BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25781_g2_i1 len=1559 path=[12519:0-107 9911:108-257 12772:258-276
12791:277-343 12855:344-345 12253:346-392 12902:393-396
12309:397-473 1319:474-476 20961:477-498 5756:499-499 5757:500-563
3150:564-587 3174:588-603 3190:604-630 3217:631-636 3223:637-707
3294:708-803 3390:804-824 3411:825-887 3474:888-905 3492:906-991
3578:992-1020 3607:1021-1159 3746:1160-1179 3766:1180-1247
3834:1248-1266 3853:1267-1448 4035:1449-1558]

Length=1559
                                                                      Score     E

ref|XP_004247895.1|  PREDICTED: crocetin glucosyltransferase, chl...    630   0.0      
dbj|BAG80545.1|  UDP-glucose:glucosyltransferase                        624   0.0      Lycium barbarum [goji berry]
ref|XP_009612652.1|  PREDICTED: crocetin glucosyltransferase, chl...    618   0.0      
ref|XP_009765809.1|  PREDICTED: crocetin glucosyltransferase, chl...    603   0.0      
dbj|BAA19155.1|  glucosyl transferase                                   602   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009590508.1|  PREDICTED: crocetin glucosyltransferase, chl...    599   0.0      
ref|XP_004242781.1|  PREDICTED: crocetin glucosyltransferase, chl...    599   0.0      
ref|XP_009787090.1|  PREDICTED: crocetin glucosyltransferase, chl...    598   0.0      
ref|XP_009622554.1|  PREDICTED: crocetin glucosyltransferase, chl...    594   0.0      
ref|XP_009778637.1|  PREDICTED: crocetin glucosyltransferase, chl...    592   0.0      
ref|XP_009612650.1|  PREDICTED: crocetin glucosyltransferase, chl...    589   0.0      
ref|XP_004252977.1|  PREDICTED: crocetin glucosyltransferase, chl...    581   0.0      
ref|XP_006349902.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    571   0.0      
dbj|BAG80537.1|  putative glycosyltransferase                           556   0.0      Lycium barbarum [goji berry]
ref|XP_002263700.1|  PREDICTED: crocetin glucosyltransferase, chl...    555   0.0      Vitis vinifera
ref|XP_006342284.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    554   0.0      
ref|XP_004229323.2|  PREDICTED: crocetin glucosyltransferase, chl...    545   0.0      
ref|XP_002262883.1|  PREDICTED: crocetin glucosyltransferase, chl...    544   0.0      Vitis vinifera
emb|CDP15120.1|  unnamed protein product                                541   0.0      
emb|CAN67608.1|  hypothetical protein VITISV_036779                     540   0.0      Vitis vinifera
dbj|BAG80544.1|  UDP-glucose:glucosyltransferase                        538   0.0      Lycium barbarum [goji berry]
ref|XP_004247896.2|  PREDICTED: crocetin glucosyltransferase, chl...    536   0.0      
emb|CDP15119.1|  unnamed protein product                                532   0.0      
ref|XP_009601422.1|  PREDICTED: crocetin glucosyltransferase, chl...    530   0.0      
ref|XP_009790237.1|  PREDICTED: crocetin glucosyltransferase, chl...    528   0.0      
dbj|BAB88935.1|  glucosyltransferase                                    528   1e-180   Nicotiana tabacum [American tobacco]
ref|XP_002263301.1|  PREDICTED: crocetin glucosyltransferase, chl...    518   7e-177   Vitis vinifera
ref|XP_011020320.1|  PREDICTED: crocetin glucosyltransferase, chl...    517   3e-176   
ref|XP_002263975.1|  PREDICTED: crocetin glucosyltransferase, chl...    515   9e-176   Vitis vinifera
ref|XP_002308970.1|  putative glucosyltransferase family protein        512   3e-174   Populus trichocarpa [western balsam poplar]
ref|XP_011024782.1|  PREDICTED: crocetin glucosyltransferase, chl...    511   4e-174   
ref|XP_002321086.2|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    509   3e-173   Populus trichocarpa [western balsam poplar]
ref|XP_002267526.1|  PREDICTED: crocetin glucosyltransferase, chl...    506   8e-172   Vitis vinifera
emb|CAN76093.1|  hypothetical protein VITISV_027116                     506   8e-172   Vitis vinifera
ref|XP_004247894.1|  PREDICTED: crocetin glucosyltransferase, chl...    505   1e-171   
gb|ABQ02258.1|  O-glucosyltransferase 3                                 505   1e-171   Vitis labrusca [Concord grape]
dbj|BAM28983.1|  UDP-glucose crocetin glucosyltransferase               504   2e-171   
sp|F8WKW0.1|UGT1_GARJA  RecName: Full=Crocetin glucosyltransferas...    502   2e-170   
ref|XP_006358760.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    501   4e-170   
ref|XP_006368000.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    500   1e-169   
ref|XP_002301753.1|  INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE ...    499   2e-169   Populus trichocarpa [western balsam poplar]
ref|XP_010650398.1|  PREDICTED: crocetin glucosyltransferase, chl...    499   3e-169   
ref|XP_002266628.2|  PREDICTED: crocetin glucosyltransferase, chl...    499   6e-169   Vitis vinifera
ref|XP_002266967.1|  PREDICTED: crocetin glucosyltransferase, chl...    498   6e-169   Vitis vinifera
gb|AAK54465.1|  cold-induced glucosyl transferase                       498   1e-168   Solanum sogarandinum
ref|XP_002301754.1|  hypothetical protein POPTR_0002s23770g             495   1e-167   Populus trichocarpa [western balsam poplar]
ref|XP_003632054.2|  PREDICTED: crocetin glucosyltransferase, chl...    493   1e-166   
ref|XP_008380455.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    492   2e-166   
ref|XP_010023602.1|  PREDICTED: crocetin glucosyltransferase, chl...    491   3e-166   
ref|XP_007034187.1|  Indole-3-acetate beta-D-glucosyltransferase,...    491   4e-166   
ref|XP_002322699.1|  hypothetical protein POPTR_0016s05290g             491   6e-166   Populus trichocarpa [western balsam poplar]
ref|XP_007221319.1|  hypothetical protein PRUPE_ppa021645mg             491   7e-166   
gb|AAX16493.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           491   7e-166   Malus domestica [apple tree]
ref|XP_007034186.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      490   9e-166   
ref|XP_011033298.1|  PREDICTED: crocetin glucosyltransferase, chl...    490   9e-166   
ref|XP_011081386.1|  PREDICTED: crocetin glucosyltransferase, chl...    490   9e-166   
emb|CAN75179.1|  hypothetical protein VITISV_018406                     491   1e-165   Vitis vinifera
ref|XP_002267330.2|  PREDICTED: crocetin glucosyltransferase, chl...    491   1e-165   Vitis vinifera
ref|XP_010650395.1|  PREDICTED: crocetin glucosyltransferase, chl...    491   2e-165   
ref|XP_003601705.1|  O-glucosyltransferase                              489   3e-165   
ref|XP_010023603.1|  PREDICTED: crocetin glucosyltransferase, chl...    488   5e-165   
ref|XP_002266919.1|  PREDICTED: crocetin glucosyltransferase, chl...    488   6e-165   Vitis vinifera
emb|CDP15112.1|  unnamed protein product                                488   8e-165   
dbj|BAD90935.1|  monoterpene glucosyltransferase                        488   1e-164   Eucalyptus perriniana
gb|AAY27090.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase           488   1e-164   Pyrus communis
ref|XP_008380456.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    487   3e-164   
ref|XP_004504379.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       486   3e-164   
gb|AHL68667.1|  UDP-glucose: anthocyanin 5-O-glucosyltransferase        486   4e-164   
ref|XP_003552552.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    485   6e-164   
ref|XP_007099701.1|  UDP-glucose:flavonoid 7-O-glucosyltransferase      485   9e-164   
ref|XP_002263498.1|  PREDICTED: crocetin glucosyltransferase, chl...    485   1e-163   Vitis vinifera
ref|XP_009373578.1|  PREDICTED: crocetin glucosyltransferase, chl...    485   1e-163   
gb|KDP32582.1|  hypothetical protein JCGZ_13132                         484   3e-163   
dbj|BAA89009.1|  anthocyanin 5-O-glucosyltransferase                    483   9e-163   Petunia x hybrida [garden petunia]
ref|XP_010246531.1|  PREDICTED: crocetin glucosyltransferase, chl...    482   2e-162   
ref|XP_010243149.1|  PREDICTED: crocetin glucosyltransferase, chl...    481   3e-162   
ref|XP_010246537.1|  PREDICTED: crocetin glucosyltransferase, chl...    481   4e-162   
ref|XP_010650447.1|  PREDICTED: crocetin glucosyltransferase, chl...    488   5e-162   
ref|XP_007163802.1|  hypothetical protein PHAVU_001G265400g             483   6e-162   
ref|XP_004298223.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       480   1e-161   
ref|XP_003531212.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    479   1e-161   
emb|CAN62622.1|  hypothetical protein VITISV_001655                     479   2e-161   Vitis vinifera
ref|XP_009337747.1|  PREDICTED: crocetin glucosyltransferase, chl...    479   4e-161   
dbj|BAF49301.1|  putative glycosyltransferase                           478   4e-161   Clitoria ternatea
ref|XP_011101592.1|  PREDICTED: crocetin glucosyltransferase, chl...    478   5e-161   
ref|XP_004502258.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       477   1e-160   
ref|XP_004297003.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       476   3e-160   
ref|XP_010039945.1|  PREDICTED: crocetin glucosyltransferase, chl...    476   3e-160   
