BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25786_g2_i2 len=2652 path=[30023:0-1189 31213:1190-1272
45010:1273-1357 31296:1358-1422 31361:1423-1489 9162:1490-1539
47359:1540-1540 31427:1541-1824 5491:1825-1903 @5570@!:1904-2266
5933:2267-2538 6205:2539-2570 6237:2571-2651]

Length=2652
                                                                      Score     E

ref|XP_004240466.1|  PREDICTED: zinc finger HIT domain-containing...    186   3e-51   
ref|XP_009788871.1|  PREDICTED: zinc finger HIT domain-containing...    185   7e-51   
ref|XP_006364547.1|  PREDICTED: zinc finger HIT domain-containing...    184   3e-50   
ref|XP_010652457.1|  PREDICTED: transcription factor PIF1 isoform X2    107   1e-48   
ref|XP_010652454.1|  PREDICTED: transcription factor PIF1 isoform X1    107   1e-48   
emb|CDP03833.1|  unnamed protein product                                109   1e-47   
ref|XP_009597634.1|  PREDICTED: zinc finger HIT domain-containing...    176   1e-47   
ref|XP_004240467.1|  PREDICTED: transcription factor PIF1-like is...    106   7e-47   
ref|XP_010321805.1|  PREDICTED: transcription factor PIF1-like is...    106   8e-47   
ref|XP_010652458.1|  PREDICTED: transcription factor PIF1 isoform X3    107   3e-46   
ref|XP_011080155.1|  PREDICTED: zinc finger HIT domain-containing...    165   1e-43   
ref|XP_009591396.1|  PREDICTED: transcription factor PIF1-like        88.2    1e-43   
ref|NP_001238734.1|  uncharacterized protein LOC100527614               164   2e-43   
gb|AGW52145.1|  PIL                                                   98.6    5e-43   
ref|XP_006364548.1|  PREDICTED: transcription factor PIF1-like          107   7e-43   
ref|XP_010245667.1|  PREDICTED: zinc finger HIT domain-containing...    162   2e-42   
emb|CDP03834.1|  unnamed protein product                                162   2e-42   
ref|XP_009794497.1|  PREDICTED: transcription factor PIF1             87.8    3e-42   
ref|XP_003542452.1|  PREDICTED: zinc finger HIT domain-containing...    161   4e-42   
ref|XP_007201708.1|  hypothetical protein PRUPE_ppa004070mg           92.8    1e-41   
ref|XP_010038345.1|  PREDICTED: zinc finger HIT domain-containing...    159   2e-41   
gb|EYU46363.1|  hypothetical protein MIMGU_mgv1a016147mg                158   5e-41   
ref|XP_010038342.1|  PREDICTED: transcription factor PIF1-like is...  95.1    7e-41   
ref|XP_010038341.1|  PREDICTED: transcription factor PIF1-like is...  94.7    8e-41   
ref|XP_008235534.1|  PREDICTED: zinc finger HIT domain-containing...    157   9e-41   
ref|XP_002303090.1|  PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 fami...  90.9    1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006588422.1|  PREDICTED: uncharacterized protein LOC100527...    156   4e-40   
ref|XP_006480182.1|  PREDICTED: zinc finger HIT domain-containing...    154   7e-40   
gb|KHG18014.1|  Transcription factor PIF1 -like protein               96.7    2e-39   
ref|XP_007144440.1|  hypothetical protein PHAVU_007G156300g             152   4e-39   
ref|XP_010245666.1|  PREDICTED: zinc finger HIT domain-containing...    153   5e-39   
ref|XP_010264020.1|  PREDICTED: transcription factor PIF1-like is...  87.4    7e-39   
gb|EYU46364.1|  hypothetical protein MIMGU_mgv1a007040mg              83.2    2e-38   
ref|XP_006594071.1|  PREDICTED: zinc finger HIT domain-containing...    151   2e-38   
ref|XP_010264023.1|  PREDICTED: transcription factor PIF1-like is...  85.5    2e-38   
gb|KCW50158.1|  hypothetical protein EUGRSUZ_K03592                   86.3    2e-38   
ref|XP_007200166.1|  hypothetical protein PRUPE_ppa016705mg             150   3e-38   
ref|XP_010548716.1|  PREDICTED: zinc finger HIT domain-containing...    150   3e-38   
gb|KHN48975.1|  Zinc finger HIT domain-containing protein 3             149   7e-38   
ref|XP_009597633.1|  PREDICTED: transcription factor PIF1-like        87.8    1e-37   
ref|XP_008372430.1|  PREDICTED: zinc finger HIT domain-containing...    149   1e-37   
ref|XP_011024540.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  87.4    2e-37   
ref|XP_009371129.1|  PREDICTED: zinc finger HIT domain-containing...    148   2e-37   
ref|XP_009371119.1|  PREDICTED: zinc finger HIT domain-containing...    147   4e-37   
ref|XP_010548715.1|  PREDICTED: zinc finger HIT domain-containing...    147   5e-37   
ref|XP_004495024.1|  PREDICTED: zinc finger HIT domain-containing...    144   6e-36   
ref|XP_002263221.1|  PREDICTED: zinc finger HIT domain-containing...    142   2e-35   Vitis vinifera
gb|KEH42413.1|  HIT zinc finger protein                                 141   8e-35   
ref|XP_004290030.1|  PREDICTED: zinc finger HIT domain-containing...    140   1e-34   
gb|AFK35496.1|  unknown                                                 140   1e-34   
ref|XP_009400770.1|  PREDICTED: zinc finger HIT domain-containing...    137   1e-33   
emb|CDY05725.1|  BnaC07g00780D                                        80.1    1e-33   
ref|XP_007049885.1|  Phytochrome interacting factor 3-like 5, put...  87.0    3e-33   
ref|XP_007049883.1|  Phytochrome interacting factor 3-like 5, put...  87.0    3e-33   
ref|XP_011024542.1|  PREDICTED: zinc finger HIT domain-containing...    135   4e-33   
emb|CDY31989.1|  BnaA07g00060D                                        83.6    4e-33   
ref|XP_007049879.1|  HIT-type Zinc finger family protein, putativ...    136   7e-33   
ref|XP_003521328.1|  PREDICTED: transcription factor PIF1-like is...  83.6    8e-33   
ref|XP_006576979.1|  PREDICTED: transcription factor PIF1-like is...  83.2    9e-33   
gb|KDP26428.1|  hypothetical protein JCGZ_17586                       87.0    9e-33   
gb|KEH42414.1|  transcription factor                                  87.4    2e-32   
ref|XP_006386897.1|  hypothetical protein POPTR_0002s25400g             133   2e-32   
gb|KDO65837.1|  hypothetical protein CISIN_1g014090mg                 85.9    2e-32   
gb|KDO65840.1|  hypothetical protein CISIN_1g014090mg                 85.5    2e-32   
emb|CBI37249.3|  unnamed protein product                              85.9    3e-32   
ref|XP_006443673.1|  hypothetical protein CICLE_v10019585mg           85.5    4e-32   
ref|XP_010922567.1|  PREDICTED: zinc finger HIT domain-containing...    132   4e-32   
ref|XP_008461998.1|  PREDICTED: transcription factor PIF1               141   6e-32   
ref|XP_010109673.1|  hypothetical protein L484_015158                 85.5    1e-31   
ref|XP_004139727.1|  PREDICTED: transcription factor PIF1-like          140   1e-31   
gb|KGN44558.1|  hypothetical protein Csa_7G333400                       140   2e-31   
ref|XP_004495025.1|  PREDICTED: transcription factor PIF1-like is...  86.3    2e-31   
ref|XP_006412907.1|  hypothetical protein EUTSA_v10026155mg             134   2e-31   
ref|XP_010684992.1|  PREDICTED: zinc finger HIT domain-containing...    131   2e-31   
ref|XP_010245663.1|  PREDICTED: transcription factor PIF1-like is...  85.9    4e-31   
ref|XP_006412908.1|  hypothetical protein EUTSA_v10026155mg             132   1e-30   
ref|XP_010245662.1|  PREDICTED: transcription factor PIF1-like is...  85.9    1e-30   
ref|XP_008464779.1|  PREDICTED: zinc finger HIT domain-containing...    128   2e-30   
ref|XP_006854319.1|  hypothetical protein AMTR_s00039p00115710          127   6e-30   
gb|KHG01839.1|  Transcription factor PIF1 -like protein               83.6    7e-30   
gb|KDO65841.1|  hypothetical protein CISIN_1g032470mg                   126   1e-29   
ref|XP_010438378.1|  PREDICTED: zinc finger HIT domain-containing...    126   2e-29   
ref|XP_004146755.1|  PREDICTED: zinc finger HIT domain-containing...    125   2e-29   
gb|ABK22660.1|  unknown                                                 125   3e-29   Picea sitchensis
ref|XP_002521150.1|  Phytochrome-interacting factor, putative         87.0    3e-29   Ricinus communis
ref|XP_008805224.1|  PREDICTED: zinc finger HIT domain-containing...    123   1e-28   
gb|EYU17967.1|  hypothetical protein MIMGU_mgv1a007316mg              83.6    1e-28   
ref|XP_006282741.1|  hypothetical protein CARUB_v10005894mg             124   1e-28   
ref|XP_010438381.1|  PREDICTED: zinc finger HIT domain-containing...    124   2e-28   
ref|XP_011083103.1|  PREDICTED: transcription factor PIF1             85.5    3e-28   
ref|XP_008235752.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  85.1    4e-28   
ref|XP_009129269.1|  PREDICTED: zinc finger HIT domain-containing...    122   6e-28   
ref|XP_002301830.1|  zinc finger family protein                         121   7e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009137810.1|  PREDICTED: zinc finger HIT domain-containing...    122   9e-28   
ref|XP_010433160.1|  PREDICTED: zinc finger HIT domain-containing...    121   1e-27   
ref|XP_010433161.1|  PREDICTED: zinc finger HIT domain-containing...    121   2e-27   
ref|XP_004493861.1|  PREDICTED: transcription factor PIF1-like is...  84.7    2e-27   
ref|XP_009129271.1|  PREDICTED: zinc finger HIT domain-containing...    119   4e-27   
gb|KFK29428.1|  hypothetical protein AALP_AA7G133200                    118   1e-26   
ref|XP_006408930.1|  hypothetical protein EUTSA_v10001974mg           84.0    2e-26   
ref|XP_010451144.1|  PREDICTED: zinc finger HIT domain-containing...    118   3e-26   
ref|NP_001031741.1|  HIT-type zinc finger protein                       117   3e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194611.2|  HIT-type zinc finger protein                          117   4e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDY06864.1|  BnaC01g09630D                                          117   5e-26   
ref|XP_008372429.1|  PREDICTED: transcription factor PIF1-like        85.9    6e-26   
dbj|BAF00716.1|  putative bHLH transcription factor                   85.1    6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849996.1|  transcription factor PIF1                           85.1    7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235535.1|  PREDICTED: zinc finger HIT domain-containing...    114   7e-26   
ref|XP_001785765.1|  predicted protein                                  115   7e-26   
ref|XP_010684995.1|  PREDICTED: transcription factor PIF1-like        84.7    8e-26   
emb|CDY35225.1|  BnaA01g08060D                                          115   1e-25   
ref|XP_008382659.1|  PREDICTED: transcription factor PIF1-like        85.9    2e-25   
gb|AAD24380.1|  unknown protein                                       84.7    2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179608.2|  transcription factor PIF1                           84.7    3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011026200.1|  PREDICTED: transcription factor PIF4             85.5    4e-25   
gb|KFH73094.1|  hypothetical protein MVEG_00318                         113   7e-25   
ref|XP_010467931.1|  PREDICTED: transcription factor PIF1-like        84.0    1e-24   
gb|KHG28067.1|  Zinc finger HIT domain-containing 3                     114   1e-24   
ref|XP_004292266.1|  PREDICTED: transcription factor PIF1-like        82.8    2e-24   
ref|XP_002867436.1|  zinc finger family protein                         111   3e-24   
gb|KFK40384.1|  hypothetical protein AALP_AA3G366400                  84.7    5e-24   
ref|XP_007144439.1|  hypothetical protein PHAVU_007G156200g             116   6e-24   
ref|XP_009399053.1|  PREDICTED: transcription factor PIF4-like        83.2    2e-23   
ref|NP_001051465.1|  Os03g0782500                                     86.7    3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99197.1|  Helix-loop-helix DNA-binding domain containing pr...  87.0    3e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002466767.1|  hypothetical protein SORBIDRAFT_01g013843        85.9    3e-23   Sorghum bicolor [broomcorn]
gb|EEE60044.1|  hypothetical protein OsJ_12829                        86.7    3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76276.1|  hypothetical protein OsI_13762                        86.7    4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_008447346.1|  PREDICTED: transcription factor PIF1-like is...  84.3    4e-23   
ref|XP_006575134.1|  PREDICTED: transcription factor PIF1-like        79.3    6e-23   
dbj|BAJ95450.1|  predicted protein                                    86.3    6e-23   
dbj|BAJ89764.1|  predicted protein                                    86.3    7e-23   
ref|XP_010054152.1|  PREDICTED: transcription factor PIF5             82.4    7e-23   
gb|KCW89798.1|  hypothetical protein EUGRSUZ_A02043                   82.4    9e-23   
gb|EMT29569.1|  Transcription factor PIF5                             85.5    1e-22   
ref|XP_002883941.1|  hypothetical protein ARALYDRAFT_319546           85.5    1e-22   
ref|XP_006651623.1|  PREDICTED: transcription factor PIF5-like        83.6    1e-22   
ref|XP_002458710.1|  hypothetical protein SORBIDRAFT_03g038770          106   1e-22   Sorghum bicolor [broomcorn]
ref|XP_006297599.1|  hypothetical protein CARUB_v10013621mg           84.7    1e-22   
ref|XP_010228906.1|  PREDICTED: transcription factor PIF5-like        85.1    2e-22   
ref|XP_008805234.1|  PREDICTED: zinc finger HIT domain-containing...    104   2e-22   
ref|NP_194608.3|  transcription factor bHLH23                         64.7    2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981538.1|  PREDICTED: transcription factor PIF4-like is...  84.3    3e-22   
ref|XP_008665523.1|  PREDICTED: transcription factor PIF5 isoform X1  84.3    3e-22   
ref|XP_006386276.1|  hypothetical protein POPTR_0002s05630g           85.1    4e-22   
tpg|DAA51720.1|  TPA: putative HLH DNA-binding domain superfamily...  84.0    4e-22   
ref|XP_008665528.1|  PREDICTED: transcription factor PIF5 isoform X2  84.7    4e-22   
gb|KEH42412.1|  HIT zinc finger protein                                 103   6e-22   
ref|XP_007048912.1|  Phytochrome interacting factor 3-like 6, put...  85.9    8e-22   
ref|XP_002991572.1|  hypothetical protein SELMODRAFT_133802             103   1e-21   
ref|XP_007048908.1|  Phytochrome interacting factor 3-like 6, put...  85.1    1e-21   
gb|KHG22328.1|  Transcription factor PIF5 -like protein               83.6    1e-21   
gb|EMS55398.1|  Transcription factor PIF5                             84.7    1e-21   
ref|XP_007048909.1|  Phytochrome interacting factor 3-like 6, put...  85.1    2e-21   
ref|XP_002889756.1|  hypothetical protein ARALYDRAFT_471048           86.7    2e-21   
ref|XP_009137809.1|  PREDICTED: uncharacterized protein LOC103861...    104   2e-21   
gb|KEH33641.1|  transcription factor                                  76.6    2e-21   
ref|XP_007048910.1|  Phytochrome interacting factor 3-like 6, put...  84.0    2e-21   
ref|XP_003545154.1|  PREDICTED: transcription factor PIF4-like is...  77.4    3e-21   
ref|XP_009376949.1|  PREDICTED: transcription factor PIF4             80.5    3e-21   
ref|XP_011087568.1|  PREDICTED: transcription factor PIF3 isoform X2  85.9    3e-21   
ref|XP_011087566.1|  PREDICTED: transcription factor PIF3 isoform X1  85.9    3e-21   
ref|XP_002971725.1|  hypothetical protein SELMODRAFT_95943              102   3e-21   
dbj|BAJ93366.1|  predicted protein                                    84.0    4e-21   
ref|XP_004955437.1|  PREDICTED: transcription factor PIF4-like        84.3    4e-21   
gb|KHN12001.1|  Transcription factor PIF4                             77.0    4e-21   
ref|XP_009602219.1|  PREDICTED: transcription factor PIF4             73.9    5e-21   
dbj|BAJ90328.1|  predicted protein                                    84.0    5e-21   
ref|XP_010070104.1|  PREDICTED: transcription factor PIF3-like is...  85.5    5e-21   
ref|XP_006575634.1|  PREDICTED: transcription factor PIF4-like        77.4    5e-21   
ref|XP_006357888.1|  PREDICTED: transcription factor PIF4-like        73.9    6e-21   
ref|XP_002466350.1|  hypothetical protein SORBIDRAFT_01g006190        84.7    6e-21   Sorghum bicolor [broomcorn]
dbj|BAC19953.1|  transcription factor BHLH9-like protein              84.0    6e-21   Oryza sativa Japonica Group [Japonica rice]
gb|KHN38358.1|  Transcription factor PIF5                             77.0    7e-21   
gb|EMT27650.1|  Transcription factor PIF3                             85.9    8e-21   
ref|NP_001058876.2|  Os07g0143200                                     83.6    8e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EEE66551.1|  hypothetical protein OsJ_23063                        83.6    8e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AEV57494.1|  rice phytochrome-interacting factor 4                 83.2    8e-21   
gb|EEC81506.1|  hypothetical protein OsI_24867                        83.6    9e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_009407100.1|  PREDICTED: transcription factor PIF1-like        84.0    1e-20   
ref|XP_010228425.1|  PREDICTED: transcription factor PIF4-like is...  85.1    1e-20   
ref|XP_010228426.1|  PREDICTED: transcription factor PIF4-like is...  84.7    1e-20   
ref|XP_010069677.1|  PREDICTED: transcription factor PIF1             75.5    1e-20   
emb|CDP15171.1|  unnamed protein product                              86.3    1e-20   
ref|XP_007207211.1|  hypothetical protein PRUPE_ppa001899mg           86.3    1e-20   
ref|XP_008342323.1|  PREDICTED: transcription factor PIF4-like        80.1    1e-20   
ref|XP_004243631.1|  PREDICTED: transcription factor PIF4             73.9    2e-20   
ref|XP_007051317.1|  Phytochrome interacting factor 3, putative       84.0    2e-20   
ref|XP_004499540.1|  PREDICTED: transcription factor PIF4-like is...  76.6    2e-20   
emb|CAD32238.1|  BP-5 protein                                         79.3    2e-20   Oryza sativa [red rice]
ref|XP_004499539.1|  PREDICTED: transcription factor PIF4-like is...  76.6    2e-20   
emb|CAA22970.1|  putative protein                                       101   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796446.1|  PREDICTED: transcription factor PIF1-like        82.4    2e-20   
ref|XP_004499538.1|  PREDICTED: transcription factor PIF4-like is...  76.6    2e-20   
ref|XP_009589214.1|  PREDICTED: transcription factor PIF3-like        85.5    3e-20   
ref|XP_010093193.1|  hypothetical protein L484_013318                 79.3    3e-20   
ref|XP_008811826.1|  PREDICTED: transcription factor PIF4-like is...  84.3    3e-20   
ref|XP_009397370.1|  PREDICTED: transcription factor PIF4-like        83.6    3e-20   
ref|XP_009757612.1|  PREDICTED: transcription factor PIF4             73.9    3e-20   
ref|XP_006358519.1|  PREDICTED: transcription factor PIF3-like        85.5    4e-20   
ref|XP_006645783.1|  PREDICTED: transcription factor PIF1-like        85.9    4e-20   
ref|XP_009774962.1|  PREDICTED: transcription factor PIF3-like is...  85.5    4e-20   
ref|XP_009774964.1|  PREDICTED: transcription factor PIF3-like is...  85.5    4e-20   
ref|XP_010906815.1|  PREDICTED: transcription factor PIF4-like is...  85.5    4e-20   
ref|XP_009401971.1|  PREDICTED: transcription factor PIF3-like is...  83.6    4e-20   
ref|XP_009401973.1|  PREDICTED: transcription factor PIF3-like is...  83.6    5e-20   
ref|XP_010906805.1|  PREDICTED: transcription factor PIF4-like is...  85.1    5e-20   
ref|XP_004149520.1|  PREDICTED: transcription factor PIF5-like        74.7    5e-20   
ref|XP_008464685.1|  PREDICTED: transcription factor PIF4-like        74.7    7e-20   
ref|XP_006589101.1|  PREDICTED: transcription factor PIF3-like        87.8    8e-20   
gb|KHN24194.1|  Transcription factor PIF3                             87.8    8e-20   
ref|XP_004970445.1|  PREDICTED: zinc finger HIT domain-containing...  99.0    8e-20   
ref|XP_008776593.1|  PREDICTED: transcription factor PIF4-like is...  85.5    9e-20   
ref|NP_001182781.1|  hypothetical protein                             98.2    9e-20   
ref|XP_010038344.1|  PREDICTED: uncharacterized zinc-finger prote...  97.8    9e-20   
ref|XP_008776592.1|  PREDICTED: transcription factor PIF4-like is...  85.5    9e-20   
ref|XP_004982350.1|  PREDICTED: transcription factor PIF1-like is...  85.1    1e-19   
ref|XP_004982351.1|  PREDICTED: transcription factor PIF1-like is...  85.1    1e-19   
ref|XP_008800314.1|  PREDICTED: transcription factor PIF3-like is...  86.7    1e-19   
ref|XP_004982352.1|  PREDICTED: transcription factor PIF1-like is...  85.1    1e-19   
ref|XP_010416208.1|  PREDICTED: transcription factor PIF1-like is...  83.6    1e-19   
emb|CDX92896.1|  BnaC07g41540D                                        99.4    1e-19   
ref|XP_010094912.1|  hypothetical protein L484_022662                 88.2    2e-19   
ref|XP_004960433.1|  PREDICTED: transcription factor PIF3-like        83.2    2e-19   
ref|XP_008370334.1|  PREDICTED: transcription factor PIF3 isoform X2  87.0    2e-19   
ref|XP_008811822.1|  PREDICTED: transcription factor PIF4-like is...  84.7    2e-19   
ref|XP_006605776.1|  PREDICTED: transcription factor PIF3-like        86.7    2e-19   
ref|XP_008811825.1|  PREDICTED: transcription factor PIF4-like is...  84.7    2e-19   
gb|KHN26204.1|  Transcription factor PIF3                             86.7    2e-19   
ref|XP_008789575.1|  PREDICTED: transcription factor APG-like         85.1    2e-19   
ref|XP_004302325.1|  PREDICTED: transcription factor PIF3-like        86.7    2e-19   
ref|XP_008800313.1|  PREDICTED: transcription factor PIF3-like is...  85.5    3e-19   
ref|XP_008811817.1|  PREDICTED: transcription factor PIF4-like is...  84.7    3e-19   
gb|EAY91148.1|  hypothetical protein OsI_12756                        84.0    3e-19   Oryza sativa Indica Group [Indian rice]
gb|ABF97814.1|  Helix-loop-helix DNA-binding domain containing pr...  84.0    3e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AHM26476.1|  PIF3                                                  85.5    3e-19   
gb|ABF97813.1|  Helix-loop-helix DNA-binding domain containing pr...  83.6    3e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004967640.1|  PREDICTED: transcription factor PIF3-like is...  86.3    3e-19   
ref|XP_004967645.1|  PREDICTED: transcription factor PIF3-like is...  86.3    3e-19   
ref|XP_002459338.1|  hypothetical protein SORBIDRAFT_02g002760        86.7    3e-19   Sorghum bicolor [broomcorn]
ref|XP_008246329.1|  PREDICTED: transcription factor PIF3             92.0    4e-19   
ref|XP_010541186.1|  PREDICTED: transcription factor PIF1             71.2    4e-19   
gb|AHM26455.1|  PIF3                                                  85.5    4e-19   
gb|EMS46835.1|  Transcription factor PIF5                             85.5    4e-19   
gb|KDO44796.1|  hypothetical protein CISIN_1g0077971mg                85.5    4e-19   
gb|KDO44798.1|  hypothetical protein CISIN_1g0077971mg                85.5    4e-19   
gb|KDO44794.1|  hypothetical protein CISIN_1g0077971mg                85.5    4e-19   
dbj|BAD81566.1|  putative BP-5 protein                                86.3    5e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006437069.1|  hypothetical protein CICLE_v10031028mg           85.5    5e-19   
ref|XP_006437072.1|  hypothetical protein CICLE_v10031028mg           85.1    5e-19   
gb|EMT30687.1|  Transcription factor PIF5                             84.7    5e-19   
ref|XP_006437071.1|  hypothetical protein CICLE_v10031028mg           85.1    5e-19   
gb|AHM26463.1|  PIF3                                                  85.5    6e-19   
ref|XP_006437070.1|  hypothetical protein CICLE_v10031028mg           85.1    6e-19   
ref|NP_001042775.2|  Os01g0286100                                     86.3    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006485005.1|  PREDICTED: transcription factor PIF4-like is...  85.1    6e-19   
ref|XP_006485007.1|  PREDICTED: transcription factor PIF4-like is...  85.1    6e-19   
ref|XP_010941465.1|  PREDICTED: transcription factor PIF3-like is...  81.3    6e-19   
ref|XP_006437068.1|  hypothetical protein CICLE_v10031028mg           85.1    6e-19   
ref|XP_006485006.1|  PREDICTED: transcription factor PIF4-like is...  85.1    6e-19   
ref|XP_010941466.1|  PREDICTED: transcription factor PIF3-like is...  81.3    6e-19   
ref|XP_002278399.1|  PREDICTED: transcription factor PIF4             69.3    7e-19   Vitis vinifera
gb|EMS53970.1|  hypothetical protein TRIUR3_30599                     96.3    8e-19   
gb|ACR35132.1|  unknown                                               86.3    8e-19   Zea mays [maize]
gb|KDO44791.1|  hypothetical protein CISIN_1g0077971mg                84.7    8e-19   
gb|KDO44792.1|  hypothetical protein CISIN_1g0077971mg                84.7    8e-19   
ref|XP_008654839.1|  PREDICTED: uncharacterized protein LOC100279...  85.9    9e-19   
gb|EEC70435.1|  hypothetical protein OsI_01449                        85.9    9e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_007145054.1|  hypothetical protein PHAVU_007G206000g           86.3    9e-19   
gb|EEE54353.1|  hypothetical protein OsJ_01348                        85.5    1e-18   Oryza sativa Japonica Group [Japonica rice]
emb|CBI22065.3|  unnamed protein product                              68.6    1e-18   
ref|XP_006854256.1|  hypothetical protein AMTR_s00039p00032460        73.2    1e-18   
ref|XP_007031281.1|  Phytochrome interacting factor 3, putative i...  81.6    1e-18   
gb|EMT21483.1|  hypothetical protein F775_26970                       95.9    1e-18   
ref|XP_003559649.1|  PREDICTED: transcription factor PIF1-like        82.4    1e-18   
gb|KGN61033.1|  hypothetical protein Csa_2G035330                     86.3    1e-18   
ref|XP_010659766.1|  PREDICTED: transcription factor PIF3-like is...  86.7    1e-18   
ref|XP_010038343.1|  PREDICTED: transcription factor PIF1-like is...  83.2    1e-18   
gb|ACR38655.1|  unknown                                               85.5    1e-18   Zea mays [maize]
ref|XP_010659765.1|  PREDICTED: transcription factor PIF3-like is...  86.7    1e-18   
gb|KDO56394.1|  hypothetical protein CISIN_1g006040mg                 86.7    1e-18   
ref|XP_010659764.1|  PREDICTED: transcription factor PIF3-like is...  86.3    1e-18   
gb|KDO56396.1|  hypothetical protein CISIN_1g006040mg                 86.7    1e-18   
gb|KDO56397.1|  hypothetical protein CISIN_1g006040mg                 86.7    1e-18   
ref|XP_004144801.1|  PREDICTED: transcription factor PIF3-like        85.9    1e-18   
ref|XP_010042473.1|  PREDICTED: transcription factor PIF3-like        86.3    1e-18   
gb|KDO56393.1|  hypothetical protein CISIN_1g006040mg                 86.3    1e-18   
gb|KHN05907.1|  Transcription factor PIF1                             62.8    2e-18   
ref|XP_010233063.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  85.9    2e-18   
ref|XP_009366017.1|  PREDICTED: transcription factor PIF3-like is...  87.0    2e-18   
ref|XP_007146296.1|  hypothetical protein PHAVU_006G028500g           65.9    2e-18   
ref|XP_006423961.1|  hypothetical protein CICLE_v10027890mg           86.3    2e-18   
gb|KDP23327.1|  hypothetical protein JCGZ_23160                       86.7    2e-18   
ref|XP_009335549.1|  PREDICTED: transcription factor PIF3-like is...  86.7    2e-18   
ref|XP_007146295.1|  hypothetical protein PHAVU_006G028500g           65.9    2e-18   
emb|CAN76246.1|  hypothetical protein VITISV_023382                   86.3    2e-18   
emb|CBI39676.3|  unnamed protein product                              85.9    2e-18   
ref|NP_001067246.1|  Os12g0610200                                     82.8    2e-18   
gb|ABA99362.2|  Helix-loop-helix DNA-binding domain containing pr...  82.8    2e-18   
ref|XP_002512587.1|  conserved hypothetical protein                   86.7    2e-18   
ref|XP_010271069.1|  PREDICTED: transcription factor PIF3 isoform X1  86.7    2e-18   
ref|XP_009366015.1|  PREDICTED: transcription factor PIF3-like is...  86.7    3e-18   
ref|XP_008388421.1|  PREDICTED: transcription factor PIF3-like        85.9    3e-18   
ref|XP_009365453.1|  PREDICTED: transcription factor PIF3-like        85.9    3e-18   
gb|AEX32796.1|  phytochrome-interacting factor 3                      85.9    3e-18   
ref|XP_010674470.1|  PREDICTED: transcription factor PIF3-like        84.7    3e-18   
ref|XP_004495811.1|  PREDICTED: transcription factor PIF3-like is...  85.9    3e-18   
ref|XP_004495812.1|  PREDICTED: transcription factor PIF3-like is...  85.9    3e-18   
ref|XP_010909460.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  86.7    4e-18   
gb|AEK06075.1|  phytochrome-interacting factor 3.1                    87.4    4e-18   
ref|XP_010240811.1|  PREDICTED: transcription factor PIF3-like is...  86.7    4e-18   
ref|XP_010240809.1|  PREDICTED: transcription factor PIF3-like is...  86.7    4e-18   
ref|XP_010271074.1|  PREDICTED: transcription factor PIF3 isoform X2  86.7    4e-18   
gb|KHM99680.1|  Transcription factor PIF5                             65.9    4e-18   
gb|AEK06080.1|  phytochrome-interacting factor 3.1                    87.4    4e-18   
ref|XP_006586042.1|  PREDICTED: transcription factor PIF4-like is...  65.9    4e-18   
gb|AEK06083.1|  phytochrome-interacting factor 3.1                    87.4    5e-18   
gb|AEK06076.1|  phytochrome-interacting factor 3.1                    87.4    5e-18   
gb|AEK06077.1|  phytochrome-interacting factor 3.1                    87.4    5e-18   
gb|KDO65842.1|  hypothetical protein CISIN_1g032470mg                 92.8    5e-18   
ref|XP_006840391.1|  hypothetical protein AMTR_s00045p00141060        86.3    6e-18   
ref|XP_010313958.1|  PREDICTED: transcription factor PIF3             85.9    6e-18   
ref|XP_010904661.1|  PREDICTED: transcription factor PIF4-like is...  85.1    6e-18   
ref|XP_010904660.1|  PREDICTED: transcription factor PIF4-like is...  85.1    6e-18   
gb|KHN28531.1|  Transcription factor PIF5                             66.2    6e-18   
ref|XP_006382253.1|  Phytochrome-interacting factor 3 family protein  85.9    7e-18   
ref|XP_003551947.2|  PREDICTED: transcription factor PIF4-like is...  66.2    7e-18   
gb|AHM26452.1|  PIF3                                                  80.9    7e-18   
ref|XP_007031278.1|  Phytochrome interacting factor 3, putative i...  86.7    7e-18   
ref|XP_010940774.1|  PREDICTED: putative transcription factor bHL...  86.3    7e-18   
tpg|DAA50359.1|  TPA: putative HLH DNA-binding domain superfamily...  86.7    9e-18   
ref|XP_009118315.1|  PREDICTED: transcription factor PIF3-like        87.4    9e-18   
emb|CDY22636.1|  BnaC08g42700D                                        87.0    9e-18   
emb|CDM82947.1|  unnamed protein product                              93.6    9e-18   
ref|NP_001147809.1|  PIL5                                             86.7    9e-18   
emb|CDY06870.1|  BnaC01g09690D                                        74.3    9e-18   
ref|XP_011023895.1|  PREDICTED: transcription factor PIF3-like        86.3    9e-18   
ref|XP_010070105.1|  PREDICTED: transcription factor PIF3-like is...  85.1    9e-18   
ref|XP_002319450.2|  hypothetical protein POPTR_0013s00310g           86.3    9e-18   
ref|XP_010070103.1|  PREDICTED: transcription factor PIF3-like is...  85.1    1e-17   
ref|XP_006417565.1|  hypothetical protein EUTSA_v10007343mg           87.0    1e-17   
ref|XP_011039054.1|  PREDICTED: transcription factor PIF3-like is...  86.3    1e-17   
ref|XP_003591254.1|  Transcription factor PIF3                        85.5    1e-17   
ref|XP_011039053.1|  PREDICTED: transcription factor PIF3-like is...  86.3    1e-17   
ref|XP_011039055.1|  PREDICTED: transcription factor PIF3-like is...  86.3    1e-17   
ref|XP_008370333.1|  PREDICTED: transcription factor PIF3 isoform X1  86.3    1e-17   
ref|NP_974634.1|  transcription factor bHLH23                         64.3    1e-17   
ref|XP_007031279.1|  Phytochrome interacting factor 3, putative i...  85.9    1e-17   
ref|XP_010914797.1|  PREDICTED: transcription factor PIF3-like is...  85.1    1e-17   
ref|XP_010914796.1|  PREDICTED: transcription factor PIF3-like is...  84.7    1e-17   
ref|XP_010109675.1|  hypothetical protein L484_015160                 91.3    1e-17   
gb|AHM26451.1|  PIF3                                                  80.5    2e-17   
emb|CDY67566.1|  BnaCnng55460D                                        81.3    2e-17   
ref|XP_011032741.1|  PREDICTED: transcription factor PIF4-like is...  82.0    2e-17   
gb|EEC69654.1|  hypothetical protein OsI_39066                        82.4    2e-17   
ref|XP_008807924.1|  PREDICTED: transcription factor PIF3-like is...  82.4    2e-17   
ref|XP_009788870.1|  PREDICTED: transcription factor PIF1-like        88.2    2e-17   
emb|CDY06358.1|  BnaA09g48450D                                        87.4    2e-17   
ref|XP_008807920.1|  PREDICTED: transcription factor PIF3-like is...  82.4    2e-17   
ref|XP_008807923.1|  PREDICTED: transcription factor PIF3-like is...  82.4    2e-17   
ref|XP_004963135.1|  PREDICTED: transcription factor PIF4-like is...  82.0    3e-17   
ref|XP_010490103.1|  PREDICTED: transcription factor PIF3-like        87.0    3e-17   
ref|XP_010475789.1|  PREDICTED: transcription factor PIF3             87.0    3e-17   
ref|XP_007141451.1|  hypothetical protein PHAVU_008G196800g           79.0    3e-17   
ref|XP_006303172.1|  hypothetical protein CARUB_v10008815mg           87.0    3e-17   
ref|XP_010458240.1|  PREDICTED: transcription factor PIF3-like        87.0    3e-17   
ref|NP_172424.1|  transcription factor PIF3                           87.0    3e-17   
ref|XP_007224914.1|  hypothetical protein PRUPE_ppa021918mg           75.5    3e-17   
gb|AHM26454.1|  PIF3                                                  80.5    4e-17   
gb|AAC99771.1|  phytochrome-associated protein 3                      87.0    4e-17   
ref|XP_011032742.1|  PREDICTED: transcription factor PIF4-like is...  82.0    5e-17   
ref|XP_009794217.1|  PREDICTED: transcription factor PIF3-like        81.6    5e-17   
ref|XP_009148251.1|  PREDICTED: transcription factor PIF3 isoform X2  85.9    7e-17   
ref|XP_009148249.1|  PREDICTED: transcription factor PIF3 isoform X1  85.9    7e-17   
gb|KFK43254.1|  phytochrome-interacting factor                        85.5    7e-17   
ref|NP_001152218.1|  HIT zinc finger family protein                   90.5    7e-17   
ref|XP_008777260.1|  PREDICTED: transcription factor PIF3-like        82.4    7e-17   
emb|CDX94963.1|  BnaC05g07080D                                        85.5    7e-17   
emb|CDY64745.1|  BnaA06g37850D                                        85.5    8e-17   
ref|NP_001146660.1|  putative HLH DNA-binding domain superfamily ...  84.0    8e-17   
ref|XP_010525627.1|  PREDICTED: transcription factor PIF4 isoform X1  83.2    9e-17   
ref|XP_008220349.1|  PREDICTED: uncharacterized protein LOC103320445  73.9    1e-16   
ref|XP_010525635.1|  PREDICTED: transcription factor PIF4 isoform X2  82.8    1e-16   
ref|XP_006350296.1|  PREDICTED: transcription factor PIF1-like is...  94.4    1e-16   
ref|XP_006350295.1|  PREDICTED: transcription factor PIF1-like is...  94.4    1e-16   
ref|XP_002306764.2|  hypothetical protein POPTR_0005s22870g           82.0    1e-16   
gb|KHG19220.1|  Transcription factor PIF3                             85.5    1e-16   
gb|KHG19219.1|  Transcription factor PIF3                             85.5    1e-16   
ref|XP_010549185.1|  PREDICTED: transcription factor PIF3-like is...  85.9    2e-16   
ref|XP_010549193.1|  PREDICTED: transcription factor PIF3-like is...  85.9    2e-16   
gb|KHN14203.1|  Transcription factor PIF3                             82.0    2e-16   
tpg|DAA54248.1|  TPA: putative HLH DNA-binding domain superfamily...  85.5    2e-16   
ref|XP_010549189.1|  PREDICTED: transcription factor PIF3-like is...  85.9    2e-16   
ref|XP_004154488.1|  PREDICTED: transcription factor bHLH82-like      80.5    2e-16   
gb|KHN36350.1|  Transcription factor PIF1                             78.2    2e-16   
ref|XP_004247109.1|  PREDICTED: transcription factor PIF1-like        93.6    2e-16   
ref|XP_008673312.1|  PREDICTED: hypothetical protein isoform X1       89.4    2e-16   
emb|CDY06867.1|  BnaC01g09660D                                        78.6    2e-16   
ref|NP_001054593.1|  Os05g0139100                                     83.2    2e-16   
tpg|DAA54246.1|  TPA: putative HLH DNA-binding domain superfamily...  84.7    2e-16   
ref|XP_007049882.1|  HIT-type Zinc finger family protein, putativ...  89.0    2e-16   
gb|KCW89801.1|  hypothetical protein EUGRSUZ_A02043                   82.4    3e-16   
ref|XP_011032743.1|  PREDICTED: transcription factor PIF4-like is...  82.4    3e-16   
gb|AHK05707.1|  bHLH transcription factor SPT                         74.7    3e-16   
dbj|BAL63287.1|  basic helix-loop-helix protein APG                   82.8    3e-16   
ref|XP_008382661.1|  PREDICTED: transcription factor PIF1-like        90.5    3e-16   
gb|EMT23685.1|  Transcription factor PIF3                             80.9    3e-16   
gb|EEE62266.1|  hypothetical protein OsJ_17053                        82.8    4e-16   
ref|XP_006412909.1|  hypothetical protein EUTSA_v10027582mg           70.5    4e-16   
ref|XP_009109363.1|  PREDICTED: transcription factor SPATULA-like     76.3    4e-16   
gb|KHN43378.1|  Transcription factor PIF3                             83.6    4e-16   
ref|XP_006604778.1|  PREDICTED: transcription factor PIF3-like is...  83.6    4e-16   
ref|XP_006473302.1|  PREDICTED: transcription factor SPATULA-like...  73.6    4e-16   
ref|XP_006473301.1|  PREDICTED: transcription factor SPATULA-like...  73.6    4e-16   
gb|EEC78487.1|  hypothetical protein OsI_18387                        82.0    6e-16   
ref|XP_008348351.1|  PREDICTED: transcription factor PIF4-like        80.5    6e-16   
ref|XP_002442504.1|  hypothetical protein SORBIDRAFT_08g021000        81.6    6e-16   
ref|XP_009356576.1|  PREDICTED: transcription factor PIF4-like        80.1    6e-16   
ref|XP_009129263.1|  PREDICTED: transcription factor bHLH119-like...  76.6    7e-16   
ref|XP_010904655.1|  PREDICTED: transcription factor PIF4-like is...  78.2    7e-16   
ref|NP_001146411.1|  uncharacterized protein LOC100279991             89.0    7e-16   
emb|CDY35222.1|  BnaA01g08090D                                        77.4    7e-16   
ref|XP_004142005.1|  PREDICTED: uncharacterized protein LOC101217594  74.3    7e-16   
ref|XP_004157205.1|  PREDICTED: uncharacterized protein LOC101227644  73.9    8e-16   
ref|XP_009129259.1|  PREDICTED: transcription factor bHLH119-like...  76.3    9e-16   
ref|XP_002439246.1|  hypothetical protein SORBIDRAFT_09g003090        82.8    9e-16   
dbj|BAJ92913.1|  predicted protein                                    84.3    1e-15   
dbj|BAJ90909.1|  predicted protein                                    84.0    1e-15   
emb|CDY50926.1|  BnaA03g59040D                                        87.4    1e-15   
dbj|BAK07789.1|  predicted protein                                    84.0    1e-15   
gb|KDO44799.1|  hypothetical protein CISIN_1g0077971mg                85.9    1e-15   
ref|XP_002981138.1|  hypothetical protein SELMODRAFT_114141           77.0    1e-15   
ref|XP_002880016.1|  hypothetical protein ARALYDRAFT_483401           70.9    1e-15   
ref|XP_008229596.1|  PREDICTED: transcription factor PIF4-like        80.5    1e-15   
ref|XP_009412363.1|  PREDICTED: transcription factor PIF3-like is...  74.7    1e-15   
ref|XP_002982619.1|  hypothetical protein SELMODRAFT_116654           76.6    1e-15   
gb|KHG14782.1|  Transcription factor PIF3                             80.9    1e-15   
ref|XP_009591142.1|  PREDICTED: transcription factor PIF3-like        78.6    1e-15   
ref|XP_009412387.1|  PREDICTED: transcription factor PIF3-like is...  74.7    1e-15   
ref|XP_006294279.1|  hypothetical protein CARUB_v10023275mg           71.6    1e-15   
emb|CDX69281.1|  BnaC01g01720D                                        75.1    2e-15   
gb|KHG14783.1|  Transcription factor PIF3                             80.5    2e-15   
ref|XP_009138272.1|  PREDICTED: transcription factor SPATULA          74.3    2e-15   
emb|CDX75629.1|  BnaA01g00730D                                        74.3    2e-15   
ref|XP_010231744.1|  PREDICTED: transcription factor APG-like         83.6    2e-15   
ref|XP_010553700.1|  PREDICTED: transcription factor PIF3-like        80.9    2e-15   
ref|XP_007216256.1|  hypothetical protein PRUPE_ppa017228mg           80.5    2e-15   
ref|XP_006658270.1|  PREDICTED: transcription factor PIF5-like        72.4    2e-15   
ref|XP_008662938.1|  PREDICTED: transcription factor APG-like         81.6    2e-15   
gb|KDP41706.1|  hypothetical protein JCGZ_16113                       75.1    3e-15   
ref|XP_010517853.1|  PREDICTED: transcription factor PIF4-like is...  71.2    3e-15   
ref|XP_010247965.1|  PREDICTED: transcription factor PIF5-like        79.7    3e-15   
ref|XP_010517855.1|  PREDICTED: transcription factor PIF4-like is...  71.2    3e-15   
gb|AFW57548.1|  putative HLH DNA-binding domain superfamily protein   81.6    3e-15   
ref|XP_010506153.1|  PREDICTED: transcription factor PIF4-like        71.2    3e-15   
emb|CDY22448.1|  BnaC03g61610D                                        74.7    3e-15   
ref|XP_010904658.1|  PREDICTED: transcription factor PIF4-like is...  75.9    3e-15   
ref|XP_010904659.1|  PREDICTED: transcription factor PIF4-like is...  75.9    3e-15   
ref|XP_010489088.1|  PREDICTED: transcription factor PIF1-like        84.7    3e-15   
ref|XP_010904657.1|  PREDICTED: transcription factor PIF4-like is...  75.9    3e-15   
ref|XP_010904653.1|  PREDICTED: transcription factor PIF4-like is...  75.9    3e-15   
ref|XP_011099122.1|  PREDICTED: transcription factor SPATULA-like     73.9    3e-15   
ref|XP_010508482.1|  PREDICTED: transcription factor PIF4-like        70.9    3e-15   
ref|XP_009130461.1|  PREDICTED: LOW QUALITY PROTEIN: putative tra...  77.4    4e-15   
ref|XP_010904656.1|  PREDICTED: transcription factor PIF4-like is...  75.9    4e-15   
ref|XP_003564529.2|  PREDICTED: zinc finger HIT domain-containing...  85.5    4e-15   
ref|NP_194609.5|  putative transcription factor bHLH056               70.1    4e-15   
emb|CDY35220.1|  BnaA01g08110D                                        79.0    5e-15   
gb|EPS60825.1|  hypothetical protein M569_13976                       78.2    6e-15   
ref|XP_006480179.1|  PREDICTED: transcription factor PIF1-like is...  89.0    7e-15   
ref|XP_009783823.1|  PREDICTED: transcription factor SPATULA-like...  74.7    7e-15   
gb|KHN48974.1|  Transcription factor PIF1                             85.9    7e-15   
ref|XP_009406248.1|  PREDICTED: transcription factor PIF1-like        84.0    7e-15   
ref|XP_010512135.1|  PREDICTED: transcription factor PIF5-like        70.1    7e-15   
ref|XP_009783822.1|  PREDICTED: transcription factor SPATULA-like...  74.7    8e-15   
ref|XP_010504884.1|  PREDICTED: transcription factor PIF5 isoform X1  70.1    9e-15   
ref|XP_006664733.1|  PREDICTED: transcription factor PIF1-like        85.5    1e-14   
ref|XP_006856483.1|  hypothetical protein AMTR_s00046p00066610        73.9    1e-14   
ref|XP_010112171.1|  Transcription factor SPATULA                     74.7    1e-14   
ref|XP_008367659.1|  PREDICTED: transcription factor SPATULA-like...  73.2    1e-14   
emb|CCE46185.1|  bHLH transcription factor                            73.9    2e-14   
gb|ABK23705.1|  unknown                                               74.3    2e-14   
gb|EPS70183.1|  hypothetical protein M569_04578                       82.0    2e-14   
ref|XP_002869472.1|  hypothetical protein ARALYDRAFT_913634           62.4    2e-14   
ref|XP_007160864.1|  hypothetical protein PHAVU_001G023200g           77.0    2e-14   
emb|CDY06865.1|  BnaC01g09640D                                        64.3    2e-14   
ref|XP_009607891.1|  PREDICTED: transcription factor SPATULA isof...  74.7    2e-14   
ref|XP_007048911.1|  Phytochrome interacting factor 3-like 6, put...  85.1    2e-14   
ref|XP_008367660.1|  PREDICTED: transcription factor SPATULA-like...  73.2    2e-14   
ref|XP_007160865.1|  hypothetical protein PHAVU_001G023200g           77.0    2e-14   
ref|XP_002983759.1|  hypothetical protein SELMODRAFT_118904           77.0    3e-14   
ref|XP_002521149.1|  conserved hypothetical protein                   81.6    3e-14   
ref|XP_010432080.1|  PREDICTED: transcription factor SPATULA-like...  74.3    3e-14   
ref|XP_009607890.1|  PREDICTED: transcription factor SPATULA isof...  74.3    3e-14   
ref|XP_010432082.1|  PREDICTED: transcription factor SPATULA-like...  74.3    3e-14   
ref|XP_006339939.1|  PREDICTED: transcription factor SPATULA-like     75.1    3e-14   
emb|CEF98945.1|  Zinc finger, HIT-type                                82.0    3e-14   
ref|XP_011100371.1|  PREDICTED: transcription factor PIF4             76.6    3e-14   
ref|XP_002510190.1|  conserved hypothetical protein                   75.1    3e-14   
ref|XP_008338329.1|  PREDICTED: transcription factor SPATULA          73.6    3e-14   



