPSQSMQRAGQGLTRGLKNLPLIHSYSSLQALSQNIKKSNRQHDLVIAS  1356
             +  SLQ+  LVEPSQSM  A   +  G + L       SL  + + I K  +Q+DL++AS
Sbjct  172   FDESLQEYRLVEPSQSMADAANVIMEGFRGLSF---RKSLGEMKREIAK-GKQYDLIMAS  227

Query  1355  YVLGEIPSLKDRITVVRQLWDLTGDI--LVLVEPGTPQGSNIISQVRSHILWMERRKCRK  1182
             +VL +I +  +RI +V  LW L  +   LVLV+ G   GS  +   R  IL        +
Sbjct  228   FVLSDITNDIERIAIVSTLWSLLAENGRLVLVDRGNSWGSLQVRSARQFILDSLTTNADE  287

Query  1181  LKESSGKSCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNG  1002
             +  S   + +       G  ++ PCPH   CP+ K G++CHFVQR  R T  R       
Sbjct  288   VVVSDDATPRI-----QGGKVLGPCPHQKECPM-KEGEWCHFVQRTPRVTQPRLPTTQRW  341

Query  1001  GSLRGFEDEKFSYVVFRR  948
                 G+   KFSYV   +
Sbjct  342   A---GYTSMKFSYVTIEK  356



>ref|WP_024919400.1| MULTISPECIES: SAM-dependent methyltransferase [Afipia]
Length=331

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 87/258 (34%), Positives = 134/258 (52%), Gaps = 41/258 (16%)
 Frame = -1

Query  1694  EAIAYVASRMPAVYSALYRVLSEVRRRVPDFSPAKVLDFGAGTGSAFWAMREVWPRSLQK  1515
             +A+AY  +RMPA Y+A+   L+ +    P F+P+ +LD GAG G+A WA  E +  SL+ 
Sbjct  51    DALAYALARMPATYAAITASLNALTEIRPGFAPSSLLDVGAGPGTATWAASETF-ASLET  109

Query  1514  VNLVEPSQSMQRAGQGLTRGLKNLPLI--HSYSSLQALSQNIKKSNRQHDLVIASYVLGE  1341
               L++ + +++     L +    L  +   S  + +AL++       + DLV+ASYV+ E
Sbjct  110   FTLLDANVALRDLATELAQPHLRLAAMRYQSGDARKALAE-----APEADLVVASYVINE  164

Query  1340  IPSLKDRITVVRQLWDLTGDILVLVEPGTPQGSNIISQVRSHILWMERRKCRKLKESSGK  1161
             +    +R  +   +W  T D L++VEPGTP G   +  +R  +                 
Sbjct  165   LGD-GERAALADAMWAKTRDTLLVVEPGTPAGYARVIDLRDRL-----------------  206

Query  1160  SCKALTTLKSGAFIVAPCPHDGPCPLEKSGKYCHFVQRLERTTSQRAYKRSNGGSLRGFE  981
                    +  GA ++APCPHD  CPL +   +CHF QRL+R+   RA+K   G  L  +E
Sbjct  207   -------IAKGARVIAPCPHDAACPLTRP-DWCHFTQRLQRS---RAHKHLKGADLP-YE  254

Query  980   DEKFSYVVFRR---GQRP  936
             DEKF+YVV  R    QRP
Sbjct  255   DEKFAYVVLSRTAPAQRP  272



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7551301571184