ref|XP_008348418.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    476   5e-160   
ref|XP_008222735.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    473   4e-159   
ref|XP_007221281.1|  hypothetical protein PRUPE_ppa005161mg             473   4e-159   
ref|XP_007221288.1|  hypothetical protein PRUPE_ppa016890mg             473   8e-159   
ref|XP_006349903.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    472   1e-158   
ref|XP_009373577.1|  PREDICTED: crocetin glucosyltransferase, chl...    472   1e-158   
ref|XP_008380454.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    472   2e-158   
ref|XP_003532736.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    473   3e-158   
ref|XP_004252978.1|  PREDICTED: crocetin glucosyltransferase, chl...    471   4e-158   
ref|XP_010673328.1|  PREDICTED: crocetin glucosyltransferase, chl...    471   4e-158   
ref|XP_008222736.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    471   4e-158   
ref|XP_009373576.1|  PREDICTED: crocetin glucosyltransferase, chl...    474   5e-158   
sp|Q9ZR25.1|5GT_VERHY  RecName: Full=Anthocyanidin 3-O-glucoside ...    469   2e-157   Glandularia x hybrida [garden verbena]
emb|CDP15111.1|  unnamed protein product                                469   2e-157   
dbj|BAF49300.1|  putative glycosyltransferase                           469   3e-157   Clitoria ternatea
ref|XP_010039944.1|  PREDICTED: crocetin glucosyltransferase, chl...    468   6e-157   
ref|XP_008380634.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    466   4e-156   
ref|XP_010023609.1|  PREDICTED: crocetin glucosyltransferase, chl...    465   5e-156   
emb|CAN62624.1|  hypothetical protein VITISV_001657                     465   5e-156   Vitis vinifera
ref|XP_002263422.1|  PREDICTED: crocetin glucosyltransferase, chl...    463   3e-155   Vitis vinifera
dbj|BAD90934.1|  monoterpene glucosyltransferase                        462   1e-154   Eucalyptus perriniana
ref|XP_002516389.1|  UDP-glucosyltransferase, putative                  461   1e-154   Ricinus communis
ref|XP_003601706.1|  UDP-glucose glucosyltransferase                    461   2e-154   
ref|XP_010023606.1|  PREDICTED: crocetin glucosyltransferase, chl...    461   3e-154   
ref|XP_003524180.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    460   3e-154   
ref|XP_010246964.1|  PREDICTED: crocetin glucosyltransferase, chl...    459   2e-153   
ref|XP_010023605.1|  PREDICTED: crocetin glucosyltransferase, chl...    458   3e-153   
gb|AFI71902.1|  flavonol 5-O-glucosyltransferase                        457   5e-153   
ref|XP_003629628.1|  UDP-glucose flavonoid 7-O-glucosyltransferase      457   6e-153   
ref|XP_010052789.1|  PREDICTED: crocetin glucosyltransferase, chl...    457   8e-153   
ref|XP_003524181.2|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    457   1e-152   
ref|XP_003601707.1|  UDP-glucuronosyltransferase 1-6                    453   5e-151   
gb|EYU32718.1|  hypothetical protein MIMGU_mgv1a005538mg                452   1e-150   
ref|XP_010246963.1|  PREDICTED: crocetin glucosyltransferase, chl...    449   6e-150   
ref|XP_010023610.1|  PREDICTED: crocetin glucosyltransferase, chl...    447   5e-149   
ref|XP_003629627.1|  Indole-3-acetate beta-glucosyltransferase          446   2e-148   
ref|XP_004298222.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       446   2e-148   
sp|Q9ZR27.1|5GT1_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    443   2e-147   Perilla frutescens var. crispa
ref|XP_010039943.1|  PREDICTED: crocetin glucosyltransferase, chl...    443   2e-147   
ref|XP_004297014.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       438   2e-145   
gb|EYU31588.1|  hypothetical protein MIMGU_mgv1a005398mg                437   9e-145   
ref|XP_010099953.1|  UDP-glycosyltransferase 75D1                       436   3e-144   
gb|KHN12357.1|  UDP-glycosyltransferase 75D1                            432   1e-143   
emb|CDP15115.1|  unnamed protein product                                432   3e-143   
ref|XP_008458144.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    431   2e-142   
ref|XP_006442002.1|  hypothetical protein CICLE_v10019912mg             427   9e-141   
gb|EYU31586.1|  hypothetical protein MIMGU_mgv1a005918mg                426   1e-140   
gb|EYU31587.1|  hypothetical protein MIMGU_mgv1a018203mg                425   2e-140   
sp|Q9ZR26.1|5GT2_PERFR  RecName: Full=Anthocyanidin 3-O-glucoside...    424   2e-140   Perilla frutescens var. crispa
ref|XP_006442000.1|  hypothetical protein CICLE_v10023445mg             425   1e-139   
ref|XP_009765810.1|  PREDICTED: crocetin glucosyltransferase, chl...    417   1e-139   
ref|XP_006492998.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       422   3e-139   
ref|XP_009612651.1|  PREDICTED: crocetin glucosyltransferase, chl...    415   2e-138   
ref|XP_010069411.1|  PREDICTED: crocetin glucosyltransferase, chl...    420   2e-138   
ref|XP_006421040.1|  hypothetical protein CICLE_v10004909mg             419   5e-138   
gb|ABL85474.1|  glycosyltransferase UGT75L4                             417   2e-137   Maclura pomifera
ref|XP_004140483.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       416   2e-136   
ref|XP_010039940.1|  PREDICTED: crocetin glucosyltransferase, chl...    411   5e-135   
dbj|BAF75879.1|  glucosyltransferase                                    410   3e-134   Dianthus caryophyllus [carnation]
gb|KDP32590.1|  hypothetical protein JCGZ_13140                         407   1e-133   
ref|XP_006414807.1|  hypothetical protein EUTSA_v10025167mg             407   2e-133   
ref|XP_009108098.1|  PREDICTED: UDP-glycosyltransferase 75C1            406   3e-133   
ref|XP_010068983.1|  PREDICTED: crocetin glucosyltransferase, chl...    405   8e-133   
emb|CDY27124.1|  BnaA08g07620D                                          405   1e-132   
ref|XP_002868314.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    401   4e-131   
gb|AAL69494.1|  putative glucosyltransferase                            400   1e-130   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12370.1|  BnaC08g08350D                                          400   1e-130   
ref|NP_193146.1|  anthocyanin 5-O-glucosyltransferase                   399   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27003.1|  hypothetical protein MIMGU_mgv1a024986mg                397   9e-130   
dbj|BAF49285.1|  anthocyanin 5-O-glucosyltransferase                    397   1e-129   Eustoma exaltatum subsp. russellianum [bluebells]
dbj|BAE98677.1|  glucosyltransferase like protein                       397   2e-129   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF49286.1|  anthocyanin 5-O-glucosyltransferase                    395   8e-129   Eustoma exaltatum subsp. russellianum [bluebells]
gb|KCW76863.1|  hypothetical protein EUGRSUZ_D01218                     393   2e-128   
ref|XP_011069457.1|  PREDICTED: crocetin glucosyltransferase, chl...    390   5e-128   
ref|XP_010096066.1|  UDP-glycosyltransferase 75D1                       392   2e-127   
ref|XP_006282890.1|  hypothetical protein CARUB_v10007134mg             389   2e-126   
ref|XP_010103920.1|  UDP-glycosyltransferase 75D1                       390   2e-126   
ref|XP_009778639.1|  PREDICTED: crocetin glucosyltransferase, chl...    389   4e-126   
ref|XP_010040348.1|  PREDICTED: crocetin glucosyltransferase, chl...    389   5e-126   
ref|XP_006418014.1|  hypothetical protein EUTSA_v10007593mg             387   7e-126   
ref|XP_006307449.1|  hypothetical protein CARUB_v10009073mg             387   1e-125   
ref|XP_010522273.1|  PREDICTED: UDP-glycosyltransferase 75B2-like       390   2e-125   
ref|XP_002305226.2|  hypothetical protein POPTR_0004s08200g             387   3e-125   Populus trichocarpa [western balsam poplar]
ref|XP_010549173.1|  PREDICTED: UDP-glycosyltransferase 75D1            387   3e-125   
ref|XP_009604418.1|  PREDICTED: crocetin glucosyltransferase, chl...    386   4e-125   
ref|XP_010023607.1|  PREDICTED: crocetin glucosyltransferase, chl...    385   8e-125   
ref|XP_010040347.1|  PREDICTED: crocetin glucosyltransferase, chl...    383   8e-125   
gb|KFK36297.1|  hypothetical protein AALP_AA4G104100                    385   9e-125   
ref|XP_011043909.1|  PREDICTED: crocetin glucosyltransferase, chl...    385   2e-124   
gb|KDO43225.1|  hypothetical protein CISIN_1g036740mg                   382   3e-124   
emb|CBI39398.3|  unnamed protein product                                381   5e-124   
emb|CBI39410.3|  unnamed protein product                                381   5e-124   
gb|KFK42892.1|  hypothetical protein AALP_AA1G052200                    381   4e-123   
ref|XP_009781303.1|  PREDICTED: crocetin glucosyltransferase, chl...    380   5e-123   
ref|XP_008793440.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    381   6e-123   
ref|XP_006365463.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    379   2e-122   
ref|XP_004239848.1|  PREDICTED: crocetin glucosyltransferase, chl...    379   3e-122   
gb|KGN46579.1|  hypothetical protein Csa_6G109740                       377   1e-121   