>ref|XP_004240466.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Solanum 
lycopersicum]
Length=138

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 115/138 (83%), Gaps = 6/138 (4%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEE------NLAPTP  2484
             MG KKC VC+EAQS+YKCP+C IP+CSL CFKKHKEIPCGKP+P  E        LAP P
Sbjct  1     MGSKKCQVCDEAQSRYKCPNCFIPFCSLVCFKKHKEIPCGKPEPEPESEPLSEEKLAPAP  60

Query  2483  ALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKA  2304
             ALHV+KP+YVDEP + + QSQLES+ASSSEI EA+R+++LQKLI N+DSS DAE++LDKA
Sbjct  61    ALHVEKPIYVDEPGEAVNQSQLESIASSSEILEAIRNKDLQKLIYNLDSSLDAENELDKA  120

Query  2303  MQKEEFHILAQKILSTIS  2250
             M+KEEF I+++KILS IS
Sbjct  121   MEKEEFRIISEKILSIIS  138



>ref|XP_009788871.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Nicotiana 
sylvestris]
Length=137

 Score =   185 bits (470),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 111/136 (82%), Gaps = 4/136 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQP----SSEENLAPTPAL  2478
             MGPK C VC++AQSKYKCP+C IPYCSL CFKKHKEI C KP+P    SS E LA  P  
Sbjct  1     MGPKNCKVCDDAQSKYKCPNCFIPYCSLVCFKKHKEIFCVKPEPELEPSSVEKLASAPGS  60

Query  2477  HVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQ  2298
             HV+KP+Y+DE S+VL QS+LES+ASS+EI EA+R++ELQ LIC+IDSS DAE++LDKAM 
Sbjct  61    HVEKPIYIDEQSEVLNQSRLESIASSNEIREAIRNKELQNLICSIDSSMDAEAELDKAMD  120

Query  2297  KEEFHILAQKILSTIS  2250
             KEEF I ++KILS IS
Sbjct  121   KEEFRIFSEKILSMIS  136



>ref|XP_006364547.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Solanum 
tuberosum]
Length=138

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 6/138 (4%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEE------NLAPTP  2484
             MG KKC VC+EAQSKYKCPSC IP+CSL CFKKHKEIPCGKP+   E        L P P
Sbjct  1     MGSKKCQVCDEAQSKYKCPSCFIPFCSLVCFKKHKEIPCGKPESEPESEPVSEEKLPPAP  60

Query  2483  ALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKA  2304
             AL V+KP+YVDEP + + QSQLES+ASSSEI EA+R++ELQKLI N+DSS DAE++LDKA
Sbjct  61    ALRVEKPIYVDEPGEAVNQSQLESIASSSEILEAIRNKELQKLIYNLDSSLDAENELDKA  120

Query  2303  MQKEEFHILAQKILSTIS  2250
             M+KEEF I+++KILS IS
Sbjct  121   MEKEEFRIISEKILSIIS  138



>ref|XP_010652457.1| PREDICTED: transcription factor PIF1 isoform X2 [Vitis vinifera]
Length=516

 Score =   107 bits (268),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 160/333 (48%), Gaps = 37/333 (11%)
 Frame = +3

Query  339   HHCAVPEFEMD-EDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQ  515
             +HC VP+FE+D ED  PL              +     +DEIMELLWQNGQVV+  QN Q
Sbjct  2     NHC-VPDFEVDDEDAIPL---------TRPKKSAAMVEDDEIMELLWQNGQVVMQIQN-Q  50

Query  516   RSVKRSHGG-----DAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
             RS K+S        DA +P P   ++  SA  + +++    +LFMQEDEMASWLHYPL D
Sbjct  51    RSFKKSQPSKFPIQDAVLP-PEQSKIRSSAPVDESSA----QLFMQEDEMASWLHYPLDD  105

Query  681   DspylsadllypssssaaaavappRDFRASApevrrppaplppippsgr-TDVLRSQNFA  857
                 L       ++S   A      D R           P+PP       + V    +F 
Sbjct  106   FCADLLDPTPCVNASPPPARPNLSPDVRQPEERPAATKPPIPPARRVELDSKVHNFLHFP  165

Query  858   RLCRPPAG-PSRAASTVVES-----NDTPIVPSEYRDSHVADSTAQVSGGNLGPRggams  1019
             R     +G PS +    +ES     +DTP V  + R S      A+++    G  GGA  
Sbjct  166   RKSTAESGEPSSSRPAGMESTVVDSSDTPGVCQQSRTSPAEWCKAELANSGYGTIGGATE  225

Query  1020  gteaagastgaKEMTVTSSPDDGSGASVSAEKS-TAPATAMDDRKAKGSETDD--EGHNA  1190
                +A       E+T+TSSP+       ++  +   P    DDRK KG E DD  E  + 
Sbjct  226   AATSAAGEHTTFELTMTSSPEGSGSGGSASAGAEPTPKAPADDRKRKGREGDDTAEYQSE  285

Query  1191  DTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             D +F   +AKKQ     ++KRSRAAEVHNLSER
Sbjct  286   DVEFESADAKKQVRGSATAKRSRAAEVHNLSER  318


 Score = 85.5 bits (210),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  319   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  363


 Score = 51.6 bits (122),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 68/149 (46%), Gaps = 36/149 (24%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP--------AMGIGMGMNPPVAPYpmggprfpmpafpm  1697
             MMS+G  C M+PMM+PG+QQYMP         MG+ MGMN P+ P+P       +P    
Sbjct  363   MMSMG--CSMVPMMYPGVQQYMPQMGMGMGMGMGMEMGMNRPMMPFPSVLGGSTLPTTAA  420

Query  1698  ptpfS------------MADP--SRIQALNHTDPMLnsphnsshp------------pFP  1799
                              MA P  SRIQA N +DP+LNS    S               + 
Sbjct  421   AAHLGQRYPMPAFHMPHMAAPDSSRIQANNQSDPVLNSLGTQSSNQPRVPNFADPYLQYL  480

Query  1800  TQTQVTPSMNEMAEHSNKSKPCSSKDVEN  1886
              Q Q+ P+ N+     N SKP +SK  EN
Sbjct  481   QQMQMPPAQNQAMGQQNTSKPSTSKGTEN  509



>ref|XP_010652454.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_002263397.3| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_010652455.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
 ref|XP_010652456.1| PREDICTED: transcription factor PIF1 isoform X1 [Vitis vinifera]
Length=530

 Score =   107 bits (268),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 160/335 (48%), Gaps = 38/335 (11%)
 Frame = +3

Query  333   MNHHCAVPEFEMD-EDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQN  509
             MNH   VP+FE+D ED  PL              +     +DEIMELLWQNGQVV+  QN
Sbjct  1     MNH--CVPDFEVDDEDAIPL---------TRPKKSAAMVEDDEIMELLWQNGQVVMQIQN  49

Query  510   HQRSVKRSHGG-----DAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPL  674
              QRS K+S        DA +P P   ++  SA  + +++    +LFMQEDEMASWLHYPL
Sbjct  50    -QRSFKKSQPSKFPIQDAVLP-PEQSKIRSSAPVDESSA----QLFMQEDEMASWLHYPL  103

Query  675   VDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsgr-TDVLRSQN  851
              D    L       ++S   A      D R           P+PP       + V    +
Sbjct  104   DDFCADLLDPTPCVNASPPPARPNLSPDVRQPEERPAATKPPIPPARRVELDSKVHNFLH  163

Query  852   FARLCRPPAG-PSRAASTVVES-----NDTPIVPSEYRDSHVADSTAQVSGGNLGPRgga  1013
             F R     +G PS +    +ES     +DTP V  + R S      A+++    G  GGA
Sbjct  164   FPRKSTAESGEPSSSRPAGMESTVVDSSDTPGVCQQSRTSPAEWCKAELANSGYGTIGGA  223

Query  1014  msgteaagastgaKEMTVTSSPDDGSGASVSAEKS-TAPATAMDDRKAKGSETDD--EGH  1184
                  +A       E+T+TSSP+       ++  +   P    DDRK KG E DD  E  
Sbjct  224   TEAATSAAGEHTTFELTMTSSPEGSGSGGSASAGAEPTPKAPADDRKRKGREGDDTAEYQ  283

Query  1185  NADTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             + D +F   +AKKQ     ++KRSRAAEVHNLSER
Sbjct  284   SEDVEFESADAKKQVRGSATAKRSRAAEVHNLSER  318


 Score = 85.1 bits (209),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  319   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  363


 Score = 51.6 bits (122),  Expect(3) = 1e-48, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 68/149 (46%), Gaps = 36/149 (24%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP--------AMGIGMGMNPPVAPYpmggprfpmpafpm  1697
             MMS+G  C M+PMM+PG+QQYMP         MG+ MGMN P+ P+P       +P    
Sbjct  363   MMSMG--CSMVPMMYPGVQQYMPQMGMGMGMGMGMEMGMNRPMMPFPSVLGGSTLPTTAA  420

Query  1698  ptpfS------------MADP--SRIQALNHTDPMLnsphnsshp------------pFP  1799
                              MA P  SRIQA N +DP+LNS    S               + 
Sbjct  421   AAHLGQRYPMPAFHMPHMAAPDSSRIQANNQSDPVLNSLGTQSSNQPRVPNFADPYLQYL  480

Query  1800  TQTQVTPSMNEMAEHSNKSKPCSSKDVEN  1886
              Q Q+ P+ N+     N SKP +SK  EN
Sbjct  481   QQMQMPPAQNQAMGQQNTSKPSTSKGTEN  509



>emb|CDP03833.1| unnamed protein product [Coffea canephora]
Length=538

 Score =   109 bits (273),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 180/359 (50%), Gaps = 56/359 (16%)
 Frame = +3

Query  339   HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
             +HC VP+FEMD+DY  +P  +  +A+  +   K +  E+EIMELLWQNGQVV  +QN QR
Sbjct  2     NHC-VPDFEMDDDYG-IPTSSSINASTTARPKKPAIGEEEIMELLWQNGQVVFQSQN-QR  58

Query  519   SVKRS--HGG--DAAIPVPAAREVVGSAEEE-----MATSHHQPELFMQEDEMASWLHYP  671
             S K+S   GG  D      A+RE+    E +         H Q +LFMQEDEMASWLHYP
Sbjct  59    SFKKSPNRGGEPDQLHQSGASREIPSILENDNLSAAAPPQHQQQQLFMQEDEMASWLHYP  118

Query  672   ---------LVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg  824
                      L  D  Y        +++       PPR+ R +  E+R PPA +PP PP  
Sbjct  119   LDDSSFDRDLYSDLLYPPPPSASTTTTMTPTPSVPPRELRTTIVEIRPPPAVIPPRPPVP  178

Query  825   rTD---------VLRSQNFARLCRPP-----AGPSRAASTVVESNDTPIVPSEYRDSHVA  962
                           R QNF    R P     +G +R   TVV+SN+T     E R     
Sbjct  179   PPSKGTYPIEAAAPRLQNFMHFSRLPKSRNESGYTREL-TVVDSNETQTTVPESRVPE--  235

Query  963   DSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSSPD-DGSGASVSAEKSTAPATAM  1139
                  V  G +     A +   A   +T A E+TVTSSP   G   S +AE    P T++
Sbjct  236   ---GDVRCGAVSCTAAAATSAAARDLATTACELTVTSSPGASGGSVSATAEPHHRPPTSI  292

Query  1140  --------DDRKAKGSETDD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSER  1274
                     +DRK KG ET++ +  + D +F   +AK+Q    TS+KRSRAAEVHNLSER
Sbjct  293   HKPSTSGVEDRKRKGRETEETDCPSEDIEFESADAKRQARGSTSTKRSRAAEVHNLSER  351


 Score = 86.7 bits (213),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  352   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQL  396


 Score = 45.1 bits (105),  Expect(3) = 1e-47, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 50/98 (51%), Gaps = 26/98 (27%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAM----------GIGMGMNPPVAPYpmggprfpmpaf  1691
             +MS+G  CGM+PMM+P +QQYMPAM          G+ +GMN PV PYP   P   MP+ 
Sbjct  396   LMSMG--CGMLPMMYPSVQQYMPAMGMGMGMGMGMGMDLGMNRPVMPYPSFIPGSGMPSP  453

Query  1692  pmptpfS--------------MADPSRIQALNHTDPML  1763
              +                   + D SRIQA N  DPML
Sbjct  454   AVAANMGPRFPMPAFHMQPVPVPDSSRIQASNQLDPML  491



>ref|XP_009597634.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Nicotiana 
tomentosiformis]
Length=137

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 108/136 (79%), Gaps = 4/136 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQP----SSEENLAPTPAL  2478
             MGPK C VC+ AQSKYKCP+C IPYCSL CFKKHKEI C KP+P    SS E LA  P  
Sbjct  1     MGPKNCKVCDVAQSKYKCPNCFIPYCSLVCFKKHKEIFCVKPEPELEPSSVEKLASAPES  60

Query  2477  HVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQ  2298
             HV+KP+ + E S+VL Q +LES+ASS+EI EA+R++ELQ LICNIDSS DAE++LDKAM+
Sbjct  61    HVEKPICIAEQSEVLNQLRLESIASSNEIREAIRNKELQNLICNIDSSMDAEAELDKAME  120

Query  2297  KEEFHILAQKILSTIS  2250
             KEEF I ++KILS IS
Sbjct  121   KEEFRIFSEKILSMIS  136



>ref|XP_004240467.1| PREDICTED: transcription factor PIF1-like isoform X2 [Solanum 
lycopersicum]
Length=508

 Score =   106 bits (265),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 169/341 (50%), Gaps = 58/341 (17%)
 Frame = +3

Query  339   HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
             ++C VP+F+MD+DY  +P              K +  ++EIMEL+WQNG V++ +QN QR
Sbjct  2     NYCVVPDFKMDDDYYDIP--------SAIFNKKSTIADEEIMELVWQNGGVIMQSQN-QR  52

Query  519   SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDDspyls  698
             SV++S+      P  +A       E+ +A S     L+MQEDEM SWL  PL D S    
Sbjct  53    SVRKSN----LFPEQSA------VEQTVAVSA---PLYMQEDEMNSWLQSPLDDSSFDDF  99

Query  699   adllypssssaaaavappRDFRASApevrrppaplppippsgrTDVL--RSQNFARLCR-  869
              +      +  +AA APP +   S  E+R P  P    P       L  R QNF    R 
Sbjct  100   LNTTPSCDAVTSAAAAPPGEIGTSKVEIRPPLVPPCSRPIRCTEGELPHRLQNFGHFSRL  159

Query  870   -----------PPAGPSRAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggam  1016
                          +G S  AST+V+SN+TP+       + V+++   V+  N+  R    
Sbjct  160   SGEAVLRNGTTSSSGHSVRASTIVDSNETPVA------ARVSENVTPVTAMNVRGRELTA  213

Query  1017  sgteaag---astgaKEMTVTSSPDDGSGASVSAEKS------TAPATAMDDRKAKGSET  1169
             +           T A E+ +T+S   GSG SVSA         T   TA  DRK K  E+
Sbjct  214   TSMATTSGGREVTMACELALTAS-TRGSGGSVSARAGPPQPSHTEADTAAYDRKRKSRES  272

Query  1170  DD-EGHNADTDFGY-NAKKQ----TSSKRSRAAEVHNLSER  1274
             DD EG + D ++ + +A+KQ    TS+K+SRAAEVHNLSER
Sbjct  273   DDNEGQSEDVEYEFADARKQVRSSTSAKKSRAAEVHNLSER  313


 Score = 82.8 bits (203),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  314   KRRDRINEKMKALQELIPCCNKSDKASMLDEAIEYLKSLQLQVQM  358


 Score = 49.3 bits (116),  Expect(3) = 7e-47, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 3/33 (9%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMGM  1634
             QMM +   GC M+PMM+PGI QYMP MG+ M M
Sbjct  357   QMMAT---GCSMVPMMYPGIPQYMPTMGMNMSM  386



>ref|XP_010321805.1| PREDICTED: transcription factor PIF1-like isoform X1 [Solanum 
lycopersicum]
Length=512

 Score =   106 bits (265),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 120/341 (35%), Positives = 169/341 (50%), Gaps = 58/341 (17%)
 Frame = +3

Query  339   HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
             ++C VP+F+MD+DY  +P              K +  ++EIMEL+WQNG V++ +QN QR
Sbjct  2     NYCVVPDFKMDDDYYDIP--------SAIFNKKSTIADEEIMELVWQNGGVIMQSQN-QR  52

Query  519   SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDDspyls  698
             SV++S+      P  +A       E+ +A S     L+MQEDEM SWL  PL D S    
Sbjct  53    SVRKSN----LFPEQSA------VEQTVAVSA---PLYMQEDEMNSWLQSPLDDSSFDDF  99

Query  699   adllypssssaaaavappRDFRASApevrrppaplppippsgrTDVL--RSQNFARLCR-  869
              +      +  +AA APP +   S  E+R P  P    P       L  R QNF    R 
Sbjct  100   LNTTPSCDAVTSAAAAPPGEIGTSKVEIRPPLVPPCSRPIRCTEGELPHRLQNFGHFSRL  159

Query  870   -----------PPAGPSRAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggam  1016
                          +G S  AST+V+SN+TP+       + V+++   V+  N+  R    
Sbjct  160   SGEAVLRNGTTSSSGHSVRASTIVDSNETPVA------ARVSENVTPVTAMNVRGRELTA  213

Query  1017  sgteaag---astgaKEMTVTSSPDDGSGASVSAEKS------TAPATAMDDRKAKGSET  1169
             +           T A E+ +T+S   GSG SVSA         T   TA  DRK K  E+
Sbjct  214   TSMATTSGGREVTMACELALTAS-TRGSGGSVSARAGPPQPSHTEADTAAYDRKRKSRES  272

Query  1170  DD-EGHNADTDFGY-NAKKQ----TSSKRSRAAEVHNLSER  1274
             DD EG + D ++ + +A+KQ    TS+K+SRAAEVHNLSER
Sbjct  273   DDNEGQSEDVEYEFADARKQVRSSTSAKKSRAAEVHNLSER  313


 Score = 82.8 bits (203),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  314   KRRDRINEKMKALQELIPCCNKSDKASMLDEAIEYLKSLQLQVQM  358


 Score = 49.3 bits (116),  Expect(3) = 8e-47, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 3/33 (9%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMGM  1634
             QMM +   GC M+PMM+PGI QYMP MG+ M M
Sbjct  357   QMMAT---GCSMVPMMYPGIPQYMPTMGMNMSM  386



>ref|XP_010652458.1| PREDICTED: transcription factor PIF1 isoform X3 [Vitis vinifera]
Length=489

 Score =   107 bits (268),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 160/333 (48%), Gaps = 37/333 (11%)
 Frame = +3

Query  339   HHCAVPEFEMD-EDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQ  515
             +HC VP+FE+D ED  PL              +     +DEIMELLWQNGQVV+  QN Q
Sbjct  2     NHC-VPDFEVDDEDAIPL---------TRPKKSAAMVEDDEIMELLWQNGQVVMQIQN-Q  50

Query  516   RSVKRSHGG-----DAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
             RS K+S        DA +P P   ++  SA  + +++    +LFMQEDEMASWLHYPL D
Sbjct  51    RSFKKSQPSKFPIQDAVLP-PEQSKIRSSAPVDESSA----QLFMQEDEMASWLHYPLDD  105

Query  681   DspylsadllypssssaaaavappRDFRASApevrrppaplppippsgr-TDVLRSQNFA  857
                 L       ++S   A      D R           P+PP       + V    +F 
Sbjct  106   FCADLLDPTPCVNASPPPARPNLSPDVRQPEERPAATKPPIPPARRVELDSKVHNFLHFP  165

Query  858   RLCRPPAG-PSRAASTVVES-----NDTPIVPSEYRDSHVADSTAQVSGGNLGPRggams  1019
             R     +G PS +    +ES     +DTP V  + R S      A+++    G  GGA  
Sbjct  166   RKSTAESGEPSSSRPAGMESTVVDSSDTPGVCQQSRTSPAEWCKAELANSGYGTIGGATE  225

Query  1020  gteaagastgaKEMTVTSSPDDGSGASVSAEKS-TAPATAMDDRKAKGSETDD--EGHNA  1190
                +A       E+T+TSSP+       ++  +   P    DDRK KG E DD  E  + 
Sbjct  226   AATSAAGEHTTFELTMTSSPEGSGSGGSASAGAEPTPKAPADDRKRKGREGDDTAEYQSE  285

Query  1191  DTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             D +F   +AKKQ     ++KRSRAAEVHNLSER
Sbjct  286   DVEFESADAKKQVRGSATAKRSRAAEVHNLSER  318


 Score = 85.5 bits (210),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  319   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  363


 Score = 43.5 bits (101),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  C M+PMM+PG+QQYMP
Sbjct  363   MMSMG--CSMVPMMYPGVQQYMP  383



>ref|XP_011080155.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Sesamum 
indicum]
Length=133

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 106/132 (80%), Gaps = 0/132 (0%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP+KC VCEEAQSKYKCPSC+IPYCSL CFKKHKE PC KP+P +EE + P+ A + DK
Sbjct  1     MGPRKCEVCEEAQSKYKCPSCLIPYCSLACFKKHKETPCSKPEPINEEKVYPSAATNDDK  60

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             P YVDE ++VL +SQL+S+A+S+EI + +++E+LQK+I  ID S D E++LDK+M++E F
Sbjct  61    PCYVDEQNEVLQESQLQSLAASNEIRDLIKNEKLQKVIYKIDCSADPENELDKSMEEESF  120

Query  2285  HILAQKILSTIS  2250
              + A+KI S I 
Sbjct  121   RLFAEKISSIIG  132



>ref|XP_009591396.1| PREDICTED: transcription factor PIF1-like [Nicotiana tomentosiformis]
Length=554

 Score = 88.2 bits (217),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  355   RRRDRINEKMRALQELIPRCNKTDKASMLDEAIEYLKSLQLQVQM  399


 Score = 84.3 bits (207),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 95/174 (55%), Gaps = 29/174 (17%)
 Frame = +3

Query  840   RSQNFARLCRPPA------GPSRAA-----STVVESNDTPIVPSEYRDSHVADSTAQVSG  986
             R QNF    R P+      GPS ++     STVVESN+TPI   E R S+VAD+   V G
Sbjct  181   RFQNFGHFSRLPSRTRSELGPSNSSKSPRESTVVESNETPISGPESRVSYVADNVVPVPG  240

Query  987   GNLGPRggamsgteaagastgaK----EMTVTSSPDDGSGASVSAEKSTAPATAM-----  1139
             GN+G     ++GT  A  +        E++VTSSP  G+  + SAE   +   A+     
Sbjct  241   GNVGCGAVNVNGTATASTAIREPAATCELSVTSSPGSGNSINTSAEPPPSQTAALATPTA  300

Query  1140  ---DDRKAKGSETDD-EGHNADTDF-----GYNAKKQTSSKRSRAAEVHNLSER  1274
                +DRK KG ET+D +G N + +F       +A+   S+KRSRAAEVHNLSER
Sbjct  301   AASNDRKRKGRETNDGDGQNEEAEFESGDTKKHARGSASTKRSRAAEVHNLSER  354


 Score = 55.1 bits (131),  Expect(3) = 1e-43, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 71/158 (45%), Gaps = 38/158 (24%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA--------MGIGMGMNPPVAPYpmggprfpmpafpm  1697
             MMS+G  CGM+PMM+PG+QQYMPA        MG+ +GMN P+ PYP   P   M     
Sbjct  399   MMSMG--CGMVPMMYPGMQQYMPAMGMGMGMGMGMEIGMNRPMVPYPPLLPGAAMQNAAA  456

Query  1698  ptpfS--------------MADPSRIQALNHTDPML--nsphnsshppFPT---------  1802
                                + DPSR+QA +  DPML     HN + P  P          
Sbjct  457   AARMGPRFPMPPFHLPPVPVPDPSRMQASSQQDPMLHPLVAHNPNQPRLPNFNDPYQQFF  516

Query  1803  ---QTQVTPSMNEMAEHSNKSKPCSSKDVENPTTLQCG  1907
                Q QV    N+  E    +KP S K+V NP   Q G
Sbjct  517   GLHQAQVQLPQNQAVEQQGNNKPGSRKEVGNPGNPQSG  554


 Score = 91.7 bits (226),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 81/124 (65%), Gaps = 22/124 (18%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            MNH  +VP+F+MD DY+ +P     +++GL+   K + +ED+IMELLW NGQVV+ +QN 
Sbjct  1    MNH--SVPDFDMDGDYT-IP-----TSSGLTRPKKSAMVEDDIMELLWHNGQVVMQSQN-  51

Query  513  QRSVKRSH------GGDAAIPVPAA--REVVGSAEEEMATSHHQPELFMQEDEMASWLHY  668
            QRS+K+SH       GDA IP   A  RE+     EE  T     +LFMQEDEMASWLHY
Sbjct  52   QRSLKKSHISNGGGSGDALIPSEQAVSREI--RHVEETTTPQ---QLFMQEDEMASWLHY  106

Query  669  PLVD  680
            PL D
Sbjct  107  PLDD  110



>ref|NP_001238734.1| uncharacterized protein LOC100527614 [Glycine max]
 gb|ACU16742.1| unknown [Glycine max]
Length=132

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC EAQSKYKCPSC +PYCSL CFKKHKE+PC KPQPS  +  A + ++  +K
Sbjct  1     MGPRQCQVCNEAQSKYKCPSCYLPYCSLVCFKKHKELPCVKPQPSEAKTTAVSESI-AEK  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL VDE S+VL + QLE++ASSSEI +AL  + LQ+LIC ID S++AE++LDKAM +E F
Sbjct  60    PLVVDESSEVLEKFQLEAIASSSEIRDALNDKALQELICRIDCSSNAENELDKAMAEEAF  119

Query  2285  HILAQKILSTISP  2247
              +L  KILSTI+P
Sbjct  120   RLLTDKILSTINP  132



>gb|AGW52145.1| PIL [Populus tomentosa]
Length=571

 Score = 98.6 bits (244),  Expect(3) = 5e-43, Method: Compositional matrix adjust.
 Identities = 118/342 (35%), Positives = 157/342 (46%), Gaps = 47/342 (14%)
 Frame = +3

Query  351   VPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSVKR  530
             VP+FEMD+DYS  P       +  +   K +  E+EIMELLWQNGQVV+H+Q  Q+    
Sbjct  5     VPDFEMDDDYSLPP-----PPSTHTRPRKPAMQEEEIMELLWQNGQVVMHSQRSQKKSSS  59

Query  531   SHGG--DAAIP---VPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD-----  680
                   DA +P   +P  +E+  S +++    HH   LFMQEDEMASWL++PL D     
Sbjct  60    PPSKLDDAVLPAHQLPGTKEIRSSHDQQ--QEHHH--LFMQEDEMASWLNHPLNDTNFDH  115

Query  681   ----DspylsadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVLRSQ  848
                 D  Y         +  AA   A     R +   +     P    P      V R++
Sbjct  116   DFCADLLYPPTASTASITREAAVTNAAASTVRGATQRMEARSYPAVSAPRPPIPPVRRAE  175

Query  849   ---NFARLCRPPA------GPSRAA-----STVVESNDTPIVP-SEYRDSHVADSTAQVS  983
                NFA   R  A      GPS +      STVV+S +TP    SE   +   D+T    
Sbjct  176   VVQNFAYFSRHRAGGVSESGPSNSKSMIRESTVVDSCETPTARISETAFARSVDNTCGTM  235

Query  984   GGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGS  1163
              G       + + +      T   EMT TSS    S      ++       ++DRK KG 
Sbjct  236   NGAAVAGTVSSAPSSNREMMTNPCEMTSTSSQCSESYTPYECQRE----RGVEDRKRKGR  291

Query  1164  ETDDEGHNADTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             E + E H+ D +F   +A KQ     SSKRSRAAEVHNLSER
Sbjct  292   EEEAECHSEDAEFESADANKQIRGSMSSKRSRAAEVHNLSER  333


 Score = 86.7 bits (213),  Expect(3) = 5e-43, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  334   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  378


 Score = 40.4 bits (93),  Expect(3) = 5e-43, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 18/22 (82%), Gaps = 2/22 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G  C M+PMMFPG QQYM
Sbjct  378   MMSMG--CSMVPMMFPGFQQYM  397



>ref|XP_006364548.1| PREDICTED: transcription factor PIF1-like [Solanum tuberosum]
Length=515

 Score =   107 bits (268),  Expect(3) = 7e-43, Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 179/339 (53%), Gaps = 48/339 (14%)
 Frame = +3

Query  339   HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
             ++C VP+F+MD+DYS +      ++A  +   K +  ++EIMEL+WQNG+V++ +QN QR
Sbjct  2     NYCVVPDFKMDDDYSDI------ASAIFNISKKSTIADEEIMELVWQNGRVIMQSQN-QR  54

Query  519   SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDDspyls  698
             SV++S+                + EE +A S     L+MQEDEM SWL  PL DDS +  
Sbjct  55    SVRKSNLFSEQ----------SAVEETVAASA---PLYMQEDEMNSWLQSPL-DDSSFDD  100

Query  699   adllypssssaaaavappRDFRASApevrrppaplppippsgrTDVL--RSQNFARLCRP  872
                  PS ++  +A APP +   S  E+R P AP    P       L  R QNF    R 
Sbjct  101   FLNTTPSCAAVTSAAAPPGEIGTSTVEIRPPLAPPSSRPVRCTEGELPHRLQNFGHFSRL  160

Query  873   PAGP------------SRAASTVVESNDTPIVPS-EYRDSHVADSTAQVSGGNL-GPRgg  1010
             P G             S  AST+V+SN+TP+V   EY  S V+D     S  N+ G    
Sbjct  161   PEGAILRNGNTSSSRHSVRASTIVDSNETPVVAGPEYMISRVSDDVPLASAVNVRGVEMT  220

Query  1011  amsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPA-----TAMDDRKAKGSETDD  1175
             AM+ T      T A E+T+T+S     G+  +      P+      A +DRK KG E+DD
Sbjct  221   AMATTSGDREVTTACELTLTASTSGSGGSVSTRSDLPQPSYKEADAAAEDRKRKGRESDD  280

Query  1176  -EGHNADTDFGY-NAKKQ----TSSKRSRAAEVHNLSER  1274
              +G + D ++ + +A+KQ    TS+K+SRAAEVHNLSER
Sbjct  281   NDGQSEDVEYEFADARKQVRSSTSAKKSRAAEVHNLSER  319


 Score = 84.3 bits (207),  Expect(3) = 7e-43, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  320   KRRDRINEKMKALQELIPHCNKSDKASMLDEAIEYLKSLQLQVQM  364


 Score = 33.1 bits (74),  Expect(3) = 7e-43, Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (74%), Gaps = 3/23 (13%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQY  1604
             QMM +   GC ++P+M+PGI QY
Sbjct  363   QMMAT---GCSLVPVMYPGIPQY  382



>ref|XP_010245667.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Nelumbo nucifera]
Length=142

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC+EAQSKYKCPSC+ PYCSL CFKKHKEIPC K   S      P P L+  +
Sbjct  1     MGPRQCEVCKEAQSKYKCPSCLTPYCSLACFKKHKEIPCSKAVTSEASEAKPGPILYPKR  60

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
                VD+PSQVL + QLE++  S+EI +AL++EELQKLI  ID STDAE++LDKAM++E+F
Sbjct  61    SYQVDDPSQVLQKVQLEAIVDSTEIRDALKNEELQKLIYQIDCSTDAENELDKAMEREDF  120

Query  2285  HILAQKILSTISP  2247
                  KILS ISP
Sbjct  121   RKFTDKILSIISP  133



>emb|CDP03834.1| unnamed protein product [Coffea canephora]
Length=132

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGPK C VC++AQSKYKCP C++PYCSL CFKKHKEIPC KP+ SS+   AP  A+H+ K
Sbjct  1     MGPKICQVCDDAQSKYKCPRCLVPYCSLVCFKKHKEIPCSKPESSSQ---APKRAVHLGK  57

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             P YV +PS+ L Q QLES+A SSEI + L+ +ELQKLI N+D S +AE +L KAM+ + F
Sbjct  58    PYYVHDPSESLQQVQLESIACSSEIRDILKDKELQKLILNVDGSAEAEKELGKAMEVDAF  117

Query  2285  HILAQKILSTISP  2247
              I  +KILS I P
Sbjct  118   RIFTEKILSIIGP  130



>ref|XP_009794497.1| PREDICTED: transcription factor PIF1 [Nicotiana sylvestris]
Length=557

 Score = 87.8 bits (216),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  359   RRRDRINEKMRALQELIPRCNKTDKASMLDEAIEYLKSLQLQVQM  403


 Score = 85.9 bits (211),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 94/174 (54%), Gaps = 29/174 (17%)
 Frame = +3

Query  840   RSQNFARLCRPPA------GPSRAA-----STVVESNDTPIVPSEYRDSHVADSTAQVSG  986
             R QNF    R P+      GPS ++     STVV+SN+TPI   E R S VAD+   V G
Sbjct  185   RFQNFGHFSRLPSRTRSELGPSNSSKSPRESTVVDSNETPISGPESRVSQVADNVVPVPG  244

Query  987   GNLGPRggamsgteaagastgaK----EMTVTSSPDDGSGASVSAEKSTAPATAM-----  1139
             GN       ++GT  A  +        E++VTSSP  G+  + SAE   +   A+     
Sbjct  245   GNGACGAVNVNGTATASTAIREPATTCELSVTSSPGSGNSINASAEPPLSETAALATPTA  304

Query  1140  ---DDRKAKGSETDD-EGHNADTDFG-----YNAKKQTSSKRSRAAEVHNLSER  1274
                +DRK KG ETDD +G N D +FG      +A+  TS+KRSRAAEVHNLSER
Sbjct  305   AASNDRKRKGIETDDGDGQNEDAEFGSGDTKKHARGSTSTKRSRAAEVHNLSER  358


 Score = 49.7 bits (117),  Expect(3) = 3e-42, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 70/157 (45%), Gaps = 37/157 (24%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY-------MPAMGIGMGMNPPVAPYpmggprfpmpafpmp  1700
             MMS+G  CGM+PMM+PG+QQY       M  MG+ +GMN P+ PYP   P   M      
Sbjct  403   MMSMG--CGMVPMMYPGMQQYMPAMGMGMVGMGMEIGMNRPMVPYPPLLPGAAMQNAAAA  460

Query  1701  tpfS--------------MADPSRIQALNHTDPMLn--sphnsshppFPT----------  1802
                               + DPSR+QA +  DPMLN     N + P  P           
Sbjct  461   AQMGPRFPMAPFHLPPVPVPDPSRMQASSQQDPMLNPLVARNPNQPRLPNFNDPYQQHFG  520

Query  1803  --QTQVTPSMNEMAEHSNKSKPCSSKDVENPTTLQCG  1907
               Q QV    N+  E    +KP SSK+V NP   Q G
Sbjct  521   LHQAQVQLPQNQAVEQQGYNKPGSSKEVGNPGNPQSG  557


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 81/127 (64%), Gaps = 25/127 (20%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            MNH  +VPEF+MD+DY+ +P     +++GL+   K +  E++IMELLW NGQVV+ +QN 
Sbjct  1    MNH--SVPEFDMDDDYT-IP-----TSSGLTRPKKSAMAEEDIMELLWHNGQVVMQSQN-  51

Query  513  QRSVKRSH---------GGDAAIPVPAA--REVVGSAEEEMATSHHQPELFMQEDEMASW  659
            QRS+K+SH          GDA IP   A  RE+     EE  T     +LFMQEDEMASW
Sbjct  52   QRSLKKSHISNGGGGGGSGDALIPSEQAVSREI--RHVEETTTPQ---QLFMQEDEMASW  106

Query  660  LHYPLVD  680
            LHYPL D
Sbjct  107  LHYPLDD  113



>ref|XP_003542452.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X1 [Glycine max]
Length=132

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC + QSKYKCPSC +PYCSL CFKKHKE PC KPQPS  +  A + +  V+K
Sbjct  1     MGPRQCQVCNQTQSKYKCPSCYLPYCSLVCFKKHKESPCVKPQPSETKATAVSESF-VEK  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL  DE S+VL + QLE++ASSSEI +AL  E LQ+LIC ID S++AE++LDKAM +E F
Sbjct  60    PLVADESSEVLQKFQLEAIASSSEIRDALNDEALQELICRIDGSSNAENELDKAMAEEAF  119

Query  2285  HILAQKILSTISP  2247
              +   KILSTI+P
Sbjct  120   RLFTDKILSTINP  132



>ref|XP_007201708.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
 gb|EMJ02907.1| hypothetical protein PRUPE_ppa004070mg [Prunus persica]
Length=531

 Score = 92.8 bits (229),  Expect(3) = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/340 (34%), Positives = 156/340 (46%), Gaps = 42/340 (12%)
 Frame = +3

Query  348   AVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSVK  527
              VP+FEM++DYS +P     +++  +   K S  +DEIMELLWQNGQVV+ +QN + S  
Sbjct  4     CVPDFEMEDDYS-IP-----TSSAPNRLRKSSLPDDEIMELLWQNGQVVMQSQNQRPSPN  57

Query  528   RSHGGDA----AIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLV-DDspy  692
                   A    A  +P  R++          +H   +LFM EDEMASWL YPLV D    
Sbjct  58    NKKSSQAPSKYAAVLPEDRDIPRPQPHPTPQNH---QLFMHEDEMASWLQYPLVDDPFCA  114

Query  693   lsadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVL----RSQNFAR  860
                     +        A   + R +         P+ P   +   + L     + N AR
Sbjct  115   DLLYPDSSTVHQTNTNTAAAAELRPNPISAPPSKPPIHPPRRTELQNFLPFAKTNNNTAR  174

Query  861   LCRPPAGPS------RAASTVVESNDTPIVPSEYR--DSHVADSTAQVSGGNLGPRggam  1016
             +      PS      R ++TVV+S DTP+V    R  DS +                 A 
Sbjct  175   VSE--TAPSSSKSVVRESTTVVDSCDTPLVGHSSRALDSGLDGGGGGGGVTAGAATSFAT  232

Query  1017  sgteaagastgaK-----EMTVTSSPDDGSGASVSAEK--STAPATAMDDRKAKGSETDD  1175
               T  A  S   K     EM++TSSP   S ++  + +  S+    A +DRK KG E +D
Sbjct  233   VATANAATSFTGKEIMTCEMSLTSSPGGSSASASVSAEPISSQKPRAGEDRKRKGREAED  292

Query  1176  EGHNADTDFGY---NAKKQ----TSSKRSRAAEVHNLSER  1274
             +G     D  +   N KKQ    TS+KRSRAAEVHNLSER
Sbjct  293   DGEFQSEDVEFESANGKKQARGSTSTKRSRAAEVHNLSER  332


 Score = 85.5 bits (210),  Expect(3) = 1e-41, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  333   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  377


 Score = 42.7 bits (99),  Expect(3) = 1e-41, Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 40/109 (37%), Gaps = 50/109 (46%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY-----------------------------------MPAM  1616
             MMS+G  CGM+PMMFPG+QQY                                   MP  
Sbjct  377   MMSMG--CGMVPMMFPGVQQYMPMGMGMGMGMGIGMEMAGMTRPMMPFPNVLAGSSMPTA  434

Query  1617  GIGMGMNPPVAPYpmggprfpmpafpmptpfSMADPSRIQALNHTDPML  1763
                +G   PV P+ M                   DP+R+QA N +D ML
Sbjct  435   AAHLGPRFPVPPFHMQPIPAN-------------DPARVQATNQSDQML  470



>ref|XP_010038345.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Eucalyptus grandis]
Length=132

 Score =   159 bits (403),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC EAQSKYKCPSC++PYCSL CFK+HKE PC KP  S + + A +  LH  +
Sbjct  1     MGPRQCRVCNEAQSKYKCPSCLVPYCSLACFKRHKEAPCIKPV-SPDHSEAASGELHGYR  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL +D+P+ V+ Q QLES+ASSSEI + L+ E LQKLI  ID S D +SDL+KAM+ E F
Sbjct  60    PLNIDDPNDVVQQGQLESLASSSEIRDVLKDESLQKLISKIDGSGDPDSDLEKAMEVEAF  119

Query  2285  HILAQKILSTISP  2247
             H+ A KILS I P
Sbjct  120   HLFADKILSAIGP  132



>gb|EYU46363.1| hypothetical protein MIMGU_mgv1a016147mg [Erythranthe guttata]
Length=133

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             M PKKC VC+++QSKYKCP+C+IPYCSL CFKKHK IPC KP+  +EE +   PA ++DK
Sbjct  1     MAPKKCEVCDKSQSKYKCPTCLIPYCSLACFKKHKVIPCTKPESVNEEKVHSVPARNIDK  60

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             P  VDE S+VL +SQL+S+ASS++I ++++ E+LQKLI +ID S + ES+LD+AM  E F
Sbjct  61    PCCVDEQSEVLQESQLQSIASSNDIRDSVKDEKLQKLIRDIDCSANPESELDRAMNDESF  120

Query  2285  HILAQKILSTIS  2250
              +  +KILSTI 
Sbjct  121   RLFTEKILSTIG  132



>ref|XP_010038342.1| PREDICTED: transcription factor PIF1-like isoform X2 [Eucalyptus 
grandis]
Length=542

 Score = 95.1 bits (235),  Expect(3) = 7e-41, Method: Compositional matrix adjust.
 Identities = 132/359 (37%), Positives = 157/359 (44%), Gaps = 65/359 (18%)
 Frame = +3

Query  342   HCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRS  521
             HC VP+F+MD+DYS LP    P    L+G        DEI ELLWQNG VV+ +Q   RS
Sbjct  3     HC-VPDFDMDDDYS-LPSFPRPRRPHLAG--------DEIAELLWQNGPVVMQSQ---RS  49

Query  522   VKRSH--GGD----AAIPVPAAREVVGSAEEEMATSHHQPE-------------LFMQED  644
             VK+S   G D    +AI      +     + +      Q +             LFMQED
Sbjct  50    VKKSEPSGCDGYQLSAIQSQTQHQHQHQHQHQQQQQQQQQQQQQEREQEQQQQHLFMQED  109

Query  645   EMASWLHYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg  824
             EMASWLHYPL D S               A         RAS         P P  P   
Sbjct  110   EMASWLHYPLNDASFVADFCSDLLYPPPCANVNVAATAARASPVVAELRQQPPPKPPTPM  169

Query  825   rTDVLRSQNF---ARLCRP------PAGPSRAA--STVVESNDTPIVPSEYRDS---HVA  962
                  R +NF   +RL RP      P+  SRA   STVV+S+ TP V    R S   H  
Sbjct  170   -APPRRFENFGHFSRLNRPRVDESGPSNSSRAGNESTVVDSSGTPAVGPRSRVSEALHCD  228

Query  963   DSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGAS---VSAEKSTAPAT  1133
              S   V GG       A S  +  G   G  E+TVTSSP   S  +      + S+ P  
Sbjct  229   VSRGTVDGGAAA---LATSSADGGGREMGTCELTVTSSPGASSACAEPLPPRKSSSTPPP  285

Query  1134  AMDDRKAKGSETDD-------EGHNADT-----DFGYNAKKQTSSKRSRAAEVHNLSER  1274
               +DRK KG E D        E H+ D      D    A+  TSSKRSRAAEVHNLSER
Sbjct  286   PAEDRKRKGIEIDPDADPDADECHSEDVELESADTKKPARGSTSSKRSRAAEVHNLSER  344


 Score = 82.8 bits (203),  Expect(3) = 7e-41, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  345   RRRDRINEKMKALQELIPHCNKSDKASMLDEAIEYLKSLQMQVQM  389


 Score = 40.8 bits (94),  Expect(3) = 7e-41, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+ QY+P
Sbjct  389   MMSMG--CGVVPMMFPGVHQYVP  409



>ref|XP_010038341.1| PREDICTED: transcription factor PIF1-like isoform X1 [Eucalyptus 
grandis]
Length=566

 Score = 94.7 bits (234),  Expect(3) = 8e-41, Method: Compositional matrix adjust.
 Identities = 132/359 (37%), Positives = 157/359 (44%), Gaps = 65/359 (18%)
 Frame = +3

Query  342   HCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRS  521
             HC VP+F+MD+DYS LP    P    L+G        DEI ELLWQNG VV+ +Q   RS
Sbjct  3     HC-VPDFDMDDDYS-LPSFPRPRRPHLAG--------DEIAELLWQNGPVVMQSQ---RS  49

Query  522   VKRSH--GGD----AAIPVPAAREVVGSAEEEMATSHHQPE-------------LFMQED  644
             VK+S   G D    +AI      +     + +      Q +             LFMQED
Sbjct  50    VKKSEPSGCDGYQLSAIQSQTQHQHQHQHQHQQQQQQQQQQQQQEREQEQQQQHLFMQED  109

Query  645   EMASWLHYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg  824
             EMASWLHYPL D S               A         RAS         P P  P   
Sbjct  110   EMASWLHYPLNDASFVADFCSDLLYPPPCANVNVAATAARASPVVAELRQQPPPKPPTPM  169

Query  825   rTDVLRSQNF---ARLCRP------PAGPSRAA--STVVESNDTPIVPSEYRDS---HVA  962
                  R +NF   +RL RP      P+  SRA   STVV+S+ TP V    R S   H  
Sbjct  170   APP-RRFENFGHFSRLNRPRVDESGPSNSSRAGNESTVVDSSGTPAVGPRSRVSEALHCD  228

Query  963   DSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGAS---VSAEKSTAPAT  1133
              S   V GG       A S  +  G   G  E+TVTSSP   S  +      + S+ P  
Sbjct  229   VSRGTVDGGAAA---LATSSADGGGREMGTCELTVTSSPGASSACAEPLPPRKSSSTPPP  285

Query  1134  AMDDRKAKGSETDD-------EGHNADT-----DFGYNAKKQTSSKRSRAAEVHNLSER  1274
               +DRK KG E D        E H+ D      D    A+  TSSKRSRAAEVHNLSER
Sbjct  286   PAEDRKRKGIEIDPDADPDADECHSEDVELESADTKKPARGSTSSKRSRAAEVHNLSER  344


 Score = 82.8 bits (203),  Expect(3) = 8e-41, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  345   RRRDRINEKMKALQELIPHCNKSDKASMLDEAIEYLKSLQMQVQM  389


 Score = 40.8 bits (94),  Expect(3) = 8e-41, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+ QY+P
Sbjct  389   MMSMG--CGVVPMMFPGVHQYVP  409



>ref|XP_008235534.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Prunus mume]
Length=133

 Score =   157 bits (397),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP+ C VC EAQSKYKCPSC+ PYCS+ CFKKHKE PC  P  S E+     P   VD+
Sbjct  1     MGPRLCQVCNEAQSKYKCPSCLAPYCSVACFKKHKENPCALPVSSLEKPPTTGPESRVDR  60

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL V+EPS+VL + QLE+VASSSEIC AL+ E LQKLI NID S DAE +L+KAM  + F
Sbjct  61    PLTVEEPSEVLQRLQLEAVASSSEICSALKDENLQKLILNIDCSPDAEKELEKAMGVDVF  120

Query  2285  HILAQKILSTIS  2250
              I   KILST+ 
Sbjct  121   RIFTDKILSTLG  132



>ref|XP_002303090.1| PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 family protein [Populus 
trichocarpa]
 gb|EEE82363.1| PHYTOCHROME INTERACTING FACTOR 3-LIKE 5 family protein [Populus 
trichocarpa]
Length=615

 Score = 90.9 bits (224),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 172/388 (44%), Gaps = 95/388 (24%)
 Frame = +3

Query  351   VPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR--SV  524
             VP+FEMD+DYS  P       +  +   K +  E+EIMELLWQNGQVV+H+Q  Q+  S 
Sbjct  5     VPDFEMDDDYSLPP-----PPSTHTRPRKPAMQEEEIMELLWQNGQVVMHSQRSQKKSSP  59

Query  525   KRSHGGDAAIP---VPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYP--------  671
               S   DA +P   +P  +E+  S +++    HH   LFMQEDEMASWL++P        
Sbjct  60    PPSELDDAVLPADQLPGTKEIRSSHDQQQ--EHHH--LFMQEDEMASWLNHPLNDTNFDH  115

Query  672   ------LVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsgrTD  833
                   L   +   ++     + ++AAA+       R  A       AP PPIPP  R +
Sbjct  116   DFCADLLYPPTASTASITREAAVTNAAASTVRGATQRMEARSYPAVSAPRPPIPPVRRAE  175

Query  834   VLRSQNFARLCRPPAGPSRAA-----------STVVESNDTPIVP-SEYRDSHVADSTAQ  977
             V+  QNFA   R  AG    +           STVV+S +TP    SE   +  AD+T  
Sbjct  176   VV--QNFAYFSRHRAGGVSESGRSNSKSVVRESTVVDSCETPTARISETAFARSADNTCG  233

Query  978   VSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAK  1157
                G       + + +      T   EMT TSSP    G S ++ +  A  + ++DRK K
Sbjct  234   TINGAAVAGTVSSAPSSNRETMTNPCEMTSTSSP----GCSSASAELPALMSPVEDRKRK  289

Query  1158  GSETDDEGHN--------------------------------------------ADTDF-  1202
             G E + E H+                                             D +F 
Sbjct  290   GREEEAECHSEFIAISITMAHGNQPQSVAIRQKTQNSADSSKPLQGRRDAANPLKDAEFE  349

Query  1203  GYNAKKQT----SSKRSRAAEVHNLSER  1274
               +AKK+     SSKRSRAAEVHNLSER
Sbjct  350   SADAKKRIRGSMSSKRSRAAEVHNLSER  377


 Score = 87.0 bits (214),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  378   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  422


 Score = 39.7 bits (91),  Expect(3) = 1e-40, Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 64/162 (40%), Gaps = 47/162 (29%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY------MPAMGIGMGMNPPVAPYpmggpr----------  1673
             MMS+G  C M+PMMFPG QQY         MG+ MG++ P+ P+P               
Sbjct  422   MMSMG--CSMVPMMFPGFQQYMPPMGIGMGMGMEMGLSRPMMPFPNILAGAPSATPAAAA  479

Query  1674  ----fpmpafpmptpfSMADPSRIQALNHTDPMLnsphnsshppFPTQTQV---------  1814
                           P    DPSR+Q  N  DPML SP   +    P Q +V         
Sbjct  480   HLVPRFPVPPFHVPPIPAPDPSRVQPTNQVDPMLGSPGQQN----PNQPRVPNFVDPYQH  535

Query  1815  -----------TPSMNEMAEHSNKSKPCSSKDVENPTTLQCG  1907
                         P    MA+ S  SKP +S+  ENP   Q G
Sbjct  536   YLGLYQMHLPGVPRNQAMAQPST-SKPSTSRVAENPGNHQSG  576



>ref|XP_006588422.1| PREDICTED: uncharacterized protein LOC100527614 isoform X1 [Glycine 
max]
 gb|KHN05909.1| Zinc finger HIT domain-containing protein 3 [Glycine soja]
Length=144

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC EAQSKYKCPSC +PYCSL CFKKHKE+PC KPQPS  +  A + ++  +K
Sbjct  1     MGPRQCQVCNEAQSKYKCPSCYLPYCSLVCFKKHKELPCVKPQPSEAKTTAVSESI-AEK  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL VDE S+VL + QLE++ASSSEI +AL  + LQ+LIC ID S++AE++LDKAM +E F
Sbjct  60    PLVVDESSEVLEKFQLEAIASSSEIRDALNDKALQELICRIDCSSNAENELDKAMAEEAF  119

Query  2285  HILAQKILSTIS  2250
              +L  K++  I+
Sbjct  120   RLLTDKVMLYIA  131



>ref|XP_006480182.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Citrus 
sinensis]
Length=133

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -2

Query  2645  MGP--KKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHV  2472
             MGP  + C VC EAQSKYKCP+C  PYCSL CFK HKE PC KP+P+ E+ + P     V
Sbjct  1     MGPPARLCQVCNEAQSKYKCPNCFTPYCSLVCFKNHKETPCAKPEPTEEKPIFPESP--V  58

Query  2471  DKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKE  2292
             ++PL VDEPSQVL + QLES+ASSSEI +AL+ E LQKLI  IDSS++ E +LDKAM+ E
Sbjct  59    ERPLNVDEPSQVLQKEQLESIASSSEIRDALQDESLQKLILGIDSSSNPEIELDKAMEVE  118

Query  2291  EFHILAQKILSTISP  2247
              F     KIL++ISP
Sbjct  119   AFRTFTDKILASISP  133



>gb|KHG18014.1| Transcription factor PIF1 -like protein [Gossypium arboreum]
Length=552

 Score = 96.7 bits (239),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 128/380 (34%), Positives = 169/380 (44%), Gaps = 97/380 (26%)
 Frame = +3

Query  333   MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
             MNH   VP+FEM++DYS +P     S++ L+   K S  ED IMELLWQNGQVV+ +QN 
Sbjct  1     MNH--CVPDFEMEDDYS-IP-----SSSILNRAKKPSMPEDGIMELLWQNGQVVMQSQN-  51

Query  513   QRSVKRSH------GGDAAIPVPAAREV---------VGSAEEEMATSHHQPELFMQEDE  647
             QRS K+         G +A+     RE+             +++  T H    LFMQEDE
Sbjct  52    QRSFKKPSPFKYLDAGQSAL-----REIRSSSHHQQQQQQQQQQSVTDH----LFMQEDE  102

Query  648   MASWLHYPLVD---------------DspylsadllypssssaaaavappRDFRASApev  782
             MASWLH PL D                S  ++  +   +++SA       R  + SA  +
Sbjct  103   MASWLHNPLSDANFDHDFCADLLYPSSSTAVAPCVTSTATTSAPPPPPLGRVPQVSASAM  162

Query  783   rrppaplppippsgrTDVLRSQNFARLCRPPAGPSRAAS-----TVVESNDTPIVPSEYR  947
                  P  P       +  R QNF+ L +   GPS + S     TVV+S+DTP V  E  
Sbjct  163   VPASRPPIPPARRNELESTRIQNFSSLSKEQPGPSNSKSVAREVTVVDSSDTPAVAPESG  222

Query  948   DSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEK---S  1118
              S       + + G              A A+     +  T S    +G SV A K   +
Sbjct  223   ASQAMPCNTEAASG---------EDNNNACANMSFAAVAYTQS----AGVSVGASKDNIA  269

Query  1119  TAPATAM----------------------DDRKAKGSETDD-EGHNADTDF-GYNAKKQ-  1223
             T  AT                        +DRK KG E DD E H+ D +F     KKQ 
Sbjct  270   TCEATVTSSPGGSSASASAEPTAQKRGPAEDRKRKGREPDDAECHSEDAEFESPETKKQS  329

Query  1224  ---TSSKRSRAAEVHNLSER  1274
                +S+KRSRAAEVHNLSER
Sbjct  330   RGSSSTKRSRAAEVHNLSER  349


 Score = 86.7 bits (213),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  350   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  394


 Score = 30.8 bits (68),  Expect(3) = 2e-39, Method: Compositional matrix adjust.
 Identities = 12/16 (75%), Positives = 14/16 (88%), Gaps = 2/16 (13%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP  1589
             MMS+G  CGM+PMMFP
Sbjct  394   MMSMG--CGMLPMMFP  407



>ref|XP_007144440.1| hypothetical protein PHAVU_007G156300g [Phaseolus vulgaris]
 ref|XP_007144441.1| hypothetical protein PHAVU_007G156300g [Phaseolus vulgaris]
 gb|ESW16434.1| hypothetical protein PHAVU_007G156300g [Phaseolus vulgaris]
 gb|ESW16435.1| hypothetical protein PHAVU_007G156300g [Phaseolus vulgaris]
Length=129

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 4/133 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC EA SKYKCPSC IPYCSL CFKKHKE+PC KPQP  E         HV  
Sbjct  1     MGPRQCKVCNEAPSKYKCPSCYIPYCSLGCFKKHKELPCVKPQPLLETITTAVSESHV--  58

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
                V+E S+VL + QLE++ASSSEI ++L  + LQ+LIC IDSS++AE +LDKAM +E F
Sbjct  59    --VVEETSEVLQKFQLEAIASSSEIRDSLNDKALQELICRIDSSSNAEDELDKAMAEEAF  116

Query  2285  HILAQKILSTISP  2247
              +L +KILSTI+P
Sbjct  117   RLLTEKILSTINP  129



>ref|XP_010245666.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Nelumbo nucifera]
Length=156

 Score =   153 bits (386),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 99/147 (67%), Gaps = 14/147 (10%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC+EAQSKYKCPSC+ PYCSL CFKKHKEIPC K   S      P P L+  +
Sbjct  1     MGPRQCEVCKEAQSKYKCPSCLTPYCSLACFKKHKEIPCSKAVTSEASEAKPGPILYPKR  60

Query  2465  PLYVDEPSQVLTQSQLESV--------------ASSSEICEALRSEELQKLICNIDSSTD  2328
                VD+PSQVL + QLE++                S+EI +AL++EELQKLI  ID STD
Sbjct  61    SYQVDDPSQVLQKVQLEAIVLSFSDIHRWFKEKVDSTEIRDALKNEELQKLIYQIDCSTD  120

Query  2327  AESDLDKAMQKEEFHILAQKILSTISP  2247
             AE++LDKAM++E+F     KILS ISP
Sbjct  121   AENELDKAMEREDFRKFTDKILSIISP  147



>ref|XP_010264020.1| PREDICTED: transcription factor PIF1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264021.1| PREDICTED: transcription factor PIF1-like isoform X1 [Nelumbo 
nucifera]
Length=511

 Score = 87.4 bits (215),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 40/46 (87%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             Q+RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  319   QRRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  364


 Score = 76.6 bits (187),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 96/304 (32%), Positives = 140/304 (46%), Gaps = 46/304 (15%)
 Frame = +3

Query  450   EDEIMELLWQNGQVVVHTQNHQRSVKRSH-GGDAAIPVPAAREVVG-----------SAE  593
             EDE++ELLWQNGQ+V+ +Q   RS+++S    DA IP   +                S+E
Sbjct  31    EDEVVELLWQNGQIVMQSQ---RSLRKSLPKFDAVIPAEGSSAEETRTTTAATTATISSE  87

Query  594   EEMATSHHQPELFMQEDEMASWLHYPLVDDspylsadllypssssaaaavappRDFRASA  773
             +E   +     +FMQEDE ASWLHYPL D            + S          + R   
Sbjct  88    KEAVVN----PVFMQEDETASWLHYPLEDSFTTDIVYPTPSNGSQIP-------ERRPEN  136

Query  774   pevrrppaplppippsgrTDVLRSQNFARLCRPP----AGPSRA-----ASTVVESNDTP  926
                  P  P+PP   +      + Q F     P     A PS A      +TV++S+DTP
Sbjct  137   KHPAAPRPPIPPATRAELDSAAKFQRFMHFSLPKGKGEAKPSNANKAVRETTVIDSSDTP  196

Query  927   IVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTV-TSSPDDGSGASV  1103
             +       +  + +TA+ S GNL  R  +MSG  AA A    + ++   +       +  
Sbjct  197   MAAIRPAVAQASRTTAEFSSGNL--RSESMSGDGAAAADATRELLSCDRTMASSSGASGA  254

Query  1104  SAEKSTAPATAMDDRKAKG-SETDDEGHNADTDFGYNAKKQ-----TSSKRSRAAEVHNL  1265
             S E S  P T  DDRK K   + +++ H  D ++    KK+     T++++ RAAEVHNL
Sbjct  255   SVEPSMKPPT--DDRKRKSRRDYNNDRHGEDVEYEIMDKKKEIRGSTAARKGRAAEVHNL  312

Query  1266  SERV  1277
             SER 
Sbjct  313   SERF  316


 Score = 47.4 bits (111),  Expect(3) = 7e-39, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 2/25 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAM  1616
             MMS+G  CGM+PMMFPG+QQYMP +
Sbjct  364   MMSMG--CGMVPMMFPGVQQYMPTI  386



>gb|EYU46364.1| hypothetical protein MIMGU_mgv1a007040mg [Erythranthe guttata]
Length=422

 Score = 83.2 bits (204),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQ+Q+Q+
Sbjct  231   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYMKSLQMQLQM  275


 Score = 65.1 bits (157),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 2/38 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAPY  1655
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ PY
Sbjct  275   MMSMG--CGMVPMMYPGMQQYMPTMLMGMGMNRPMMPY  310


 Score = 62.4 bits (150),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 72/148 (49%), Gaps = 39/148 (26%)
 Frame = +3

Query  897   STVVESNDTP--IVPSEY------RDSHVADSTAQVSGGNLGPRggamsgteaagastga  1052
             STVVESN+TP  +   E+      R  +  +  A V GG                 +   
Sbjct  100   STVVESNETPKAVAAPEFGVSQSRRQVYARNGNAAVRGG----------------LARLP  143

Query  1053  KEMTVTSSPDDGSGASVSAEKSTAP-------ATAMDDRKAKGSETDDEGHNADTDFGYN  1211
              E+TVTSS D GS AS S+    +P       + A +DRK K  E DD+      DF Y 
Sbjct  144   CEVTVTSSVDGGSRASFSSSAEPSPPNEKAPQSEAAEDRKRKARE-DDDNECQSEDFEYE  202

Query  1212  A---KKQ----TSSKRSRAAEVHNLSER  1274
             A   KKQ    TS+KRSRAAEVHNLSER
Sbjct  203   ATEAKKQSRGATSTKRSRAAEVHNLSER  230



>ref|XP_006594071.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X2 [Glycine max]
 ref|XP_006594072.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X3 [Glycine max]
Length=144

 Score =   151 bits (381),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 1/132 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC + QSKYKCPSC +PYCSL CFKKHKE PC KPQPS  +  A + +  V+K
Sbjct  1     MGPRQCQVCNQTQSKYKCPSCYLPYCSLVCFKKHKESPCVKPQPSETKATAVSESF-VEK  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL  DE S+VL + QLE++ASSSEI +AL  E LQ+LIC ID S++AE++LDKAM +E F
Sbjct  60    PLVADESSEVLQKFQLEAIASSSEIRDALNDEALQELICRIDGSSNAENELDKAMAEEAF  119

Query  2285  HILAQKILSTIS  2250
              +   K++  ++
Sbjct  120   RLFTDKVMLYVA  131



>ref|XP_010264023.1| PREDICTED: transcription factor PIF1-like isoform X2 [Nelumbo 
nucifera]
Length=507

 Score = 85.5 bits (210),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  316   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  360


 Score = 77.0 bits (188),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/303 (32%), Positives = 140/303 (46%), Gaps = 46/303 (15%)
 Frame = +3

Query  450   EDEIMELLWQNGQVVVHTQNHQRSVKRSH-GGDAAIPVPAAREVVG-----------SAE  593
             EDE++ELLWQNGQ+V+ +Q   RS+++S    DA IP   +                S+E
Sbjct  31    EDEVVELLWQNGQIVMQSQ---RSLRKSLPKFDAVIPAEGSSAEETRTTTAATTATISSE  87

Query  594   EEMATSHHQPELFMQEDEMASWLHYPLVDDspylsadllypssssaaaavappRDFRASA  773
             +E   +     +FMQEDE ASWLHYPL D            + S          + R   
Sbjct  88    KEAVVN----PVFMQEDETASWLHYPLEDSFTTDIVYPTPSNGSQIP-------ERRPEN  136

Query  774   pevrrppaplppippsgrTDVLRSQNFARLCRPP----AGPSRA-----ASTVVESNDTP  926
                  P  P+PP   +      + Q F     P     A PS A      +TV++S+DTP
Sbjct  137   KHPAAPRPPIPPATRAELDSAAKFQRFMHFSLPKGKGEAKPSNANKAVRETTVIDSSDTP  196

Query  927   IVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTV-TSSPDDGSGASV  1103
             +       +  + +TA+ S GNL  R  +MSG  AA A    + ++   +       +  
Sbjct  197   MAAIRPAVAQASRTTAEFSSGNL--RSESMSGDGAAAADATRELLSCDRTMASSSGASGA  254

Query  1104  SAEKSTAPATAMDDRKAKG-SETDDEGHNADTDFGYNAKKQ-----TSSKRSRAAEVHNL  1265
             S E S  P T  DDRK K   + +++ H  D ++    KK+     T++++ RAAEVHNL
Sbjct  255   SVEPSMKPPT--DDRKRKSRRDYNNDRHGEDVEYEIMDKKKEIRGSTAARKGRAAEVHNL  312

Query  1266  SER  1274
             SER
Sbjct  313   SER  315


 Score = 47.8 bits (112),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 22/25 (88%), Gaps = 2/25 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAM  1616
             MMS+G  CGM+PMMFPG+QQYMP +
Sbjct  360   MMSMG--CGMVPMMFPGVQQYMPTI  382



>gb|KCW50158.1| hypothetical protein EUGRSUZ_K03592 [Eucalyptus grandis]
Length=533

 Score = 86.3 bits (212),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 138/322 (43%), Gaps = 55/322 (17%)
 Frame = +3

Query  453   DEIMELLWQNGQVVVHTQNHQRSVKRSH--GGD----AAIPVPAAREVVGSAEEEMATSH  614
             DEI ELLWQNG VV+ +Q   RSVK+S   G D    +AI      +     + +     
Sbjct  21    DEIAELLWQNGPVVMQSQ---RSVKKSEPSGCDGYQLSAIQSQTQHQHQHQHQHQQQQQQ  77

Query  615   HQPE-------------LFMQEDEMASWLHYPLVDDspylsadllypssssaaaavappR  755
              Q +             LFMQEDEMASWLHYPL D S               A       
Sbjct  78    QQQQQQQEREQEQQQQHLFMQEDEMASWLHYPLNDASFVADFCSDLLYPPPCANVNVAAT  137

Query  756   DFRASApevrrppaplppippsgrTDVLRSQNF---ARLCRP------PAGPSRAA--ST  902
               RAS         P P  P        R +NF   +RL RP      P+  SRA   ST
Sbjct  138   AARASPVVAELRQQPPPKPPTPMAPP-RRFENFGHFSRLNRPRVDESGPSNSSRAGNEST  196

Query  903   VVESNDTPIVPSEYRDS---HVADSTAQVSGGNLGPRggamsgteaagastgaKEMTVTS  1073
             VV+S+ TP V    R S   H   S   V GG       A S  +  G   G  E+TVTS
Sbjct  197   VVDSSGTPAVGPRSRVSEALHCDVSRGTVDGGAAA---LATSSADGGGREMGTCELTVTS  253

Query  1074  SPDDGSGASVSA---EKSTAPATAMDDRKAKGSETDD-------EGHNADT-----DFGY  1208
             SP   S  +      + S+ P    +DRK KG E D        E H+ D      D   
Sbjct  254   SPGASSACAEPLPPRKSSSTPPPPAEDRKRKGIEIDPDADPDADECHSEDVELESADTKK  313

Query  1209  NAKKQTSSKRSRAAEVHNLSER  1274
              A+  TSSKRSRAAEVHNLSER
Sbjct  314   PARGSTSSKRSRAAEVHNLSER  335


 Score = 82.8 bits (203),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  336   RRRDRINEKMKALQELIPHCNKSDKASMLDEAIEYLKSLQMQVQM  380


 Score = 41.2 bits (95),  Expect(3) = 2e-38, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+ QY+P
Sbjct  380   MMSMG--CGVVPMMFPGVHQYVP  400



>ref|XP_007200166.1| hypothetical protein PRUPE_ppa016705mg, partial [Prunus persica]
 gb|EMJ01365.1| hypothetical protein PRUPE_ppa016705mg, partial [Prunus persica]
Length=126

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP+ C VC EAQSKYKCPSC+ PYCS+ CFKKHKE PC  P  S E +    P   VD+
Sbjct  1     MGPRLCQVCNEAQSKYKCPSCLAPYCSVACFKKHKENPCALPVSSLENSPTTGPESRVDR  60

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             PL V+EPS+VL + QLE+VASSSEIC AL+ E LQKLI NID S DAE +L+KAM  + F
Sbjct  61    PLTVEEPSEVLQRLQLEAVASSSEICSALKDENLQKLILNIDCSPDAEKELEKAMGVDVF  120

Query  2285  HILAQK  2268
              I   K
Sbjct  121   RIFTDK  126



>ref|XP_010548716.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Tarenaya hassleriana]
Length=135

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = -2

Query  2642  GPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDKP  2463
               + C +CE+AQS+YKCPSC+ PYCSL+CFKKHKE PC KP  S+EE  AP   + V++P
Sbjct  5     AARTCEICEKAQSRYKCPSCLAPYCSLSCFKKHKETPCAKPS-SNEEKPAPLKEVPVERP  63

Query  2462  LYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFH  2283
             ++V+E SQV+ ++QLE++ASSSE+CEAL+ E LQKLI +IDSS+D   +LDKAM  E F 
Sbjct  64    VHVEEASQVVQKTQLEALASSSEVCEALKDESLQKLIRDIDSSSDPLLELDKAMGVEAFR  123

Query  2282  ILAQKILSTIS  2250
             +   K+LS IS
Sbjct  124   VFTDKVLSHIS  134



>gb|KHN48975.1| Zinc finger HIT domain-containing protein 3 [Glycine soja]
Length=144

 Score =   149 bits (377),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 1/132 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC +AQSKYKCPSC +PYCSL CFKKHKE PC KPQPS  +  A + +  V+K
Sbjct  1     MGPRQCQVCNQAQSKYKCPSCYLPYCSLVCFKKHKESPCVKPQPSETKATAVSESF-VEK  59

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             P   DE S+VL   QLE++ASSSEI +AL  E LQ+LIC ID S++AE++LDKAM +E F
Sbjct  60    PFVADESSEVLQNFQLEAIASSSEIRDALNDEALQELICRIDGSSNAENELDKAMAEEAF  119

Query  2285  HILAQKILSTIS  2250
              +   K++  ++
Sbjct  120   CLFTDKVMLYVA  131



>ref|XP_009597633.1| PREDICTED: transcription factor PIF1-like [Nicotiana tomentosiformis]
Length=508

 Score = 87.8 bits (216),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 116/346 (34%), Positives = 158/346 (46%), Gaps = 70/346 (20%)
 Frame = +3

Query  333   MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
             MNH  +VP FEMD+DYS +P     +    +   K + ++++IMEL+WQNGQV+  +QN 
Sbjct  1     MNH--SVPNFEMDDDYSNIP----TTFGITTPSKKSTVVDEDIMELIWQNGQVIAQSQN-  53

Query  513   QRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDDspy  692
             QRS                + V  SA          P LF+QEDEMA+WL YPL D S  
Sbjct  54    QRS----------------QTVAASA----------PPLFIQEDEMATWLQYPLDDSSFE  87

Query  693   lsadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVLRSQ---NFARL  863
                   +  ++ +++ V                    PP      T+   SQ   NF   
Sbjct  88    RDLYADFLYNTPSSSVVTAAVPPPGEIDTTTVEIRSNPPPSQLRCTEGEFSQRLQNFGHF  147

Query  864   CRPP----------AGPSRAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRgga  1013
              R P          +G +  AST+VESN+TPI       S V+D+ A VS GN G     
Sbjct  148   SRLPKAKSQNCKSSSGNTARASTIVESNETPIA----EVSRVSDNVAPVSAGNGG-GRTT  202

Query  1014  msgteaagastgaKEMTVT------SSPDDGSGASVSAEKSTAP--------ATAMDDRK  1151
                T AA  ++  +EM+        +S   G+  SVSA     P         T  +D+K
Sbjct  203   TDTTTAAAETSSGREMSTAACEFMGTSSASGARGSVSASAELQPLPPLQEAALTPAEDQK  262

Query  1152  AKGSETDDEGHNADTDF-----GYNAKKQTSSKRSRAAEVHNLSER  1274
              KG E+D+E  + D +F            TS+KRSRAAEVHNLSER
Sbjct  263   RKGRESDNEERSEDAEFESADAKKQTSSSTSTKRSRAAEVHNLSER  308


 Score = 85.1 bits (209),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  309   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQMQVQM  353


 Score = 35.0 bits (79),  Expect(3) = 1e-37, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (81%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  C M+PM++PG+ QY
Sbjct  353   MMSMG--CSMVPMIYPGVPQY  371



>ref|XP_008372430.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Malus 
domestica]
Length=143

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 94/132 (71%), Gaps = 1/132 (1%)
 Frame = -2

Query  2645  MGPKK-CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MGP+  C VC EAQSKYKCPSC  PYCS+ CFKKHKE PC  P  S E+     P L V+
Sbjct  1     MGPRVVCQVCNEAQSKYKCPSCRAPYCSVPCFKKHKENPCSLPVSSEEKPPTAGPELLVE  60

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +PL V+EPSQVL + QLE++ASS EIC AL+ E LQKLI +ID S DAE +L+KAM  + 
Sbjct  61    RPLLVEEPSQVLQRPQLEAIASSGEICSALKDENLQKLILSIDCSPDAEKELEKAMGVDV  120

Query  2288  FHILAQKILSTI  2253
             F +   KILSTI
Sbjct  121   FRVFTDKILSTI  132



>ref|XP_011024540.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF1 [Populus 
euphratica]
Length=624

 Score = 87.4 bits (215),  Expect(3) = 2e-37, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  386   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  430


 Score = 80.9 bits (198),  Expect(3) = 2e-37, Method: Compositional matrix adjust.
 Identities = 125/394 (32%), Positives = 167/394 (42%), Gaps = 99/394 (25%)
 Frame = +3

Query  351   VPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSVKR  530
             VP+FEMD+DYS  P       +  +   K +  E+EIMELLWQNGQVV+H+Q  Q+    
Sbjct  5     VPDFEMDDDYSLPP-----PPSTHTRPRKTAMQEEEIMELLWQNGQVVMHSQRSQKKSSS  59

Query  531   --SHGGDAAIP---VPAAREVVGSAEEEMATSHHQPELFMQEDEMASW------------  659
               S   DA +P   +P  +E+  S +++    HH   LFMQEDEMASW            
Sbjct  60    PLSKLDDAVLPADQLPGTKEIRSSHDQQQ--EHHH--LFMQEDEMASWLNHPLNDTNFDH  115

Query  660   -----LHYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg  824
                  L YP    +  ++ +     ++++    A  R    S P V    +   P  P G
Sbjct  116   DFCADLLYPPTASTVSITREAAVTKAAASPVRGATQRTEARSYPAVYATVSAPRPPIPPG  175

Query  825   rTDVLRSQNFARLCRPPAG------PSRAAS-----TVVESNDTPIVP-SEYRDSHVADS  968
             R     +QNFA   R  AG      PS + S     TVV+S +TP    SE   +  AD+
Sbjct  176   RRGEGVAQNFAYFSRHRAGGVSESGPSNSKSVVRESTVVDSCETPTARISETPFARSADN  235

Query  969   TAQVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDR  1148
             T             + + +      T   EMT TSSPD    +S SAE   A  + ++DR
Sbjct  236   TCGTMNCTAVAGTVSSAPSSNREMVTNPCEMTSTSSPD---CSSASAEP-PALMSPVEDR  291

Query  1149  KAKGSETDDEGHN-----------------------------------------------  1187
             K KG E + E H+                                               
Sbjct  292   KRKGREEEAECHSEVNDANAITIAMALGNQPRSVAIRQKTQNSADSSKPLQGXRDAANPL  351

Query  1188  ADTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
              D +F   +AKKQ     SSKRSRAAEVHNLSER
Sbjct  352   KDAEFESADAKKQIRGSMSSKRSRAAEVHNLSER  385


 Score = 38.9 bits (89),  Expect(3) = 2e-37, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  C M+PMMFPG QQY
Sbjct  430   MMSMG--CSMVPMMFPGFQQY  448



>ref|XP_009371129.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Pyrus x bretschneideri]
Length=141

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 97/132 (73%), Gaps = 3/132 (2%)
 Frame = -2

Query  2645  MGPKK-CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MGP+  C VC EAQSKYKCPSC  PYCS+ CFKKHKE PC  P  S E+   P+P L V+
Sbjct  1     MGPRVVCQVCNEAQSKYKCPSCRAPYCSVPCFKKHKENPCALPVSSEEK--PPSPELLVE  58

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +PL V+EPSQVL + QLE++ASSSE+  AL+ E L+KLI +IDSS DAE +L+KAM  + 
Sbjct  59    RPLLVEEPSQVLQRPQLEAIASSSELHSALKDENLRKLILSIDSSPDAEKELEKAMGVDV  118

Query  2288  FHILAQKILSTI  2253
             F +   KILSTI
Sbjct  119   FRVFTDKILSTI  130



>ref|XP_009371119.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Pyrus x bretschneideri]
Length=143

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 95/132 (72%), Gaps = 1/132 (1%)
 Frame = -2

Query  2645  MGPKK-CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MGP+  C VC EAQSKYKCPSC  PYCS+ CFKKHKE PC  P  S E+     P L V+
Sbjct  1     MGPRVVCQVCNEAQSKYKCPSCRAPYCSVPCFKKHKENPCALPVSSEEKPPTAGPELLVE  60

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +PL V+EPSQVL + QLE++ASSSE+  AL+ E L+KLI +IDSS DAE +L+KAM  + 
Sbjct  61    RPLLVEEPSQVLQRPQLEAIASSSELHSALKDENLRKLILSIDSSPDAEKELEKAMGVDV  120

Query  2288  FHILAQKILSTI  2253
             F +   KILSTI
Sbjct  121   FRVFTDKILSTI  132



>ref|XP_010548715.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Tarenaya hassleriana]
Length=137

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = -2

Query  2642  GPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEE-NLAPTPALHVDK  2466
               + C +CE+AQS+YKCPSC+ PYCSL+CFKKHKE PC KP  + E+   AP   + V++
Sbjct  5     AARTCEICEKAQSRYKCPSCLAPYCSLSCFKKHKETPCAKPSSNEEKPAAAPLKEVPVER  64

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
             P++V+E SQV+ ++QLE++ASSSE+CEAL+ E LQKLI +IDSS+D   +LDKAM  E F
Sbjct  65    PVHVEEASQVVQKTQLEALASSSEVCEALKDESLQKLIRDIDSSSDPLLELDKAMGVEAF  124

Query  2285  HILAQKILSTIS  2250
              +   K+LS IS
Sbjct  125   RVFTDKVLSHIS  136



>ref|XP_004495024.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Cicer 
arietinum]
Length=146

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 13/146 (9%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPS-----SEENLAPTPA  2481
             MGP++C +C EAQSKYKCP C + YCSL CFKKHKE+PC  P  S     + E+L   P+
Sbjct  1     MGPRQCQICHEAQSKYKCPKCYLLYCSLPCFKKHKELPCVNPTSSEGKTTAAESLVEKPS  60

Query  2480  L--------HVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDA  2325
                       V+KPL VD+ S+VL + QLE++ASSSEI +AL ++ LQ+LIC ID S +A
Sbjct  61    AVDNIVLEALVEKPLVVDKTSEVLQKFQLEAIASSSEIRDALNNKVLQELICRIDCSPNA  120

Query  2324  ESDLDKAMQKEEFHILAQKILSTISP  2247
             E++LDKAM +E F +  +KILSTI+P
Sbjct  121   ENELDKAMAEEAFRMFTEKILSTINP  146



>ref|XP_002263221.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Vitis 
vinifera]
 emb|CBI37251.3| unnamed protein product [Vitis vinifera]
Length=132

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 96/135 (71%), Gaps = 7/135 (5%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK---PQPSSEENLAPTPALH  2475
             M  ++C VC EA SKYKCPSC+IPYCSL CFKKHKEIPC K   P+  + E+      L 
Sbjct  1     MSRRECKVCNEAASKYKCPSCLIPYCSLVCFKKHKEIPCVKLVSPEVKTNED----SQLL  56

Query  2474  VDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQK  2295
             V++P  VDEP++VL   QLES+ASSSEI +AL+ ++LQ+LI  ID S DAE++L+KAM  
Sbjct  57    VERPYLVDEPNEVLQMLQLESIASSSEIRDALKDQDLQELINKIDQSPDAENELEKAMGI  116

Query  2294  EEFHILAQKILSTIS  2250
             E F I   KILS IS
Sbjct  117   EAFSIFTDKILSAIS  131



>gb|KEH42413.1| HIT zinc finger protein [Medicago truncatula]
Length=147

 Score =   141 bits (355),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 18/149 (12%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGPK+C +C +AQSKYKCP C + YCSL CFKKHKE+PC  P PS  E        HV+K
Sbjct  1     MGPKQCQICHKAQSKYKCPKCYLLYCSLACFKKHKELPCVNPTPS--ETKTADLESHVEK  58

Query  2465  P----------------LYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSS  2334
             P                + VD+  +VL Q QLE++ASSSEI +AL  + LQ+LIC ID S
Sbjct  59    PSVVDNAVVEAPVEKPLVVVDKTGEVLQQFQLEAIASSSEIRDALNDKALQELICQIDCS  118

Query  2333  TDAESDLDKAMQKEEFHILAQKILSTISP  2247
             ++AE++LDKAM  E F +   KILSTI+P
Sbjct  119   SNAENELDKAMADEAFRLFTNKILSTINP  147



>ref|XP_004290030.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Fragaria 
vesca subsp. vesca]
Length=146

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 98/146 (67%), Gaps = 13/146 (9%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPC-------GKPQPS------SE  2505
             MGP+ C VC EAQSKYKCPSC  PYCS+ CFKKHKE PC         P+ +      SE
Sbjct  1     MGPQVCQVCNEAQSKYKCPSCRAPYCSVPCFKKHKETPCVSLLHSEDNPKSTCVLPVQSE  60

Query  2504  ENLAPTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDA  2325
             E  +  P   V++P+ V EPS VL + QLE++ASSSE+ +AL+ E LQKLI +ID S DA
Sbjct  61    EKPSAAPESVVERPVTVTEPSAVLKREQLEAIASSSELRDALKDESLQKLIESIDCSPDA  120

Query  2324  ESDLDKAMQKEEFHILAQKILSTISP  2247
             E++LDKAM  E F +   KILSTI+P
Sbjct  121   ENELDKAMDVEVFRLFTDKILSTINP  146