ref|XP_004140604.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       377   1e-121   
emb|CDP21497.1|  unnamed protein product                                377   2e-121   
emb|CAN73416.1|  hypothetical protein VITISV_017052                     376   2e-121   Vitis vinifera
ref|XP_010435193.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       375   3e-121   
ref|XP_010485047.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    375   5e-121   
gb|KGN45711.1|  hypothetical protein Csa_6G007450                       375   5e-121   
ref|XP_010925318.1|  PREDICTED: crocetin glucosyltransferase, chl...    375   9e-121   
ref|XP_009622557.1|  PREDICTED: crocetin glucosyltransferase, chl...    374   1e-120   
ref|XP_004162387.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       374   1e-120   
ref|XP_010457643.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       374   2e-120   
ref|XP_010434952.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       373   5e-120   
ref|XP_011021104.1|  PREDICTED: crocetin glucosyltransferase, chl...    372   9e-120   
ref|NP_567471.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltra...    372   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AFJ52965.1|  UDP-glycosyltransferase 1                               371   3e-119   
ref|XP_002892295.1|  UDP-glucosyl transferase 75B2                      370   5e-119   
ref|XP_008458143.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    370   5e-119   
gb|ADG45874.1|  UDP-glucosyltransferase                                 370   6e-119   
ref|XP_010485054.1|  PREDICTED: UDP-glycosyltransferase 75B1 isof...    370   7e-119   
ref|XP_010450127.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       369   9e-119   
ref|XP_004253165.1|  PREDICTED: crocetin glucosyltransferase, chl...    370   1e-118   
ref|XP_010434517.1|  PREDICTED: UDP-glycosyltransferase 75D1            369   1e-118   
ref|XP_006373420.1|  hypothetical protein POPTR_0017s13620g             368   3e-118   
emb|CDP21504.1|  unnamed protein product                                368   4e-118   
ref|XP_006285715.1|  hypothetical protein CARUB_v10007186mg             369   4e-118   
ref|XP_010450109.1|  PREDICTED: UDP-glycosyltransferase 75C1            367   5e-118   
ref|XP_010440288.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       367   9e-118   
gb|EYU31585.1|  hypothetical protein MIMGU_mgv1a007491mg                365   1e-117   
gb|AAB58497.1|  UDP-glucose:indole-3-acetate beta-D-glucosyltrans...    367   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415092.1|  hypothetical protein EUTSA_v10007589mg             367   1e-117   
ref|XP_009119145.1|  PREDICTED: UDP-glycosyltransferase 75B1            367   2e-117   
ref|XP_010434494.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       366   3e-117   
gb|KCW57754.1|  hypothetical protein EUGRSUZ_H00503                     363   3e-117   
ref|NP_172044.1|  UDP-glucosyl transferase 75B2                         365   3e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC54093.1|  anthocyanin 5-glucosyltransferase                      366   4e-117   Torenia hybrid cultivar
ref|XP_008458151.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    365   5e-117   
ref|NP_563742.1|  UDP-glucosyltransferase 75B1                          365   9e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008787452.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    365   1e-116   
dbj|BAP90370.1|  UDP-glycose: glycosyltransferase UGT75R1               362   1e-115   
emb|CDP20005.1|  unnamed protein product                                360   3e-115   
emb|CDY47274.1|  BnaA10g03720D                                          360   4e-115   
dbj|BAK55743.1|  UDP-glucose glucosyltransferase                        360   4e-115   
emb|CDY10124.1|  BnaC05g03670D                                          360   5e-115   
ref|XP_006853436.1|  hypothetical protein AMTR_s00032p00176750          358   2e-114   
gb|ABQ02257.1|  O-glucosyltransferase 2                                 357   3e-114   Vitis labrusca [Concord grape]
ref|XP_008791887.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    358   3e-114   
ref|XP_008793436.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    358   3e-114   
ref|XP_002263497.1|  PREDICTED: crocetin glucosyltransferase, chl...    357   6e-114   Vitis vinifera
ref|XP_010917296.1|  PREDICTED: crocetin glucosyltransferase, chl...    357   9e-114   
ref|XP_009403481.1|  PREDICTED: crocetin glucosyltransferase, chl...    357   1e-113   
emb|CBI39412.3|  unnamed protein product                                362   1e-113   
ref|XP_009105515.1|  PREDICTED: UDP-glycosyltransferase 75B2            356   2e-113   
ref|XP_007041389.1|  UDP-Glycosyltransferase superfamily protein        355   4e-113   
gb|KFK39474.1|  hypothetical protein AALP_AA3G248900                    355   6e-113   
ref|XP_010025793.1|  PREDICTED: crocetin glucosyltransferase, chl...    353   6e-113   
ref|XP_010673325.1|  PREDICTED: crocetin glucosyltransferase, chl...    356   1e-112   
gb|EYU31602.1|  hypothetical protein MIMGU_mgv1a021119mg                354   1e-112   
emb|CDP20001.1|  unnamed protein product                                354   1e-112   
ref|XP_002892298.1|  UDP-glucosyl transferase 75B1                      353   2e-112   
ref|XP_007226459.1|  hypothetical protein PRUPE_ppa024612mg             352   5e-112   
ref|XP_010434953.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       352   6e-112   
gb|EYU36923.1|  hypothetical protein MIMGU_mgv1a026563mg                352   8e-112   
gb|ABQ02256.1|  O-glucosyltransferase 1                                 351   9e-112   Vitis labrusca [Concord grape]
ref|XP_002263532.1|  PREDICTED: crocetin glucosyltransferase, chl...    351   1e-111   Vitis vinifera
emb|CDP20003.1|  unnamed protein product                                351   1e-111   
gb|EYU27002.1|  hypothetical protein MIMGU_mgv1a023035mg                351   1e-111   
ref|XP_011101605.1|  PREDICTED: crocetin glucosyltransferase, chl...    345   3e-111   
ref|XP_008793438.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    350   3e-111   
ref|XP_009403483.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    350   4e-111   
ref|XP_006305828.1|  hypothetical protein CARUB_v10010859mg             349   5e-111   
gb|AFJ52962.1|  UDP-glycosyltransferase 1                               351   6e-111   
ref|XP_007041388.1|  UDP-Glycosyltransferase superfamily protein        350   6e-111   
gb|KCW57186.1|  hypothetical protein EUGRSUZ_H00001                     345   2e-110   
ref|XP_008219026.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       348   3e-110   
emb|CDY71964.1|  BnaAnng39390D                                          348   3e-110   
emb|CDY22902.1|  BnaA01g18400D                                          346   1e-109   
emb|CDY65144.1|  BnaC01g41850D                                          345   2e-109   
emb|CDY09068.1|  BnaC08g10220D                                          345   3e-109   
emb|CDY46180.1|  BnaA01g23020D                                          344   4e-109   
ref|XP_004140605.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       345   5e-109   
ref|XP_010100065.1|  UDP-glycosyltransferase 75D1                       342   6e-109   
ref|XP_010527436.1|  PREDICTED: UDP-glycosyltransferase 75C1 isof...    344   6e-109   
gb|KGN46578.1|  hypothetical protein Csa_6G109730                       344   7e-109   
ref|XP_011097030.1|  PREDICTED: crocetin glucosyltransferase, chl...    337   1e-108   
ref|XP_002868197.1|  indole-3-acetate beta-D-glucosyltransferase        343   2e-108   
ref|XP_009107847.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...    343   2e-108   
ref|XP_009107846.1|  PREDICTED: UDP-glycosyltransferase 75D1-like...    343   3e-108   
ref|XP_004307485.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       342   3e-108   
ref|XP_009146925.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       342   6e-108   
ref|XP_006282963.1|  hypothetical protein CARUB_v10007692mg             341   2e-107   
emb|CDP15113.1|  unnamed protein product                                339   2e-107   
emb|CAN70791.1|  hypothetical protein VITISV_029654                     339   2e-107   Vitis vinifera
emb|CAB10333.1|  glucosyltransferase like protein                       339   5e-107   Arabidopsis thaliana [mouse-ear cress]
emb|CDY09070.1|  BnaC08g10240D                                          338   8e-107   
gb|AFJ52963.1|  UDP-glycosyltransferase 1                               340   1e-106   
ref|XP_007041390.1|  UDP-Glycosyltransferase superfamily protein        337   2e-106   
ref|XP_009381252.1|  PREDICTED: crocetin glucosyltransferase, chl...    337   5e-106   
ref|XP_010915038.1|  PREDICTED: crocetin glucosyltransferase, chl...    337   5e-106   
gb|ACW82415.1|  putative glucosyltransferase                            327   3e-105   
ref|XP_004162386.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    332   5e-104   