>gb|AFK35496.1| unknown [Medicago truncatula]
Length=147

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 18/149 (12%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGPK+C +C +AQSKYKCP C + YCSL CFKKHKE+PC  P PS  E        HV+K
Sbjct  1     MGPKQCQICHKAQSKYKCPKCYLLYCSLACFKKHKELPCVDPTPS--ETKTADLESHVEK  58

Query  2465  P----------------LYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSS  2334
             P                + VD+  +VL Q QLE++ASSSEI +AL  + LQ+LIC ID S
Sbjct  59    PSVVDNAVVEAPVEKPLVVVDKTGEVLQQFQLEAIASSSEIRDALNDKALQELICQIDCS  118

Query  2333  TDAESDLDKAMQKEEFHILAQKILSTISP  2247
             ++AE++LDKAM  E F +   KILSTI+P
Sbjct  119   SNAENELDKAMADEAFRLFTNKILSTINP  147



>ref|XP_009400770.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Musa 
acuminata subsp. malaccensis]
Length=136

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 5/132 (4%)
 Frame = -2

Query  2639  PKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDKPL  2460
             P+KC VC EAQSKYKCP+C++PYCSL CFKKHKE PC KP PS EE    TP L + +  
Sbjct  7     PRKCEVCREAQSKYKCPNCLVPYCSLACFKKHKENPCKKPLPSVEE----TPNLMLPERS  62

Query  2459  Y-VDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFH  2283
             Y V++PS V+ + +L+ +A+SSEI EALR+ +L+++I  ID S D E  L  AM+++ FH
Sbjct  63    YEVNDPSWVVDKERLQLIANSSEIREALRNGDLRRIIQKIDGSDDPEDQLTNAMEEQIFH  122

Query  2282  ILAQKILSTISP  2247
                +KILS ISP
Sbjct  123   DFTEKILSIISP  134



>emb|CDY05725.1| BnaC07g00780D [Brassica napus]
Length=507

 Score = 80.1 bits (196),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIP CNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  319   KRRDRINERMKALQELIPCCNKSDKASMLDEAIEYMKSLQLQIQM  363


 Score = 77.4 bits (189),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 110/344 (32%), Positives = 149/344 (43%), Gaps = 56/344 (16%)
 Frame = +3

Query  333   MNHHC--AVPEFEMDEDYSPLPMIappsaaglsggakksaMED-EIMELLWQNGQVVVHT  503
             MNHH    VP+FE D+DY  +      S++ L         ED ++MELLW NGQVV+  
Sbjct  1     MNHHRHHFVPDFETDDDY--VNANTNSSSSNLPRKPIIGEEEDGDLMELLWHNGQVVLQN  58

Query  504   QNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQP----ELFMQEDEMASWLHYP  671
             Q                P    + +  SA  ++      P     LF+QEDEM+SWLHYP
Sbjct  59    QR---------------PNTKKQPLSSSAAVKLHNGAPPPPLDHNLFIQEDEMSSWLHYP  103

Query  672   LVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVLRSQN  851
             L DD             ++     +  R    S+     P    PP P S +  V    N
Sbjct  104   LRDD----DFCSDLFFPAAPPPVPSTVRPPEPSSMRPPAPSPVRPPAPSSVKPAVRNFMN  159

Query  852   FARL--------CRPPAGPSRAASTVVESNDTPIVPSEYRDSHVA---DSTAQVSG----  986
             F+RL         R  +GPS A STV ES    + PS    S  A   D T +  G    
Sbjct  160   FSRLRGDFTGGNGRGESGPSIAKSTVRES--AKVNPSATPASSAAREPDLTRRTDGADSR  217

Query  987   --GNLGPRggamsgteaagastgaKEMTVT---SSPDDGSGASVSAEKSTAPA-TAMDDR  1148
               G+LG +     G           +  VT   +S + G+ +SV+++    P  T +D+R
Sbjct  218   GAGDLGSKSAVDGGGAYTVGHNRKGKAVVTTERTSENLGASSSVASKSEIEPLETIVDER  277

Query  1149  KAKGSET--DDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             K K  E     E  N +   G   +  +S+KRSRAAEVHNLSER
Sbjct  278   KRKEREEVGSTECRNEEAKQG---RGSSSTKRSRAAEVHNLSER  318


 Score = 36.2 bits (82),  Expect(3) = 1e-33, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 18/21 (86%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  CGM+PMM+ G+QQY
Sbjct  363   MMSMG--CGMMPMMYTGMQQY  381



>ref|XP_007049885.1| Phytochrome interacting factor 3-like 5, putative isoform 3 [Theobroma 
cacao]
 gb|EOX94042.1| Phytochrome interacting factor 3-like 5, putative isoform 3 [Theobroma 
cacao]
Length=516

 Score = 87.0 bits (214),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  330   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  374


 Score = 57.8 bits (138),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 87/175 (50%), Gaps = 33/175 (19%)
 Frame = +3

Query  840   RSQNFARLCR------PPAGPSRAAS-----TVVESNDTPIVPSEYRDSH-VADSTAQVS  983
             R QNF    R        +GPS + S     TVV+S++TP +  + R S  V  +T   S
Sbjct  158   RIQNFVHFSRHKTARVEQSGPSNSKSVVRESTVVDSSETPAMAPDSRGSQAVPSNTEAAS  217

Query  984   GGN------------LGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAP  1127
             GGN            +     A     A   +    E+TVTSSP   S ++  A +  AP
Sbjct  218   GGNNNNASATVSAAAVASTQSAGVSVGATKDNLATCEVTVTSSPGGSSASAEPATQKAAP  277

Query  1128  ATAMDDRKAKGSETDD-EGHNADTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             A   +DRK KG E DD E H+ D +F   + KKQT    S+KRSRAAEVHNLSER
Sbjct  278   A---EDRKRKGREPDDAECHSEDAEFESADTKKQTRGSTSTKRSRAAEVHNLSER  329


 Score = 47.8 bits (112),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CGM+PMMFPG+QQYMP
Sbjct  374   MMSMG--CGMVPMMFPGVQQYMP  394


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 53/87 (61%), Gaps = 15/87 (17%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRS-----HGGDAAIP-----VPAAREVVGSAEEE  599
            EDEIMELLWQNGQVVV +QN QRS K+S     H    + P      P+  +     +++
Sbjct  9    EDEIMELLWQNGQVVVQSQN-QRSFKKSPPFKFHDAHQSAPKEIRSSPSHHQHHQQQQQQ  67

Query  600  MATSHHQPELFMQEDEMASWLHYPLVD  680
              T H    LFMQEDEMASWLHYPL D
Sbjct  68   SVTDH----LFMQEDEMASWLHYPLND  90



>ref|XP_007049883.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007049884.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94040.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94041.1| Phytochrome interacting factor 3-like 5, putative isoform 1 [Theobroma 
cacao]
Length=539

 Score = 87.0 bits (214),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  353   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  397


 Score = 58.2 bits (139),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 87/175 (50%), Gaps = 33/175 (19%)
 Frame = +3

Query  840   RSQNFARLCR------PPAGPSRAAS-----TVVESNDTPIVPSEYRDSH-VADSTAQVS  983
             R QNF    R        +GPS + S     TVV+S++TP +  + R S  V  +T   S
Sbjct  181   RIQNFVHFSRHKTARVEQSGPSNSKSVVRESTVVDSSETPAMAPDSRGSQAVPSNTEAAS  240

Query  984   GGN------------LGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAP  1127
             GGN            +     A     A   +    E+TVTSSP   S ++  A +  AP
Sbjct  241   GGNNNNASATVSAAAVASTQSAGVSVGATKDNLATCEVTVTSSPGGSSASAEPATQKAAP  300

Query  1128  ATAMDDRKAKGSETDD-EGHNADTDF-GYNAKKQT----SSKRSRAAEVHNLSER  1274
             A   +DRK KG E DD E H+ D +F   + KKQT    S+KRSRAAEVHNLSER
Sbjct  301   A---EDRKRKGREPDDAECHSEDAEFESADTKKQTRGSTSTKRSRAAEVHNLSER  352


 Score = 47.4 bits (111),  Expect(3) = 3e-33, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CGM+PMMFPG+QQYMP
Sbjct  397   MMSMG--CGMVPMMFPGVQQYMP  417


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 74/124 (60%), Gaps = 22/124 (18%)
 Frame = +3

Query  339  HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
            +HC VP+FEM +DYS +P     S++ L+   K    EDEIMELLWQNGQVVV +QN QR
Sbjct  2    NHC-VPDFEMGDDYS-IP-----SSSSLTRSKKPPMPEDEIMELLWQNGQVVVQSQN-QR  53

Query  519  SVKRS-----HGGDAAIP-----VPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHY  668
            S K+S     H    + P      P+  +     +++  T H    LFMQEDEMASWLHY
Sbjct  54   SFKKSPPFKFHDAHQSAPKEIRSSPSHHQHHQQQQQQSVTDH----LFMQEDEMASWLHY  109

Query  669  PLVD  680
            PL D
Sbjct  110  PLND  113



>ref|XP_011024542.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Populus 
euphratica]
Length=133

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = -2

Query  2645  MGPK-KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MG K KC VC EA+SKYKCPSC +PYCSL CF KHKE PC  P P  E+ +A    +   
Sbjct  1     MGTKHKCQVCHEAESKYKCPSCRVPYCSLVCFTKHKETPCAIPVPVEEKPVADVKVVE-K  59

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +P+ VDEP +VL + QLES+ASSSEI   L  E LQKLI  ID STD E++LD AM  + 
Sbjct  60    RPVKVDEPGEVLLKLQLESIASSSEIRNDLMDESLQKLIHKIDCSTDPETELDVAMGVDV  119

Query  2288  FHILAQKILSTIS  2250
             F I   KILS I 
Sbjct  120   FRIFTDKILSAIG  132



>emb|CDY31989.1| BnaA07g00060D [Brassica napus]
Length=476

 Score = 83.6 bits (205),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  292   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  336


 Score = 68.9 bits (167),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 142/326 (44%), Gaps = 52/326 (16%)
 Frame = +3

Query  339   HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMED-EIMELLWQNGQVVVHTQNHQ  515
             HH  VP+FE D+DY  +      S++ L         ED ++MELLW NGQVV+  QN +
Sbjct  4     HHHFVPDFETDDDY--VNANTNSSSSNLPRKPILGEEEDGDLMELLWHNGQVVL--QNQR  59

Query  516   RSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDDspyl  695
              + K+     ++           S+       H+   LF+QEDEM+SWLHYPL DD    
Sbjct  60    PNTKKQPPSSSS-----------SSAPPPPLDHN---LFIQEDEMSSWLHYPLRDD----  101

Query  696   sadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVLRSQNFARL----  863
                  + S     AA +  R         R P    PP P S +  V    NF+RL    
Sbjct  102   ----DFCSDLFFPAAPSSERHTSNQVTSTRPPVPSTPPAPSSVKPPVRNFMNFSRLRGDF  157

Query  864   -CRPPAGPSRAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaaga  1040
               R  +GP    STV ES    + PS    +  A S A+ S  +LG R     G      
Sbjct  158   TGRGESGP----STVRES--AKVNPS----ATPASSAARES--DLGSRSAVDGGGAYTVG  205

Query  1041  stgaKEMTVTSSP-DDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHN-------ADT  1196
                  +  VT+ P  +  G S S    +   T +D+RK K  E  DE          A  
Sbjct  206   DNRKGKAVVTTEPARENQGTSSSVASKSEIETIVDERKRKEREAIDETECRNEVSPLARL  265

Query  1197  DFGYNAKKQTSSKRSRAAEVHNLSER  1274
                   +  +S+KRSRAAEVHNLSER
Sbjct  266   VEAKQGRGSSSTKRSRAAEVHNLSER  291


 Score = 40.0 bits (92),  Expect(3) = 4e-33, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CGM+PM++ G+QQYMP
Sbjct  336   MMSMG--CGMMPMIYTGMQQYMP  356



>ref|XP_007049879.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007049880.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007049881.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94036.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94037.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX94038.1| HIT-type Zinc finger family protein, putative isoform 1 [Theobroma 
cacao]
Length=174

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 102/172 (59%), Gaps = 40/172 (23%)
 Frame = -2

Query  2642  GP-KKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAP--------  2490
             GP ++C VC +AQSKYKCPSC++PYCSL CFK+HKE PC KP+ + E++  P        
Sbjct  3     GPSRQCQVCNQAQSKYKCPSCLVPYCSLACFKRHKETPCTKPKSTEEKSGTPCVKSESAN  62

Query  2489  -------------------------------TPALHVDKPLYVDEPSQVLTQSQLESVAS  2403
                                            +P   V+K L VD+PS++L   QL+++AS
Sbjct  63    DAETTSVKLDSSNDAGTPSLKPESTKERSTASPRFQVEKKLEVDDPSEMLQILQLQAIAS  122

Query  2402  SSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTISP  2247
             SSE+ EAL+ E LQKLI +IDSS DA ++LDKAM  + F I + KILS I+P
Sbjct  123   SSEVREALKDEHLQKLISDIDSSPDAMNELDKAMGVDVFRIFSDKILSAINP  174



>ref|XP_003521328.1| PREDICTED: transcription factor PIF1-like isoform X1 [Glycine 
max]
 ref|XP_006576978.1| PREDICTED: transcription factor PIF1-like isoform X2 [Glycine 
max]
Length=517

 Score = 83.6 bits (205),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAI YLKSLQLQVQ+
Sbjct  319   RRRDRINEKMKALQELIPRCNKSDKASMLDEAISYLKSLQLQVQM  363


 Score = 60.5 bits (145),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +3

Query  1056  EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDFGYNAKKQ---  1223
             ++T+TSSP    G S S ++    A A +DRK KG E ++ E  + D DF   AKKQ   
Sbjct  245   DLTMTSSP----GGSSSCDEPVQVAAAEEDRKRKGREAEEWECQSEDVDFESEAKKQVCG  300

Query  1224  -TSSKRSRAAEVHNLSER  1274
              TS+KRSRAAEVHNLSER
Sbjct  301   STSTKRSRAAEVHNLSER  318


 Score = 47.4 bits (111),  Expect(3) = 8e-33, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 2/24 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA  1613
             MMS+G  CGM+P+MFPGIQQYMPA
Sbjct  363   MMSMG--CGMVPVMFPGIQQYMPA  384


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 20/127 (16%)
 Frame = +3

Query  327  VTMNHHCAVPEF--EMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVH  500
            +T NH+  VP+F  +MD D+   P++ P +       +     +D+IMELLW NGQVVV 
Sbjct  1    MTNNHNHCVPDFDIQMDHDHE-YPILTPSALPRQKKPSIA---DDDIMELLWHNGQVVVQ  56

Query  501  TQNHQRSVKR------SHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
            +QN QRS+++      SH    A P    RE+    E      +    LFM E EMASWL
Sbjct  57   SQN-QRSLRKLPPVTNSHDASPAGPS-MTREIRPLVE------NFNQHLFMHEGEMASWL  108

Query  663  HYPLVDD  683
            HYP+ DD
Sbjct  109  HYPIDDD  115



>ref|XP_006576979.1| PREDICTED: transcription factor PIF1-like isoform X3 [Glycine 
max]
 ref|XP_006576980.1| PREDICTED: transcription factor PIF1-like isoform X4 [Glycine 
max]
Length=496

 Score = 83.2 bits (204),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAI YLKSLQLQVQ+
Sbjct  319   RRRDRINEKMKALQELIPRCNKSDKASMLDEAISYLKSLQLQVQM  363


 Score = 60.5 bits (145),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 50/78 (64%), Gaps = 9/78 (12%)
 Frame = +3

Query  1056  EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDFGYNAKKQ---  1223
             ++T+TSSP    G S S ++    A A +DRK KG E ++ E  + D DF   AKKQ   
Sbjct  245   DLTMTSSP----GGSSSCDEPVQVAAAEEDRKRKGREAEEWECQSEDVDFESEAKKQVCG  300

Query  1224  -TSSKRSRAAEVHNLSER  1274
              TS+KRSRAAEVHNLSER
Sbjct  301   STSTKRSRAAEVHNLSER  318


 Score = 47.4 bits (111),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 2/24 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA  1613
             MMS+G  CGM+P+MFPGIQQYMPA
Sbjct  363   MMSMG--CGMVPVMFPGIQQYMPA  384


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 20/127 (16%)
 Frame = +3

Query  327  VTMNHHCAVPEF--EMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVH  500
            +T NH+  VP+F  +MD D+   P++ P +       +     +D+IMELLW NGQVVV 
Sbjct  1    MTNNHNHCVPDFDIQMDHDHE-YPILTPSALPRQKKPSIA---DDDIMELLWHNGQVVVQ  56

Query  501  TQNHQRSVKR------SHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
            +QN QRS+++      SH    A P    RE+    E      +    LFM E EMASWL
Sbjct  57   SQN-QRSLRKLPPVTNSHDASPAGPS-MTREIRPLVE------NFNQHLFMHEGEMASWL  108

Query  663  HYPLVDD  683
            HYP+ DD
Sbjct  109  HYPIDDD  115



>gb|KDP26428.1| hypothetical protein JCGZ_17586 [Jatropha curcas]
Length=537

 Score = 87.0 bits (214),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  335   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  379


 Score = 66.6 bits (161),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 80/139 (58%), Gaps = 15/139 (11%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYR--DSHVADSTAQVSGGNLGPRggamsgteaagast---gaKEM  1061
             STVV+S+DTP +PSE R  ++ VA +TA VS G+ G    + +      +       +EM
Sbjct  198   STVVDSSDTPAMPSESRVSEAAVARNTAGVSSGDNGCGTMSGAAAAGTSSRAGGGNNREM  257

Query  1062  T---VTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF-GYNAKKQ--  1223
                 +T +   G  ++ +   S  PAT  +DRK KG E + E H+ D +F   +AKKQ  
Sbjct  258   MTCEITVTSSPGGSSASAEPPSQKPAT--EDRKRKGREEETEYHSEDVEFESADAKKQVR  315

Query  1224  --TSSKRSRAAEVHNLSER  1274
               TS+KRSRAAEVHNLSER
Sbjct  316   GSTSTKRSRAAEVHNLSER  334


 Score = 37.4 bits (85),  Expect(3) = 9e-33, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (81%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  C M+PMMF GIQQY
Sbjct  379   MMSMG--CSMVPMMFSGIQQY  397


 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 53/82 (65%), Gaps = 10/82 (12%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKR---SHGGDAAIPVPAA--REVVGSAEEEMATSH  614
            EDEIMELLWQNGQVVV +Q  Q S+K+   S   DA +PV A+  RE+  + E       
Sbjct  23   EDEIMELLWQNGQVVVQSQT-QMSLKKLPHSKYDDAVLPVEASNTREIRSTQEHHQQQQ-  80

Query  615  HQPELFMQEDEMASWLHYPLVD  680
                LFMQEDEMASWLHYPL D
Sbjct  81   ---HLFMQEDEMASWLHYPLND  99



>gb|KEH42414.1| transcription factor [Medicago truncatula]
Length=534

 Score = 87.4 bits (215),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  334   KRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  378


 Score = 54.3 bits (129),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 70/132 (53%), Gaps = 15/132 (11%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSS  1076
             STVV+S DTPI+ ++   +     T + +    G     +S +    A+T   +MTVTSS
Sbjct  211   STVVDSCDTPIMTAKTYAASRLSETVRSATAETG----CVSVSTTGKAATTTLDMTVTSS  266

Query  1077  PDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDFGYNAKKQ-----TSSKR  1238
             P   SG++    +         DRK KG E ++ E  + D DF    +K+     TS+KR
Sbjct  267   PGCSSGSAEPVHREPE-----LDRKRKGREPEESEFQSEDVDFECREEKKQHRGSTSAKR  321

Query  1239  SRAAEVHNLSER  1274
             SRAAEVHNLSER
Sbjct  322   SRAAEVHNLSER  333


 Score = 48.1 bits (113),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 2/24 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA  1613
             MMS+G  CGM+PMMFPGIQQ+MPA
Sbjct  378   MMSMG--CGMVPMMFPGIQQFMPA  399


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 22/116 (19%)
 Frame = +3

Query  333  MNHHCAVPEFEM---DEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHT  503
            MN+H  VP+F++   DED  P+                 +  +DEIMELLWQNGQVV+ +
Sbjct  1    MNYH--VPDFDIQMDDEDEYPI----------HHSKKPFTQQDDEIMELLWQNGQVVMQS  48

Query  504  QNHQRSVK---RSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
            QNH++  K    +    A+  +P  RE+  +  +     H    LFMQEDEMASWL
Sbjct  49   QNHRQFRKPLAPATTTTASRVIPEHREIRSTDADNYMNQH----LFMQEDEMASWL  100



>ref|XP_006386897.1| hypothetical protein POPTR_0002s25400g [Populus trichocarpa]
 gb|ERP64694.1| hypothetical protein POPTR_0002s25400g [Populus trichocarpa]
Length=133

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = -2

Query  2645  MGPK-KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MG K KC VC EA+SKYKCPSC +PYCSL CF KHKE PC  P    E+ +A    +   
Sbjct  1     MGTKHKCQVCHEAESKYKCPSCRVPYCSLVCFTKHKETPCAIPVSVEEKPVADVKVVE-K  59

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +P+ VDEP +VL + QLES+ASSSEI   L  E LQKLI  ID STD ES+LD AM  + 
Sbjct  60    RPVKVDEPGEVLLKLQLESIASSSEIRNDLMDESLQKLIHKIDCSTDPESELDVAMGVDV  119

Query  2288  FHILAQKILSTIS  2250
             F I   KILS I 
Sbjct  120   FRIFTDKILSAIG  132



>gb|KDO65837.1| hypothetical protein CISIN_1g014090mg [Citrus sinensis]
 gb|KDO65838.1| hypothetical protein CISIN_1g014090mg [Citrus sinensis]
Length=423

 Score = 85.9 bits (211),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  340   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  384


 Score = 58.2 bits (139),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 76/143 (53%), Gaps = 21/143 (15%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaK-------  1055
             STVV+S+DTP    + R S    S    SG N   R    SG  AA  S+G         
Sbjct  201   STVVDSSDTPAPGPDSRASEAMRSMEGASGVNNNNRCRNTSGAGAAATSSGGGGGSSGAR  260

Query  1056  -----EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF-GYNAK  1217
                  EMTVTSS     G S ++ +  A   A +DRK KG ETDDE H+ D +    +AK
Sbjct  261   DLTMCEMTVTSS----PGGSSASAEPPAQKPAAEDRKRKGRETDDEYHSEDVELESADAK  316

Query  1218  KQ----TSSKRSRAAEVHNLSER  1274
             KQ    TS+KRSRAAEVHNLSER
Sbjct  317   KQSRGSTSAKRSRAAEVHNLSER  339


 Score = 45.8 bits (107),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+QQYMP
Sbjct  384   MMSMG--CGVVPMMFPGVQQYMP  404


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 12/114 (11%)
 Frame = +3

Query  339  HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
            +HC VP+FE D+D+S +P     +++ L+   K +  E+++MELLWQNG VV+H QN QR
Sbjct  2    NHC-VPDFEFDDDHS-IP-----TSSVLNRPRKSAMAEEDVMELLWQNGPVVLHNQN-QR  53

Query  519  SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
            S+K+S     A    A RE+  S   +     H   LFMQEDEMASWLHYPL D
Sbjct  54   SLKKSQPSFPA-DQSAPREIPSSHHHQQEQQDH---LFMQEDEMASWLHYPLND  103



>gb|KDO65840.1| hypothetical protein CISIN_1g014090mg [Citrus sinensis]
Length=403

 Score = 85.5 bits (210),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  320   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  364


 Score = 58.5 bits (140),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 76/143 (53%), Gaps = 21/143 (15%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaK-------  1055
             STVV+S+DTP    + R S    S    SG N   R    SG  AA  S+G         
Sbjct  181   STVVDSSDTPAPGPDSRASEAMRSMEGASGVNNNNRCRNTSGAGAAATSSGGGGGSSGAR  240

Query  1056  -----EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF-GYNAK  1217
                  EMTVTSS     G S ++ +  A   A +DRK KG ETDDE H+ D +    +AK
Sbjct  241   DLTMCEMTVTSS----PGGSSASAEPPAQKPAAEDRKRKGRETDDEYHSEDVELESADAK  296

Query  1218  KQ----TSSKRSRAAEVHNLSER  1274
             KQ    TS+KRSRAAEVHNLSER
Sbjct  297   KQSRGSTSAKRSRAAEVHNLSER  319


 Score = 45.8 bits (107),  Expect(3) = 2e-32, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+QQYMP
Sbjct  364   MMSMG--CGVVPMMFPGVQQYMP  384


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPEL  629
            E+++MELLWQNG VV+H QN QRS+K+S     A    A RE+  S   +     H   L
Sbjct  12   EEDVMELLWQNGPVVLHNQN-QRSLKKSQPSFPA-DQSAPREIPSSHHHQQEQQDH---L  66

Query  630  FMQEDEMASWLHYPLVD  680
            FMQEDEMASWLHYPL D
Sbjct  67   FMQEDEMASWLHYPLND  83



>emb|CBI37249.3| unnamed protein product [Vitis vinifera]
Length=479

 Score = 85.9 bits (211),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  281   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  325


 Score = 52.8 bits (125),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = +3

Query  1056  EMTVTSSPDDGSGASVSAEKS-TAPATAMDDRKAKGSETDD--EGHNADTDF-GYNAKKQ  1223
             E+T+TSSP+       ++  +   P    DDRK KG E DD  E  + D +F   +AKKQ
Sbjct  200   ELTMTSSPEGSGSGGSASAGAEPTPKAPADDRKRKGREGDDTAEYQSEDVEFESADAKKQ  259

Query  1224  T----SSKRSRAAEVHNLSER  1274
                  ++KRSRAAEVHNLSER
Sbjct  260   VRGSATAKRSRAAEVHNLSER  280


 Score = 50.8 bits (120),  Expect(3) = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 68/149 (46%), Gaps = 36/149 (24%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP--------AMGIGMGMNPPVAPYpmggprfpmpafpm  1697
             MMS+G  C M+PMM+PG+QQYMP         MG+ MGMN P+ P+P       +P    
Sbjct  325   MMSMG--CSMVPMMYPGVQQYMPQMGMGMGMGMGMEMGMNRPMMPFPSVLGGSTLPTTAA  382

Query  1698  ptpfS------------MADP--SRIQALNHTDPMLnsphnsshp------------pFP  1799
                              MA P  SRIQA N +DP+LNS    S               + 
Sbjct  383   AAHLGQRYPMPAFHMPHMAAPDSSRIQANNQSDPVLNSLGTQSSNQPRVPNFADPYLQYL  442

Query  1800  TQTQVTPSMNEMAEHSNKSKPCSSKDVEN  1886
              Q Q+ P+ N+     N SKP +SK  EN
Sbjct  443   QQMQMPPAQNQAMGQQNTSKPSTSKGTEN  471


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 70/120 (58%), Gaps = 22/120 (18%)
 Frame = +3

Query  339  HHCAVPEFEMD-EDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQ  515
            +HC VP+FE+D ED  PL              +     +DEIMELLWQNGQVV+  QN Q
Sbjct  2    NHC-VPDFEVDDEDAIPL---------TRPKKSAAMVEDDEIMELLWQNGQVVMQIQN-Q  50

Query  516  RSVKRSHGG-----DAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
            RS K+S        DA +P P   ++  SA  + +++    +LFMQEDEMASWLHYPL D
Sbjct  51   RSFKKSQPSKFPIQDAVLP-PEQSKIRSSAPVDESSA----QLFMQEDEMASWLHYPLDD  105



>ref|XP_006443673.1| hypothetical protein CICLE_v10019585mg [Citrus clementina]
 ref|XP_006443674.1| hypothetical protein CICLE_v10019585mg [Citrus clementina]
 ref|XP_006480181.1| PREDICTED: transcription factor PIF1-like isoform X3 [Citrus 
sinensis]
 gb|ESR56913.1| hypothetical protein CICLE_v10019585mg [Citrus clementina]
 gb|ESR56914.1| hypothetical protein CICLE_v10019585mg [Citrus clementina]
Length=546

 Score = 85.5 bits (210),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  340   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKALQLQVQM  384


 Score = 58.5 bits (140),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 76/143 (53%), Gaps = 21/143 (15%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaK-------  1055
             STVV+S+DTP    + R S    S    SG N   R    SG  AA  S+G         
Sbjct  201   STVVDSSDTPAPGPDSRASEAMRSMEGASGVNNNNRCRNTSGAGAAATSSGGGGGSSGAR  260

Query  1056  -----EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF-GYNAK  1217
                  EMTVTSS     G S ++ +  A   A +DRK KG ETDDE H+ D +    +AK
Sbjct  261   DLTMCEMTVTSS----PGGSSASAEPPAQKPAAEDRKRKGRETDDEYHSEDVELESADAK  316

Query  1218  KQ----TSSKRSRAAEVHNLSER  1274
             KQ    TS+KRSRAAEVHNLSER
Sbjct  317   KQSRGSTSAKRSRAAEVHNLSER  339


 Score = 45.1 bits (105),  Expect(3) = 4e-32, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG++PMMFPG+QQYMP
Sbjct  384   MMSVG--CGVVPMMFPGVQQYMP  404


 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +3

Query  339  HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
            +HC VP+FE D+D+S +P     +++ L+   K +  E+++MELLWQNG VV+H QN QR
Sbjct  2    NHC-VPDFEFDDDHS-IP-----TSSVLNRPRKSAMAEEDVMELLWQNGPVVLHNQN-QR  53

Query  519  SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
            S+K+S     A    A RE+  S   +         LFMQEDEMASWLHYPL D
Sbjct  54   SLKKSQPSFPADQS-APREIPSSHHHQQEQQD---HLFMQEDEMASWLHYPLND  103



>ref|XP_010922567.1| PREDICTED: zinc finger HIT domain-containing protein 3 [Elaeis 
guineensis]
Length=135

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 4/133 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP+ C VC+EAQSKYKCP+C+ PYCSL CFKKHKE PC K  P  E  +   P    ++
Sbjct  1     MGPRTCEVCKEAQSKYKCPTCLAPYCSLGCFKKHKENPCKKSLPEQELTIQKLP----ER  56

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
                VDEPS V+ + Q +S+  SSEI +AL+  EL+KLI  IDSS + E+DL KAM+ + F
Sbjct  57    LYQVDEPSWVVDKEQFQSIVESSEILDALKDGELRKLIQKIDSSEEPENDLTKAMEGQTF  116

Query  2285  HILAQKILSTISP  2247
                  KIL+ ++P
Sbjct  117   REFTDKILAVLNP  129



>ref|XP_008461998.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
 ref|XP_008461999.1| PREDICTED: transcription factor PIF1 [Cucumis melo]
Length=532

 Score =   141 bits (356),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 161/458 (35%), Positives = 220/458 (48%), Gaps = 93/458 (20%)
 Frame = +3

Query  315   VIAKVTMNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVV  494
             +  ++ MNH   VP+FEM +D+S LP  +  +    S        +D+++ELLWQNGQVV
Sbjct  1     MTGRLRMNH--CVPDFEMADDFS-LPTFSSLTRPRKSSLP-----DDDVVELLWQNGQVV  52

Query  495   VHTQNHQRSVKRSHGGDAAIPVP----AAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
              H+QN QRS+++S      + +P    A RE+  S++ E    HH  ELFMQEDEMASWL
Sbjct  53    THSQN-QRSLRKSPPSKFDVSIPQEQAATREIRPSSQLE---EHH--ELFMQEDEMASWL  106

Query  663   HYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg---rTD  833
             +YPLV+D  + S  L    ++   A   P  D R SA          P  P      +T 
Sbjct  107   NYPLVEDHNFCSDLLFPAITAPLCANPQP--DLRPSATATLTLTPRPPIPPCRRPEVQTS  164

Query  834   VLRSQNFARLCRPPAGPSRAA--STVVESNDTPIVPSEYRDSHVADS--TAQVSGGNL--  995
             V  S+N A +   P+        STVV+S DTP V  E R S +A       V+GG +  
Sbjct  165   VQFSRNKATVESEPSNSKVMVRESTVVDSCDTPSVGPESRASQMARRKLVEVVNGGGVRY  224

Query  996   -------GPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKA  1154
                    G RG ++ G           EM+VTSS     G S ++ +   P  A+DDRK 
Sbjct  225   EIARGGDGVRGPSVGGDGTGEKEMMTCEMSVTSS----PGGSSASAEPACPKLAVDDRKR  280

Query  1155  KGSETDD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSERV*MQFC*Plhril*  1316
             KG   DD E H+ D ++   + KKQ    TS+KRSRAAEVHNLSER              
Sbjct  281   KGRALDDTECHSEDIEYESADPKKQLRGSTSTKRSRAAEVHNLSER--------------  326

Query  1317  fflhlllCYNQSNAETSRQDQ*EDESSAATYTAMQQVGQGFDFRRSN*VSKIAPVASAGI  1496
                              R+D+  ++       A+Q++       R N   K + +  A  
Sbjct  327   ----------------RRRDRINEK-----MKALQEL-----IPRCNKTDKASMLDEAIE  360

Query  1497  CLF*VMRKTRS*YQMMMSLGHGCGMIPMMFPGIQQYMP  1610
              L     KT      MMS+  GCGM+PMMFPG+QQY+P
Sbjct  361   YL-----KTLQLQVQMMSM--GCGMMPMMFPGVQQYLP  391


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  327   RRRDRINEKMKALQELIPRCNKTDKASMLDEAIEYLKTLQLQVQM  371



>ref|XP_010109673.1| hypothetical protein L484_015158 [Morus notabilis]
 gb|EXC24143.1| hypothetical protein L484_015158 [Morus notabilis]
Length=559

 Score = 85.5 bits (210),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  337   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  381


 Score = 58.9 bits (141),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 72/142 (51%), Gaps = 17/142 (12%)
 Frame = +3

Query  876   AGPS---RAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagast  1046
             AGPS    AA TVV+S +TP V    R   +  S  + S  NL       SG   +G   
Sbjct  203   AGPSCSKSAAVTVVDSCETPAVGPSSRVCEIGRSPGETSYANLA------SGGGFSGKEA  256

Query  1047  gaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDF-GYNAKK  1220
                E T+TSSP D S ++             +DRK KG E DD E  + D +F   + KK
Sbjct  257   MRCEGTMTSSPGDSSASAEPPPPPAK--LPAEDRKRKGIEADDAECQSEDVEFESGDTKK  314

Query  1221  Q----TSSKRSRAAEVHNLSER  1274
             Q    TS+KRSRAAEVHNLSER
Sbjct  315   QVRGTTSTKRSRAAEVHNLSER  336


 Score = 42.7 bits (99),  Expect(3) = 1e-31, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 19/21 (90%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  CGM+PMMFPGIQQY
Sbjct  381   MMSMG--CGMVPMMFPGIQQY  399


 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 70/122 (57%), Gaps = 13/122 (11%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            MNH   VP+FEM++DYS        +++G+    K    ED+IMELLWQNGQV+V +QN 
Sbjct  1    MNH--CVPDFEMEDDYS------ISTSSGVGRPKKSFMPEDDIMELLWQNGQVIVQSQNQ  52

Query  513  QRSVKRSHGGDAAIPVPAAREVVGS-----AEEEMATSHHQPELFMQEDEMASWLHYPLV  677
            +  +K S        +PA  E+  S      E        Q  LFMQEDEMASWLHYPLV
Sbjct  53   RSVMKSSPPSKYDAVIPADMEIRPSQAQQVHEHHHHHQQQQQHLFMQEDEMASWLHYPLV  112

Query  678  DD  683
            DD
Sbjct  113  DD  114



>ref|XP_004139727.1| PREDICTED: transcription factor PIF1-like [Cucumis sativus]
Length=529

 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 160/458 (35%), Positives = 217/458 (47%), Gaps = 93/458 (20%)
 Frame = +3

Query  315   VIAKVTMNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVV  494
             +I ++ MNH   VP+FEM +D+S LP  +  +    S        +D++MELLWQNGQVV
Sbjct  1     MIGRLRMNH--CVPDFEMADDFS-LPTFSSLTRPRKSSLP-----DDDVMELLWQNGQVV  52

Query  495   VHTQNHQRSVKRSHGGDAAIPVP----AAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
              H+QN QRS ++S      + +P    A RE+  S + E    HH  ELFMQEDEMASWL
Sbjct  53    THSQN-QRSFRKSPPSKFDVSIPQEQAATREIRPSTQLE---EHH--ELFMQEDEMASWL  106

Query  663   HYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg---rTD  833
             +YPLV+D  + S  L    ++   A   P  D R SA          P  P      +T 
Sbjct  107   NYPLVEDHNFCSDLLFPAITAPLCANPQP--DIRPSATATLTLTPRPPIPPCRRPEVQTS  164

Query  834   VLRSQNFARLCRPPAGPSRAA--STVVESNDTPIVPSEYRDSHVADSTA-----------  974
             V  S+N A +   P+        STVV+S DTP V  E R S +A               
Sbjct  165   VQFSRNKATVESEPSNSKVMVRESTVVDSCDTPSVGPESRASEMARRKLVEVVNGGGVRY  224

Query  975   QVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKA  1154
             +++ G+ G RG ++ G           EMTVTSS     G S ++ +   P  A+DDRK 
Sbjct  225   EIARGSDGVRGASVGGDGIGEKEMMTCEMTVTSS----PGGSSASAEPACPKLAVDDRKR  280

Query  1155  KGSETDD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSERV*MQFC*Plhril*  1316
             KG   DD E  + D ++   + KKQ    TS+KRSRAAEVHNLS                
Sbjct  281   KGRALDDTECQSEDVEYESADPKKQLRGSTSTKRSRAAEVHNLS----------------  324

Query  1317  fflhlllCYNQSNAETSRQDQ*EDESSAATYTAMQQVGQGFDFRRSN*VSKIAPVASAGI  1496
                           E  R+D+  ++       A+Q++       R N   K + +  A  
Sbjct  325   --------------ERRRRDRINEK-----MKALQEL-----IPRCNKTDKASMLDEAIE  360

Query  1497  CLF*VMRKTRS*YQMMMSLGHGCGMIPMMFPGIQQYMP  1610
              L     KT      MMS+G  CGM+PMMFPG+QQY+P
Sbjct  361   YL-----KTLQLQVQMMSMG--CGMMPMMFPGVQQYLP  391


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  327   RRRDRINEKMKALQELIPRCNKTDKASMLDEAIEYLKTLQLQVQM  371



>gb|KGN44558.1| hypothetical protein Csa_7G333400 [Cucumis sativus]
Length=532

 Score =   140 bits (352),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 160/458 (35%), Positives = 217/458 (47%), Gaps = 93/458 (20%)
 Frame = +3

Query  315   VIAKVTMNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVV  494
             +I ++ MNH   VP+FEM +D+S LP  +  +    S        +D++MELLWQNGQVV
Sbjct  1     MIGRLRMNH--CVPDFEMADDFS-LPTFSSLTRPRKSSLP-----DDDVMELLWQNGQVV  52

Query  495   VHTQNHQRSVKRSHGGDAAIPVP----AAREVVGSAEEEMATSHHQPELFMQEDEMASWL  662
              H+QN QRS ++S      + +P    A RE+  S + E    HH  ELFMQEDEMASWL
Sbjct  53    THSQN-QRSFRKSPPSKFDVSIPQEQAATREIRPSTQLE---EHH--ELFMQEDEMASWL  106

Query  663   HYPLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsg---rTD  833
             +YPLV+D  + S  L    ++   A   P  D R SA          P  P      +T 
Sbjct  107   NYPLVEDHNFCSDLLFPAITAPLCANPQP--DIRPSATATLTLTPRPPIPPCRRPEVQTS  164

Query  834   VLRSQNFARLCRPPAGPSRAA--STVVESNDTPIVPSEYRDSHVADSTA-----------  974
             V  S+N A +   P+        STVV+S DTP V  E R S +A               
Sbjct  165   VQFSRNKATVESEPSNSKVMVRESTVVDSCDTPSVGPESRASEMARRKLVEVVNGGGVRY  224

Query  975   QVSGGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKA  1154
             +++ G+ G RG ++ G           EMTVTSS     G S ++ +   P  A+DDRK 
Sbjct  225   EIARGSDGVRGASVGGDGIGEKEMMTCEMTVTSS----PGGSSASAEPACPKLAVDDRKR  280

Query  1155  KGSETDD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSERV*MQFC*Plhril*  1316
             KG   DD E  + D ++   + KKQ    TS+KRSRAAEVHNLS                
Sbjct  281   KGRALDDTECQSEDVEYESADPKKQLRGSTSTKRSRAAEVHNLS----------------  324

Query  1317  fflhlllCYNQSNAETSRQDQ*EDESSAATYTAMQQVGQGFDFRRSN*VSKIAPVASAGI  1496
                           E  R+D+  ++       A+Q++       R N   K + +  A  
Sbjct  325   --------------ERRRRDRINEK-----MKALQEL-----IPRCNKTDKASMLDEAIE  360

Query  1497  CLF*VMRKTRS*YQMMMSLGHGCGMIPMMFPGIQQYMP  1610
              L     KT      MMS+G  CGM+PMMFPG+QQY+P
Sbjct  361   YL-----KTLQLQVQMMSMG--CGMMPMMFPGVQQYLP  391


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  327   RRRDRINEKMKALQELIPRCNKTDKASMLDEAIEYLKTLQLQVQM  371



>ref|XP_004495025.1| PREDICTED: transcription factor PIF1-like isoform X1 [Cicer arietinum]
 ref|XP_004495026.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cicer arietinum]
 ref|XP_004495027.1| PREDICTED: transcription factor PIF1-like isoform X3 [Cicer arietinum]
Length=525

 Score = 86.3 bits (212),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  328   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  372


 Score = 52.4 bits (124),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 72/133 (54%), Gaps = 12/133 (9%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSG--GNLGPRggamsgteaagastgaKEMTVT  1070
             STVV+S DTP + ++   +     TA+ +   G +       + T A G  T   +MTVT
Sbjct  200   STVVDSCDTPFMAAKTYVASTLSETARSTAETGFVSMSSAGKAETSAGGRETTTVDMTVT  259

Query  1071  SSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDFGYNAKKQ----TSSK  1235
             SS     G+S SAE       A+ DRK KG E D+ E  + D DF    +K+    ++SK
Sbjct  260   SS---LGGSSESAEP--VQKEAVLDRKRKGREPDESEFQSEDVDFESKEEKKQIRGSASK  314

Query  1236  RSRAAEVHNLSER  1274
             RSRAAEVHNLSER
Sbjct  315   RSRAAEVHNLSER  327


 Score = 47.8 bits (112),  Expect(3) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 2/24 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA  1613
             MMS+G  CGM+PMMFPGI+QYMPA
Sbjct  372   MMSMG--CGMVPMMFPGIRQYMPA  393


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 68/125 (54%), Gaps = 28/125 (22%)
 Frame = +3

Query  333  MNHHCAVPEFEM----DEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVH  500
            MNH+  VP+F++    +EDY P+ +             K S   DEIMELLWQNGQVVV 
Sbjct  1    MNHY--VPDFDIQMDDEEDY-PIHI-----------SKKPSLQNDEIMELLWQNGQVVVQ  46

Query  501  TQNHQRSVK----RSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHY  668
            +QNH++  K     ++ GD  IP    R +  S  E    + H   LFMQEDEMASWL  
Sbjct  47   SQNHRQFRKPPPPTTNTGDRVIP---ERGIRSSDAEHYNINQH---LFMQEDEMASWLFD  100

Query  669  PLVDD  683
             + +D
Sbjct  101  SMNED  105



>ref|XP_006412907.1| hypothetical protein EUTSA_v10026155mg [Eutrema salsugineum]
 gb|ESQ54360.1| hypothetical protein EUTSA_v10026155mg [Eutrema salsugineum]
Length=227

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 31/158 (20%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDKPLYVD  2451
             C +C +  SKYKCPSC++PYCSL CFKKHKE PC KP  + E+  +P   + VD+P++V+
Sbjct  64    CEICVKVVSKYKCPSCLVPYCSLGCFKKHKETPCAKPSSTEEKPASPGKEVLVDRPVHVE  123

Query  2450  EPSQ-------------------------------VLTQSQLESVASSSEICEALRSEEL  2364
             E S                                V+ ++QLE++ASSSEI EAL+ E L
Sbjct  124   ESSDVAGKTQLEASAATPAKEVMVARPINVEEEKYVVEKTQLEAIASSSEIREALKDEAL  183

Query  2363  QKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             QKLICNIDSS++  S+LD+AM  E F +  +KILS IS
Sbjct  184   QKLICNIDSSSNPLSELDQAMGVEAFRVFTEKILSNIS  221



>ref|XP_010684992.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010684993.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=152

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 98/151 (65%), Gaps = 18/151 (12%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK----------------PQP  2514
             MG ++C VC EA+SKYKCP+C+IPYCSL CFKKHKE PC                  P P
Sbjct  1     MGLQQCKVCNEAKSKYKCPACLIPYCSLGCFKKHKETPCATAKSVLPDEEPKTSYVIPVP  60

Query  2513  SSEENLAPTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSS  2334
               E+    TP L  ++PL+VDE  +VL Q+QLES+ +S+EI + L++E+L+KL+C I+ S
Sbjct  61    VDEK--PTTPQLLAERPLFVDEACEVLDQAQLESIGASTEIQDTLKNEDLRKLVCRINDS  118

Query  2333  TDAESDLDKAMQKEEFHILAQKILSTISP*G  2241
              +A  +L+KAM  + F + ++K+LS  +  G
Sbjct  119   PNALEELEKAMSVDVFRVFSEKVLSAANSKG  149



>ref|XP_010245663.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
 ref|XP_010245664.1| PREDICTED: transcription factor PIF1-like isoform X4 [Nelumbo 
nucifera]
Length=533

 Score = 85.9 bits (211),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  321   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQL  365


 Score = 53.5 bits (127),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 70/134 (52%), Gaps = 13/134 (10%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNL--GPRggamsgteaagastgaKEMTVT  1070
             STVV+S+ TP V      +  + +TAQ   GNL  G   G  +          + + T+T
Sbjct  192   STVVDSSVTPAVGPRSAVAQTSRTTAQFYSGNLRSGSMSGDGTAAADGARELVSCDQTMT  251

Query  1071  SSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDF-GYNAKKQ----TSS  1232
             SS      +  SAE ST P T  DDRK K  E DD E  + D +F     KKQ    TS+
Sbjct  252   SS---SGASGASAEPSTKPPT--DDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSA  306

Query  1233  KRSRAAEVHNLSER  1274
             +RSRAAEVHNLSER
Sbjct  307   RRSRAAEVHNLSER  320


 Score = 46.2 bits (108),  Expect(3) = 4e-31, Method: Compositional matrix adjust.
 Identities = 17/38 (45%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +3

Query  1494  ICLF*VMRKTRS*YQMMMSLGHGCGMIPMMFPGIQQYM  1607
             +C + +M      + + + L  GCGM+PMMFPG+QQYM
Sbjct  365   LCPWLIMSAITRKHTVAVMLSMGCGMVPMMFPGVQQYM  402


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 66/118 (56%), Gaps = 11/118 (9%)
 Frame = +3

Query  339  HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
            +HC VP+FE+++D  P P     S       +   + E+E++ELLWQNGQVV+ +Q   R
Sbjct  2    NHC-VPDFEIEDDAIPAP-----SGLYRQKKSTLDSREEEVVELLWQNGQVVMQSQRSSR  55

Query  519  -SVKRSHGGDAAIPV---PAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
             S  +    DA IP    PA  E+  +     A      +LFMQEDEMA+WLHYPL D
Sbjct  56   KSPPKFPFEDAVIPAGGSPAG-EIRATTAAAAAEEEATNQLFMQEDEMAAWLHYPLED  112



>ref|XP_006412908.1| hypothetical protein EUTSA_v10026155mg [Eutrema salsugineum]
 gb|ESQ54361.1| hypothetical protein EUTSA_v10026155mg [Eutrema salsugineum]
Length=228

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 98/160 (61%), Gaps = 34/160 (21%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA--LHVDKPLY  2457
             C +C +  SKYKCPSC++PYCSL CFKKHKE PC KP  S+EE  A +P   + VD+P++
Sbjct  64    CEICVKVVSKYKCPSCLVPYCSLGCFKKHKETPCAKPS-STEEKPAASPGKEVLVDRPVH  122

Query  2456  VDEPSQV-------------------------------LTQSQLESVASSSEICEALRSE  2370
             V+E S V                               + ++QLE++ASSSEI EAL+ E
Sbjct  123   VEESSDVAGKTQLEASAATPAKEVMVARPINVEEEKYVVEKTQLEAIASSSEIREALKDE  182

Query  2369  ELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              LQKLICNIDSS++  S+LD+AM  E F +  +KILS IS
Sbjct  183   ALQKLICNIDSSSNPLSELDQAMGVEAFRVFTEKILSNIS  222



>ref|XP_010245662.1| PREDICTED: transcription factor PIF1-like isoform X3 [Nelumbo 
nucifera]
Length=566

 Score = 85.9 bits (211),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  372   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  416


 Score = 53.9 bits (128),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 70/134 (52%), Gaps = 13/134 (10%)
 Frame = +3

Query  897   STVVESNDTPIVPSEYRDSHVADSTAQVSGGNL--GPRggamsgteaagastgaKEMTVT  1070
             STVV+S+ TP V      +  + +TAQ   GNL  G   G  +          + + T+T
Sbjct  243   STVVDSSVTPAVGPRSAVAQTSRTTAQFYSGNLRSGSMSGDGTAAADGARELVSCDQTMT  302

Query  1071  SSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDF-GYNAKKQ----TSS  1232
             SS      +  SAE ST P T  DDRK K  E DD E  + D +F     KKQ    TS+
Sbjct  303   SS---SGASGASAEPSTKPPT--DDRKRKSREQDDNECQSEDAEFESVETKKQVRGSTSA  357

Query  1233  KRSRAAEVHNLSER  1274
             +RSRAAEVHNLSER
Sbjct  358   RRSRAAEVHNLSER  371


 Score = 43.9 bits (102),  Expect(3) = 1e-30, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  1551  LGHGCGMIPMMFPGIQQYM  1607
             L  GCGM+PMMFPG+QQYM
Sbjct  417   LSMGCGMVPMMFPGVQQYM  435


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 74/140 (53%), Gaps = 12/140 (9%)
 Frame = +3

Query  270  FIIDLIFSFFFCFNEVIAKVTMNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaM  449
            F + +I      F  ++ K+   +HC VP+FE+++D  P P     S       +   + 
Sbjct  33   FPVLIIRKHLHYFKNLLEKM---NHC-VPDFEIEDDAIPAP-----SGLYRQKKSTLDSR  83

Query  450  EDEIMELLWQNGQVVVHTQNHQR-SVKRSHGGDAAIPVPA--AREVVGSAEEEMATSHHQ  620
            E+E++ELLWQNGQVV+ +Q   R S  +    DA IP     A E+  +     A     
Sbjct  84   EEEVVELLWQNGQVVMQSQRSSRKSPPKFPFEDAVIPAGGSPAGEIRATTAAAAAEEEAT  143

Query  621  PELFMQEDEMASWLHYPLVD  680
             +LFMQEDEMA+WLHYPL D
Sbjct  144  NQLFMQEDEMAAWLHYPLED  163



>ref|XP_008464779.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Cucumis melo]
 ref|XP_008464780.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Cucumis melo]
Length=133

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCG-KPQPSSEENLAPTPALHVD  2469
             M P++C VC EA SKYKCP C+ PYCSL CFKKHKE+PC  KP    +++ AP  +  VD
Sbjct  1     MAPRECQVCNEAPSKYKCPLCLAPYCSLVCFKKHKEVPCAIKPVSEEDQSTAPNGSF-VD  59

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +P+ V + ++VL +SQLE++ASSSEI   L  E+L+K I  IDSS D E++LDKAM+ E 
Sbjct  60    RPICVGDQNEVLEKSQLEAIASSSEIHNILNDEKLRKFILAIDSSLDPETELDKAMEDEA  119

Query  2288  FH  2283
             F 
Sbjct  120   FR  121



>ref|XP_006854319.1| hypothetical protein AMTR_s00039p00115710 [Amborella trichopoda]
 gb|ERN15786.1| hypothetical protein AMTR_s00039p00115710 [Amborella trichopoda]
Length=139

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MG   CGVC EAQSKYKCP+C +PYCSL CFK H+E+PC KP    ++   P   L   +
Sbjct  1     MGRPSCGVCVEAQSKYKCPTCFMPYCSLACFKNHREVPCTKPDLPEQK---PETHLLSAR  57

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
              + VDE S VL + Q ES+ASS EI   L+++EL ++I NI+SST+AE +LDKA++   F
Sbjct  58    SIRVDEESWVLQKDQFESIASSYEIRNTLKNDELCRIISNINSSTNAEDELDKALRDPAF  117

Query  2285  HILAQKILSTISP  2247
                + KI   ++P
Sbjct  118   REFSDKISCILNP  130



>gb|KHG01839.1| Transcription factor PIF1 -like protein [Gossypium arboreum]
Length=542

 Score = 83.6 bits (205),  Expect(3) = 7e-30, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LD+AI+YLKSLQ+QVQ+
Sbjct  358   RRRDRINEKMRALQELIPRCNKSDKASMLDDAIDYLKSLQMQVQM  402


 Score = 49.3 bits (116),  Expect(3) = 7e-30, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 6/61 (10%)
 Frame = +3

Query  1110  EKSTAPATAMDDRKAKGSETDD-EGHNADTDF-GYNAKKQT----SSKRSRAAEVHNLSE  1271
             E +   A + +DRK KG E D+ E H+ + +F   + KKQT    S+KRSRAAEVHNLSE
Sbjct  297   EPTAQKAASAEDRKRKGRELDEAECHSENAEFESADTKKQTRGSTSAKRSRAAEVHNLSE  356

Query  1272  R  1274
             R
Sbjct  357   R  357


 Score = 48.5 bits (114),  Expect(3) = 7e-30, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 3/31 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGM  1634
             MMS+G  CGM+PM FPG+QQY+  MGIGM M
Sbjct  402   MMSMG--CGMVPM-FPGVQQYISPMGIGMSM  429


 Score = 76.6 bits (187),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 53/90 (59%), Gaps = 18/90 (20%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHG-----GDAAIPVPAAREVVGSAEEEMATSH  614
            EDEIMELLWQNGQVV+ +QN QRS+K+         D + P    RE+  S+       H
Sbjct  24   EDEIMELLWQNGQVVMQSQN-QRSMKKLPSFKLLDADHSAP----REIRSSSPSHKHRRH  78

Query  615  HQPE--------LFMQEDEMASWLHYPLVD  680
            H  E        LFMQEDEMASWLHYP+ D
Sbjct  79   HHQEQQQLVTDHLFMQEDEMASWLHYPISD  108



>gb|KDO65841.1| hypothetical protein CISIN_1g032470mg [Citrus sinensis]
Length=129

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = -2

Query  2645  MGP--KKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHV  2472
             MGP  + C VC EAQSKYKCP+C  PYCSL CFK HKE PC KP+P+ E+ + P     V
Sbjct  1     MGPPARLCQVCNEAQSKYKCPNCFTPYCSLVCFKNHKETPCAKPEPTEEKPIFPESP--V  58

Query  2471  DKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKE  2292
             ++ L  DEPSQVL + QLES+ASSSEI +AL+ E LQKLI  IDSS++ E        + 
Sbjct  59    ERSLNADEPSQVLQKEQLESIASSSEIRDALQDESLQKLILGIDSSSNPEIVRTITSYRS  118

Query  2291  EFHIL  2277
              F+++
Sbjct  119   HFYLM  123



>ref|XP_010438378.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Camelina sativa]
 ref|XP_010438380.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Camelina sativa]
Length=170

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 94/160 (59%), Gaps = 34/160 (21%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA----------  2481
             C +C+   SKYKCPSC++PYCSL CFK HKE PC KP  S+EEN A +PA          
Sbjct  9     CEICKNVVSKYKCPSCLLPYCSLACFKTHKETPCAKPS-STEENPAASPAKEVPVERSVV  67

Query  2480  -----------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSE  2370
                                    + V +PL+V+E   VL ++QLE++ASSSEI EAL+ E
Sbjct  68    VEEANDVVEKTQHKASAASPAKEIPVARPLHVEEEKFVLEKAQLEAIASSSEIREALKDE  127

Query  2369  ELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              LQKLI NIDSS++   +LD+AM+ E F     KILS IS
Sbjct  128   ALQKLIYNIDSSSNPLQELDEAMRVEAFREFTDKILSNIS  167



>ref|XP_004146755.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Cucumis 
sativus]
 ref|XP_004162534.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Cucumis 
sativus]
 gb|KGN47795.1| hypothetical protein Csa_6G403610 [Cucumis sativus]
Length=133

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCG-KPQPSSEENLAPTPALHVD  2469
             M P+KC VC EA SKYKCP C+ PYCSL CFKKHKE+PC  KP    +++ A      VD
Sbjct  1     MAPRKCQVCNEAPSKYKCPLCLAPYCSLVCFKKHKEVPCAIKPVSEGDQSTACN-GTFVD  59

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +P+ V + ++VL +SQLE++ASSSEI   L  E+LQK I  IDSS D E+++DKAM+ E 
Sbjct  60    RPICVGDQNEVLEKSQLEAIASSSEIHNILNDEKLQKFILAIDSSPDPETEVDKAMEDEA  119

Query  2288  FH  2283
             F 
Sbjct  120   FR  121



>gb|ABK22660.1| unknown [Picea sitchensis]
Length=159

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 88/134 (66%), Gaps = 4/134 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPT-PALHVD  2469
             MG ++C VC +A SKYKCP+C IPYCSL CFK+HKE+PC +  P+   +  PT P    +
Sbjct  20    MGGRQCQVCGDAPSKYKCPTCFIPYCSLMCFKQHKEVPCSREAPAVSTDSQPTQPPRSFE  79

Query  2468  KPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE  2289
             +    DE    L ++QLE+V +SSEI   L+ +ELQK+I  IDSS +AE +LDKAM+   
Sbjct  80    EE---DEQGWRLHRTQLEAVVASSEIRNILKDQELQKIILRIDSSENAEEELDKAMEGPH  136

Query  2288  FHILAQKILSTISP  2247
             F     KILS ISP
Sbjct  137   FQEFTDKILSIISP  150



>ref|XP_002521150.1| Phytochrome-interacting factor, putative [Ricinus communis]
 gb|EEF41301.1| Phytochrome-interacting factor, putative [Ricinus communis]
Length=572

 Score = 87.0 bits (214),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  371   RRRDRINEKMRALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  415


 Score = 51.2 bits (121),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 50/79 (63%), Gaps = 9/79 (11%)
 Frame = +3

Query  1056  EMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEG-HNADTDF-GYNAKKQ--  1223
             EMTVTSSP   S ++   +    PA   DDRK KG E + E  H+ D +F   +AKKQ  
Sbjct  295   EMTVTSSPGGSSASAEPPQPQRPPA---DDRKRKGREEETEYYHSEDVEFESADAKKQAR  351

Query  1224  --TSSKRSRAAEVHNLSER  1274
               TS+KRSRAAEVHNLSER
Sbjct  352   GSTSTKRSRAAEVHNLSER  370


 Score = 41.2 bits (95),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  C M+PMMFPGIQQY
Sbjct  415   MMSMG--CSMVPMMFPGIQQY  433


 Score = 79.7 bits (195),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 77/131 (59%), Gaps = 22/131 (17%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            M+H+  VP+FEMD+D + +P     S+  +      ++ EDE MELLW NGQVVV TQ+ 
Sbjct  1    MSHY--VPDFEMDDDCA-IP----TSSTLVRPKKSITSTEDEFMELLWHNGQVVVQTQSL  53

Query  513  QRSVKRSHG-GDAAIPVPAA--REVVGSAEEEMATSHHQPE------------LFMQEDE  647
            ++  ++ H   DA IPV  +  R+V+ +A+E    +++               LFMQEDE
Sbjct  54   KKPQQQHHKYDDAVIPVDQSNPRDVIRTAQEHHNHNNNSNNNNNNNNNTHNSNLFMQEDE  113

Query  648  MASWLHYPLVD  680
            MASWLHYP+ D
Sbjct  114  MASWLHYPIND  124



>ref|XP_008805224.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Phoenix dactylifera]
Length=135

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 84/133 (63%), Gaps = 4/133 (3%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             M P+ C VC+EAQSKYKCP C+ PYCSL CFKKHKE PC K  P  E  +   P    ++
Sbjct  1     MAPRTCEVCKEAQSKYKCPICLAPYCSLGCFKKHKENPCKKSVPEEELTVQKLP----ER  56

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
                VDEP+ V+ + Q +S+  SSEI  AL+  EL+KLI  IDSS   E++L +AM+   F
Sbjct  57    SYQVDEPNWVVDKEQFQSIVESSEILGALKDGELRKLIQKIDSSEKPENELTRAMEGRTF  116

Query  2285  HILAQKILSTISP  2247
                  KIL+ ++P
Sbjct  117   REFTDKILAVLNP  129



>gb|EYU17967.1| hypothetical protein MIMGU_mgv1a007316mg [Erythranthe guttata]
Length=411

 Score = 83.6 bits (205),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  236   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQVQVQM  280


 Score = 48.5 bits (114),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 49/87 (56%), Gaps = 15/87 (17%)
 Frame = +3

Query  1056  EMTVTSSPDDGSGASVSA------EKSTAPATAMDDRKAKGSETD-DEGHNADTDF---G  1205
             E++VTSSP  GS AS S            P   +++RK K  E D +E  + D +F   G
Sbjct  150   EVSVTSSPG-GSRASFSGSGEQQQRPPPPPPPPLNNRKRKAREADENECQSEDIEFEVAG  208

Query  1206  YNAKKQT----SSKRSRAAEVHNLSER  1274
               AKKQ     S+KRSRAA+VHNLSER
Sbjct  209   GEAKKQVCGSASTKRSRAAQVHNLSER  235


 Score = 44.7 bits (104),  Expect(3) = 1e-28, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CGM+PMM+PG+QQYMP
Sbjct  280   MMSMG--CGMVPMMYPGMQQYMP  300


 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 49/73 (67%), Gaps = 5/73 (7%)
 Frame = +3

Query  462  MELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQE  641
            MELLWQNGQVVV TQN QR  K++ GG   + +PA RE+  +  +E    H    LFMQE
Sbjct  1    MELLWQNGQVVVQTQN-QRLPKKTGGGGGGVMIPAEREMRPAGGDEQQQQH----LFMQE  55

Query  642  DEMASWLHYPLVD  680
            DEM++WL YPL D
Sbjct  56   DEMSAWLQYPLDD  68



>ref|XP_006282741.1| hypothetical protein CARUB_v10005894mg [Capsella rubella]
 gb|EOA15639.1| hypothetical protein CARUB_v10005894mg [Capsella rubella]
Length=170

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 92/159 (58%), Gaps = 32/159 (20%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSE------------------  2505
             C +C++  SKYKCPSC++PYCSL CFK HKE PC KP  + E                  
Sbjct  9     CEICKKVVSKYKCPSCLVPYCSLACFKIHKETPCAKPSSTEEKPASPAKEEVPVERPVHV  68

Query  2504  ----------ENLA----PTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEE  2367
                       EN A    P   + V +P++V+E   VL ++QLE++ASSSEI EAL+ E 
Sbjct  69    EEANDVVEKTENKASAASPAKEIPVARPIHVEEEKYVLEKTQLEAIASSSEIREALKDEA  128

Query  2366  LQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             LQKLICNIDSS++   +LD+AM  E F     KILS IS
Sbjct  129   LQKLICNIDSSSNPVQELDEAMGLEAFREFTDKILSNIS  167



>ref|XP_010438381.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Camelina sativa]
Length=169

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 92/159 (58%), Gaps = 33/159 (21%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLA--------------  2493
             C +C+   SKYKCPSC++PYCSL CFK HKE PC KP  S+EEN A              
Sbjct  9     CEICKNVVSKYKCPSCLLPYCSLACFKTHKETPCAKPS-STEENPASPAKEVPVERSVVV  67

Query  2492  ------------------PTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEE  2367
                               P   + V +PL+V+E   VL ++QLE++ASSSEI EAL+ E 
Sbjct  68    EEANDVVEKTQHKASAASPAKEIPVARPLHVEEEKFVLEKAQLEAIASSSEIREALKDEA  127

Query  2366  LQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             LQKLI NIDSS++   +LD+AM+ E F     KILS IS
Sbjct  128   LQKLIYNIDSSSNPLQELDEAMRVEAFREFTDKILSNIS  166



>ref|XP_011083103.1| PREDICTED: transcription factor PIF1 [Sesamum indicum]
Length=520

 Score = 85.5 bits (210),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  324   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  368


 Score = 52.4 bits (124),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 77/170 (45%), Gaps = 33/170 (19%)
 Frame = +3

Query  840   RSQNFARLCRPPAGP-----------SRAASTVVESNDTPIVPSEYRDSH-VADSTAQVS  983
             R QNF    R P  P           +   STVVESN+TP    E R SH VADS AQV 
Sbjct  162   RLQNFVHFSRLPNRPRTEPTPRPSVTTARESTVVESNETPRYAPESRVSHTVADSRAQV-  220

Query  984   GGNLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAM-------D  1142
               NL  R     GT A        E+   +S      +  ++E    P           +
Sbjct  221   --NLESRTATAGGTSARTG-----ELGAGTSSGGSGASFTASEPPPPPPPPPQRAPPPPE  273

Query  1143  DRKAKGSETDD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSER  1274
             DRK K  E DD E  + D +     AKKQ    TS+KRSRAAEVHNLSER
Sbjct  274   DRKRKAREADDNECQSEDIEVEAGEAKKQGRGSTSTKRSRAAEVHNLSER  323


 Score = 38.1 bits (87),  Expect(3) = 3e-28, Method: Compositional matrix adjust.
 Identities = 41/125 (33%), Positives = 50/125 (40%), Gaps = 27/125 (22%)
 Frame = +3

Query  1575  PMMFPGIQQYMPAMGIGMGMNPPVAPYpmggprfpmpafpmptpfSMADPSRIQALNHTD  1754
             P M PG     PA    MG   P+ P+ M                 + DPSRIQA N TD
Sbjct  409   PSMLPGSAMPNPAAAAHMGPRFPMPPFHMQPV-------------PVPDPSRIQAPNQTD  455

Query  1755  PMLnsphn--sshppFPT------------QTQVTPSMNEMAEHSNKSKPCSSKDVENPT  1892
             P+LNS  +   + P  P             Q Q+    N+       SKP SSKD+ NP 
Sbjct  456   PILNSVTSHNPNQPRMPNFIDPYQQFLGLQQAQLPLPQNQAVVQPGVSKPSSSKDMGNPD  515

Query  1893  TLQCG  1907
               Q G
Sbjct  516   NQQPG  520


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 72/118 (61%), Gaps = 18/118 (15%)
 Frame = +3

Query  339  HHCAVPEF-EMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQ  515
            +HC VP+F EM++D+SP PM +  S +           E+EIMELLWQNGQVV+ +QN +
Sbjct  2    NHC-VPDFHEMEDDFSP-PMPSGFSRSIKPATG-----EEEIMELLWQNGQVVMQSQNQR  54

Query  516  RSVKRSHG---GDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVD  680
             S K + G   G   + +PA RE+  S EE       Q  LFMQEDEMASWL YPL D
Sbjct  55   PSKKSTFGSGSGRGEVVIPAEREIRSSGEE-------QQHLFMQEDEMASWLQYPLDD  105



>ref|XP_008235752.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor PIF1-like 
[Prunus mume]
Length=450

 Score = 85.1 bits (209),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  252   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  296


 Score = 48.1 bits (113),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 7/52 (13%)
 Frame = +3

Query  1140  DDRKAKGSETDDEGHNADTDFGY---NAKKQ----TSSKRSRAAEVHNLSER  1274
             +DRK KG E +D+G     D  +   N KK+    TS+KRSRAAEVHNLSER
Sbjct  200   EDRKRKGREAEDDGEFQSEDVEFESANGKKKARGSTSTKRSRAAEVHNLSER  251


 Score = 42.0 bits (97),  Expect(3) = 4e-28, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 19/21 (90%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  CGM+PMMFPG+QQY
Sbjct  296   MMSMG--CGMVPMMFPGVQQY  314


 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 17/118 (14%)
 Frame = +3

Query  348  AVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQN------  509
             VP+FEM++DYS +P     +++  +   K S  +DEIMELLWQNGQVV+ +QN      
Sbjct  4    CVPDFEMEDDYS-IP-----TSSAPNRLRKSSLPDDEIMELLWQNGQVVMQSQNQRPLPN  57

Query  510  HQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
            +++S +     DA +P    R++        A +H   +LFM E+EMASWL YPLVDD
Sbjct  58   NKKSSQAPSKYDAVLP--EDRDIPRPQPHPTAQNH---QLFMHEEEMASWLQYPLVDD  110



>ref|XP_009129269.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X1 [Brassica rapa]
Length=167

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 28/154 (18%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA----------  2481
             C +CE+  SKYKCPSC++PYCSL CFKKHKE PC KP  S+EE  A +PA          
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKKHKETPCAKPS-STEEKPAASPAKDVSVVENKD  67

Query  2480  -----------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLI  2352
                              + V +P+ V+E   V+ ++QLE++AS SEI EAL+ + LQKLI
Sbjct  68    VVVKTDHKASASSAAKEVPVARPIIVEEEKYVVEKTQLEAIASCSEIREALKDKALQKLI  127

Query  2351  CNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              +IDSS +   +LD+AM  E F +L +KILS IS
Sbjct  128   SSIDSSPNPLLELDEAMGVEAFRVLTEKILSNIS  161



>ref|XP_002301830.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE81103.1| zinc finger family protein [Populus trichocarpa]
Length=154

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 87/154 (56%), Gaps = 23/154 (15%)
 Frame = -2

Query  2645  MGPK-KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVD  2469
             MG K KC VC EA+SKYKCPSC +PYCSL CF KHKE PC  P    E+ +A    +   
Sbjct  1     MGTKHKCQVCHEAESKYKCPSCRVPYCSLVCFTKHKETPCAIPVSVEEKPVADVKVVE-K  59

Query  2468  KPLYVDEPSQVLTQSQLESV---------------------ASSSEICEALRSEELQKLI  2352
             +P+ VDEP +VL + QLES+                     ASSSEI   L  E LQKLI
Sbjct  60    RPVKVDEPGEVLLKLQLESIDNWSGLGALLGPNILTPETVTASSSEIRNDLMDESLQKLI  119

Query  2351  CNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
               ID STD ES+LD AM  + F I   KILS I 
Sbjct  120   HKIDCSTDPESELDVAMGVDVFRIFTDKILSAIG  153



>ref|XP_009137810.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X2 [Brassica rapa]
Length=168

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 96/166 (58%), Gaps = 35/166 (21%)
 Frame = -2

Query  2645  MGPK---KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA--  2481
             M P+    CG+CE   SKYKCP C++PYCS+ CFKKHKE+PC KP  S++E  A +PA  
Sbjct  1     MSPRATQTCGICERVVSKYKCPCCLVPYCSVGCFKKHKELPCVKPS-STDEKPATSPAKE  59

Query  2480  -----------------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEIC  2388
                                          + V  P+  +E   V+ ++QLE++ASSSEI 
Sbjct  60    VPVETTDVVEKTESKAVGNSDASPTKEAQMAVAIPVNAEEAKHVVDKTQLEAIASSSEIR  119

Query  2387  EALRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             EAL+ E LQKLI  IDSS++   +LD+AM +E F +L  KILS +S
Sbjct  120   EALKDESLQKLITKIDSSSNPLKELDEAMGEEAFRMLKDKILSNLS  165



>ref|XP_010433160.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X1 [Camelina sativa]
Length=172

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 95/162 (59%), Gaps = 36/162 (22%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA---------L  2478
             C +C++  S+YKCPSC++PYCSL CFK HKE PC KP  S+E+N A +P          +
Sbjct  9     CEICKKVVSRYKCPSCILPYCSLACFKIHKETPCAKPS-STEDNPAASPPKEEVPVERPV  67

Query  2477  HVD--------------------------KPLYVDEPSQVLTQSQLESVASSSEICEALR  2376
             HV                           +PL+V+E   VL ++QLE++ASSSEI EAL+
Sbjct  68    HVGEATTDIVEKTQHKASAASPAKEIPVARPLHVEEEKFVLEKAQLEAIASSSEIREALK  127

Query  2375  SEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              E LQKLI NIDSS++   +LD+AM+ E F     KILS IS
Sbjct  128   DESLQKLIYNIDSSSNPLQELDEAMRVEAFREFTDKILSNIS  169



>ref|XP_010433161.1| PREDICTED: zinc finger HIT domain-containing protein 3-like isoform 
X2 [Camelina sativa]
Length=171

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 93/161 (58%), Gaps = 35/161 (22%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLA--------------  2493
             C +C++  S+YKCPSC++PYCSL CFK HKE PC KP  S+E+N A              
Sbjct  9     CEICKKVVSRYKCPSCILPYCSLACFKIHKETPCAKPS-STEDNPASPPKEEVPVERPVH  67

Query  2492  --------------------PTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRS  2373
                                 P   + V +PL+V+E   VL ++QLE++ASSSEI EAL+ 
Sbjct  68    VGEATTDIVEKTQHKASAASPAKEIPVARPLHVEEEKFVLEKAQLEAIASSSEIREALKD  127

Query  2372  EELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             E LQKLI NIDSS++   +LD+AM+ E F     KILS IS
Sbjct  128   ESLQKLIYNIDSSSNPLQELDEAMRVEAFREFTDKILSNIS  168



>ref|XP_004493861.1| PREDICTED: transcription factor PIF1-like isoform X4 [Cicer arietinum]
Length=506

 Score = 84.7 bits (208),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  284   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  328


 Score = 44.3 bits (103),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 70/160 (44%), Gaps = 41/160 (26%)
 Frame = +3

Query  846   QNFARLCR-------PPAGPSRAA---STVVESNDTPIVPSEYRDSHVADSTAQVSGGNL  995
             QNFA   R        P+  SR A   ST V+S DTP V      S    S+A+++ G  
Sbjct  148   QNFAYFARHSVRTEPGPSSISRTAVNESTGVDSCDTPAVQPV---SETVRSSAELTEGGT  204

Query  996   GPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDD  1175
             G                 A  MT     D+  G+S S E       A  +RK KG E ++
Sbjct  205   G---------------LEAPSMTC----DEPGGSSSSGE--AVRKVAEQERKRKGREAEE  243

Query  1176  -EGHNADTDFGYNAKKQ------TSSKRSRAAEVHNLSER  1274
              E  + D DF     K+      +S KRSRAAEVHNLSER
Sbjct  244   WEDQSEDVDFESAEAKRNICGSSSSVKRSRAAEVHNLSER  283


 Score = 44.3 bits (103),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 2/25 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAM  1616
             MMS+G  CGM+PMMF GIQQYMP +
Sbjct  328   MMSMG--CGMVPMMFRGIQQYMPTI  350


 Score = 78.6 bits (192),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 48/78 (62%), Gaps = 10/78 (13%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPEL  629
            +DEIMELLWQNGQVV  TQNH+   K   G D      + R    SA+EE    H    L
Sbjct  18   DDEIMELLWQNGQVVTQTQNHRYLRKPPPGTD------STRGGTLSAKEENYNQH----L  67

Query  630  FMQEDEMASWLHYPLVDD  683
            FMQE EMASWLHYP+ DD
Sbjct  68   FMQEGEMASWLHYPINDD  85



>ref|XP_009129271.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Brassica rapa]
Length=166

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (60%), Gaps = 25/152 (16%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALH--------  2475
             C +CE+  SKYKCPSC++PYCSL CFKKHKE PC KP  + E+  +P   +         
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKKHKETPCAKPSSTEEKPASPAKDVSVVENKDVV  68

Query  2474  -----------------VDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICN  2346
                              V +P+ V+E   V+ ++QLE++AS SEI EAL+ + LQKLI +
Sbjct  69    VKTDHKASASSAAKEVPVARPIIVEEEKYVVEKTQLEAIASCSEIREALKDKALQKLISS  128

Query  2345  IDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             IDSS +   +LD+AM  E F +L +KILS IS
Sbjct  129   IDSSPNPLLELDEAMGVEAFRVLTEKILSNIS  160



>gb|KFK29428.1| hypothetical protein AALP_AA7G133200 [Arabis alpina]
Length=172

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 91/158 (58%), Gaps = 33/158 (21%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA----------  2481
             C +C++  SKYKCPSC+IPYCSL CFK HKE PC KP  S+EE  A +P           
Sbjct  9     CEICDKVVSKYKCPSCLIPYCSLACFKIHKETPCAKPS-STEEKPAASPTKEVPVERSVL  67

Query  2480  ----------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEE  2367
                                   + V +P+ ++E   V+ ++QLE++AS SEI EAL+ E 
Sbjct  68    VEEANDGVEKTQLKANASSANEVQVARPINIEEEKYVVEKTQLEAIASYSEIREALKDEA  127

Query  2366  LQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTI  2253
             L+KLIC+IDSS++   +LD+AM  E F +   KILS I
Sbjct  128   LKKLICSIDSSSNPIQELDEAMGGEAFRVFTDKILSNI  165



>ref|XP_006408930.1| hypothetical protein EUTSA_v10001974mg [Eutrema salsugineum]
 gb|ESQ50383.1| hypothetical protein EUTSA_v10001974mg [Eutrema salsugineum]
Length=478

 Score = 84.0 bits (206),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  307   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  351


 Score = 46.6 bits (109),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 24/31 (77%), Gaps = 2/31 (6%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGM  1634
             MMS+G  CGM+PMM+ G+Q YMP M +GM M
Sbjct  351   MMSMG--CGMMPMMYTGMQHYMPHMAMGMEM  379


 Score = 38.5 bits (88),  Expect(3) = 2e-26, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (58%), Gaps = 5/59 (8%)
 Frame = +3

Query  1098  SVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             +V  ++ TA  T +D+RK K  E  D+        G      TS+KRSRAA+VHNLSER
Sbjct  253   AVIVQQETA-NTTVDERKRKEREAIDDSEETKQGRG----STTSTKRSRAAQVHNLSER  306


 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 60/114 (53%), Gaps = 10/114 (9%)
 Frame = +3

Query  351  VPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSVKR  530
            VP+F+ D+DY+ +   +  S++           ED++MELLWQNGQVV+  Q       R
Sbjct  5    VPDFDTDDDYANVNPNSSSSSSLNLPRKPIMGEEDDLMELLWQNGQVVIQNQ-------R  57

Query  531  SHGGDAAIPVPAAREVVGSAEEEMATSHHQP---ELFMQEDEMASWLHYPLVDD  683
             +  +   P  + +   G          HQP    LF+QEDEMASWLHYPL +D
Sbjct  58   LNNANKKPPSSSVKLHGGGVAPPPPPPTHQPLDENLFIQEDEMASWLHYPLRED  111



>ref|XP_010451144.1| PREDICTED: zinc finger HIT domain-containing protein 3-like, 
partial [Camelina sativa]
Length=200

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 93/158 (59%), Gaps = 34/158 (22%)
 Frame = -2

Query  2624  VCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA-------LHVD-  2469
             +C++  SKYKCPSC++PYCSL CFK HKE PC KP  S+E+N A  P        +HV+ 
Sbjct  41    ICKKVVSKYKCPSCILPYCSLACFKIHKETPCAKPS-STEDNPASPPKEVPEERPVHVEE  99

Query  2468  -------------------------KPLYVDEPSQVLTQSQLESVASSSEICEALRSEEL  2364
                                      +PL+V+E   VL ++QLE++ASSSEI +AL+ E L
Sbjct  100   ATNDVVEKTQHKAIAASPAKEVPVARPLHVEEEKFVLEKAQLEAIASSSEIRDALKDEAL  159

Query  2363  QKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             QKLI NIDSS++   +LD+AM  E F     KILS IS
Sbjct  160   QKLIYNIDSSSNPLQELDQAMGVEAFREFTDKILSNIS  197



>ref|NP_001031741.1| HIT-type zinc finger protein [Arabidopsis thaliana]
 dbj|BAD44383.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE77402.1| At4g28820 [Arabidopsis thaliana]
 gb|AEE85550.1| HIT-type zinc finger protein [Arabidopsis thaliana]
Length=172

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 90/158 (57%), Gaps = 31/158 (20%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKP-QPSSEENLAPTPA---------  2481
             C +CE+  SKYKCPSC++PYCSL CFK HKE PC KP  PSS E    +PA         
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKIHKETPCAKPSDPSSTEEKPASPAKEVPVKRPE  68

Query  2480  ---------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEEL  2364
                                  + V +P+ V+E   +L ++Q E++ASSSEI EAL+ E L
Sbjct  69    EANDVVEKTQQKASAASPAKEIPVARPIIVEEEKYILEKTQFEAIASSSEIREALKDEPL  128

Query  2363  QKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             QKLI +IDSS++   +LD+AM  E F     KILS IS
Sbjct  129   QKLIYSIDSSSNPLQELDEAMGIEAFREFTDKILSNIS  166



>ref|NP_194611.2| HIT-type zinc finger protein [Arabidopsis thaliana]
 gb|ABE77404.1| At4g28820 [Arabidopsis thaliana]
 gb|AEE85549.1| HIT-type zinc finger protein [Arabidopsis thaliana]
Length=173

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 92/159 (58%), Gaps = 32/159 (20%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKP-QPSS-EENLAPTPA--------  2481
             C +CE+  SKYKCPSC++PYCSL CFK HKE PC KP  PSS EE  A +PA        
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKIHKETPCAKPSDPSSTEEKPAASPAKEVPVKRP  68

Query  2480  ----------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEE  2367
                                   + V +P+ V+E   +L ++Q E++ASSSEI EAL+ E 
Sbjct  69    EEANDVVEKTQQKASAASPAKEIPVARPIIVEEEKYILEKTQFEAIASSSEIREALKDEP  128

Query  2366  LQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             LQKLI +IDSS++   +LD+AM  E F     KILS IS
Sbjct  129   LQKLIYSIDSSSNPLQELDEAMGIEAFREFTDKILSNIS  167



>emb|CDY06864.1| BnaC01g09630D [Brassica napus]
Length=178

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 92/162 (57%), Gaps = 35/162 (22%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHK----------EIPCGKPQPSSEENLAPTPA  2481
             C +CE+  SKYKCPSC++PYCSL CFKKHK          + PC KP  + E+  +P   
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLVCFKKHKGKLFFNSHLKKTPCAKPSAAEEKPASPAKE  68

Query  2480  LHV-------------------------DKPLYVDEPSQVLTQSQLESVASSSEICEALR  2376
             + V                          +P+ V+E   V+ ++QLE++ASSSEI EAL+
Sbjct  69    VSVVETKHVVVKTEHKASASSAAKEVPVARPITVEEEKYVVEKTQLEAIASSSEIREALK  128

Query  2375  SEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              E LQKLI  IDSS++   +LD+AM  E F +L +KILS IS
Sbjct  129   DEALQKLISTIDSSSNPLQELDEAMGVEAFRVLTEKILSNIS  170



>ref|XP_008372429.1| PREDICTED: transcription factor PIF1-like [Malus domestica]
Length=535

 Score = 85.9 bits (211),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  334   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  378


 Score = 43.5 bits (101),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 34/61 (56%), Gaps = 11/61 (18%)
 Frame = +3

Query  1125  PATAMDDRKAKGSETDD-----EGHNADTDF-GYNAKKQ-----TSSKRSRAAEVHNLSE  1271
             P    D+RK KG E        E  + D +F   N KKQ     +S+KRSRAAEVHNLSE
Sbjct  273   PPLTADNRKRKGREAAAADDDAEFQSRDVEFESANGKKQLRGLTSSTKRSRAAEVHNLSE  332

Query  1272  R  1274
             R
Sbjct  333   R  333


 Score = 38.5 bits (88),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G+G  MIPMMFPG+QQ M
Sbjct  378   MMSMGYG--MIPMMFPGVQQMM  397


 Score = 80.1 bits (196),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 65/115 (57%), Gaps = 10/115 (9%)
 Frame = +3

Query  351  VPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSV--  524
            VP+FEMD +Y  LP  +  +    S        ED+IMELLWQ+GQVV+ +QN + SV  
Sbjct  5    VPDFEMDYEYL-LPTTSALNRPRKSTMP-----EDDIMELLWQDGQVVMQSQNQRSSVNS  58

Query  525  KRSHGG--DAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
            KRSH    D  +P         + + +       P LF+QEDEMASWL YPLVD+
Sbjct  59   KRSHQSKYDVVLPDDGXGITRPAPQPQPQXPAQNPHLFIQEDEMASWLQYPLVDE  113



>dbj|BAF00716.1| putative bHLH transcription factor [Arabidopsis thaliana]
Length=407

 Score = 85.1 bits (209),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  224   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  268


 Score = 49.3 bits (116),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +3

Query  1086  GSGASVSAEKSTAP-ATAMDDRKAKGSE--TDDEGHNADTDFGYNAKKQTSSKRSRAAEV  1256
             G+ +SV ++    P  T +DDRK K  E  T DE  +   +        TS+KRSRAAEV
Sbjct  158   GTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEV  217

Query  1257  HNLSER  1274
             HNLSER
Sbjct  218   HNLSER  223


 Score = 33.5 bits (75),  Expect(3) = 6e-26, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ P
Sbjct  268   MMSMG--CGMMPMMYPGMQQYMPHMAMGMGMNQPIPP  302



>ref|NP_849996.1| transcription factor PIF1 [Arabidopsis thaliana]
 gb|ABM06045.1| At2g20180 [Arabidopsis thaliana]
 gb|AEC06978.1| transcription factor PIF1 [Arabidopsis thaliana]
Length=407

 Score = 85.1 bits (209),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  224   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  268


 Score = 49.3 bits (116),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +3

Query  1086  GSGASVSAEKSTAP-ATAMDDRKAKGSE--TDDEGHNADTDFGYNAKKQTSSKRSRAAEV  1256
             G+ +SV ++    P  T +DDRK K  E  T DE  +   +        TS+KRSRAAEV
Sbjct  158   GTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEV  217

Query  1257  HNLSER  1274
             HNLSER
Sbjct  218   HNLSER  223


 Score = 33.5 bits (75),  Expect(3) = 7e-26, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ P
Sbjct  268   MMSMG--CGMMPMMYPGMQQYMPHMAMGMGMNQPIPP  302



>ref|XP_008235535.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Prunus mume]
Length=104

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 76/132 (58%), Gaps = 29/132 (22%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP+ C VC EAQSKYKCPSC+ PYCS+ CFKKHKE PC  P  S E+   PT       
Sbjct  1     MGPRLCQVCNEAQSKYKCPSCLAPYCSVACFKKHKENPCALPVSSLEK--PPT-------  51

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEF  2286
                                 SSSEIC AL+ E LQKLI NID S DAE +L+KAM  + F
Sbjct  52    --------------------SSSEICSALKDENLQKLILNIDCSPDAEKELEKAMGVDVF  91

Query  2285  HILAQKILSTIS  2250
              I   KILST+ 
Sbjct  92    RIFTDKILSTLG  103



>ref|XP_001785765.1| predicted protein [Physcomitrella patens]
 gb|EDQ49429.1| predicted protein [Physcomitrella patens]
Length=141