gb|ABQ02259.1|  truncated O-glucosyltransferase 4                       328   3e-103   
ref|XP_008339230.1|  PREDICTED: UDP-glycosyltransferase 75C1-like       328   1e-102   
gb|ACM66950.1|  flavonoid glucosyltransferase                           328   2e-102   
gb|EAY72781.1|  hypothetical protein OsI_00644                          328   2e-102   
emb|CDY22742.1|  BnaA08g05720D                                          327   3e-102   
ref|XP_009403482.1|  PREDICTED: crocetin glucosyltransferase, chl...    327   4e-102   
dbj|BAD67837.1|  putative glucosyltransferase                           327   5e-102   
ref|NP_001042201.2|  Os01g0179600                                       327   5e-102   
ref|XP_010915126.1|  PREDICTED: LOW QUALITY PROTEIN: crocetin glu...    338   5e-102   
emb|CDP21505.1|  unnamed protein product                                325   6e-102   
gb|EAZ10778.1|  hypothetical protein OsJ_00613                          327   8e-102   
dbj|BAF03079.1|  UDP-glucose:flavonol 5-O-glucosyltransferase hom...    322   9e-102   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                         325   9e-102   
gb|AAL24226.1|  AT4g15550/dl3815c                                       323   1e-101   
emb|CDM81837.1|  unnamed protein product                                324   6e-101   
dbj|BAF96596.1|  UDP-glucose:anthocysnin 5-O-glucosyltransferase        320   7e-101   
emb|CDY09069.1|  BnaC08g10230D                                          323   8e-101   
ref|XP_008793435.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    324   9e-101   
sp|B2NID7.1|5GT_GENTR  RecName: Full=Anthocyanidin 3-O-glucoside ...    323   3e-100   
ref|XP_009362456.1|  PREDICTED: crocetin glucosyltransferase, chl...    322   3e-100   
ref|XP_009373249.1|  PREDICTED: crocetin glucosyltransferase, chl...    322   3e-100   
ref|XP_006858828.1|  hypothetical protein AMTR_s00066p00177320          321   5e-100   
dbj|BAJ95093.1|  predicted protein                                      321   7e-100   
ref|XP_009107848.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       321   8e-100   
emb|CDY31602.1|  BnaA03g54500D                                          320   1e-99    
emb|CBI39391.3|  unnamed protein product                                317   2e-99    
ref|XP_009373248.1|  PREDICTED: crocetin glucosyltransferase, chl...    320   3e-99    
emb|CDM81835.1|  unnamed protein product                                319   4e-99    
ref|XP_002321569.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    318   8e-99    
ref|XP_004965984.1|  PREDICTED: UDP-glycosyltransferase 75D1-like       318   8e-99    
ref|XP_007036115.1|  UDP-glucosyl transferase 74B1, putative            317   1e-98    
ref|XP_010475249.1|  PREDICTED: UDP-glycosyltransferase 75B1-like       315   4e-98    
ref|XP_008673623.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    316   8e-98    
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like       315   8e-98    
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    315   9e-98    
gb|AFW80209.1|  hypothetical protein ZEAMMB73_447013                    316   1e-97    
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       315   2e-97    
emb|CDY21979.1|  BnaC09g00850D                                          315   2e-97    
ref|NP_001063685.1|  Os09g0518200                                       314   4e-97    
ref|XP_002455067.1|  hypothetical protein SORBIDRAFT_03g003760          315   4e-97    
gb|KEH25950.1|  UDP-glucosyltransferase family protein                  313   5e-97    
ref|XP_003571494.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    313   9e-97    
gb|AFI98393.1|  UDP-glucosyltransferase                                 308   9e-97    
gb|KCW59915.1|  hypothetical protein EUGRSUZ_H02639                     309   1e-96    
ref|XP_002280305.1|  PREDICTED: UDP-glycosyltransferase 74B1            312   1e-96    
gb|EAZ09772.1|  hypothetical protein OsI_32059                          312   1e-96    
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase      312   1e-96    
emb|CDY22741.1|  BnaA08g05710D                                          311   2e-96    
ref|XP_009362510.1|  PREDICTED: crocetin glucosyltransferase, chl...    314   2e-96    
ref|XP_006439748.1|  hypothetical protein CICLE_v10020081mg             311   3e-96    
ref|XP_008458142.1|  PREDICTED: anthocyanidin 3-O-glucoside 5-O-g...    310   4e-96    
ref|XP_006476729.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       311   4e-96    
ref|XP_006414486.1|  hypothetical protein EUTSA_v10027441mg             311   4e-96    
gb|KDO69768.1|  hypothetical protein CISIN_1g012645mg                   310   5e-96    
gb|KDP35132.1|  hypothetical protein JCGZ_10666                         310   1e-95    
gb|EYU22114.1|  hypothetical protein MIMGU_mgv1a026355mg                304   2e-95    
ref|XP_011028616.1|  PREDICTED: UDP-glycosyltransferase 74B1            308   3e-95    
gb|AFK36738.1|  unknown                                                 309   3e-95    
ref|XP_003565425.1|  PREDICTED: crocetin glucosyltransferase, chl...    309   6e-95    
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       308   7e-95    
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       306   2e-94    
ref|XP_010230853.1|  PREDICTED: crocetin glucosyltransferase, chl...    307   2e-94    
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       306   2e-94    
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          306   3e-94    
emb|CBI39388.3|  unnamed protein product                                310   3e-94    
gb|AES96307.2|  UDP-glucosyltransferase family protein                  307   5e-94    
emb|CDP13110.1|  unnamed protein product                                305   6e-94    
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative             305   6e-94    
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg             305   7e-94    
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       305   9e-94    
dbj|BAK06770.1|  predicted protein                                      306   9e-94    
ref|XP_010908641.1|  PREDICTED: crocetin glucosyltransferase 2-like     305   1e-93    
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       305   1e-93    
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    303   3e-93    
gb|ABK96547.1|  unknown                                                 303   6e-93    
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       302   7e-93    
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       302   1e-92    
ref|XP_006664936.1|  PREDICTED: crocetin glucosyltransferase 2-like     302   1e-92    
emb|CAN68287.1|  hypothetical protein VITISV_017016                     301   1e-92    
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       301   1e-92    
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                        301   2e-92    
ref|XP_003613349.1|  UDP-glucose glucosyltransferase                    306   2e-92    
ref|XP_003565426.1|  PREDICTED: crocetin glucosyltransferase, chl...    302   3e-92    
emb|CBI39411.3|  unnamed protein product                                295   3e-92    
ref|XP_002437220.1|  hypothetical protein SORBIDRAFT_10g023060          301   5e-92    
ref|NP_001142122.1|  uncharacterized protein LOC100274286               300   6e-92    
ref|XP_003517852.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       300   7e-92    
emb|CDX68805.1|  BnaC01g06480D                                          299   8e-92    
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       300   1e-91    
dbj|BAJ96117.1|  predicted protein                                      300   1e-91    
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       300   1e-91    
ref|XP_002438628.1|  hypothetical protein SORBIDRAFT_10g023120          300   1e-91    
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g             299   1e-91    
ref|XP_010091051.1|  UDP-glycosyltransferase                            299   2e-91    
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       299   2e-91    
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       299   2e-91    
ref|XP_009366234.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       299   2e-91    
ref|XP_006858830.1|  hypothetical protein AMTR_s00066p00177790          298   4e-91    
emb|CDP06918.1|  unnamed protein product                                298   4e-91    
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2          297   5e-91    
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  298   5e-91    
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2            297   6e-91    
ref|NP_001184915.1|  UDP-Glycosyltransferase superfamily protein        297   7e-91    
ref|XP_008384038.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       297   8e-91    
gb|ACM09899.2|  glycosyltransferase                                     297   8e-91    
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                  297   1e-90    
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase            296   1e-90    