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 91/136 (67%), Gaps = 7/136 (5%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQP---SSEENLAPTPALH  2475
             MG K+C VC++A+SKYKCP C+ PYCSL C+KKHKEIPC KP     ++E+ +   PA  
Sbjct  1     MG-KQCEVCKDAESKYKCPICLTPYCSLVCYKKHKEIPCAKPNANGNNAEKIVDEQPASV  59

Query  2474  VDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQK  2295
              +     DE +  L ++QLE+VA+S EI + LR  +LQ+LI  IDSS++ + +L+KAM+ 
Sbjct  60    AED---ADESNHRLKRTQLEAVAASEEIRKMLRDRDLQELISKIDSSSNPKLELEKAMEG  116

Query  2294  EEFHILAQKILSTISP  2247
               F     K+LS I+P
Sbjct  117   PYFREFTDKLLSVINP  132



>ref|XP_010684995.1| PREDICTED: transcription factor PIF1-like [Beta vulgaris subsp. 
vulgaris]
Length=563

 Score = 84.7 bits (208),  Expect(3) = 8e-26, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQ+QVQ+
Sbjct  332   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQMQVQM  376


 Score = 44.7 bits (104),  Expect(3) = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 66/142 (46%), Gaps = 13/142 (9%)
 Frame = +3

Query  888   RAASTVVESNDTPIVPSEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTV  1067
             R   TVVESN TP +        V+ +     GG    +     G     A+ G+ E+TV
Sbjct  190   RTDLTVVESNSTPALGQVQSMGEVSSAFPSSVGGERLDKDRGSGGKRLEKAAGGSDEITV  249

Query  1068  TSS----PDDGSGASVSAEKSTAPATAMDDRKAKGSETDDE-----GHNADTDFGYNAKK  1220
             +SS    P + +  ++ A +       M+DRK K  + D+        + + + G + KK
Sbjct  250   SSSSSGGPTNTTTTAIIASEDVGEKVVMEDRKRKQRDVDESPTTATAQDVELEAGDDEKK  309

Query  1221  QTSS----KRSRAAEVHNLSER  1274
              +      KRSRAAEVHNLSER
Sbjct  310   HSRGSHFGKRSRAAEVHNLSER  331


 Score = 38.1 bits (87),  Expect(3) = 8e-26, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 3/24 (13%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGI-QQYMP  1610
             MMS+G  CGM+PMM+PG+  QYMP
Sbjct  376   MMSMG--CGMVPMMYPGVPPQYMP  397


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 62/121 (51%), Gaps = 17/121 (14%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            MN++  VP+FEM++++  +           S    +   EDEI+ELLWQ+GQ+V   QN 
Sbjct  1    MNYY--VPDFEMEDEHHII---------STSSPITRHKAEDEILELLWQDGQIVAQPQN-  48

Query  513  QRSVKRSHGGDAAIPVP-----AAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLV  677
            QR  + S    +  P+P               ++      Q +L+M EDEMA+WLHYPL 
Sbjct  49   QRKFQPSSAAASPPPLPNYQYQHHHHHQHHQHQQQQQQQQQQQLYMAEDEMATWLHYPLD  108

Query  678  D  680
            D
Sbjct  109  D  109



>emb|CDY35225.1| BnaA01g08060D [Brassica napus]
Length=177

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 94/164 (57%), Gaps = 38/164 (23%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHK----------EIPCGKPQPSSEENLAPTPA  2481
             C +CE+  SKYKCPSC++PYCSL CFKKHK            PC KP  S+EE  A +PA
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKKHKGKLFFNSHLKRTPCAKPS-STEEKPAASPA  67

Query  2480  ---------------------------LHVDKPLYVDEPSQVLTQSQLESVASSSEICEA  2382
                                        + V +P+ V+E   V+ ++QLE++A SSEI EA
Sbjct  68    KEVSVVENKDVVAKTEHKASASSAAKEVPVARPITVEEEKYVVEKTQLEAIALSSEIREA  127

Query  2381  LRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             L+ E LQKLI +IDSS++   +LD+AM  E F +L +KILS IS
Sbjct  128   LKDEALQKLISSIDSSSNPLQELDEAMGVEAFRLLTEKILSNIS  171



>ref|XP_008382659.1| PREDICTED: transcription factor PIF1-like [Malus domestica]
Length=529

 Score = 85.9 bits (211),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  328   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  372


 Score = 42.7 bits (99),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 10/60 (17%)
 Frame = +3

Query  1125  PATAMDDRKAKGSET----DDEGHNADTDF-GYNAKKQ-----TSSKRSRAAEVHNLSER  1274
             P     +RK KG E     D E  + D +F   N KKQ     +S+KRSRAAEVHNLSER
Sbjct  268   PPPTAXNRKRKGREVAAADDAEIQSEDVEFESANGKKQVRGSTSSTKRSRAAEVHNLSER  327


 Score = 37.7 bits (86),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQ  1601
             GCGM+PMMFPG+QQ
Sbjct  376   GCGMVPMMFPGVQQ  389


 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +3

Query  348  AVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRSV-  524
             VP+FEMD+DYS LP     +++ L+   K +  ED++MELLWQNGQVV+  QN + +V 
Sbjct  4    CVPDFEMDDDYS-LP-----TSSALNRPRKSTMPEDDVMELLWQNGQVVMQNQNQRSAVN  57

Query  525  -KRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
             KRSH     + +P     +     +       P LF+QEDEMASWL YPLVDD
Sbjct  58   SKRSHQSKYDVVLPDDGXGITRPAXQPQPQAQNPHLFVQEDEMASWLQYPLVDD  111



>gb|AAD24380.1| unknown protein [Arabidopsis thaliana]
Length=490

 Score = 84.7 bits (208),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  295   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  339


 Score = 43.1 bits (100),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +3

Query  1086  GSGASVSAEKSTAP-ATAMDDRKAKGSE--TDDEGHNADTDFGYNAKKQTSSKRSRAAEV  1256
             G+ +SV ++    P  T +DDRK K  E  T DE  +   +        TS+KRSRAAEV
Sbjct  229   GTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEV  288

Query  1257  HNLSER  1274
             HNLSER
Sbjct  289   HNLSER  294


 Score = 38.5 bits (88),  Expect(3) = 2e-25, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ P
Sbjct  339   MMSMG--CGMMPMMYPGMQQYMPHMAMGMGMNQPIPP  373


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 13/114 (11%)
 Frame = +3

Query  342  HCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRS  521
            H  VP+F+ D+DY  +                    +D++MELLWQNGQVVV  QN +  
Sbjct  2    HHFVPDFDTDDDY--VNNHNSSLNHLPRKSITTMGEDDDLMELLWQNGQVVV--QNQRLH  57

Query  522  VKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
             K+        P  +  +++ S + +   S  Q  LF+QEDEM SWLHYPL DD
Sbjct  58   TKK--------PSSSPPKLLPSMDPQQQPSSDQ-NLFIQEDEMTSWLHYPLRDD  102



>ref|NP_179608.2| transcription factor PIF1 [Arabidopsis thaliana]
 ref|NP_001189559.1| transcription factor PIF1 [Arabidopsis thaliana]
 sp|Q8GZM7.1|PIF1_ARATH RecName: Full=Transcription factor PIF1; AltName: Full=Basic 
helix-loop-helix protein 15; Short=AtbHLH15; Short=bHLH 15; 
AltName: Full=Protein PHY-INTERACTING FACTOR 1; AltName: Full=Protein 
PHYTOCHROME INTERACTING FACTOR 3-LIKE 5; AltName: 
Full=Transcription factor EN 101; AltName: Full=bHLH transcription 
factor bHLH015 [Arabidopsis thaliana]
 gb|AAN78308.1| putative bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAC56979.1| PIF3 like basic Helix Loop Helix protein [Arabidopsis thaliana]
 gb|AEC06977.1| transcription factor PIF1 [Arabidopsis thaliana]
 gb|AEC06979.1| transcription factor PIF1 [Arabidopsis thaliana]
Length=478

 Score = 84.7 bits (208),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  295   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  339


 Score = 43.1 bits (100),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +3

Query  1086  GSGASVSAEKSTAP-ATAMDDRKAKGSE--TDDEGHNADTDFGYNAKKQTSSKRSRAAEV  1256
             G+ +SV ++    P  T +DDRK K  E  T DE  +   +        TS+KRSRAAEV
Sbjct  229   GTSSSVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETKQARVSTTSTKRSRAAEV  288

Query  1257  HNLSER  1274
             HNLSER
Sbjct  289   HNLSER  294


 Score = 38.1 bits (87),  Expect(3) = 3e-25, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ P
Sbjct  339   MMSMG--CGMMPMMYPGMQQYMPHMAMGMGMNQPIPP  373


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 13/114 (11%)
 Frame = +3

Query  342  HCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQRS  521
            H  VP+F+ D+DY  +                    +D++MELLWQNGQVVV  QN +  
Sbjct  2    HHFVPDFDTDDDY--VNNHNSSLNHLPRKSITTMGEDDDLMELLWQNGQVVV--QNQRLH  57

Query  522  VKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
             K+        P  +  +++ S + +   S  Q  LF+QEDEM SWLHYPL DD
Sbjct  58   TKK--------PSSSPPKLLPSMDPQQQPSSDQ-NLFIQEDEMTSWLHYPLRDD  102



>ref|XP_011026200.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026201.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026202.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
 ref|XP_011026203.1| PREDICTED: transcription factor PIF4 [Populus euphratica]
Length=528

 Score = 85.5 bits (210),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  342   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  386


 Score = 43.9 bits (102),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 17/31 (55%), Positives = 23/31 (74%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G G++P+MFPG+Q +M  MG+GMG  PP  P
Sbjct  390   GSGIVPVMFPGVQHFMSRMGMGMG--PPPLP  418


 Score = 36.2 bits (82),  Expect(3) = 4e-25, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 3/60 (5%)
 Frame = +3

Query  1104  SAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYN---AKKQTSSKRSRAAEVHNLSER  1274
             + ++S  P+     +     E++ +  +A+ D       AK+  S++RSRAAEVHNLSER
Sbjct  282   TCKQSAVPSRGQKRKTMDAEESECQSEDAELDSAVANKPAKRSGSARRSRAAEVHNLSER  341



>gb|KFH73094.1| hypothetical protein MVEG_00318 [Mortierella verticillata NRRL 
6337]
Length=156

 Score =   113 bits (282),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = -2

Query  2636  KKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDKPLY  2457
             K CGVC+  +SKYKCP+C +PYCSL C+KKHKE PC KP P  E    P P +   KP Y
Sbjct  6     KICGVCDTNESKYKCPNCTLPYCSLVCYKKHKETPCEKPAPIPEPETIPVPPVE-PKPDY  64

Query  2456  VDEPS-QVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEE-FH  2283
             ++E S  +L + QL  +A S+ + E L++E L++L+  IDSS + E  LDKA ++++ F 
Sbjct  65    LEEESVALLNEEQLSRIAQSARLQELLKNEGLRRLVRMIDSSENPEYLLDKARKEDQRFR  124

Query  2282  ILAQKILSTI--SP*GSVFDHVLDCILMWKK  2196
               +++IL+ +  +P  +  + VL+ I M K+
Sbjct  125   EFSEEILTIVGRAPGQTGTEQVLEAIGMGKQ  155



>ref|XP_010467931.1| PREDICTED: transcription factor PIF1-like [Camelina sativa]
Length=528

 Score = 84.0 bits (206),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  341   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  385


 Score = 42.4 bits (98),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = +3

Query  1062  TVTSSPDD---GSGASVSAEKSTAP-ATAMDDRKAKGSETDDEGH----NADTDFGYNAK  1217
             T+T++P     G+  S+ +++   P  T +D+RK K  E  DE      N +T  G    
Sbjct  267   TMTTTPTIEILGTSTSIMSKREIGPEKTIVDERKRKEREAIDEAECRNENEETKQG----  322

Query  1218  KQTSSKRSRAAEVHNLSER  1274
              + S+KR+RAAEVHNLSER
Sbjct  323   -RGSTKRTRAAEVHNLSER  340


 Score = 37.4 bits (85),  Expect(3) = 1e-24, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 19/21 (90%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  CG++PMM+PG+QQY
Sbjct  385   MMSMG--CGVMPMMYPGMQQY  403


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 51/116 (44%), Gaps = 13/116 (11%)
 Frame = +3

Query  342  HCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDE--IMELLWQNGQVVVHTQNHQ  515
            H  VP+F+ D+DY     +   S             +D+  +MELLW NGQVVVH Q   
Sbjct  2    HHFVPDFDRDDDY-----VNSSSLNLPRKSITTMGGDDDNDLMELLWHNGQVVVHNQRLH  56

Query  516  RSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
                  H    +   P          ++      Q  LF+ EDEM SWLHYPL DD
Sbjct  57   H-----HNKKPSSSPPKMFHPPPPPMQQQQQPSDQ-NLFIHEDEMTSWLHYPLRDD  106



>gb|KHG28067.1| Zinc finger HIT domain-containing 3 [Gossypium arboreum]
Length=237

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 92/166 (55%), Gaps = 40/166 (24%)
 Frame = -2

Query  2642  GP-KKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALH---  2475
             GP ++C VC + QSKYKCPSC+IPYCSL CFK HKE PC K +   E++  P+  L    
Sbjct  3     GPSRQCQVCNQTQSKYKCPSCLIPYCSLACFKTHKETPCEKSESVKEKSGTPSVNLGSND  62

Query  2474  ------------------------------------VDKPLYVDEPSQVLTQSQLESVAS  2403
                                                 V + L V++PS+VL   Q++++AS
Sbjct  63    NAITTSVKPESTNDAVPPSVETKSSEGRPTASREFLVGRKLEVEDPSEVLQIMQMQAIAS  122

Query  2402  SSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKI  2265
             S++I EAL+ E LQKLI +IDSS DA ++LDKAM  + F I + K+
Sbjct  123   SNDIREALKDEHLQKLISDIDSSPDALNELDKAMGLDVFRIFSDKV  168



>ref|XP_004292266.1| PREDICTED: transcription factor PIF1-like [Fragaria vesca subsp. 
vesca]
Length=525

 Score = 82.8 bits (203),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR LQ+LIPRCNK DKAS+L+EAIEYLKSLQLQVQ+
Sbjct  326   RRRDRINEKMRTLQELIPRCNKSDKASMLEEAIEYLKSLQLQVQM  370


 Score = 40.8 bits (94),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 9/67 (13%)
 Frame = +3

Query  1101  VSAEKSTAPATAMDDRKAKGSET--DDEGHNADTDFGY---NAKK----QTSSKRSRAAE  1253
             VS +K   P     DRK KG E   DD    ++ D  +   +AKK     +S+KRSRAAE
Sbjct  259   VSTQKPPPPLPPPVDRKRKGREREPDDAECQSEQDVEFESGSAKKVNRGSSSTKRSRAAE  318

Query  1254  VHNLSER  1274
             VHNLSER
Sbjct  319   VHNLSER  325


 Score = 39.7 bits (91),  Expect(3) = 2e-24, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 2/21 (10%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQY  1604
             MMS+G  CGM+PMMFPG+Q Y
Sbjct  370   MMSMG--CGMVPMMFPGVQPY  388


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 70/117 (60%), Gaps = 15/117 (13%)
 Frame = +3

Query  333  MNHHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            MNHH  VP+FEM++DYS +P       A  +   K +  EDEIMEL+W NGQ+V+H+Q+ 
Sbjct  1    MNHH--VPDFEMEDDYS-IP-------ASSARPGKSTMSEDEIMELVWHNGQLVMHSQSQ  50

Query  513  QRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
            + + KRS   D  IP      +   A         QP+LFM EDEMASWLHYPL DD
Sbjct  51   RPAQKRSKY-DVVIP----EHITAPAAPPQQQPETQPQLFMHEDEMASWLHYPLNDD  102



>ref|XP_002867436.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43695.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=173

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 88/159 (55%), Gaps = 32/159 (20%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQ------------PSSEENL---  2496
             C +C++  SKYKCPSC++PYCSL CFK HKE PC KP             P+ E ++   
Sbjct  9     CDICKKLVSKYKCPSCLVPYCSLGCFKIHKETPCAKPSGPSSTVDKPAASPAKEVSVERP  68

Query  2495  -----------------APTPALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEE  2367
                              +P   + V +P++V+E   VL ++  E++ASSSEI EAL+ E 
Sbjct  69    EEANDVVEKTQHKASAESPAKEIPVARPIHVEEEKYVLEKTHFEAIASSSEIREALKDEA  128

Query  2366  LQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
             LQKLI  IDSS++   +LD AM  E F     KILS IS
Sbjct  129   LQKLIYRIDSSSNPLQELDGAMGIEAFREFTDKILSNIS  167



>gb|KFK40384.1| hypothetical protein AALP_AA3G366400 [Arabis alpina]
Length=533

 Score = 84.7 bits (208),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  344   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  388


 Score = 41.2 bits (95),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 20/23 (87%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CGM+PMM+ G+QQYMP
Sbjct  388   MMSMG--CGMMPMMYTGMQQYMP  408


 Score = 35.8 bits (81),  Expect(3) = 5e-24, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 35/67 (52%), Gaps = 6/67 (9%)
 Frame = +3

Query  1092  GASVSAEKSTAPATA------MDDRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAE  1253
             G +V+   S  P T+      +D+RK K  E   +   + ++        T +KRSRAA+
Sbjct  277   GKAVATPASEIPGTSSPEKTIVDERKRKEREATIDDTESPSEETKGRGTTTCTKRSRAAQ  336

Query  1254  VHNLSER  1274
             VHNLSER
Sbjct  337   VHNLSER  343


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPE-  626
            E+++MELLWQNGQVV+  Q    +  +     + + + A  E      EE+A S    + 
Sbjct  38   EEDLMELLWQNGQVVLQNQRLNNTTTKKPSSSSTVKLHAGEE------EEVAPSQLLDQN  91

Query  627  LFMQEDEMASWLHYPLVDD  683
            LF+QEDEM SWLHYPL DD
Sbjct  92   LFIQEDEMTSWLHYPLRDD  110



>ref|XP_007144439.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
 gb|ESW16433.1| hypothetical protein PHAVU_007G156200g [Phaseolus vulgaris]
Length=517

 Score =   116 bits (291),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 195/451 (43%), Gaps = 111/451 (25%)
 Frame = +3

Query  333   MNHHCAVPEFEM---DEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHT  503
             MNH   VP+FE+   D++  P+P+             K S   DEIMELLWQNGQVV+H+
Sbjct  1     MNH--CVPDFEIQMEDDEEFPIPV-----------SKKPSMQNDEIMELLWQNGQVVMHS  47

Query  504   QNHQRSVKRSH-----GGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHY  668
             QNH+   K  H     GGD  IP   ARE+  S  E     H    LFMQEDEMASWLHY
Sbjct  48    QNHRPLRKPPHTLPSGGGDGVIP---AREIRSSEHENYGNQH----LFMQEDEMASWLHY  100

Query  669   PLVDDspylsadllypssssaaaavappRDFRASApevrrppaplppippsgrTDVL---  839
             P+ +D P            +        +   ++A +       L    P          
Sbjct  101   PIHEDPPPFDHHDFCADMLNPPTNAIASQSHNSAAIQSSIRTTELRHPAPRPPIPPSRLP  160

Query  840   -----RSQNFARLCR-----PPAGPSRAASTVVESNDTPIVPSEYRDSHVADSTAQVSGG  989
                  R QNFA   +       +  + A  T+V+S DTP+  +E  ++  A  TA  +G 
Sbjct  161   VPAAKRMQNFAHFSKQGNASSSSKAAAAQPTMVDSCDTPVATAELGETGRASVTAADAG-  219

Query  990   NLGPRggamsgteaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSET  1169
                         E+ G      ++TVTSSP   SG++   +K         DRK KG E 
Sbjct  220   ---------KAAESGGREAATCDLTVTSSPGGSSGSAEPVQKEV-------DRKRKGREA  263

Query  1170  DD-EGHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSERV*MQFC*Plhril*fflhl  1331
             ++ E  + D DF    AKK     TS+KRSRAAEVHNL                      
Sbjct  264   EESEFQSEDVDFESPEAKKHGRGSTSTKRSRAAEVHNL----------------------  301

Query  1332  llCYNQSNAETSRQDQ*EDESSAATYTAMQQVGQGFDFRRSN*VSKIAPVASAGICLF*V  1511
                     +E  R+D+  ++       A+Q++       R N   K + +  A   L   
Sbjct  302   --------SERRRRDRINEK-----MKALQEL-----IPRCNKSDKASMLDEAIEYL---  340

Query  1512  MRKTRS*YQMMMSLGHGCGMIPMMFPGIQQY  1604
               K+      MMS+G  CGM+PMMFPGIQQY
Sbjct  341   --KSLQLQVQMMSMG--CGMVPMMFPGIQQY  367


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  305   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  349



>ref|XP_009399053.1| PREDICTED: transcription factor PIF4-like [Musa acuminata subsp. 
malaccensis]
Length=535

 Score = 83.2 bits (204),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  358   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKTLQLQVQM  402


 Score = 41.6 bits (96),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 22/33 (67%), Gaps = 3/33 (9%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMGM  1634
             QMM     G GM  MMFP +QQY+  MG+G+GM
Sbjct  401   QMMW---MGSGMASMMFPCVQQYISGMGMGIGM  430


 Score = 34.3 bits (77),  Expect(3) = 2e-23, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A + TS +RSRAAEVHNLSER
Sbjct  337   ATRPTSKRRSRAAEVHNLSER  357



>ref|NP_001051465.1| Os03g0782500 [Oryza sativa Japonica Group]
 gb|ABF99196.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABF99198.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13379.1| Os03g0782500 [Oryza sativa Japonica Group]
 dbj|BAG97322.1| unnamed protein product [Oryza sativa Japonica Group]
Length=410

 Score = 86.7 bits (213),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  231   RRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQI  275


 Score = 40.0 bits (92),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  281   GMAPMMFPGAHQFMPPMAVGM  301


 Score = 32.0 bits (71),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             R+   S ++D    A  +   ++++  S +R+RAAEVHNLSER
Sbjct  188   REDSDSRSEDAECEATEETKSSSRRYGSKRRTRAAEVHNLSER  230



>gb|ABF99197.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=421

 Score = 87.0 bits (214),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  242   RRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQI  286


 Score = 40.4 bits (93),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  292   GMAPMMFPGAHQFMPPMAVGM  312


 Score = 31.6 bits (70),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             R+   S ++D    A  +   ++++  S +R+RAAEVHNLSER
Sbjct  199   REDSDSRSEDAECEATEETKSSSRRYGSKRRTRAAEVHNLSER  241



>ref|XP_002466767.1| hypothetical protein SORBIDRAFT_01g013843 [Sorghum bicolor]
 gb|EER93765.1| hypothetical protein SORBIDRAFT_01g013843 [Sorghum bicolor]
Length=535

 Score = 85.9 bits (211),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  339   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQM  383


 Score = 37.4 bits (85),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 21/31 (68%), Gaps = 1/31 (3%)
 Frame = +3

Query  1542  MMSLGHGCGMIP-MMFPGIQQYMPAMGIGMG  1631
             MM +G G    P +MFPG+ QY+  MG+GMG
Sbjct  383   MMWMGSGIAAPPAVMFPGVHQYLSRMGVGMG  413


 Score = 35.4 bits (80),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +3

Query  1215  KKQTSSKRSRAAEVHNLSER  1274
             +K T+++RSRAAEVHNLSER
Sbjct  319   QKMTTARRSRAAEVHNLSER  338



>gb|EEE60044.1| hypothetical protein OsJ_12829 [Oryza sativa Japonica Group]
Length=489

 Score = 86.7 bits (213),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  331   RRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQI  375


 Score = 40.0 bits (92),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  381   GMAPMMFPGAHQFMPPMAVGM  401


 Score = 32.0 bits (71),  Expect(3) = 3e-23, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             R+   S ++D    A  +   ++++  S +R+RAAEVHNLSER
Sbjct  288   REDSDSRSEDAECEATEETKSSSRRYGSKRRTRAAEVHNLSER  330



>gb|EEC76276.1| hypothetical protein OsI_13762 [Oryza sativa Indica Group]
Length=505

 Score = 86.7 bits (213),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  347   RRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQI  391


 Score = 40.0 bits (92),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  397   GMAPMMFPGAHQFMPPMAVGM  417


 Score = 31.6 bits (70),  Expect(3) = 4e-23, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             R+   S ++D    A  +   ++++  S +R+RAAEVHNLSER
Sbjct  304   REDSDSRSEDAECEATEETKSSSRRYGSKRRTRAAEVHNLSER  346



>ref|XP_008447346.1| PREDICTED: transcription factor PIF1-like isoform X2 [Cucumis 
melo]
Length=379

 Score = 84.3 bits (207),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQ  1491
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLK+LQLQVQ
Sbjct  322   RRRDRINEKMKALQELIPRCNKADKASMLDEAIEYLKTLQLQVQ  365


 Score = 53.9 bits (128),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 8/57 (14%)
 Frame = +3

Query  1128  ATAMDDRKAKGSETDDE---GHNADTDF-GYNAKKQ----TSSKRSRAAEVHNLSER  1274
              T+++DRK KG ETDD     ++ D +F   +AKKQ    TS+KRSRAAEVHNLSER
Sbjct  265   TTSLEDRKRKGKETDDSDYLCYSTDVEFESTDAKKQVRGSTSTKRSRAAEVHNLSER  321


 Score = 84.3 bits (207),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 66/115 (57%), Gaps = 14/115 (12%)
 Frame = +3

Query  339  HHCAVPEFEMDEDYSPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNHQR  518
            ++C VP+FE DED        P S++  S     S ++ E+MELLWQNGQVV+H+ N + 
Sbjct  2    NYC-VPDFETDEDSL-----LPSSSSVPSRSKTSSMLDGEVMELLWQNGQVVMHSPNQKS  55

Query  519  SVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
             +K         P     E + + +    +   +P+LFMQEDEM SWLHYPLVDD
Sbjct  56   RMKS--------PQSTTAEQITNRDTRRMSQQEEPQLFMQEDEMISWLHYPLVDD  102



>ref|XP_006575134.1| PREDICTED: transcription factor PIF1-like [Glycine max]
Length=131

 Score = 79.3 bits (194),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK  KAS+LDE IEYLKSLQLQVQ+
Sbjct  47    RRRDRINEKMKALQELIPRCNKSGKASMLDEPIEYLKSLQLQVQM  91


 Score = 40.4 bits (93),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 2/23 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             MMS+G  CG+IPM+FPGIQQYMP
Sbjct  91    MMSMG--CGIIPMIFPGIQQYMP  111


 Score = 38.1 bits (87),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 23/33 (70%), Gaps = 5/33 (15%)
 Frame = +3

Query  1191  DTDFGY-NAKKQ----TSSKRSRAAEVHNLSER  1274
             D DF    AKKQ    TS+KRS AAEVHNLSER
Sbjct  14    DVDFESPEAKKQVRGSTSTKRSHAAEVHNLSER  46



>dbj|BAJ95450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=387

 Score = 86.3 bits (212),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR+LQ+LIP CNK DKASILDEAIEYLKSLQ+QVQV
Sbjct  208   RRRDRINEKMRSLQELIPHCNKADKASILDEAIEYLKSLQMQVQV  252


 Score = 37.7 bits (86),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 6/48 (13%)
 Frame = +3

Query  1149  KAKGSETDDEGHNAD------TDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             K KG   DD    ++      T+   ++++  S +RSRAAEVHN SER
Sbjct  160   KRKGRGKDDSDSRSEDVECEATEETKSSRRHGSKRRSRAAEVHNQSER  207


 Score = 33.9 bits (76),  Expect(3) = 6e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  258   GMAPMMFPGSHQFMPPMAVGM  278



>dbj|BAJ89764.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86868.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=396

 Score = 86.3 bits (212),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR+LQ+LIP CNK DKASILDEAIEYLKSLQ+QVQV
Sbjct  217   RRRDRINEKMRSLQELIPHCNKADKASILDEAIEYLKSLQMQVQV  261


 Score = 37.4 bits (85),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 6/48 (13%)
 Frame = +3

Query  1149  KAKGSETDDEGHNAD------TDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             K KG   DD    ++      T+   ++++  S +RSRAAEVHN SER
Sbjct  169   KRKGRGKDDSDSRSEDVECEATEETKSSRRHGSKRRSRAAEVHNQSER  216


 Score = 33.9 bits (76),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  267   GMAPMMFPGSHQFMPPMAVGM  287



>ref|XP_010054152.1| PREDICTED: transcription factor PIF5 [Eucalyptus grandis]
 gb|KCW89799.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
 gb|KCW89800.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
Length=533

 Score = 82.4 bits (202),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRIN+KM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  348   RRRDRINKKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  392


 Score = 41.6 bits (96),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFPG+Q YM +M  GM M PP  P
Sbjct  396   GGGMAPMMFPGVQHYMSSM--GMTMCPPPMP  424


 Score = 33.5 bits (75),  Expect(3) = 7e-23, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A +  S++RSRAAEVHNLSER
Sbjct  327   ATRSGSTRRSRAAEVHNLSER  347


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPEL  629
            + E++ELLWQNGQVV+H+QNH++     H   + +P      + GS       S+     
Sbjct  26   DQELVELLWQNGQVVMHSQNHRKPSSNQH-ESSQLPKQDQPIMKGSG------SYGNSSN  78

Query  630  FMQEDEMASWLHYPLVD  680
             +Q+DE  SW+HYP+ D
Sbjct  79   LIQDDETVSWIHYPVED  95



>gb|KCW89798.1| hypothetical protein EUGRSUZ_A02043 [Eucalyptus grandis]
Length=568

 Score = 82.4 bits (202),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRIN+KM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  383   RRRDRINKKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  427


 Score = 41.6 bits (96),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFPG+Q YM +M  GM M PP  P
Sbjct  431   GGGMAPMMFPGVQHYMSSM--GMTMCPPPMP  459


 Score = 33.1 bits (74),  Expect(3) = 9e-23, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A +  S++RSRAAEVHNLSER
Sbjct  362   ATRSGSTRRSRAAEVHNLSER  382


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 44/77 (57%), Gaps = 7/77 (9%)
 Frame = +3

Query  450  EDEIMELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPEL  629
            + E++ELLWQNGQVV+H+QNH++     H   + +P      + GS       S+     
Sbjct  61   DQELVELLWQNGQVVMHSQNHRKPSSNQH-ESSQLPKQDQPIMKGSG------SYGNSSN  113

Query  630  FMQEDEMASWLHYPLVD  680
             +Q+DE  SW+HYP+ D
Sbjct  114  LIQDDETVSWIHYPVED  130



>gb|EMT29569.1| Transcription factor PIF5 [Aegilops tauschii]
Length=233

 Score = 85.5 bits (210),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR+LQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  53    RRRDRINEKMRSLQELIPHCNKADKASILDEAIEYLKSLQMQVQI  97


 Score = 37.7 bits (86),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/64 (33%), Positives = 33/64 (52%), Gaps = 13/64 (20%)
 Frame = +3

Query  1083  DGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHN  1262
             DG+G S ++ K   P   + D + + +E              ++++  S +RSRAAEVHN
Sbjct  2     DGNGRSAASHKK--PLVKLQDVECEATEETK-----------SSRRHGSKRRSRAAEVHN  48

Query  1263  LSER  1274
              SER
Sbjct  49    QSER  52


 Score = 33.9 bits (76),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMG  1631
             GM PMMFPG  Q+MP M +GM 
Sbjct  103   GMAPMMFPGSHQFMPPMAVGMN  124



>ref|XP_002883941.1| hypothetical protein ARALYDRAFT_319546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60200.1| hypothetical protein ARALYDRAFT_319546 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score = 85.5 bits (210),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+QV
Sbjct  304   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQV  348


 Score = 39.3 bits (90),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 2/65 (3%)
 Frame = +3

Query  1086  GSGASVSAEKSTAP-ATAMDDRKAKGSETDDEGHNADTDFGYNAK-KQTSSKRSRAAEVH  1259
             G+ +SV ++    P  T  DD+K K  E   E     ++    A+   TS+KRSRAAEVH
Sbjct  239   GTSSSVVSKSEIEPEKTNFDDKKRKEREATTEEAECRSEETKQARGSTTSTKRSRAAEVH  298

Query  1260  NLSER  1274
             NLSER
Sbjct  299   NLSER  303


 Score = 32.0 bits (71),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  1551  LGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             +  GCGM+PMM+PG+QQYMP M + MGMN P+ P
Sbjct  349   MSMGCGMMPMMYPGMQQYMPHMAMRMGMNQPLPP  382


 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 63/120 (53%), Gaps = 9/120 (8%)
 Frame = +3

Query  342  HCAVPEFEMDEDYSPLPMIappsaaglsggakksaM---EDEIMELLWQNGQVVVHTQN-  509
            H  VP+F+ D+DY  +      S+         + M   +D++MELLWQNGQVVV  Q  
Sbjct  2    HHFVPDFDTDDDY--VNTNNNNSSLNHLPRKSITTMGEDDDDLMELLWQNGQVVVQNQRL  59

Query  510  HQRSVKR--SHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
            H  + K+  S      +  P     + + +++   S  Q  LF+QEDEM SWLHYPL DD
Sbjct  60   HNNNTKKPSSSSFPTKLLQPPIPPSMDNHQQQQQPSSDQ-NLFIQEDEMTSWLHYPLRDD  118



>ref|XP_006651623.1| PREDICTED: transcription factor PIF5-like [Oryza brachyantha]
Length=350

 Score = 83.6 bits (205),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+
Sbjct  200   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQM  244


 Score = 37.4 bits (85),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query  1560  GCGMIP-MMFPGIQQYMPAMGIGMG  1631
             G GM P +MFPG+ QY+P MG+GMG
Sbjct  248   GSGMAPPVMFPGVHQYLPRMGVGMG  272


 Score = 35.8 bits (81),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 27/49 (55%), Gaps = 6/49 (12%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQ------TSSKRSRAAEVHNLSER  1274
             RK   +  D E  + D +    A  Q      T+++RSRAAEVHNLSER
Sbjct  151   RKRLDTTEDSESPSEDAESESAALAQKPPPKLTTARRSRAAEVHNLSER  199



>ref|XP_002458710.1| hypothetical protein SORBIDRAFT_03g038770 [Sorghum bicolor]
 gb|EES03830.1| hypothetical protein SORBIDRAFT_03g038770 [Sorghum bicolor]
Length=150

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 82/148 (55%), Gaps = 15/148 (10%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPT-------  2487
             MG   C VC+EA  KYKCPSC  PYCS+TCFKKHKE  C K  P  E + +P        
Sbjct  1     MGGGSCCVCKEAPPKYKCPSCRTPYCSVTCFKKHKEESCQKTSPQEEISKSPLQEEVTLN  60

Query  2486  --------PALHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSST  2331
                       +   K L V++PS V+  ++L S+A    I +ALR  ELQK+I  ID S 
Sbjct  61    TTCIAESPNTVGPTKALEVEDPSWVVDNNRLRSLAELKGIQDALRDPELQKMILKIDGSL  120

Query  2330  DAESDLDKAMQKEEFHILAQKILSTISP  2247
             + E +L+K M+ + F   A KIL  +SP
Sbjct  121   EPEKELEKLMEGQAFGQFADKILDIVSP  148



>ref|XP_006297599.1| hypothetical protein CARUB_v10013621mg [Capsella rubella]
 gb|EOA30497.1| hypothetical protein CARUB_v10013621mg [Capsella rubella]
Length=470

 Score = 84.7 bits (208),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  284   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  328


 Score = 36.2 bits (82),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 2/37 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             MMS+G  CGM+PMM+PG+QQYMP M +GMGMN P+ P
Sbjct  328   MMSMG--CGMMPMMYPGMQQYMPHMAMGMGMNQPLPP  362


 Score = 35.4 bits (80),  Expect(3) = 1e-22, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 34/63 (54%), Gaps = 0/63 (0%)
 Frame = +3

Query  1086  GSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNL  1265
             G+ AS  ++    P T  + ++ +   T++E      +        TS+KRSRAAEVHNL
Sbjct  221   GTSASAVSKSEIEPETTAERKRKEREATEEETECRSEETKQGRGSTTSTKRSRAAEVHNL  280

Query  1266  SER  1274
             SER
Sbjct  281   SER  283


 Score = 57.0 bits (136),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 41/79 (52%), Gaps = 12/79 (15%)
 Frame = +3

Query  462  MELLWQNGQVVVHTQNHQRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPE-----  626
            MELLW NGQVVVH Q       R H  +     P+            ++   QP+     
Sbjct  1    MELLWHNGQVVVHNQ-------RLHHNNNNTKKPSPSPSPTPKLLHPSSMQQQPQPSDQN  53

Query  627  LFMQEDEMASWLHYPLVDD  683
            LF+QEDEM+SWLHYPL +D
Sbjct  54   LFIQEDEMSSWLHYPLRED  72



>ref|XP_010228906.1| PREDICTED: transcription factor PIF5-like [Brachypodium distachyon]
Length=418

 Score = 85.1 bits (209),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR+LQ+LIP CNK DKASILDEAIEYLKSLQ+Q+Q+
Sbjct  246   RRRDRINEKMRSLQELIPHCNKADKASILDEAIEYLKSLQMQLQI  290


 Score = 38.1 bits (87),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  296   GMAPMMFPGAHQFMPPMAMGM  316


 Score = 32.7 bits (73),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 29/48 (60%), Gaps = 6/48 (13%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDF-----GYNAKKQTSSKRSRAAEVHNLSER  1274
             RK +G + D +  + D +F       ++++  S +RSRAAEVHN SER
Sbjct  199   RKGRGRD-DSDSRSEDAEFEATEETKSSRRHGSKRRSRAAEVHNQSER  245



>ref|XP_008805234.1| PREDICTED: zinc finger HIT domain-containing protein 3 isoform 
X2 [Phoenix dactylifera]
Length=113

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 71/111 (64%), Gaps = 4/111 (4%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             M P+ C VC+EAQSKYKCP C+ PYCSL CFKKHKE PC K  P  E  +   P    ++
Sbjct  1     MAPRTCEVCKEAQSKYKCPICLAPYCSLGCFKKHKENPCKKSVPEEELTVQKLP----ER  56

Query  2465  PLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDL  2313
                VDEP+ V+ + Q +S+  SSEI  AL+  EL+KLI  IDSS   E+ L
Sbjct  57    SYQVDEPNWVVDKEQFQSIVESSEILGALKDGELRKLIQKIDSSEKPENYL  107



>ref|NP_194608.3| transcription factor bHLH23 [Arabidopsis thaliana]
 sp|Q9SVU6.1|BH023_ARATH RecName: Full=Transcription factor bHLH23; AltName: Full=Basic 
helix-loop-helix protein 23; Short=AtbHLH23; Short=bHLH 23; 
AltName: Full=Transcription factor EN 107; AltName: Full=bHLH 
transcription factor bHLH023 [Arabidopsis thaliana]
 emb|CAA22973.1| putative protein [Arabidopsis thaliana]
 emb|CAB81467.1| putative protein [Arabidopsis thaliana]
 dbj|BAH30543.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85545.1| transcription factor bHLH23 [Arabidopsis thaliana]
Length=413

 Score = 64.7 bits (156),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RR +INE M+ALQ+L+PRC K D++S+LD+ IEY+KSLQ Q+Q+
Sbjct  288   RRRQKINEMMKALQELLPRCTKTDRSSMLDDVIEYVKSLQSQIQM  332


 Score = 55.8 bits (133),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/298 (28%), Positives = 119/298 (40%), Gaps = 57/298 (19%)
 Frame = +3

Query  450   EDEIMELLWQNGQVVVHTQNHQRS------VKRSHGGDAAIPVPAAREVVGSAEEEMATS  611
             ED+I+ELL ++ QVV  +Q    S      ++ S  GD         E  G   +     
Sbjct  24    EDDIVELLGKSSQVVTSSQTQTPSCDPPLILRGSGSGDG--------EGNGPLPQPPPPL  75

Query  612   HHQPELFMQEDEMASWLHYPLVDDspylsadllypssssaaaavappRDFRASApevrrp  791
             +HQ  LF+QEDEMASWLH P   D  Y        +S+   +         AS      P
Sbjct  76    YHQQSLFIQEDEMASWLHQPNRQDYLYSQLLYSGVASTHPQSL--------ASLEPPPPP  127

Query  792   paplppippsgrTDVL---RSQNFARLCRPPAGPSRAASTVVESNDTPI------VPSEY  944
              A            +L   R++NF  + R            V SN T +      +P+  
Sbjct  128   RAQYILAADRPTGHILAERRAENFMNISRQRGNIFLGGVEAVPSNSTLLSSATESIPA--  185

Query  945   RDSHVADSTAQVSGG--------NLGPRggamsgteaagastgaKEMTVTSSPDDGSGAS  1100
               +H  +S A V+GG         LGPRG A++            E   T S       +
Sbjct  186   --THGTESRATVTGGVSRTFAVPGLGPRGKAVAI-----------ETAGTQSWGLCKAET  232

Query  1101  VSAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
                ++  A  T + D + + +  +    N  T+    A+  TSSKRSRAA +H LSER
Sbjct  233   EPVQRQPATETDITDERKRKTREETNVENQGTE---EARDSTSSKRSRAAIMHKLSER  287


 Score = 35.0 bits (79),  Expect(3) = 2e-22, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 3/40 (8%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPG--IQQYMPAMGIGMGMNPPVAPY  1655
             M S+GH   + PMM+ G   QQYMP M +GM   P   P+
Sbjct  332   MFSMGH-VMIPPMMYAGNIQQQYMPHMAMGMNRPPAFIPF  370



>ref|XP_004981538.1| PREDICTED: transcription factor PIF4-like isoform X1 [Setaria 
italica]
 ref|XP_004981539.1| PREDICTED: transcription factor PIF4-like isoform X2 [Setaria 
italica]
 ref|XP_004981540.1| PREDICTED: transcription factor PIF4-like isoform X3 [Setaria 
italica]
Length=428

 Score = 84.3 bits (207),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDE IEYLKSLQ+QVQ+
Sbjct  243   RRRDRINEKMRALQELIPHCNKTDKASILDETIEYLKSLQMQVQI  287


 Score = 35.4 bits (80),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 17/43 (40%), Positives = 28/43 (65%), Gaps = 1/43 (2%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             R    S+++D    A T+   ++++  + +R+RAAEVHNLSER
Sbjct  201   RDDSDSQSEDAECEA-TEETKSSRRCGTKRRTRAAEVHNLSER  242


 Score = 35.4 bits (80),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 23/41 (56%), Gaps = 11/41 (27%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM---------GMN--PPVAPY  1655
             GM PMMFPG  Q+MP M +GM         G+N  P V PY
Sbjct  293   GMAPMMFPGAHQFMPPMALGMTSACIPAAQGLNQMPRVVPY  333



>ref|XP_008665523.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665524.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665525.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665526.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
 ref|XP_008665527.1| PREDICTED: transcription factor PIF5 isoform X1 [Zea mays]
Length=566

 Score = 84.3 bits (207),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDE IEYLKSLQ+QVQ+
Sbjct  378   RRRDRINEKMRALQELIPHCNKTDKASILDETIEYLKSLQMQVQI  422


 Score = 36.6 bits (83),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             GM PMMFPG+ Q++P M   +GMNP   P
Sbjct  428   GMAPMMFPGVHQFIPQM--ALGMNPGCIP  454


 Score = 34.3 bits (77),  Expect(3) = 3e-22, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 7/57 (12%)
 Frame = +3

Query  1125  PATAMDDRKAKGSETDDEGHNADTDFGYNAKKQT-------SSKRSRAAEVHNLSER  1274
             P+ ++  +K KG   DD    ++      A ++T       + +R+RAAEVHNLSER
Sbjct  321   PSDSVHVQKRKGRCRDDSDSPSEDAECEEASEETKPSRRYGTKRRTRAAEVHNLSER  377