ref|XP_006858829.1|  hypothetical protein AMTR_s00066p00177490          296   1e-90    
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       296   1e-90    
emb|CDP03995.1|  unnamed protein product                                296   1e-90    
ref|XP_002460531.1|  hypothetical protein SORBIDRAFT_02g030050          296   2e-90    
gb|KEH25946.1|  UDP-glucosyltransferase family protein                  296   2e-90    
ref|XP_010321783.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       296   3e-90    
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       296   3e-90    
ref|XP_004978365.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    296   6e-90    
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       295   6e-90    
ref|XP_004965983.1|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    295   7e-90    
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       295   7e-90    
ref|XP_010039151.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       294   9e-90    
ref|XP_006855046.1|  hypothetical protein AMTR_s00031p00082410          295   9e-90    
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    294   1e-89    
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg             294   1e-89    
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       294   1e-89    
emb|CDP03926.1|  unnamed protein product                                294   2e-89    
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    293   2e-89    
ref|XP_004957371.1|  PREDICTED: crocetin glucosyltransferase 2-like     294   2e-89    
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       293   2e-89    
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...    293   2e-89    
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    293   2e-89    
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       293   2e-89    
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       293   2e-89    
ref|XP_009383146.1|  PREDICTED: crocetin glucosyltransferase 2-like     293   3e-89    
ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    293   4e-89    
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       293   4e-89    
ref|XP_007044514.1|  UDP-glucosyl transferase 74B1                      293   4e-89    
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                        293   5e-89    
ref|XP_010091337.1|  UDP-glycosyltransferase 74E2                       292   5e-89    
ref|XP_007210590.1|  hypothetical protein PRUPE_ppa016463mg             292   6e-89    
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like       293   7e-89    
ref|NP_001057976.1|  Os06g0593200                                       293   8e-89    
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like     293   9e-89    
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative            291   1e-88    
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg                291   1e-88    
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg             291   1e-88    
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    291   1e-88    
emb|CDP03994.1|  unnamed protein product                                291   1e-88    
ref|XP_002306205.2|  putative glucosyltransferase family protein        291   2e-88    
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    291   2e-88    
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       291   2e-88    
ref|XP_011085046.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       291   2e-88    
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...    291   2e-88    
ref|XP_007151915.1|  hypothetical protein PHAVU_004G086500g             291   2e-88    
ref|NP_001046237.2|  Os02g0203300                                       292   2e-88    
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg             291   2e-88    
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g             291   2e-88    
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                       290   2e-88    
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    290   3e-88    
gb|KDP45199.1|  hypothetical protein JCGZ_15064                         290   4e-88    
emb|CAN80193.1|  hypothetical protein VITISV_017236                     304   4e-88    
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       290   5e-88    
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...    290   5e-88    
ref|XP_008805997.1|  PREDICTED: indole-3-acetate beta-glucosyltra...    290   6e-88    
ref|XP_002880070.1|  UDP-glucosyltransferase 74F2                       289   7e-88    
gb|KDP35129.1|  hypothetical protein JCGZ_10663                         289   7e-88    
ref|XP_007157504.1|  hypothetical protein PHAVU_002G075200g             289   1e-87    
ref|XP_008239719.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       289   1e-87    
ref|XP_006344123.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       289   1e-87    
gb|KDP45202.1|  hypothetical protein JCGZ_15067                         288   1e-87    
ref|XP_004957373.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       289   1e-87    
gb|KEH25945.1|  UDP-glucosyltransferase family protein                  288   1e-87    
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    289   1e-87    
ref|XP_002442677.1|  hypothetical protein SORBIDRAFT_08g001100          290   1e-87    
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                       288   2e-87    
gb|KDP45201.1|  hypothetical protein JCGZ_15066                         288   2e-87    
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       288   2e-87    
ref|XP_006826758.1|  hypothetical protein AMTR_s00136p00072610          289   2e-87    
emb|CAE48291.1|  glucosyltransferase 2                                  288   3e-87    
emb|CAN67249.1|  hypothetical protein VITISV_008684                     286   3e-87    
emb|CBI24719.3|  unnamed protein product                                287   3e-87    
ref|XP_009111039.1|  PREDICTED: UDP-glycosyltransferase 74E2            287   4e-87    
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       287   4e-87    
ref|XP_010672476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    287   5e-87    
ref|XP_006372897.1|  putative glucosyltransferase family protein        287   5e-87    
sp|Q767C8.1|IH5GT_IRIHO  RecName: Full=Cyanidin 3-O-rutinoside 5-...    287   7e-87    
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       287   8e-87    
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                    287   8e-87    
ref|XP_008460408.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       287   8e-87    
ref|XP_006357100.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       286   8e-87    
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       286   8e-87    
emb|CDP08068.1|  unnamed protein product                                286   9e-87    
ref|XP_010095579.1|  UDP-glycosyltransferase 74E2                       286   9e-87    
ref|XP_010457690.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       286   1e-86    
ref|XP_010475278.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    286   1e-86    
ref|XP_008449394.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       287   1e-86    
gb|KDP35128.1|  hypothetical protein JCGZ_10662                         286   1e-86    
ref|NP_181910.1|  UDP-glucosyltransferase 74F2                          286   1e-86    
ref|XP_011082053.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       286   1e-86    
gb|ABR16264.1|  unknown                                                 287   2e-86    
ref|XP_003560622.2|  PREDICTED: cyanidin 3-O-rutinoside 5-O-gluco...    286   2e-86    
ref|XP_009776061.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       286   2e-86    
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       286   2e-86    
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    286   2e-86    
ref|XP_004245060.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       286   2e-86    
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...    285   2e-86    
ref|XP_006307470.1|  hypothetical protein CARUB_v10009096mg             285   2e-86    
ref|XP_004957369.1|  PREDICTED: crocetin glucosyltransferase 2-like     286   2e-86    
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       286   3e-86    
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    285   3e-86    
gb|KEH25943.1|  UDP-glucosyltransferase family protein                  285   3e-86    
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       285   4e-86    
gb|KDP35130.1|  hypothetical protein JCGZ_10664                         284   6e-86    
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       285   7e-86    
ref|XP_009142974.1|  PREDICTED: UDP-glycosyltransferase 74F2            284   7e-86    
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    285   7e-86    
ref|XP_010457662.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       284   7e-86    



>ref|XP_004247895.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=468

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/461 (63%), Positives = 370/461 (80%), Gaps = 5/461 (1%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CHVLLV FP QGHINPSLQFAK+LVNLG  VT ST  +A NR+S  P I+GL F PFSDG
Sbjct  8     CHVLLVTFPGQGHINPSLQFAKKLVNLGLNVTFSTSLTAFNRISKLPNIEGLSFTPFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD   E +  + + F++S+ + GS+ + ++I ++  EGRPF R+IYT++M+W G+VA+G+
Sbjct  68    YDGKFEGSLDEFESFYSSLVSHGSEFMTQIIESRAVEGRPFKRVIYTTLMAWVGIVAKGI  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTET  946
             +VP T  W QPATV+DIYY+ FT+Y D F+NCS +QVV++PG+P L  RDFPSF+F   T
Sbjct  128   NVPSTFFWIQPATVMDIYYYCFTDYADCFKNCSEDQVVDLPGLPQLSPRDFPSFVF---T  184

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
             +VN    W ++++ DQIE +N EENP+VLVNTFD LEFDALRA+K + MVGIGP IPSA+
Sbjct  185   DVNSKYGWGVKSIIDQIELLNSEENPRVLVNTFDDLEFDALRALKNLTMVGIGPSIPSAF  244

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             LDG DP D +FG DLR +S +Y++WLD+  K SV+Y+AFGSY+++ + ++EEI QGLVK 
Sbjct  245   LDGNDPLDKSFGADLRSSSENYMDWLDTMTKESVIYIAFGSYSEISSQLMEEIGQGLVKC  304

Query  585   KMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
               PFLWV+RE  +G  PEEKL CKEELE QGKIVRWC+QVEVLQHPS+GCFLTHCGWNST
Sbjct  305   GRPFLWVIREEKEGGHPEEKLTCKEELEKQGKIVRWCSQVEVLQHPSLGCFLTHCGWNST  364

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGG  226
             LESL+SG+P+VACPLW DQ  NAKL+QDVWK+GVRV+A++EGVV+ DE+KRCIE VM  G
Sbjct  365   LESLSSGMPIVACPLWTDQGCNAKLVQDVWKIGVRVNASKEGVVERDEFKRCIEIVMKDG  424

Query  225   EKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             EK  EL+ NAKKWK+LAK A K++GSS +NLKAY++E+L S
Sbjct  425   EKRVELKKNAKKWKDLAKEATKENGSSNVNLKAYVNEILLS  465



>dbj|BAG80545.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=467

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/459 (64%), Positives = 364/459 (79%), Gaps = 5/459 (1%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CHVLLV FP QGHINPSLQFAKRLVNLG KVT ST  SA NR+S  P I+GL FAPFSDG
Sbjct  8     CHVLLVTFPGQGHINPSLQFAKRLVNLGVKVTFSTSLSAFNRISKLPNIEGLSFAPFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD   + +  +   F++S+ + GS+ V ++I ++  EG PFTR+IYT+IM+W GVVA+ +
Sbjct  68    YDGKFKGSMNEFDSFYSSLMSHGSEFVTQIIKSRVAEGHPFTRIIYTTIMAWVGVVAKSI  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTET  946
             +VP T  W QPATVLDIYY+ FT+Y D F+NCS +QVVE+PG+P L  RDFPS + S   
Sbjct  128   NVPSTFFWIQPATVLDIYYYCFTDYADYFKNCSQDQVVELPGLPRLSPRDFPSLVLS---  184

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
             +VN    WA++++ DQ+E +N EENP+VLVNTFD LE DALRA+K + MVGIGP IPSA+
Sbjct  185   DVNSTYGWAVKSIIDQVELLNSEENPRVLVNTFDDLEHDALRALKNLTMVGIGPSIPSAF  244

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             LD  DP D +FG DL ++S DY+EWLD + K SV+Y+AFGSY+++ + ++EEIAQGLVK 
Sbjct  245   LDENDPFDKSFGADLIRSSEDYMEWLDKRTKDSVIYIAFGSYSEISSQLMEEIAQGLVKY  304

Query  585   KMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
               PFLWV+RE   GE PEE L CKEELE  GKIVRWC+QVEVLQH S+GCFLTHCGWNST
Sbjct  305   GRPFLWVIREGQNGENPEENLTCKEELEKHGKIVRWCSQVEVLQHLSLGCFLTHCGWNST  364

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGG  226
             LES+ SGVP+VACPLW DQ  NAKL+QDVWK GVRV+AN++G+V+ DE+KRCIE VM  G
Sbjct  365   LESVCSGVPVVACPLWTDQGCNAKLVQDVWKTGVRVNANKDGIVERDEFKRCIEIVMEDG  424

Query  225   EKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             EK +EL+ NAKKWK+LAK AMK++GSS LNL+AY++E+L
Sbjct  425   EKRDELKKNAKKWKDLAKEAMKENGSSNLNLRAYVNEIL  463



>ref|XP_009612652.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=481

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/474 (62%), Positives = 372/474 (78%), Gaps = 21/474 (4%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CHVLLV FP QGHINPSLQF+KRLVNLG KVT ST  +A NR+++ P I+GL FAPFSDG
Sbjct  8     CHVLLVTFPGQGHINPSLQFSKRLVNLGVKVTFSTSLTAFNRINNLPTIEGLTFAPFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD   + +  +L  F++S+ + GS+ V +L+T +  EGRPFTR+IYT++M+W G+VA+ +
Sbjct  68    YDGKFKGSVDELHSFYSSLISHGSEFVTRLVTFRTAEGRPFTRIIYTTLMAWVGLVAKNI  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYG---------------DLFRNCSGNQVVEVPGVPA  991
             +VP TL W QPATV DIYY+ FT+Y                D F+NCS +QVVE+PG+P 
Sbjct  128   NVPSTLFWIQPATVFDIYYYCFTDYNNNIPSIFLQVGSNYVDYFKNCSQDQVVELPGLPQ  187