>ref|XP_006386276.1| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 ref|XP_002302124.2| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 gb|ERP64073.1| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
 gb|EEE81397.2| hypothetical protein POPTR_0002s05630g [Populus trichocarpa]
Length=530

 Score = 85.1 bits (209),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  342   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  386


 Score = 40.8 bits (94),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 34/60 (57%), Gaps = 3/60 (5%)
 Frame = +3

Query  1104  SAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYN---AKKQTSSKRSRAAEVHNLSER  1274
             + ++S  P+     +     E++ +  +A+ D       AK+  S++RSRAAEVHNLSER
Sbjct  282   TCKQSAVPSRGQKRKTMDAEESECQSEDAELDSAVANKPAKRSGSTRRSRAAEVHNLSER  341


 Score = 29.3 bits (64),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 14/16 (88%), Gaps = 0/16 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYM  1607
             G G++P+MFPG+Q +M
Sbjct  390   GSGIVPVMFPGVQHFM  405



>tpg|DAA51720.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=523

 Score = 84.0 bits (206),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDE IEYLKSLQ+QVQ+
Sbjct  335   RRRDRINEKMRALQELIPHCNKTDKASILDETIEYLKSLQMQVQI  379


 Score = 36.2 bits (82),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             GM PMMFPG+ Q++P M   +GMNP   P
Sbjct  385   GMAPMMFPGVHQFIPQM--ALGMNPGCIP  411


 Score = 34.7 bits (78),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 7/57 (12%)
 Frame = +3

Query  1125  PATAMDDRKAKGSETDDEGHNADTDFGYNAKKQT-------SSKRSRAAEVHNLSER  1274
             P+ ++  +K KG   DD    ++      A ++T       + +R+RAAEVHNLSER
Sbjct  278   PSDSVHVQKRKGRCRDDSDSPSEDAECEEASEETKPSRRYGTKRRTRAAEVHNLSER  334



>ref|XP_008665528.1| PREDICTED: transcription factor PIF5 isoform X2 [Zea mays]
Length=537

 Score = 84.7 bits (208),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDE IEYLKSLQ+QVQ+
Sbjct  349   RRRDRINEKMRALQELIPHCNKTDKASILDETIEYLKSLQMQVQI  393


 Score = 36.2 bits (82),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (69%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             GM PMMFPG+ Q++P M   +GMNP   P
Sbjct  399   GMAPMMFPGVHQFIPQM--ALGMNPGCIP  425


 Score = 33.9 bits (76),  Expect(3) = 4e-22, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 7/57 (12%)
 Frame = +3

Query  1125  PATAMDDRKAKGSETDDEGHNADTDFGYNAKKQT-------SSKRSRAAEVHNLSER  1274
             P+ ++  +K KG   DD    ++      A ++T       + +R+RAAEVHNLSER
Sbjct  292   PSDSVHVQKRKGRCRDDSDSPSEDAECEEASEETKPSRRYGTKRRTRAAEVHNLSER  348



>gb|KEH42412.1| HIT zinc finger protein [Medicago truncatula]
Length=130

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 18/124 (15%)
 Frame = -2

Query  2570  CSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDKP----------------LYVDEPSQ  2439
             CSL CFKKHKE+PC  P PS  E        HV+KP                + VD+  +
Sbjct  9     CSLACFKKHKELPCVNPTPS--ETKTADLESHVEKPSVVDNAVVEAPVEKPLVVVDKTGE  66

Query  2438  VLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILS  2259
             VL Q QLE++ASSSEI +AL  + LQ+LIC ID S++AE++LDKAM  E F +   KILS
Sbjct  67    VLQQFQLEAIASSSEIRDALNDKALQELICQIDCSSNAENELDKAMADEAFRLFTNKILS  126

Query  2258  TISP  2247
             TI+P
Sbjct  127   TINP  130



>ref|XP_007048912.1| Phytochrome interacting factor 3-like 6, putative isoform 5 [Theobroma 
cacao]
 gb|EOX93069.1| Phytochrome interacting factor 3-like 6, putative isoform 5 [Theobroma 
cacao]
Length=397

 Score = 85.9 bits (211),  Expect(3) = 8e-22, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEY+KSLQLQ+QV
Sbjct  209   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYMKSLQLQLQV  253


 Score = 43.1 bits (100),  Expect(3) = 8e-22, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             Q+ + +  G GM PMMFPGIQ YM  MGIGMG
Sbjct  250   QLQVVMWMGSGMAPMMFPGIQHYMSRMGIGMG  281


 Score = 25.0 bits (53),  Expect(3) = 8e-22, Method: Compositional matrix adjust.
 Identities = 10/10 (100%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
 Frame = +3

Query  1245  AAEVHNLSER  1274
             AAEVHNLSER
Sbjct  199   AAEVHNLSER  208



>ref|XP_002991572.1| hypothetical protein SELMODRAFT_133802 [Selaginella moellendorffii]
 gb|EFJ07326.1| hypothetical protein SELMODRAFT_133802 [Selaginella moellendorffii]
Length=145

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 77/134 (57%), Gaps = 11/134 (8%)
 Frame = -2

Query  2633  KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK---PQPSSEENLAPTPALHVDKP  2463
             +CG+C  A SKYKCP C++PYCSL CFK HK  PC K    +   +  L   P     + 
Sbjct  14    QCGICSGAVSKYKCPGCLVPYCSLQCFKDHKAAPCTKVAAAEEEEQAQLVQPP-----RD  68

Query  2462  LYVDEPSQV---LTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKE  2292
                 + SQV   L + QLE+VA+S EI   LR+EELQ ++  ID+S  AE DLD AM   
Sbjct  69    FENGDESQVATRLRRQQLEAVAASEEIRAMLRNEELQAIVSKIDASATAEKDLDTAMNLP  128

Query  2291  EFHILAQKILSTIS  2250
             +F   A KIL  I+
Sbjct  129   DFKGFADKILEVIA  142



>ref|XP_007048908.1| Phytochrome interacting factor 3-like 6, putative isoform 1 [Theobroma 
cacao]
 gb|EOX93065.1| Phytochrome interacting factor 3-like 6, putative isoform 1 [Theobroma 
cacao]
Length=524

 Score = 85.1 bits (209),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEY+KSLQLQ+QV
Sbjct  337   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYMKSLQLQLQV  381


 Score = 43.5 bits (101),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPGIQ YM  MGIGMG
Sbjct  385   GSGMAPMMFPGIQHYMSRMGIGMG  408


 Score = 25.0 bits (53),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 10/10 (100%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
 Frame = +3

Query  1245  AAEVHNLSER  1274
             AAEVHNLSER
Sbjct  327   AAEVHNLSER  336



>gb|KHG22328.1| Transcription factor PIF5 -like protein [Gossypium arboreum]
Length=322

 Score = 83.6 bits (205),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQ Q+QV
Sbjct  154   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQSQLQV  198


 Score = 41.6 bits (96),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFPGIQ YM  M   MG  PP  P
Sbjct  202   GNGMAPMMFPGIQHYMSPM--AMGTAPPTMP  230


 Score = 28.1 bits (61),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 35/68 (51%), Gaps = 5/68 (7%)
 Frame = +3

Query  1080  DDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYN---AKKQTSSKRSRAA  1250
             DD +G  V  EK T+       ++  G   +D  +   ++F  +    +  +  +RSRAA
Sbjct  88    DDYNGGQVENEKGTSVGVTSSQKRKNGDGRED--YECQSEFAEDKPVRRSGSYRRRSRAA  145

Query  1251  EVHNLSER  1274
             EVHNLSER
Sbjct  146   EVHNLSER  153



>gb|EMS55398.1| Transcription factor PIF5 [Triticum urartu]
Length=356

 Score = 84.7 bits (208),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR+LQ+LIP CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  177   RRRDRINEKMRSLQELIPHCNKADKASILDEAIEYLKSLQMQVQI  221


 Score = 34.3 bits (77),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 7/50 (14%)
 Frame = +3

Query  1146  RKAKGSETDDEGHNADTDFGYNAKKQTSS-------KRSRAAEVHNLSER  1274
             R  +  E   E   A  D    A ++T S       +RSRAAEVHN SER
Sbjct  127   RHGRQWEIGGESQEASRDVECEATEETKSSRRHGSKRRSRAAEVHNQSER  176


 Score = 33.9 bits (76),  Expect(3) = 1e-21, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  227   GMAPMMFPGSHQFMPPMAVGM  247



>ref|XP_007048909.1| Phytochrome interacting factor 3-like 6, putative isoform 2 [Theobroma 
cacao]
 gb|EOX93066.1| Phytochrome interacting factor 3-like 6, putative isoform 2 [Theobroma 
cacao]
Length=527

 Score = 85.1 bits (209),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEY+KSLQLQ+QV
Sbjct  337   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYMKSLQLQLQV  381


 Score = 43.1 bits (100),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPGIQ YM  MGIGMG
Sbjct  388   GSGMAPMMFPGIQHYMSRMGIGMG  411


 Score = 25.0 bits (53),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/10 (100%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
 Frame = +3

Query  1245  AAEVHNLSER  1274
             AAEVHNLSER
Sbjct  327   AAEVHNLSER  336



>ref|XP_002889756.1| hypothetical protein ARALYDRAFT_471048 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66015.1| hypothetical protein ARALYDRAFT_471048 [Arabidopsis lyrata subsp. 
lyrata]
Length=522

 Score = 86.7 bits (213),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  352   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQI  396


 Score = 34.7 bits (78),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 1/32 (3%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQQYMPAMGIGMGM  1634
             +MS+  G  M P+MFP G+  Y  AM +GMGM
Sbjct  396   IMSMASGYYMPPVMFPPGMGHYPAAMAMGMGM  427


 Score = 31.6 bits (70),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  1230  SKRSRAAEVHNLSER  1274
             SKRSR+AEVHNLSER
Sbjct  337   SKRSRSAEVHNLSER  351



>ref|XP_009137809.1| PREDICTED: uncharacterized protein LOC103861854 isoform X1 [Brassica 
rapa]
Length=201

 Score =   104 bits (260),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 96/199 (48%), Gaps = 68/199 (34%)
 Frame = -2

Query  2645  MGPK---KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPA--  2481
             M P+    CG+CE   SKYKCP C++PYCS+ CFKKHKE+PC KP  S++E  A +PA  
Sbjct  1     MSPRATQTCGICERVVSKYKCPCCLVPYCSVGCFKKHKELPCVKPS-STDEKPATSPAKE  59

Query  2480  -----------------------------LHVDKPLYVDEPSQVLTQSQ-----------  2421
                                          + V  P+  +E   V+ ++Q           
Sbjct  60    VPVETTDVVEKTESKAVGNSDASPTKEAQMAVAIPVNAEEAKHVVDKTQLEAIGASATKE  119

Query  2420  ----------------------LESVASSSEICEALRSEELQKLICNIDSSTDAESDLDK  2307
                                   LE++ASSSEI EAL+ E LQKLI  IDSS++   +LD+
Sbjct  120   VPVARPIKITAEEAKYVVDKTQLEAIASSSEIREALKDESLQKLITKIDSSSNPLKELDE  179

Query  2306  AMQKEEFHILAQKILSTIS  2250
             AM +E F +L  KILS +S
Sbjct  180   AMGEEAFRMLKDKILSNLS  198



>gb|KEH33641.1| transcription factor [Medicago truncatula]
Length=511

 Score = 76.6 bits (187),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQQLIP  +K DKAS+L+EAIEYLKSLQLQ+QV
Sbjct  326   RRRDRINEKMKALQQLIPHSSKTDKASMLEEAIEYLKSLQLQLQV  370


 Score = 40.4 bits (93),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGM  1628
             G GM PMM PG Q YM  MG+GM
Sbjct  374   GSGMTPMMLPGYQHYMSQMGMGM  396


 Score = 36.2 bits (82),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 6/60 (10%)
 Frame = +3

Query  1113  KSTAPATAMDDRKAKGSETDDEGHNA-DTDFGYNAKKQTS-----SKRSRAAEVHNLSER  1274
             K+ + +T   D+K K  + +D    + DT+     +K+TS     ++R+RAAEVHNLSER
Sbjct  266   KTCSLSTRSHDKKRKVMDVEDSVEQSEDTELKSGVRKKTSQRSGSARRNRAAEVHNLSER  325



>ref|XP_007048910.1| Phytochrome interacting factor 3-like 6, putative isoform 3 [Theobroma 
cacao]
 gb|EOX93067.1| Phytochrome interacting factor 3-like 6, putative isoform 3 [Theobroma 
cacao]
Length=517

 Score = 84.0 bits (206),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEY+KSLQLQ+QV
Sbjct  337   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYMKSLQLQLQV  381


 Score = 43.5 bits (101),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPGIQ YM  MGIGMG
Sbjct  388   GSGMAPMMFPGIQHYMSRMGIGMG  411


 Score = 25.0 bits (53),  Expect(3) = 2e-21, Method: Compositional matrix adjust.
 Identities = 10/10 (100%), Positives = 10/10 (100%), Gaps = 0/10 (0%)
 Frame = +3

Query  1245  AAEVHNLSER  1274
             AAEVHNLSER
Sbjct  327   AAEVHNLSER  336



>ref|XP_003545154.1| PREDICTED: transcription factor PIF4-like isoform X1 [Glycine 
max]
 ref|XP_006595762.1| PREDICTED: transcription factor PIF4-like isoform X2 [Glycine 
max]
Length=562

 Score = 77.4 bits (189),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR LQQLIP  NK DKAS+L+EAIEYLKSLQ Q+QV
Sbjct  371   RRRDRINEKMRTLQQLIPNSNKTDKASMLEEAIEYLKSLQFQLQV  415


 Score = 41.2 bits (95),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM P+MFPGIQ YM  MG+GMG
Sbjct  419   GSGMTPVMFPGIQHYMSQMGMGMG  442


 Score = 33.1 bits (74),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query  1203  GYNAKKQT-SSKRSRAAEVHNLSER  1274
             G  A ++T SSKR+RAAEVHN SER
Sbjct  346   GNKASQRTGSSKRNRAAEVHNQSER  370



>ref|XP_009376949.1| PREDICTED: transcription factor PIF4 [Pyrus x bretschneideri]
Length=541

 Score = 80.5 bits (197),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP+ NK DKAS+LDEAIEYLKSLQ+Q+QV
Sbjct  357   RRRDRINEKMRALQELIPQSNKTDKASMLDEAIEYLKSLQMQLQV  401


 Score = 39.3 bits (90),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 4/31 (13%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMM+PG+Q Y+  MG+G    PP  P
Sbjct  405   GSGMAPMMYPGVQHYISQMGMG----PPALP  431


 Score = 32.0 bits (71),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  1227  SSKRSRAAEVHNLSER  1274
             S++RSRAAEVHNLSER
Sbjct  341   STRRSRAAEVHNLSER  356



>ref|XP_011087568.1| PREDICTED: transcription factor PIF3 isoform X2 [Sesamum indicum]
Length=710

 Score = 85.9 bits (211),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  454   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  498


 Score = 34.7 bits (78),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             + T SKRSRAAEVHNLSER
Sbjct  435   RGTGSKRSRAAEVHNLSER  453


 Score = 31.2 bits (69),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQQYMPA  1613
             +MS+G G  M PMMFP G+Q   PA
Sbjct  498   IMSMGAGLCMPPMMFPTGMQHVHPA  522



>ref|XP_011087566.1| PREDICTED: transcription factor PIF3 isoform X1 [Sesamum indicum]
 ref|XP_011087567.1| PREDICTED: transcription factor PIF3 isoform X1 [Sesamum indicum]
Length=743

 Score = 85.9 bits (211),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  454   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  498


 Score = 34.7 bits (78),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 17/19 (89%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             + T SKRSRAAEVHNLSER
Sbjct  435   RGTGSKRSRAAEVHNLSER  453


 Score = 31.2 bits (69),  Expect(3) = 3e-21, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 1/25 (4%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQQYMPA  1613
             +MS+G G  M PMMFP G+Q   PA
Sbjct  498   IMSMGAGLCMPPMMFPTGMQHVHPA  522



>ref|XP_002971725.1| hypothetical protein SELMODRAFT_95943 [Selaginella moellendorffii]
 gb|EFJ27474.1| hypothetical protein SELMODRAFT_95943 [Selaginella moellendorffii]
Length=142

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 77/134 (57%), Gaps = 11/134 (8%)
 Frame = -2

Query  2633  KCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK---PQPSSEENLAPTPALHVDKP  2463
             +CG+C  A SKYKCP C++PYCSL CFK HK  PC K    +   +  L   P     + 
Sbjct  11    QCGICSGAVSKYKCPGCLVPYCSLQCFKDHKAAPCTKVAAAEEEEQAQLVQPP-----RD  65

Query  2462  LYVDEPSQV---LTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESDLDKAMQKE  2292
                 + SQ+   L + QLE+VA+S EI   LR+EELQ ++  ID+S  AE DLD AM   
Sbjct  66    FENGDESQMATRLRRQQLEAVAASEEIRAMLRNEELQAIVSKIDASATAEKDLDTAMNLP  125

Query  2291  EFHILAQKILSTIS  2250
             +F   A KIL  I+
Sbjct  126   DFKGFADKILEVIA  139



>dbj|BAJ93366.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=488

 Score = 84.0 bits (206),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQ+QVQ+
Sbjct  326   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKTLQMQVQM  370


 Score = 34.7 bits (78),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +3

Query  1215  KKQTSSKRSRAAEVHNLSER  1274
             +K T+++RSRAAEVHNLSER
Sbjct  306   QKLTTARRSRAAEVHNLSER  325


 Score = 33.1 bits (74),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (59%), Gaps = 2/39 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIP-MMFPGIQQYMPAMG-IGMGMNPPVAP  1652
             MM +G G    P +MFPG+ QY+P MG   M   P +AP
Sbjct  370   MMWMGGGMAAPPAVMFPGMHQYLPQMGPASMARMPFMAP  408



>ref|XP_004955437.1| PREDICTED: transcription factor PIF4-like [Setaria italica]
Length=390

 Score = 84.3 bits (207),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+L+P C+K DKASILDEAIEYLKSLQ+QVQ+
Sbjct  207   RRRDRINEKMRALQELVPHCSKTDKASILDEAIEYLKSLQMQVQI  251


 Score = 34.3 bits (77),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +3

Query  1077  PDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADT-DFGYNAKKQTSSKRSRAAE  1253
             P  G+GAS S+  ++    A+  R     ++ DE  + DT D    +++  S +R+RAAE
Sbjct  143   PGAGAGASTSSGWNS---NALLKRSRDEFDSRDEDADFDTVDETPPSRRPASKRRTRAAE  199

Query  1254  VHNLSER  1274
             VHN+SER
Sbjct  200   VHNMSER  206


 Score = 32.7 bits (73),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMP--AMGIGMGMNPPVAPY  1655
             GM PMM PG  Q MP  +MG+     PP A +
Sbjct  257   GMAPMMLPGAHQLMPPISMGLSSACMPPAAQF  288



>gb|KHN12001.1| Transcription factor PIF4 [Glycine soja]
Length=584

 Score = 77.0 bits (188),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR LQQLIP  NK DKAS+L+EAIEYLKSLQ Q+QV
Sbjct  371   RRRDRINEKMRTLQQLIPNSNKTDKASMLEEAIEYLKSLQFQLQV  415


 Score = 40.8 bits (94),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM P+MFPGIQ YM  MG+GMG
Sbjct  419   GSGMTPVMFPGIQHYMSQMGMGMG  442


 Score = 33.1 bits (74),  Expect(3) = 4e-21, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +3

Query  1203  GYNAKKQT-SSKRSRAAEVHNLSER  1274
             G  A ++T SSKR+RAAEVHN SER
Sbjct  346   GNKASQRTGSSKRNRAAEVHNQSER  370



>ref|XP_009602219.1| PREDICTED: transcription factor PIF4 [Nicotiana tomentosiformis]
Length=481

 Score = 73.9 bits (180),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P   K DKAS+LDEAIEYLKSLQ+Q+Q+
Sbjct  308   RRRDRINEKMKALQELLPHSTKTDKASMLDEAIEYLKSLQMQLQM  352


 Score = 41.6 bits (96),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM  MMFPG+Q YM  MG+GMG  PP  P
Sbjct  356   GSGMASMMFPGVQHYMSRMGMGMG--PPTVP  384


 Score = 35.8 bits (81),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 6/42 (14%)
 Frame = +3

Query  1149  KAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             ++K  E +  G N       +A+K  +++RSRAAEVHNLSER
Sbjct  272   QSKAGELESAGGNK------SAQKSGTARRSRAAEVHNLSER  307



>dbj|BAJ90328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=209

 Score = 84.0 bits (206),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQ+QVQ+
Sbjct  47    RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKTLQMQVQM  91


 Score = 34.7 bits (78),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +3

Query  1215  KKQTSSKRSRAAEVHNLSER  1274
             +K T+++RSRAAEVHNLSER
Sbjct  27    QKLTTARRSRAAEVHNLSER  46


 Score = 32.7 bits (73),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 14/27 (52%), Positives = 18/27 (67%), Gaps = 1/27 (4%)
 Frame = +3

Query  1542  MMSLGHGCGMIP-MMFPGIQQYMPAMG  1619
             MM +G G    P +MFPG+ QY+P MG
Sbjct  91    MMWMGGGMAAPPAVMFPGMHQYLPQMG  117



>ref|XP_010070104.1| PREDICTED: transcription factor PIF3-like isoform X2 [Eucalyptus 
grandis]
Length=705

 Score = 85.5 bits (210),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  463   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQM  507


 Score = 35.0 bits (79),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 31/53 (58%), Gaps = 3/53 (6%)
 Frame = +3

Query  1125  PATAMDDRKAKGSETDDEGHNADTDFGYNAKK---QTSSKRSRAAEVHNLSER  1274
             P + +  +  +  E+D    + + D  +  K+   Q +SKRSRAAEVHNLSER
Sbjct  410   PKSNLKRKSLETDESDGPSEDVEEDPTHEKKQNSAQGTSKRSRAAEVHNLSER  462


 Score = 30.8 bits (68),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 20/35 (57%), Gaps = 5/35 (14%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GI----QQYMPAMGIGMG  1631
             MMS+G G  + PMM P G+      + P  GIGMG
Sbjct  507   MMSMGAGLYIPPMMVPTGMHPAQMPHFPPFGIGMG  541



>ref|XP_006575634.1| PREDICTED: transcription factor PIF4-like [Glycine max]
Length=562

 Score = 77.4 bits (189),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR LQQLIP  NK DKAS+L+EAIEYLKSLQ Q+QV
Sbjct  371   RRRDRINEKMRTLQQLIPNSNKTDKASMLEEAIEYLKSLQFQLQV  415


 Score = 44.3 bits (103),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM P+MFPGIQ YM  MG+GMG
Sbjct  419   GGGMTPVMFPGIQHYMSQMGMGMG  442


 Score = 29.6 bits (65),  Expect(3) = 5e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 4/36 (11%)
 Frame = +3

Query  1170  DDEGHNADTDFGYNAKKQT-SSKRSRAAEVHNLSER  1274
             D E  +AD   G  A ++T SS+R+RAAEVHN SER
Sbjct  338   DTELKSAD---GNKASQRTRSSRRNRAAEVHNQSER  370



>ref|XP_006357888.1| PREDICTED: transcription factor PIF4-like [Solanum tuberosum]
Length=517

 Score = 73.9 bits (180),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P   K DKAS+LDEAIEYLKSLQ+Q+Q+
Sbjct  342   RRRDRINEKMKALQELLPHSTKTDKASMLDEAIEYLKSLQMQLQM  386


 Score = 43.5 bits (101),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM  MMFPG+Q YM  MG+GMG  PP  P
Sbjct  390   GSGMASMMFPGVQHYMSRMGMGMG--PPSVP  418


 Score = 33.5 bits (75),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A+K  +++RSRAAEVHNLSER
Sbjct  321   AQKSGTARRSRAAEVHNLSER  341



>ref|XP_002466350.1| hypothetical protein SORBIDRAFT_01g006190 [Sorghum bicolor]
 gb|EER93348.1| hypothetical protein SORBIDRAFT_01g006190 [Sorghum bicolor]
Length=424

 Score = 84.7 bits (208),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKASILDE IEYLKSLQ+QVQ+
Sbjct  241   RRRDRINEKMRALQELIPHCNKTDKASILDETIEYLKSLQMQVQI  285


 Score = 34.3 bits (77),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 16/21 (76%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             GM PMMFPG  Q+MP M +GM
Sbjct  291   GMAPMMFPGAHQFMPPMALGM  311


 Score = 31.6 bits (70),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +++    +R+RAAEVHNLSER
Sbjct  220   SRRHGPKRRTRAAEVHNLSER  240



>dbj|BAC19953.1| transcription factor BHLH9-like protein [Oryza sativa Japonica 
Group]
 dbj|BAC21408.1| transcription factor BHLH9-like protein [Oryza sativa Japonica 
Group]
Length=417

 Score = 84.0 bits (206),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEK+RALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  239   RRRDRINEKLRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  283


 Score = 33.5 bits (75),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +K+  + +R+RAAEVHNLSER
Sbjct  218   SKRPAAKRRTRAAEVHNLSER  238


 Score = 33.5 bits (75),  Expect(3) = 6e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             G++PMMFPG  Q MP MG+G+
Sbjct  289   GIVPMMFPGTHQLMPPMGMGL  309



>gb|KHN38358.1| Transcription factor PIF5 [Glycine soja]
Length=558

 Score = 77.0 bits (188),  Expect(3) = 7e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMR LQQLIP  NK DKAS+L+EAIEYLKSLQ Q+QV
Sbjct  371   RRRDRINEKMRTLQQLIPNSNKTDKASMLEEAIEYLKSLQFQLQV  415


 Score = 43.9 bits (102),  Expect(3) = 7e-21, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM P+MFPGIQ YM  MG+GMG
Sbjct  419   GGGMTPVMFPGIQHYMSQMGMGMG  442


 Score = 29.6 bits (65),  Expect(3) = 7e-21, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 4/36 (11%)
 Frame = +3

Query  1170  DDEGHNADTDFGYNAKKQT-SSKRSRAAEVHNLSER  1274
             D E  +AD   G  A ++T SS+R+RAAEVHN SER
Sbjct  338   DTELKSAD---GNKASQRTRSSRRNRAAEVHNQSER  370



>gb|EMT27650.1| Transcription factor PIF3 [Aegilops tauschii]
Length=321

 Score = 85.9 bits (211),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQ+QVQ+
Sbjct  152   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKTLQMQVQM  196


 Score = 34.7 bits (78),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 19/20 (95%), Gaps = 0/20 (0%)
 Frame = +3

Query  1215  KKQTSSKRSRAAEVHNLSER  1274
             +K T+++RSRAAEVHNLSER
Sbjct  132   QKLTTARRSRAAEVHNLSER  151


 Score = 30.0 bits (66),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 2/28 (7%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQ--QYMPAMG  1619
             MM +G G     +MFPG+Q  QY+P MG
Sbjct  196   MMWMGSGMAPPAVMFPGMQMHQYLPQMG  223



>ref|NP_001058876.2| Os07g0143200 [Oryza sativa Japonica Group]
 dbj|BAF20790.2| Os07g0143200 [Oryza sativa Japonica Group]
Length=447

 Score = 83.6 bits (205),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEK+RALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  240   RRRDRINEKLRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  284


 Score = 33.9 bits (76),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMG  1631
             G++PMMFPG  Q MP MG+G+ 
Sbjct  290   GIVPMMFPGTHQLMPPMGMGLN  311


 Score = 33.5 bits (75),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +K+  + +R+RAAEVHNLSER
Sbjct  219   SKRPAAKRRTRAAEVHNLSER  239



>gb|EEE66551.1| hypothetical protein OsJ_23063 [Oryza sativa Japonica Group]
Length=517

 Score = 83.6 bits (205),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             ++RRDRINEK+RALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  338   RRRRDRINEKLRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  383


 Score = 34.3 bits (77),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             G++PMMFPG  Q MP MG+G+
Sbjct  389   GIVPMMFPGTHQLMPPMGMGL  409


 Score = 32.7 bits (73),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +K+  + +R+RAAEVHNLSER
Sbjct  318   SKRPAAKRRTRAAEVHNLSER  338



>gb|AEV57494.1| rice phytochrome-interacting factor 4 [Oryza sativa Japonica 
Group]
Length=414

 Score = 83.2 bits (204),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEK+RALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  236   RRRDRINEKLRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  280


 Score = 33.9 bits (76),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGM  1628
             G++PMMFPG  Q MP MG+G+
Sbjct  286   GIVPMMFPGTHQLMPPMGMGL  306


 Score = 33.5 bits (75),  Expect(3) = 8e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +K+  + +R+RAAEVHNLSER
Sbjct  215   SKRPAAKRRTRAAEVHNLSER  235



>gb|EEC81506.1| hypothetical protein OsI_24867 [Oryza sativa Indica Group]
Length=593

 Score = 83.6 bits (205),  Expect(3) = 9e-21, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             ++RRDRINEK+RALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  414   RRRRDRINEKLRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  459


 Score = 34.3 bits (77),  Expect(3) = 9e-21, Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G++PMMFPG  Q MP M  GMG+N    P
Sbjct  465   GIVPMMFPGTHQLMPPM--GMGLNTACMP  491


 Score = 32.7 bits (73),  Expect(3) = 9e-21, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +K+  + +R+RAAEVHNLSER
Sbjct  394   SKRPAAKRRTRAAEVHNLSER  414



>ref|XP_009407100.1| PREDICTED: transcription factor PIF1-like [Musa acuminata subsp. 
malaccensis]
Length=415

 Score = 84.0 bits (206),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  264   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQM  308


 Score = 33.1 bits (74),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A+   S++RSRAAEVHNLSER
Sbjct  243   AQGSISTRRSRAAEVHNLSER  263


 Score = 33.1 bits (74),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 3/32 (9%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             QMM   G    M  MM PG QQ MP M +G+G
Sbjct  307   QMMWMGGR---MAQMMLPGAQQSMPGMAVGVG  335



>ref|XP_010228425.1| PREDICTED: transcription factor PIF4-like isoform X1 [Brachypodium 
distachyon]
Length=379

 Score = 85.1 bits (209),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P CNK DKASILDEAIEYLKSLQLQVQ+
Sbjct  197   RRRDRINEKMKALQELVPHCNKSDKASILDEAIEYLKSLQLQVQI  241


 Score = 33.5 bits (75),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 18/29 (62%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             GM PMMFPG  Q MP M   MG+NP   P
Sbjct  247   GMAPMMFPGAHQLMPQM--AMGLNPACMP  273


 Score = 31.6 bits (70),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = +3

Query  1161  SETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             S  +D       D    +++    +R+RAAEVHN SER
Sbjct  159   SRCEDADDCEAVDETRTSRRPAGKRRARAAEVHNQSER  196



>ref|XP_010228426.1| PREDICTED: transcription factor PIF4-like isoform X2 [Brachypodium 
distachyon]
Length=377

 Score = 84.7 bits (208),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P CNK DKASILDEAIEYLKSLQLQVQ+
Sbjct  197   RRRDRINEKMKALQELVPHCNKSDKASILDEAIEYLKSLQLQVQI  241


 Score = 33.5 bits (75),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 18/29 (62%), Gaps = 2/29 (7%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             GM PMMFPG  Q MP M   MG+NP   P
Sbjct  247   GMAPMMFPGAHQLMPQM--AMGLNPACMP  273


 Score = 31.6 bits (70),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 20/38 (53%), Gaps = 0/38 (0%)
 Frame = +3

Query  1161  SETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             S  +D       D    +++    +R+RAAEVHN SER
Sbjct  159   SRCEDADDCEAVDETRTSRRPAGKRRARAAEVHNQSER  196



>ref|XP_010069677.1| PREDICTED: transcription factor PIF1 [Eucalyptus grandis]
Length=431

 Score = 75.5 bits (184),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 45/54 (83%), Gaps = 2/54 (4%)
 Frame = +1

Query  1339  ATINQMQKRR--DRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             A ++ +  RR  DRI+ KM+ALQ+LIP+C K DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  257   ANVHNLSGRRRGDRISRKMKALQELIPQCTKADKASLLDEAIEYLKSLQLQVQM  310


 Score = 43.9 bits (102),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 6/42 (14%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIG----MGMNPPVAPY  1655
             MMS+G  C M+P++FPG+Q YMP M +G    +GMNPP   Y
Sbjct  310   MMSMG--CSMVPVVFPGVQAYMPCMNMGTATNVGMNPPTMLY  349


 Score = 30.8 bits (68),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 43/87 (49%), Gaps = 13/87 (15%)
 Frame = +3

Query  1053  KEMTVTSSPDDGS---GASVSAEKSTAPATAM--DDRKAKGSETDD-EGHNADTDFGY--  1208
             ++ T+ +SP  GS   G    A    AP   M  + RK +G +  D E  + + D  +  
Sbjct  179   RDETMVTSPPVGSATTGMGRLAPAGAAPQVGMQREKRKREGRDAGDGEWLSDEKDVRFES  238

Query  1209  -NAK----KQTSSKRSRAAEVHNLSER  1274
              +AK    K T +KRSR A VHNLS R
Sbjct  239   GDAKERGAKSTPAKRSRCANVHNLSGR  265



>emb|CDP15171.1| unnamed protein product [Coffea canephora]
Length=717

 Score = 86.3 bits (212),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQV
Sbjct  455   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQV  499


 Score = 33.9 bits (76),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A+  + SKRSRAAEVHNLSER
Sbjct  434   ARGVSGSKRSRAAEVHNLSER  454


 Score = 30.0 bits (66),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             +MS+G G  M PMMFP   Q+M
Sbjct  499   VMSMGAGLCMPPMMFPTGLQHM  520



>ref|XP_007207211.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
 gb|EMJ08410.1| hypothetical protein PRUPE_ppa001899mg [Prunus persica]
Length=744

 Score = 86.3 bits (212),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  468   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  512


 Score = 32.7 bits (73),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  1230  SKRSRAAEVHNLSER  1274
             SKRSRAAEVHNLSER
Sbjct  453   SKRSRAAEVHNLSER  467


 Score = 30.4 bits (67),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             +MS+G G  M PMMFP   Q+M
Sbjct  512   IMSMGAGLYMPPMMFPAGMQHM  533



>ref|XP_008342323.1| PREDICTED: transcription factor PIF4-like [Malus domestica]
 ref|XP_008342324.1| PREDICTED: transcription factor PIF4-like [Malus domestica]
Length=542

 Score = 80.1 bits (196),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP  NK DKAS+LDEAIEYLKSLQ+Q+QV
Sbjct  357   RRRDRINEKMRALQELIPHSNKTDKASMLDEAIEYLKSLQMQLQV  401


 Score = 37.4 bits (85),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 19/31 (61%), Gaps = 4/31 (13%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM  MMFPG+Q Y+  MG+G    PP  P
Sbjct  405   GSGMAXMMFPGVQHYISQMGMG----PPALP  431


 Score = 32.0 bits (71),  Expect(3) = 1e-20, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 16/16 (100%), Gaps = 0/16 (0%)
 Frame = +3

Query  1227  SSKRSRAAEVHNLSER  1274
             S++RSRAAEVHNLSER
Sbjct  341   STRRSRAAEVHNLSER  356



>ref|XP_004243631.1| PREDICTED: transcription factor PIF4 [Solanum lycopersicum]
 ref|XP_010323940.1| PREDICTED: transcription factor PIF4 [Solanum lycopersicum]
 ref|XP_010323941.1| PREDICTED: transcription factor PIF4 [Solanum lycopersicum]
Length=517

 Score = 73.9 bits (180),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P   K DKAS+LDEAIEYLKSLQ+Q+Q+
Sbjct  342   RRRDRINEKMKALQELLPHSTKTDKASMLDEAIEYLKSLQMQLQM  386


 Score = 42.0 bits (97),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM  MMFPG+Q Y+  MG+GMG  PP  P
Sbjct  390   GSGMASMMFPGVQHYISRMGMGMG--PPSVP  418


 Score = 33.5 bits (75),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A+K  +++RSRAAEVHNLSER
Sbjct  321   AQKSGTARRSRAAEVHNLSER  341



>ref|XP_007051317.1| Phytochrome interacting factor 3, putative [Theobroma cacao]
 gb|EOX95474.1| Phytochrome interacting factor 3, putative [Theobroma cacao]
Length=613

 Score = 84.0 bits (206),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRD+INEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  431   RRRDKINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQM  475


 Score = 34.3 bits (77),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 21/39 (54%), Gaps = 8/39 (21%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA--------MGIGMGM  1634
             MMS+G G  M PMM P + Q + A        M +GMGM
Sbjct  475   MMSMGTGAYMPPMMLPTVMQQINAQHLAGYSPMAVGMGM  513


 Score = 30.8 bits (68),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 56/139 (40%), Gaps = 18/139 (13%)
 Frame = +3

Query  900   TVVESNDTPIVP-SEYRDSHVADSTAQVSGGNLGPRggamsgteaagastgaKEMTVTSS  1076
             T + SN  PI+P SE ++  + D  ++  G    P          A +S  A   ++  +
Sbjct  296   TSLASNMKPILPHSEPQNESLPDEQSEAVGNKDTPSNTRFPSRVRAPSSNLAPNTSIKGN  355

Query  1077  PDDG--------SGASVSAEKSTAPATAMDDRKAKGSETDDEGHNA-----DTDFGYNAK  1217
             P +G        S +  S   S  P   +  R     E  D   NA      T     ++
Sbjct  356   PGNGKSIEQMVASSSVCSLGASNCPTYTLKRRY----EDTDLSENAMEEPEGTTKAVPSR  411

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             +   +KR R AEVHNLSER
Sbjct  412   RSKGAKRKRKAEVHNLSER  430



>ref|XP_004499540.1| PREDICTED: transcription factor PIF4-like isoform X3 [Cicer arietinum]
Length=527

 Score = 76.6 bits (187),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQQLIP  +K DKAS+L+EAIEYLKSLQLQ+QV
Sbjct  349   RRRDRINEKMKALQQLIPHSSKTDKASMLEEAIEYLKSLQLQLQV  393


 Score = 40.8 bits (94),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGM  1628
             G GM PMM PG Q YM  MG+GM
Sbjct  397   GSGMTPMMLPGFQHYMSQMGMGM  419


 Score = 31.6 bits (70),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +++  S++R+RAAEVHNLSER
Sbjct  328   SQRSGSARRNRAAEVHNLSER  348


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = +3

Query  447  MEDEIMELLWQNGQVVVHTQNHQRSVKRSH-GGDAAIPVPAAREVVGSAEEEMATSHHQP  623
            ++ E++ELLWQNGQVV+H+Q +++ +   H   +         E  GS+           
Sbjct  25   LDHELVELLWQNGQVVLHSQTNRKPITSRHVQKNLQSTTLRTNETFGSSSN---------  75

Query  624  ELFMQEDEMASWLHYPLVD  680
               +Q+DE  SW+HYPL D
Sbjct  76   --LIQDDETVSWIHYPLED  92



>emb|CAD32238.1| BP-5 protein [Oryza sativa]
Length=335

 Score = 79.3 bits (194),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 2/47 (4%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQL--IPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+L  IP CNK DKAS+LDEAIEYLKSLQLQ++V
Sbjct  177   RRRDRINEKMRALQELELIPHCNKTDKASMLDEAIEYLKSLQLQLRV  223


 Score = 35.4 bits (80),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             K T+++RSRAAEVHNLSER
Sbjct  158   KMTTARRSRAAEVHNLSER  176


 Score = 34.3 bits (77),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 1/25 (4%)
 Frame = +3

Query  1560  GCGMIP-MMFPGIQQYMPAMGIGMG  1631
             G GM P +MFPG+ QY+P MG+ +G
Sbjct  227   GSGMAPPLMFPGVHQYLPRMGVRIG  251



>ref|XP_004499539.1| PREDICTED: transcription factor PIF4-like isoform X2 [Cicer arietinum]
Length=531

 Score = 76.6 bits (187),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQQLIP  +K DKAS+L+EAIEYLKSLQLQ+QV
Sbjct  349   RRRDRINEKMKALQQLIPHSSKTDKASMLEEAIEYLKSLQLQLQV  393


 Score = 40.8 bits (94),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGM  1628
             G GM PMM PG Q YM  MG+GM
Sbjct  397   GSGMTPMMLPGFQHYMSQMGMGM  419


 Score = 31.6 bits (70),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +++  S++R+RAAEVHNLSER
Sbjct  328   SQRSGSARRNRAAEVHNLSER  348


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = +3

Query  447  MEDEIMELLWQNGQVVVHTQNHQRSVKRSH-GGDAAIPVPAAREVVGSAEEEMATSHHQP  623
            ++ E++ELLWQNGQVV+H+Q +++ +   H   +         E  GS+           
Sbjct  25   LDHELVELLWQNGQVVLHSQTNRKPITSRHVQKNLQSTTLRTNETFGSSSN---------  75

Query  624  ELFMQEDEMASWLHYPLVD  680
               +Q+DE  SW+HYPL D
Sbjct  76   --LIQDDETVSWIHYPLED  92



>emb|CAA22970.1| putative protein [Arabidopsis thaliana]
 emb|CAB81470.1| putative protein [Arabidopsis thaliana]
Length=206

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 90/154 (58%), Gaps = 30/154 (19%)
 Frame = -2

Query  2630  CGVCEEAQSKYKCPSCVIPYCSLTCFKKHK--------EIPCGKP-QPSSEEN-------  2499
             C +CE+  SKYKCPSC++PYCSL CFK HK        E PC KP  PSS E        
Sbjct  9     CEICEKVVSKYKCPSCLVPYCSLGCFKIHKVCNLINNAETPCAKPSDPSSTEEKPVVQCE  68

Query  2498  ---------LAPTPA--LHVDKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLI  2352
                      +A +PA  + V +P   +E + V+ ++Q ++ ASSSEI EAL+ E LQKLI
Sbjct  69    PWFESCSGFVAASPAKEVPVKRP---EEANDVVEKTQQKASASSSEIREALKDEPLQKLI  125

Query  2351  CNIDSSTDAESDLDKAMQKEEFHILAQKILSTIS  2250
              +IDSS++   +LD+AM  E F     KILS IS
Sbjct  126   YSIDSSSNPLQELDEAMGIEAFREFTDKILSNIS  159



>ref|XP_008796446.1| PREDICTED: transcription factor PIF1-like [Phoenix dactylifera]
Length=400

 Score = 82.4 bits (202),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ LQ+LIPRCNK DKAS LDEAIEYLKSLQLQVQ+
Sbjct  203   RRRDRINEKMKTLQELIPRCNKSDKASTLDEAIEYLKSLQLQVQL  247


 Score = 37.0 bits (84),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 35/70 (50%), Gaps = 6/70 (9%)
 Frame = +3

Query  1083  DGSGASV-SAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQ-----TSSKRSR  1244
             DG  A V    +  A + A D RK K    D   H+ D +F    K++      S +RSR
Sbjct  133   DGQAAVVMGLRRDLARSHAGDGRKRKARAGDSGCHSEDAEFESGDKRKDTQRSASIRRSR  192

Query  1245  AAEVHNLSER  1274
             A E+HNLSER
Sbjct  193   ATELHNLSER  202


 Score = 29.6 bits (65),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 11/23 (48%), Positives = 16/23 (70%), Gaps = 6/23 (26%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMP  1610
             +MS+G      P+MFPG+Q Y+P
Sbjct  247   LMSMG------PVMFPGVQTYLP  263



>ref|XP_004499538.1| PREDICTED: transcription factor PIF4-like isoform X1 [Cicer arietinum]
Length=535