Query  990   LGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK  811
             L  RDFPSF+F    +VN    W ++++ DQIE +N EENP++LVNTFDALE +ALR +K
Sbjct  188   LSRRDFPSFVF---IDVNSSYGWGVKSIIDQIELLNNEENPRILVNTFDALEPNALRVLK  244

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADV  631
              + MVGIGP IPSA+LDG+DPSD +FG DLR++S +Y+EWLD++ K SV+Y+AFGSY+++
Sbjct  245   NLTMVGIGPSIPSAFLDGKDPSDNSFGADLRRSSENYMEWLDTRTKESVIYIAFGSYSEI  304

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
              + ++EEIAQGLVK   PFLWV+RE  +GE    KL CKEELE +GKIV WC+QVEVLQH
Sbjct  305   SSQLMEEIAQGLVKCGRPFLWVIREGKEGENLGGKLSCKEELEKKGKIVSWCSQVEVLQH  364

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCFLTHCGWNSTLESL+SG+P+VACPLW DQ  NAKLIQDVWK GVRV+ANEEG+V+
Sbjct  365   PSLGCFLTHCGWNSTLESLSSGIPVVACPLWTDQGCNAKLIQDVWKTGVRVNANEEGLVE  424

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              DE+KRCIE VM  GEK EELR NAKKWK+LAK AM ++GSS +NLKAY++E+L
Sbjct  425   RDEFKRCIEIVM-EGEKREELRGNAKKWKDLAKEAMNENGSSNVNLKAYVNEIL  477



>ref|XP_009765809.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana sylvestris]
Length=485

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/477 (59%), Positives = 373/477 (78%), Gaps = 11/477 (2%)
 Frame = -3

Query  1521  TPHII-FHHHPRMEG-CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS  1348
             TPH++  H    ++  CHVL+ +FP QGHINPSLQF+K+L+NLG KVTLS+  SA NR+ 
Sbjct  10    TPHLLPIHQMENLKNECHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIK  69

Query  1347  SRPEIQGLDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRL  1174
             + P+I+GL FAPFSDGYD   + +  D   F +++K+ GS+ +A LI +K + G PFTR+
Sbjct  70    NLPKIEGLTFAPFSDGYDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRV  129

Query  1173  IYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC-SGNQVVEVPGV  997
             IYT +M WAG VA+ LH+P TL W QPATV DIYY+ FT + + F+N  S +Q++E+PG+
Sbjct  130   IYTILMDWAGSVAKKLHIPSTLFWIQPATVFDIYYYRFTNFANYFKNYDSQDQIIELPGL  189

Query  996   PALGVRDFPSFLFS-TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALR  820
             P+L   DFPSF+F   ++N     DWA+E+++ QIE +N EENP++LVNTFDALE +ALR
Sbjct  190   PSLSSSDFPSFVFDDVKSN-----DWAVESIKRQIEILNSEENPRILVNTFDALELNALR  244

Query  819   AIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSY  640
              +K V MVGIGPLIPS++LD +D  D  F  D+ ++ N+Y+EWLD++   SV+Y+AFGSY
Sbjct  245   VLKNVTMVGIGPLIPSSFLDEKDRKDNFFAADMIESENNYMEWLDARANKSVIYIAFGSY  304

Query  639   ADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEV  460
             A++ +  +EEI+QGL+K   PFLWV+RET  GEKPEEKL CK+ELE  G+IV WC+Q+EV
Sbjct  305   AEISSQWMEEISQGLLKCGRPFLWVIRETLNGEKPEEKLTCKDELEKIGRIVCWCSQMEV  364

Query  459   LQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEG  280
             L+H S+GCFLTHCGWNSTLESLASGVP+VACP+WNDQ  NAKLIQDVWK+GVRV+AN+EG
Sbjct  365   LKHSSVGCFLTHCGWNSTLESLASGVPIVACPIWNDQICNAKLIQDVWKIGVRVNANKEG  424

Query  279   VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +VK DE+++CIE VMG  E+GEELR NA+KWK+LAK + K++ SS +NLKAY++E L
Sbjct  425   IVKRDEFQKCIEIVMGDAEEGEELRKNAQKWKDLAKESTKENSSSNVNLKAYVNECL  481



>dbj|BAA19155.1| glucosyl transferase [Nicotiana tabacum]
Length=467

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/461 (60%), Positives = 366/461 (79%), Gaps = 9/461 (2%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CHVL+ +FP QGHINPSLQF+K+L+NLG KVTLS+  SA NR+ + P+I+GL FAPFSDG
Sbjct  8     CHVLIALFPGQGHINPSLQFSKKLINLGVKVTLSSSLSAFNRIKNLPKIEGLTFAPFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD   + +  D   F +++K+ GS+ +A LI +K + G PFTR+IYT +M WAG VA+ L
Sbjct  68    YDGNFKGSFDDYHLFNSAIKSHGSEFIANLIKSKAKNGYPFTRVIYTILMDWAGSVAKKL  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC-SGNQVVEVPGVPALGVRDFPSFLFS-T  952
             H+P TL W QPATV DIYY+ FT + + F+N  S +Q++E+PG+P+L   DFPSF+F   
Sbjct  128   HIPSTLFWIQPATVFDIYYYRFTNFANYFKNYDSQDQIIELPGLPSLSSSDFPSFVFDDV  187

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             ++N     DWA+E+++ QIE +N EENP++LVNTFDALE +ALR +K V MVGIGPLIPS
Sbjct  188   KSN-----DWAVESIKRQIEILNSEENPRILVNTFDALELNALRVLKNVTMVGIGPLIPS  242

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             ++LD +D  D  F  D+ ++ N+Y+EWLD++   SV+Y+AFGSYA++ +  +EEI+QGL+
Sbjct  243   SFLDEKDRKDNFFAADMIESENNYMEWLDARANKSVIYIAFGSYAEISSQWMEEISQGLL  302

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             K   PFLWV+RET  GEKPEEKL CK+ELE  G+IVRWC+Q+EVL+H S+GCFLTHCGWN
Sbjct  303   KCGRPFLWVIRETLNGEKPEEKLTCKDELEKIGRIVRWCSQMEVLKHSSVGCFLTHCGWN  362

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLESLASGVP+VACP+WNDQ  NAKLIQDVWK+GVRV+AN+EG++K DE+++CIE VMG
Sbjct  363   STLESLASGVPIVACPIWNDQICNAKLIQDVWKIGVRVNANKEGIIKRDEFQKCIEIVMG  422

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
               E+GEELR NA+KWK+LAK + K++ SS +NLKAY++E L
Sbjct  423   DAEEGEELRKNAQKWKDLAKESTKENSSSNVNLKAYVNECL  463



>ref|XP_009590508.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/461 (61%), Positives = 350/461 (76%), Gaps = 8/461 (2%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFS  1306
             + CHVLLV FP QG+INP +QF+KRLV LG  VT ST  +A NR+++ P I+GL FAPFS
Sbjct  6     DNCHVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRITNLPTIEGLTFAPFS  65

Query  1305  DGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D   + +  +  +F  S +T GS+ V  L+  +K +G PF R+IYT++  W G++A+
Sbjct  66    DGFDGNFKGSTNNFHEFNKSFRTNGSEFVTDLVKTRKNQGNPFKRIIYTTLTGWVGLLAK  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              ++VP T LW QPATVLDIYY++F  Y D  +NC  ++ +E+ G+P L  RD PSF+F+ 
Sbjct  126   SINVPSTFLWIQPATVLDIYYYFFNGYEDTIKNCPKDKFLELHGLPLLSPRDLPSFVFAD  185