 Score = 76.6 bits (187),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQQLIP  +K DKAS+L+EAIEYLKSLQLQ+QV
Sbjct  349   RRRDRINEKMKALQQLIPHSSKTDKASMLEEAIEYLKSLQLQLQV  393


 Score = 40.8 bits (94),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGM  1628
             G GM PMM PG Q YM  MG+GM
Sbjct  397   GSGMTPMMLPGFQHYMSQMGMGM  419


 Score = 31.2 bits (69),  Expect(3) = 2e-20, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             +++  S++R+RAAEVHNLSER
Sbjct  328   SQRSGSARRNRAAEVHNLSER  348


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 12/79 (15%)
 Frame = +3

Query  447  MEDEIMELLWQNGQVVVHTQNHQRSVKRSH-GGDAAIPVPAAREVVGSAEEEMATSHHQP  623
            ++ E++ELLWQNGQVV+H+Q +++ +   H   +         E  GS+           
Sbjct  25   LDHELVELLWQNGQVVLHSQTNRKPITSRHVQKNLQSTTLRTNETFGSSSN---------  75

Query  624  ELFMQEDEMASWLHYPLVD  680
               +Q+DE  SW+HYPL D
Sbjct  76   --LIQDDETVSWIHYPLED  92



>ref|XP_009589214.1| PREDICTED: transcription factor PIF3-like [Nicotiana tomentosiformis]
Length=709

 Score = 85.5 bits (210),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  448   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  492


 Score = 34.7 bits (78),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +3

Query  1224  TSSKRSRAAEVHNLSER  1274
             T SKRSRAAEVHNLSER
Sbjct  431   TGSKRSRAAEVHNLSER  447


 Score = 28.9 bits (63),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (67%), Gaps = 0/24 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPA  1613
             +MS+G G  + PMMFP   Q+M A
Sbjct  492   IMSMGAGFCVPPMMFPAGVQHMHA  515



>ref|XP_010093193.1| hypothetical protein L484_013318 [Morus notabilis]
 gb|EXB53681.1| hypothetical protein L484_013318 [Morus notabilis]
Length=512

 Score = 79.3 bits (194),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP  NK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  325   RRRDRINEKMKALQELIPHSNKTDKASMLDEAIEYLKSLQLQLQV  369


 Score = 38.5 bits (88),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 20/31 (65%), Gaps = 2/31 (6%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFPG+Q YM  M  GM M PP  P
Sbjct  373   GSGMAPMMFPGVQHYMSRM--GMAMAPPALP  401


 Score = 30.8 bits (68),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  1233  KRSRAAEVHNLSER  1274
             ++SRAAEVHNLSER
Sbjct  311   RKSRAAEVHNLSER  324



>ref|XP_008811826.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811827.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811828.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
 ref|XP_008811829.1| PREDICTED: transcription factor PIF4-like isoform X4 [Phoenix 
dactylifera]
Length=573

 Score = 84.3 bits (207),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  358   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  402


 Score = 43.9 bits (102),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFP +QQYM  MG+GMG
Sbjct  406   GNGMAPMMFPAVQQYMSRMGMGMG  429



>ref|XP_009397370.1| PREDICTED: transcription factor PIF4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009397371.1| PREDICTED: transcription factor PIF4-like [Musa acuminata subsp. 
malaccensis]
Length=542

 Score = 83.6 bits (205),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  353   RRRDRINEKMKALQDLIPHCNKTDKASMLDEAIEYLKSLQLQVQM  397


 Score = 33.5 bits (75),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A++  S +RSRAAEVHNLSER
Sbjct  332   AQRPISKRRSRAAEVHNLSER  352


 Score = 31.6 bits (70),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYM  1607
             G GM  MMFPG+QQY+
Sbjct  401   GSGMASMMFPGVQQYI  416



>ref|XP_009757612.1| PREDICTED: transcription factor PIF4 [Nicotiana sylvestris]
 ref|XP_009757613.1| PREDICTED: transcription factor PIF4 [Nicotiana sylvestris]
Length=483

 Score = 73.9 bits (180),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+L+P   K DKAS+LDEAIEYLKSLQ+Q+Q+
Sbjct  310   RRRDRINEKMKALQELLPHSTKTDKASMLDEAIEYLKSLQMQLQM  354


 Score = 40.8 bits (94),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 21/33 (64%), Gaps = 3/33 (9%)
 Frame = +3

Query  1533  YQMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
              QMM     G GM  MMFPG+Q YM  +G+GMG
Sbjct  352   LQMMWM---GSGMASMMFPGVQHYMSRIGMGMG  381


 Score = 33.5 bits (75),  Expect(3) = 3e-20, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 6/42 (14%)
 Frame = +3

Query  1149  KAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSER  1274
             ++K  E +  G N       +A+K  +++RSRAAEVHNLSER
Sbjct  274   QSKAGELESAGGNK------SAQKSGTARRSRAAEVHNLSER  309



>ref|XP_006358519.1| PREDICTED: transcription factor PIF3-like [Solanum tuberosum]
Length=716

 Score = 85.5 bits (210),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  469   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  513


 Score = 35.0 bits (79),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 18/21 (86%), Gaps = 0/21 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLSER  1274
             A+  T SKRSRAAEVHNLSER
Sbjct  448   ARGGTGSKRSRAAEVHNLSER  468


 Score = 27.7 bits (60),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             +MS+G G  + PMMFP   Q+M
Sbjct  513   IMSMGTGFCVPPMMFPTGVQHM  534



>ref|XP_006645783.1| PREDICTED: transcription factor PIF1-like [Oryza brachyantha]
Length=596

 Score = 85.9 bits (211),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  354   RRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQM  398


 Score = 32.0 bits (71),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  1227  SSKRSRAAEVHNLSER  1274
             S+KRSR AEVHNLSER
Sbjct  338   STKRSRTAEVHNLSER  353


 Score = 30.4 bits (67),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 21/38 (55%), Gaps = 8/38 (21%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM--------PAMGIGMG  1631
             MMS+G G  + PM+ P   Q++        P +GIG+G
Sbjct  398   MMSMGTGMCIPPMLLPTAMQHLQIPPMAHFPHLGIGLG  435



>ref|XP_009774962.1| PREDICTED: transcription factor PIF3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009774963.1| PREDICTED: transcription factor PIF3-like isoform X1 [Nicotiana 
sylvestris]
Length=719

 Score = 85.5 bits (210),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  450   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  494


 Score = 34.7 bits (78),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +3

Query  1224  TSSKRSRAAEVHNLSER  1274
             T SKRSRAAEVHNLSER
Sbjct  433   TGSKRSRAAEVHNLSER  449


 Score = 28.1 bits (61),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             +MS+G G  + PMMFP   Q+M
Sbjct  494   IMSMGAGFCVPPMMFPAGVQHM  515



>ref|XP_009774964.1| PREDICTED: transcription factor PIF3-like isoform X2 [Nicotiana 
sylvestris]
Length=711

 Score = 85.5 bits (210),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  450   RRRDRINEKMRALQELIPNCNKADKASMLDEAIEYLKTLQLQVQI  494


 Score = 34.7 bits (78),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 16/17 (94%), Gaps = 0/17 (0%)
 Frame = +3

Query  1224  TSSKRSRAAEVHNLSER  1274
             T SKRSRAAEVHNLSER
Sbjct  433   TGSKRSRAAEVHNLSER  449


 Score = 28.1 bits (61),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             +MS+G G  + PMMFP   Q+M
Sbjct  494   IMSMGAGFCVPPMMFPAGVQHM  515



>ref|XP_010906815.1| PREDICTED: transcription factor PIF4-like isoform X2 [Elaeis 
guineensis]
Length=541

 Score = 85.5 bits (210),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  355   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  399


 Score = 42.7 bits (99),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPG+QQYM  MG+G+G
Sbjct  403   GSGMAPMMFPGVQQYMSRMGMGVG  426



>ref|XP_009401971.1| PREDICTED: transcription factor PIF3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401972.1| PREDICTED: transcription factor PIF3-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=606

 Score = 83.6 bits (205),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP C+K+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  381   RRRDRINEKMRALQELIPNCSKVDKASMLDEAIEYLKTLQLQVQM  425


 Score = 33.5 bits (75),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  1209  NAKKQTSSKRSRAAEVHNLSER  1274
             +A K  ++KRSRAAEVHNLSER
Sbjct  359   DAAKGRNAKRSRAAEVHNLSER  380


 Score = 30.8 bits (68),  Expect(3) = 4e-20, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 4/36 (11%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIG----MGMN  1637
             MMS+G G  M P+M PG  Q++    I     MGMN
Sbjct  425   MMSMGSGLCMSPVMLPGGMQHLRVPPIAHFAQMGMN  460



>ref|XP_009401973.1| PREDICTED: transcription factor PIF3-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=585

 Score = 83.6 bits (205),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP C+K+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  381   RRRDRINEKMRALQELIPNCSKVDKASMLDEAIEYLKTLQLQVQM  425


 Score = 33.5 bits (75),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 16/22 (73%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +3

Query  1209  NAKKQTSSKRSRAAEVHNLSER  1274
             +A K  ++KRSRAAEVHNLSER
Sbjct  359   DAAKGRNAKRSRAAEVHNLSER  380


 Score = 30.8 bits (68),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (56%), Gaps = 4/36 (11%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIG----MGMN  1637
             MMS+G G  M P+M PG  Q++    I     MGMN
Sbjct  425   MMSMGSGLCMSPVMLPGGMQHLRVPPIAHFAQMGMN  460



>ref|XP_010906805.1| PREDICTED: transcription factor PIF4-like isoform X1 [Elaeis 
guineensis]
Length=549

 Score = 85.1 bits (209),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  355   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  399


 Score = 42.7 bits (99),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPG+QQYM  MG+G+G
Sbjct  403   GSGMAPMMFPGVQQYMSRMGMGVG  426



>ref|XP_004149520.1| PREDICTED: transcription factor PIF5-like [Cucumis sativus]
 ref|XP_004162571.1| PREDICTED: transcription factor PIF5-like [Cucumis sativus]
 gb|KGN54953.1| hypothetical protein Csa_4G615240 [Cucumis sativus]
Length=550

 Score = 74.7 bits (182),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1375  INEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             INEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  367   INEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  406


 Score = 43.9 bits (102),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFPG+Q YM  + +GMGM  P  P
Sbjct  410   GSGMAPMMFPGVQHYMSRVAMGMGMAQPSMP  440


 Score = 28.9 bits (63),  Expect(3) = 5e-20, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLS  1268
             A +  SS+R+RAAEVHNLS
Sbjct  341   APRSGSSRRTRAAEVHNLS  359



>ref|XP_008464685.1| PREDICTED: transcription factor PIF4-like [Cucumis melo]
 ref|XP_008464686.1| PREDICTED: transcription factor PIF4-like [Cucumis melo]
 ref|XP_008464687.1| PREDICTED: transcription factor PIF4-like [Cucumis melo]
Length=550

 Score = 74.7 bits (182),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1375  INEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             INEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+QV
Sbjct  367   INEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQV  406


 Score = 43.5 bits (101),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMGMNPPVAP  1652
             G GM PMMFP +Q YM  M +GMGM  P  P
Sbjct  410   GSGMAPMMFPSVQHYMSRMAMGMGMAQPSMP  440


 Score = 28.9 bits (63),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 0/19 (0%)
 Frame = +3

Query  1212  AKKQTSSKRSRAAEVHNLS  1268
             A +  SS+R+RAAEVHNLS
Sbjct  341   APRSGSSRRTRAAEVHNLS  359



>ref|XP_006589101.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=691

 Score = 87.8 bits (216),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  472   KRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  516


 Score = 39.3 bits (90),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 43/90 (48%), Gaps = 25/90 (28%)
 Frame = +3

Query  1080  DDGSGASVSAEKSTAPATAM-----------------DDRKAKGSETDD-EGHNADTDFG  1205
             D+G+    +AEKS  PA A                   + K K  +TDD E H+ D +  
Sbjct  382   DNGTKGQTAAEKSKEPAVASSSVCSGNGTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEE  441

Query  1206  YNAKKQTS-------SKRSRAAEVHNLSER  1274
                 K+T+       SKRSRAAEVHNLSER
Sbjct  442   SAGAKKTAGGRGGAGSKRSRAAEVHNLSER  471



>gb|KHN24194.1| Transcription factor PIF3 [Glycine soja]
Length=691

 Score = 87.8 bits (216),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  472   KRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  516


 Score = 39.3 bits (90),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 43/90 (48%), Gaps = 25/90 (28%)
 Frame = +3

Query  1080  DDGSGASVSAEKSTAPATAM-----------------DDRKAKGSETDD-EGHNADTDFG  1205
             D+G+    +AEKS  PA A                   + K K  +TDD E H+ D +  
Sbjct  382   DNGTKGQTAAEKSKEPAVASSSVCSGNGTDQGSEEPNQNLKRKRKDTDDSECHSEDVEEE  441

Query  1206  YNAKKQTS-------SKRSRAAEVHNLSER  1274
                 K+T+       SKRSRAAEVHNLSER
Sbjct  442   SAGAKKTAGGRGGAGSKRSRAAEVHNLSER  471



>ref|XP_004970445.1| PREDICTED: zinc finger HIT domain-containing protein 3-like [Setaria 
italica]
Length=173

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 85/171 (50%), Gaps = 38/171 (22%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK--------PQPSSEE----  2502
             MG   C VC+EA SKYKCPSC  PYCS+TCFKKHKE  C K          P  EE    
Sbjct  1     MGGGSCSVCKEAPSKYKCPSCRTPYCSVTCFKKHKEESCQKILLQEDVSKSPLQEEVTRS  60

Query  2501  ------------------NLAPTPALHVDKP--------LYVDEPSQVLTQSQLESVASS  2400
                               +L+P        P        L V++PS ++  ++L S+A  
Sbjct  61    SGLVGDGTKCPNDKDQHPSLSPNTTCPAKSPNTVCPTKALEVEDPSWLVDNNRLRSLAEL  120

Query  2399  SEICEALRSEELQKLICNIDSSTDAESDLDKAMQKEEFHILAQKILSTISP  2247
              EI +ALR  ELQK+I  ID S++ E +L+K M+ + F     KIL  +SP
Sbjct  121   KEIKDALRDPELQKMILKIDGSSEPEKELEKVMEGQAFRQFTDKILDIVSP  171



>ref|XP_008776593.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=520

 Score = 85.5 bits (210),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  345   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  389


 Score = 41.6 bits (96),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPG+QQYM  MG+G+G
Sbjct  393   GSGMGPMMFPGVQQYMSRMGMGVG  416



>ref|NP_001182781.1| hypothetical protein [Zea mays]
 gb|ACF85209.1| unknown [Zea mays]
 tpg|DAA57006.1| TPA: hypothetical protein ZEAMMB73_744995 [Zea mays]
Length=150

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 82/148 (55%), Gaps = 15/148 (10%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGK---PQPSSEENLAPTPALH  2475
             MG   C VC+EA  KYKCPSC  PYCS+TCFKKHKE  C K    +  S+  L     LH
Sbjct  1     MGDGSCCVCKEAPPKYKCPSCRTPYCSVTCFKKHKEESCQKILHQEEISKSALQEEVTLH  60

Query  2474  V------------DKPLYVDEPSQVLTQSQLESVASSSEICEALRSEELQKLICNIDSST  2331
                           K L V++ S ++  ++L S+A    I +ALR  ELQ++I  ID S+
Sbjct  61    TTCTAESPNTACPTKALEVEDLSWLVDNNRLRSLAELKGIQDALRDPELQRMILQIDGSS  120

Query  2330  DAESDLDKAMQKEEFHILAQKILSTISP  2247
             ++E +L+K M+ + F     KIL  ++P
Sbjct  121   ESEKELEKVMEGQAFREFTDKILDIVNP  148



>ref|XP_010038344.1| PREDICTED: uncharacterized zinc-finger protein C4F10.19c isoform 
X1 [Eucalyptus grandis]
Length=138

 Score = 97.8 bits (242),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = -2

Query  2645  MGPKKCGVCEEAQSKYKCPSCVIPYCSLTCFKKHKEIPCGKPQPSSEENLAPTPALHVDK  2466
             MGP++C VC EAQSKYKCPSC++PYCSL CFK+HKE PC KP  S + + A +  LH  +
Sbjct  1     MGPRQCRVCNEAQSKYKCPSCLVPYCSLACFKRHKEAPCIKP-VSPDHSEAASGELHGYR  59

Query  2465  PLYVDEPSQVLTQSQLESVASSS  2397
             PL +D+P+ V+ Q QLES+   S
Sbjct  60    PLNIDDPNDVVQQGQLESLGMVS  82



>ref|XP_008776592.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=525

 Score = 85.5 bits (210),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  345   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  389


 Score = 41.2 bits (95),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFPG+QQYM  MG+G+G
Sbjct  393   GSGMGPMMFPGVQQYMSRMGMGVG  416



>ref|XP_004982350.1| PREDICTED: transcription factor PIF1-like isoform X1 [Setaria 
italica]
Length=528

 Score = 85.1 bits (209),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  333   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQM  377


 Score = 41.6 bits (96),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             MM +G G    P+MFPG+ QY+P MG+GMG
Sbjct  377   MMWMGSGIAAPPVMFPGVHQYLPRMGVGMG  406



>ref|XP_004982351.1| PREDICTED: transcription factor PIF1-like isoform X2 [Setaria 
italica]
Length=524

 Score = 85.1 bits (209),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  333   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQM  377


 Score = 41.6 bits (96),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             MM +G G    P+MFPG+ QY+P MG+GMG
Sbjct  377   MMWMGSGIAAPPVMFPGVHQYLPRMGVGMG  406



>ref|XP_008800314.1| PREDICTED: transcription factor PIF3-like isoform X2 [Phoenix 
dactylifera]
Length=666

 Score = 86.7 bits (213),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAI+YLKSLQLQVQ+
Sbjct  447   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIDYLKSLQLQVQI  491


 Score = 35.0 bits (79),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +3

Query  1224  TSSKRSRAAEVHNLSER  1274
             TS+KRSRAAEVHNLSER
Sbjct  430   TSTKRSRAAEVHNLSER  446


 Score = 25.0 bits (53),  Expect(3) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 2/27 (7%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQ-QYMPAM  1616
             +MS+G G  M+P++ P GIQ  ++P M
Sbjct  491   IMSMGSGSCMLPLVPPAGIQHMHVPPM  517



>ref|XP_004982352.1| PREDICTED: transcription factor PIF1-like isoform X3 [Setaria 
italica]
Length=520

 Score = 85.1 bits (209),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  333   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQM  377


 Score = 41.6 bits (96),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             MM +G G    P+MFPG+ QY+P MG+GMG
Sbjct  377   MMWMGSGIAAPPVMFPGVHQYLPRMGVGMG  406



>ref|XP_010416208.1| PREDICTED: transcription factor PIF1-like isoform X1 [Camelina 
sativa]
Length=532

 Score = 83.6 bits (205),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINE+M+ALQ+LIPRCNK DKAS+LDEAIEY+KSLQLQ+Q+
Sbjct  346   KRRDRINERMKALQELIPRCNKSDKASMLDEAIEYMKSLQLQIQM  390


 Score = 42.7 bits (99),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +3

Query  1062  TVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGH-NADTDFGYNAKKQTSSKR  1238
             T  + P D S + +S  +     T +D+RK K  E  DE     D +     + + S+KR
Sbjct  274   TTIAIPPDISTSIMSKSEIEPEKTIVDERKRKEREAIDETECRNDNEVQETKQGRGSTKR  333

Query  1239  SRAAEVHNLSER  1274
             SRAAEVHNLSER
Sbjct  334   SRAAEVHNLSER  345


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 52/117 (44%), Gaps = 10/117 (9%)
 Frame = +3

Query  342  HCAVPEFEMDEDY---SPLPMIappsaaglsggakksaMEDEIMELLWQNGQVVVHTQNH  512
            H  VP+F+ D+DY   S L +         + G       D +MELLW NGQVVVH Q  
Sbjct  2    HHFVPDFDTDDDYVNSSSLNLPRKSITTTTTMGGDDD--NDHLMELLWHNGQVVVHNQRL  59

Query  513  QRSVKRSHGGDAAIPVPAAREVVGSAEEEMATSHHQPELFMQEDEMASWLHYPLVDD  683
                   H  +        + ++      M        LF+ EDEM SWLHYPL DD
Sbjct  60   HH-----HNNNKKPSSSPPKMLLQPPPSPMQQQPSDQNLFIHEDEMTSWLHYPLRDD  111



>emb|CDX92896.1| BnaC07g41540D [Brassica napus]
Length=204

 Score = 99.4 bits (246),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/202 (35%), Positives = 99/202 (49%), Gaps = 71/202 (35%)
 Frame = -2

Query  2645  MGPKK---CGVCEEAQSKYKCPSCVIPYCSLTCFKKHK------EIPCGKPQPSSEENLA  2493
             M P+    CG+CE   SKYKCP C++PYCS+ CFKKHK      +IPC K   S++E  A
Sbjct  1     MSPRAAQTCGICEIVVSKYKCPCCLVPYCSVGCFKKHKGKFFSLKIPCVK-SSSTDEKPA  59

Query  2492  PTPA----------------------------LHVDKPLYVDEPSQ--------------  2439
              +PA                            + V +P+ V+E                 
Sbjct  60    TSPAKEVSVDVVEKTEAKASGSSAACATKEAQVAVARPINVEEAKHAVDKTHLEATGASA  119

Query  2438  -------------------VLTQSQLESVASSSEICEALRSEELQKLICNIDSSTDAESD  2316
                                V+ ++QLE++ASSSEI EAL+ E LQKLI +ID+S++   +
Sbjct  120   TKEVPVARPITITAEEAKYVVDKTQLEAIASSSEIREALKDEALQKLIASIDTSSNPLKE  179

Query  2315  LDKAMQKEEFHILAQKILSTIS  2250
             LD+AM +E F +L +KILS +S
Sbjct  180   LDEAMGEEAFRMLKEKILSNLS  201



>ref|XP_010094912.1| hypothetical protein L484_022662 [Morus notabilis]
 gb|EXB57555.1| hypothetical protein L484_022662 [Morus notabilis]
Length=758

 Score = 88.2 bits (217),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             Q+RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  481   QRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  526


 Score = 37.7 bits (86),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 7/64 (11%)
 Frame = +3

Query  1104  SAEKSTAPATAMDDRKAKGSETDDEGHNADTDFGYNAKKQTS------SKRSRAAEVHNL  1265
             S E+++   T +  RK + +E D E H+ D +      K+T+      SKRSRAAEVHNL
Sbjct  407   SVERASDDPTHVLKRKFRDTE-DSECHSEDVEEESVGVKKTAPPRASGSKRSRAAEVHNL  465

Query  1266  SERV  1277
             SER+
Sbjct  466   SERI  469



>ref|XP_004960433.1| PREDICTED: transcription factor PIF3-like [Setaria italica]
Length=484

 Score = 83.2 bits (204),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+L+EAIEYLK+LQLQVQ+
Sbjct  314   RRRDRINEKMRALQELIPNCNKIDKASMLEEAIEYLKTLQLQVQM  358


 Score = 31.2 bits (69),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  1227  SSKRSRAAEVHNLSER  1274
             S+KRSR AEVHNLSER
Sbjct  298   SNKRSRTAEVHNLSER  313


 Score = 31.2 bits (69),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (58%), Gaps = 6/38 (16%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQ------YMPAMGIGMGMN  1637
             MMS+G G  + PM+ P +Q       + P +G+G+G +
Sbjct  358   MMSMGTGLCVPPMLLPAMQMPHPMAAHFPHLGMGLGFS  395



>ref|XP_008370334.1| PREDICTED: transcription factor PIF3 isoform X2 [Malus domestica]
Length=606

 Score = 87.0 bits (214),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  357   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  401


 Score = 33.5 bits (75),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 28/49 (57%), Gaps = 7/49 (14%)
 Frame = +3

Query  1149  KAKGSETDD-EGHNADT-DFGYNAKKQT-----SSKRSRAAEVHNLSER  1274
             K K  ETD+ E H+ D  D     KK        SKRSRAAEVHNLSER
Sbjct  308   KRKCRETDESECHSDDVEDESVGVKKGAHARGKGSKRSRAAEVHNLSER  356


 Score = 25.0 bits (53),  Expect(3) = 2e-19, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 1/20 (5%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMF-PGIQ  1598
             +MS+G G  M PMM  PG+Q
Sbjct  401   IMSMGAGMYMPPMMLSPGMQ  420



>ref|XP_008811822.1| PREDICTED: transcription factor PIF4-like isoform X2 [Phoenix 
dactylifera]
Length=575

 Score = 84.7 bits (208),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  373   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  417


 Score = 40.8 bits (94),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFP +QQYM  MG+GMG
Sbjct  421   GNGMAPMMFPAVQQYMSRMGMGMG  444



>ref|XP_006605776.1| PREDICTED: transcription factor PIF3-like [Glycine max]
Length=722

 Score = 86.7 bits (213),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  471   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  515


 Score = 38.9 bits (89),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 42/90 (47%), Gaps = 25/90 (28%)
 Frame = +3

Query  1080  DDGSGASVSAEKSTAPATAM-----------------DDRKAKGSETDD-EGHNADTDFG  1205
             D G+    +AEKS  PA A                   + K K  +TDD E H+ D +  
Sbjct  381   DSGTKGQTAAEKSMEPAVASSSVCSGTGADQGSDEPNQNLKRKTKDTDDSECHSEDVEEE  440

Query  1206  YNAKKQTS-------SKRSRAAEVHNLSER  1274
                 K+T+       SKRSRAAEVHNLSER
Sbjct  441   SAGAKKTAGGQGGAGSKRSRAAEVHNLSER  470



>ref|XP_008811825.1| PREDICTED: transcription factor PIF4-like isoform X3 [Phoenix 
dactylifera]
Length=574

 Score = 84.7 bits (208),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  373   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  417


 Score = 40.8 bits (94),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFP +QQYM  MG+GMG
Sbjct  421   GNGMAPMMFPAVQQYMSRMGMGMG  444



>gb|KHN26204.1| Transcription factor PIF3 [Glycine soja]
Length=722

 Score = 86.7 bits (213),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  471   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  515


 Score = 38.9 bits (89),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 42/90 (47%), Gaps = 25/90 (28%)
 Frame = +3

Query  1080  DDGSGASVSAEKSTAPATAM-----------------DDRKAKGSETDD-EGHNADTDFG  1205
             D G+    +AEKS  PA A                   + K K  +TDD E H+ D +  
Sbjct  381   DSGTKGQTAAEKSMEPAVASSSVCSGTGADQGSDEPNQNLKRKTKDTDDSECHSEDVEEE  440

Query  1206  YNAKKQTS-------SKRSRAAEVHNLSER  1274
                 K+T+       SKRSRAAEVHNLSER
Sbjct  441   SAGAKKTAGGRGGAGSKRSRAAEVHNLSER  470



>ref|XP_008789575.1| PREDICTED: transcription factor APG-like [Phoenix dactylifera]
Length=406

 Score = 85.1 bits (209),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/45 (87%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIPRCNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  204   RRRDRINEKMKALQELIPRCNKSDKASMLDEAIEYLKSLQLQVQM  248


 Score = 40.4 bits (93),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 6/70 (9%)
 Frame = +3

Query  1083  DGSGASVSAEKSTAPATAMDDRKAKGSETDD-EGHNADTDF-----GYNAKKQTSSKRSR  1244
             DG  A +   +  A A A D RK K  E D+ E  + D +F     G +  +  S +RS 
Sbjct  134   DGQAAVMGLRRGPAKAHAGDGRKRKAREGDNSEFQSEDAEFESGDKGKDTHRSASMRRSG  193

Query  1245  AAEVHNLSER  1274
             AAEVHNL+ER
Sbjct  194   AAEVHNLAER  203



>ref|XP_004302325.1| PREDICTED: transcription factor PIF3-like [Fragaria vesca subsp. 
vesca]
Length=710

 Score = 86.7 bits (213),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  449   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQI  493


 Score = 38.9 bits (89),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 9/72 (13%)
 Frame = +3

Query  1083  DGSGASV-SAEKSTAPATAMDDRKAKGSETDDEGHNADTD---FGYNAK----KQTSSKR  1238
             D S  SV S EK++   T +  RK++ ++ D E H+ D +    G   K    + T SKR
Sbjct  378   DSSVCSVNSVEKASDDPTRVLKRKSRDTD-DSECHSEDVEEESVGVKKKVAHGRGTGSKR  436

Query  1239  SRAAEVHNLSER  1274
             SRAAEVHNLSER
Sbjct  437   SRAAEVHNLSER  448



>ref|XP_008800313.1| PREDICTED: transcription factor PIF3-like isoform X1 [Phoenix 
dactylifera]
Length=670

 Score = 85.5 bits (210),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAI+YLKSLQLQVQ 
Sbjct  447   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIDYLKSLQLQVQF  491


 Score = 35.0 bits (79),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/17 (94%), Positives = 17/17 (100%), Gaps = 0/17 (0%)
 Frame = +3

Query  1224  TSSKRSRAAEVHNLSER  1274
             TS+KRSRAAEVHNLSER
Sbjct  430   TSTKRSRAAEVHNLSER  446


 Score = 25.0 bits (53),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%), Gaps = 2/27 (7%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQ-QYMPAM  1616
             +MS+G G  M+P++ P GIQ  ++P M
Sbjct  495   IMSMGSGSCMLPLVPPAGIQHMHVPPM  521



>ref|XP_008811817.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811818.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811819.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811820.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811821.1| PREDICTED: transcription factor PIF4-like isoform X1 [Phoenix 
dactylifera]
Length=588

 Score = 84.7 bits (208),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKM+ALQ+LIP CNK DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  373   RRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQVQI  417


 Score = 40.8 bits (94),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM PMMFP +QQYM  MG+GMG
Sbjct  421   GNGMAPMMFPAVQQYMSRMGMGMG  444



>gb|EAY91148.1| hypothetical protein OsI_12756 [Oryza sativa Indica Group]
Length=469

 Score = 84.0 bits (206),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+
Sbjct  310   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQM  354


 Score = 35.0 bits (79),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             K T+++RSRAAEVHNLSER
Sbjct  291   KMTTARRSRAAEVHNLSER  309


 Score = 26.2 bits (56),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%)
 Frame = +3

Query  1560  GCGMIP-MMFPGIQQYMPAM  1616
             G GM P +MFPG+ QY+P M
Sbjct  358   GSGMAPPVMFPGVHQYLPRM  377



>gb|ABF97814.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=481

 Score = 84.0 bits (206),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+
Sbjct  329   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQM  373


 Score = 35.0 bits (79),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             K T+++RSRAAEVHNLSER
Sbjct  310   KMTTARRSRAAEVHNLSER  328


 Score = 26.2 bits (56),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%)
 Frame = +3

Query  1560  GCGMIP-MMFPGIQQYMPAM  1616
             G GM P +MFPG+ QY+P M
Sbjct  377   GSGMAPPVMFPGVHQYLPRM  396



>gb|AHM26476.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 85.5 bits (210),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             ++RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  14    RRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQI  59


 Score = 31.2 bits (69),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  1233  KRSRAAEVHNLSER  1274
             KRSR+AEVHNLSER
Sbjct  1     KRSRSAEVHNLSER  14


 Score = 28.5 bits (62),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (69%), Gaps = 1/32 (3%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQQYMPAMGIGMGM  1634
             +MS+  G  M P+MFP G++ Y  AM +GMGM
Sbjct  59    IMSMASGYYMPPVMFPPGMRHYPAAMAMGMGM  90



>gb|ABF97813.1| Helix-loop-helix DNA-binding domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=485

 Score = 83.6 bits (205),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+
Sbjct  329   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQM  373


 Score = 35.0 bits (79),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 18/19 (95%), Gaps = 0/19 (0%)
 Frame = +3

Query  1218  KQTSSKRSRAAEVHNLSER  1274
             K T+++RSRAAEVHNLSER
Sbjct  310   KMTTARRSRAAEVHNLSER  328


 Score = 26.2 bits (56),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%)
 Frame = +3

Query  1560  GCGMIP-MMFPGIQQYMPAM  1616
             G GM P +MFPG+ QY+P M
Sbjct  377   GSGMAPPVMFPGVHQYLPRM  396



>ref|XP_004967640.1| PREDICTED: transcription factor PIF3-like isoform X1 [Setaria 
italica]
 ref|XP_004967641.1| PREDICTED: transcription factor PIF3-like isoform X2 [Setaria 
italica]
 ref|XP_004967642.1| PREDICTED: transcription factor PIF3-like isoform X3 [Setaria 
italica]
 ref|XP_004967643.1| PREDICTED: transcription factor PIF3-like isoform X4 [Setaria 
italica]
 ref|XP_004967644.1| PREDICTED: transcription factor PIF3-like isoform X5 [Setaria 
italica]
Length=624

 Score = 86.3 bits (212),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  382   RRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQM  426


 Score = 32.3 bits (72),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 59/144 (41%), Gaps = 17/144 (12%)
 Frame = +3

Query  885   SRAASTVVESNDTPIVPSEYRDSHVADS---------TAQVSGGNLGP-----Rggamsg  1022
             +R  STV++S+  P     + D   A S         TA  + GNL       R G+M+ 
Sbjct  241   TRVESTVLQSSIGPRTTPVFTDQRTAWSQPKEVRFSCTAAPTAGNLQQEMPRDRLGSMTL  300

Query  1023  teaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF  1202
              +        +    TSS   G+GA +  ++S          +   S+ DD     D   
Sbjct  301   QKQVKTRKEPEAAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSASQDDDL---EDESG  357

Query  1203  GYNAKKQTSSKRSRAAEVHNLSER  1274
             G        +KRSR AEVHNLSER
Sbjct  358   GARRSGSRGTKRSRTAEVHNLSER  381


 Score = 26.2 bits (56),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G G  + PM+ P   Q++
Sbjct  426   MMSMGSGLCIPPMLLPPTMQHL  447



>ref|XP_004967645.1| PREDICTED: transcription factor PIF3-like isoform X6 [Setaria 
italica]
Length=619

 Score = 86.3 bits (212),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  377   RRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQM  421


 Score = 32.3 bits (72),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 59/144 (41%), Gaps = 17/144 (12%)
 Frame = +3

Query  885   SRAASTVVESNDTPIVPSEYRDSHVADS---------TAQVSGGNLGP-----Rggamsg  1022
             +R  STV++S+  P     + D   A S         TA  + GNL       R G+M+ 
Sbjct  236   TRVESTVLQSSIGPRTTPVFTDQRTAWSQPKEVRFSCTAAPTAGNLQQEMPRDRLGSMTL  295

Query  1023  teaagastgaKEMTVTSSPDDGSGASVSAEKSTAPATAMDDRKAKGSETDDEGHNADTDF  1202
              +        +    TSS   G+GA +  ++S          +   S+ DD     D   
Sbjct  296   QKQVKTRKEPEAAVATSSVCSGNGAGIGNDESWRQHKRKSQAECSASQDDDL---EDESG  352

Query  1203  GYNAKKQTSSKRSRAAEVHNLSER  1274
             G        +KRSR AEVHNLSER
Sbjct  353   GARRSGSRGTKRSRTAEVHNLSER  376


 Score = 26.2 bits (56),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G G  + PM+ P   Q++
Sbjct  421   MMSMGSGLCIPPMLLPPTMQHL  442



>ref|XP_002459338.1| hypothetical protein SORBIDRAFT_02g002760 [Sorghum bicolor]
 gb|EER95859.1| hypothetical protein SORBIDRAFT_02g002760 [Sorghum bicolor]
Length=446

 Score = 86.7 bits (213),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+L+P CNK DKASILDEAIEYLKSLQ+QVQ+
Sbjct  259   RRRDRINEKMRALQELVPHCNKTDKASILDEAIEYLKSLQMQVQI  303


 Score = 30.8 bits (68),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 7/42 (17%)
 Frame = +3

Query  1170  DDEGHNADTDF-------GYNAKKQTSSKRSRAAEVHNLSER  1274
             D+   +AD D          + +  ++ +R+RAAEVHN+SER
Sbjct  217   DEFDEDADLDTVDETPPSSRDRRPASNKRRTRAAEVHNMSER  258


 Score = 27.3 bits (59),  Expect(3) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  1563  CGMIPMMFPGIQQYMPAMGIGM  1628
              GM PMM PG  Q MP M +G+
Sbjct  308   TGMAPMMIPGAHQLMPPMTMGL  329



>ref|XP_008246329.1| PREDICTED: transcription factor PIF3 [Prunus mume]
Length=729

 Score = 92.0 bits (227),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQVSVFF  1506
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQV++F+
Sbjct  468   RRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKTLQLQVQVNLFY  516


 Score = 33.1 bits (74),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)
 Frame = +3

Query  1230  SKRSRAAEVHNLSER  1274
             SKRSRAAEVHNLSER
Sbjct  453   SKRSRAAEVHNLSER  467



>ref|XP_010541186.1| PREDICTED: transcription factor PIF1 [Tarenaya hassleriana]
Length=499

 Score = 71.2 bits (173),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +1

Query  1375  INEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             INE+MR LQ+LIPRCNK DKAS+LDEAIE++KSLQLQ+Q+
Sbjct  306   INERMRTLQELIPRCNKSDKASMLDEAIEHIKSLQLQIQM  345


 Score = 38.5 bits (88),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 27/43 (63%), Gaps = 1/43 (2%)
 Frame = +3

Query  1143  DRKAKGSETDDEGHNADTDFGYNAKKQTSSKRSRAAEVHNLSE  1271
             DRK KG E  DE     ++     +  TS+KRSRAAEVHNLSE
Sbjct  258   DRKRKGREDIDET-ECRSEETKQGRGSTSTKRSRAAEVHNLSE  299


 Score = 35.0 bits (79),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 2/22 (9%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G+   M PMM+PG+QQYM
Sbjct  345   MMSMGYS--MTPMMYPGMQQYM  364



>gb|AHM26455.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
 gb|AHM26456.1| PIF3, partial [Arabidopsis lyrata subsp. petraea]
Length=91

 Score = 85.5 bits (210),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +1

Query  1357  QKRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             ++RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLKSLQLQVQ+
Sbjct  14    RRRRDRINEKMRALQELIPNCNKVDKASMLDEAIEYLKSLQLQVQI  59


 Score = 30.0 bits (66),  Expect(3) = 4e-19, Method: Composition-based stats.
 Identities = 15/32 (47%), Positives = 20/32 (63%), Gaps = 1/32 (3%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFP-GIQQYMPAMGIGMGM  1634
             +MS+  G    P+MFP G+  Y  AM +GMGM
Sbjct  59    IMSMASGYYXPPVMFPPGMXHYPAAMAMGMGM  90


 Score = 29.3 bits (64),  Expect(3) = 4e-19, Method: Composition-based stats.
 Identities = 13/14 (93%), Positives = 14/14 (100%), Gaps = 0/14 (0%)
 Frame = +3

Query  1233  KRSRAAEVHNLSER  1274
             KRSR+AEVHNLSER
Sbjct  1     KRSRSAEVHNLSER  14



>gb|EMS46835.1| Transcription factor PIF5 [Triticum urartu]
Length=306

 Score = 85.5 bits (210),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             KRRDRINEKM+ALQ+L+P CNK DKASILDEAIEYLKSLQLQVQV
Sbjct  102   KRRDRINEKMKALQELVPHCNKSDKASILDEAIEYLKSLQLQVQV  146


 Score = 29.6 bits (65),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 15/22 (68%), Gaps = 0/22 (0%)
 Frame = +3

Query  1566  GMIPMMFPGIQQYMPAMGIGMG  1631
             GM PMM+PG  Q MP M +G+ 
Sbjct  170   GMAPMMYPGAHQLMPPMAMGLN  191


 Score = 29.3 bits (64),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
 Frame = +3

Query  1176  EGHNADTDFGYNA---KKQTSSKRSRAAEVHNLSER  1274
             +  +AD     N    ++  + +R+RAAEVHN SER
Sbjct  66    QAQDADDCEAVNEPRPQRPAAKRRTRAAEVHNQSER  101



>gb|KDO44796.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
 gb|KDO44797.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=283

 Score = 85.5 bits (210),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  1273  GYECSFVNHYTESCNfffifffATINQM--QKRRDRINEKMRALQQLIPRCNKLDKASIL  1446
             G+E    N   +          A ++ +  ++RRDRINEKMRALQ+LIP CNK DKAS+L
Sbjct  66    GFESGAGNKTAQRSGSCRRSRAAEVHNLSERRRRDRINEKMRALQELIPHCNKTDKASML  125

Query  1447  DEAIEYLKSLQLQVQV  1494
             DEAIEYLKSLQLQ+QV
Sbjct  126   DEAIEYLKSLQLQLQV  141


 Score = 39.3 bits (90),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  1560  GCGMIPMMFPGIQQYMPAMGIGMG  1631
             G GM P+MFPG+Q YM  MG+GMG
Sbjct  145   GSGMAPLMFPGMQHYMSRMGMGMG  168



>gb|KDO44798.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=327

 Score = 85.5 bits (210),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQVS  1497
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+S
Sbjct  97    RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQMS  142


 Score = 39.3 bits (90),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             QM   +  G GM P+MFPG+Q YM  MG+GMG
Sbjct  140   QMSQVMWMGSGMAPLMFPGMQHYMSRMGMGMG  171



>gb|KDO44794.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
 gb|KDO44795.1| hypothetical protein CISIN_1g0077971mg, partial [Citrus sinensis]
Length=286

 Score = 85.5 bits (210),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQVS  1497
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+S
Sbjct  97    RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQMS  142


 Score = 39.3 bits (90),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             QM   +  G GM P+MFPG+Q YM  MG+GMG
Sbjct  140   QMSQVMWMGSGMAPLMFPGMQHYMSRMGMGMG  171



>dbj|BAD81566.1| putative BP-5 protein [Oryza sativa Japonica Group]
Length=565

 Score = 86.3 bits (212),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQV  1494
             +RRDRINEKMRALQ+LIP CNK+DKAS+LDEAIEYLK+LQLQVQ+
Sbjct  323   RRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQM  367


 Score = 32.0 bits (71),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 14/16 (88%), Positives = 15/16 (94%), Gaps = 0/16 (0%)
 Frame = +3

Query  1227  SSKRSRAAEVHNLSER  1274
             S+KRSR AEVHNLSER
Sbjct  307   STKRSRTAEVHNLSER  322


 Score = 26.2 bits (56),  Expect(3) = 5e-19, Method: Compositional matrix adjust.
 Identities = 9/22 (41%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +3

Query  1542  MMSLGHGCGMIPMMFPGIQQYM  1607
             MMS+G G  + PM+ P   Q++
Sbjct  367   MMSMGTGLCIPPMLLPTAMQHL  388



>ref|XP_006437069.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50309.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=542

 Score = 85.5 bits (210),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQVS  1497
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+S
Sbjct  353   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQMS  398


 Score = 39.3 bits (90),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             QM   +  G GM P+MFPG+Q YM  MG+GMG
Sbjct  396   QMSQVMWMGSGMAPLMFPGMQHYMSRMGMGMG  427



>ref|XP_006437072.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
 gb|ESR50312.1| hypothetical protein CICLE_v10031028mg [Citrus clementina]
Length=583

 Score = 85.1 bits (209),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +1

Query  1360  KRRDRINEKMRALQQLIPRCNKLDKASILDEAIEYLKSLQLQVQVS  1497
             +RRDRINEKMRALQ+LIP CNK DKAS+LDEAIEYLKSLQLQ+Q+S
Sbjct  353   RRRDRINEKMRALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQMS  398


 Score = 39.3 bits (90),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +3

Query  1536  QMMMSLGHGCGMIPMMFPGIQQYMPAMGIGMG  1631
             QM   +  G GM P+MFPG+Q YM  MG+GMG
Sbjct  396   QMSQVMWMGSGMAPLMFPGMQHYMSRMGMGMG  427



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8367725637150