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                     DW + +M+D +E IN E N +VLVNTFDALE DAL  +K V MVGIGPLIPS
Sbjct  186   SN------DWTLLSMKDHVELINSEINQRVLVNTFDALESDALSVLKNVNMVGIGPLIPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG D SDT+FG D+RQ+S DY+EWLDS+ K SVVY+AFGSY+ +PN ++EEIAQGLV
Sbjct  240   AFLDGNDSSDTSFGADMRQDSRDYIEWLDSKAKESVVYVAFGSYSMIPNQLMEEIAQGLV  299

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
               K PFLWV+RE   GEKP E L CKEELE  GK V WC+QVEVLQHPS+ CFLTHCGWN
Sbjct  300   LCKRPFLWVIREGLNGEKPFENLSCKEELEELGKTVPWCSQVEVLQHPSLACFLTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             ST+ESL SGVP+VACPLW DQ  NAKLIQDVWK GVRV+AN EGV++ +E++RCIE V+G
Sbjct  360   STIESLTSGVPVVACPLWTDQLCNAKLIQDVWKTGVRVNANNEGVIERNEFERCIEIVVG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              GEK EEL NNAKKWKELAK AMK+DGSS +NLKAY+ E+L
Sbjct  420   DGEKREELTNNAKKWKELAKDAMKEDGSSNVNLKAYVHEVL  460



>ref|XP_004242781.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=466

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/466 (61%), Positives = 365/466 (78%), Gaps = 13/466 (3%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             +   CHVLLV +P  GHINP LQFAKRLVNLG +VT  T  S  NR+S+ P I+GL FAP
Sbjct  5     KKNNCHVLLVSYPILGHINPCLQFAKRLVNLGVQVTYCTSLSGFNRISNLPTIKGLSFAP  64

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITA-KKEEGRPFTRLIYTSIMSWAGV  1141
             FSDGYD G + +  +   F  SMKT GS+ V  +++    ++   FTR+IYT++M+W G 
Sbjct  65    FSDGYDGGFKGSFDEYHLFCNSMKTYGSEFVINMVSEHTTKKNLAFTRIIYTTLMAWVGS  124

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVP-ALGVRDFPSF  964
             VA+ ++VP TL W QP T+LDIYY+YFT+Y D F+NC  +Q +E+PG+P AL  RDFPSF
Sbjct  125   VAKIINVPSTLFWIQPVTILDIYYYYFTDYADSFKNCPQHQSLELPGLPLALNPRDFPSF  184

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK-KVRMVGIG  787
             +F   TNV Y+ DWA +++++ I+ +N EENP+VLVNTFDALEFDAL+A+K  V MVG+G
Sbjct  185   VF---TNVKYN-DWATQSIKEHIQLLNSEENPRVLVNTFDALEFDALKALKDSVTMVGVG  240

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             P IPS +L+ +D  DT+FG DL+  S +Y++WLD +P  SV+Y+AFGSYA++ N ++EEI
Sbjct  241   PCIPSTFLEEKDRFDTSFGSDLQSTSKNYIDWLDEKPNESVIYIAFGSYAEISNQLMEEI  300

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             AQGL+KS  PFLWV+R+  KGE P+EKLRCKEELE QGKIV WC+QVEVL HPS+GCFLT
Sbjct  301   AQGLLKSGRPFLWVIRKGIKGENPKEKLRCKEELEKQGKIVTWCSQVEVLHHPSVGCFLT  360

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNSTLESLASGVP+VACPLWNDQ  NAKLIQDVWK+GVRVS N+EG+V+ D+++RCI
Sbjct  361   HCGWNSTLESLASGVPIVACPLWNDQLCNAKLIQDVWKIGVRVSVNDEGIVEKDDFERCI  420

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             + VM    KGEE R NAKKWK+LAK  MK++GSS LN++AY++E+L
Sbjct  421   DVVM----KGEECRKNAKKWKDLAKEVMKENGSSNLNMQAYVNEIL  462



>ref|XP_009787090.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=466

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/468 (62%), Positives = 365/468 (78%), Gaps = 17/468 (4%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSR-PEIQGLDFAPF  1309
             E CHVLLV FP+QG INPSLQFAKRL+ LG  VT ST  SA+N MS+    I+GL FAPF
Sbjct  6     ENCHVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCMSNNLSSIKGLTFAPF  65

Query  1308  SDGYDAGLEPA-----DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
             SDGYD G         + ++F+AS    GS+ V+++   + +EGRPF+R+IYT+++SW G
Sbjct  66    SDGYDNGYPNVGKSLDEYREFYASFIALGSEFVSEIFADRAKEGRPFSRIIYTTVLSWVG  125

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPAL-GVRDFP  970
             +VA+ L+ P TLLW QPAT+LD+YY+YFT Y D F+NC   ++ +E+PG+P L  +R+ P
Sbjct  126   IVAKRLNAPATLLWIQPATLLDLYYYYFTSYKDAFKNCPDEDKSLEIPGLPFLVSIREIP  185

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SFL S++      +DW I+ M++ +E IN E N  VLVNTFDALEF+ALRAIK V MVGI
Sbjct  186   SFLLSSDG----LMDWLIQTMKEHVELINSESNEIVLVNTFDALEFEALRAIKNVNMVGI  241

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPL+PS++LDG++PSDT+ GGDLRQ S DY+EWL+++P +SVVY+AFGSY+++P  M+EE
Sbjct  242   GPLVPSSFLDGKNPSDTSHGGDLRQRSKDYMEWLNAKPNASVVYVAFGSYSELPKQMMEE  301

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             IAQGL+ S+ PFLWV+     GEKP E L CKEELE QGKIV WC+QVEVLQHPS+GCFL
Sbjct  302   IAQGLIGSERPFLWVIN----GEKPMENLSCKEELEKQGKIVSWCSQVEVLQHPSLGCFL  357

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESL  G+P+VACPLW DQ  N+ LIQD+WK GVRV+ANEEGV  A E+KRC
Sbjct  358   THCGWNSTLESLVFGIPVVACPLWTDQGCNSTLIQDIWKTGVRVNANEEGVEGA-EFKRC  416

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             IE VMG G++GEELR  AKKW++LAK AMK+DGSS  NLKAY+DE+L+
Sbjct  417   IEIVMGDGKEGEELRKKAKKWRDLAKDAMKEDGSSNENLKAYVDEILN  464



>ref|XP_009622554.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=467

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/469 (61%), Positives = 365/469 (78%), Gaps = 17/469 (4%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSR-PEIQGLDFAPF  1309
             + CHVLLV FP+QG INPSLQFAKRL+ LG  VT ST  SA+N +S+  P ++GL  APF
Sbjct  6     DNCHVLLVTFPSQGQINPSLQFAKRLIKLGVNVTFSTSLSALNCISNNLPSVEGLTLAPF  65

Query  1308  SDGYDAGLEPA-----DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
             SDGYD G         + ++F+AS    GS+ V+++ T + +EGRPF+R+IYT+++SW G
Sbjct  66    SDGYDNGYPNVGKSLDEYREFYASFIALGSEFVSEIFTDRAKEGRPFSRIIYTAVLSWVG  125

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPA-LGVRDFP  970
             +VAR L+ P TLLW QPAT+LDIYY+YFT Y + F+NC   ++ +E+PG+P  +G R+ P
Sbjct  126   IVARRLNAPATLLWIQPATLLDIYYYYFTSYKEAFKNCPDEDKSLEIPGLPFFVGTREIP  185

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SFL S+    N  +DW I+ +++ IE IN E N  VLVNTFDALEF+ALRAIK V MVGI
Sbjct  186   SFLLSS----NGLMDWLIQTIKEHIELINSESNEIVLVNTFDALEFEALRAIKNVNMVGI  241

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIPSA+LDG +PSDT++GGDLRQ S DY+EWL+S+P +SVVY+AFGSY ++P  M+EE
Sbjct  242   GPLIPSAFLDG-NPSDTSYGGDLRQCSKDYMEWLNSKPNASVVYVAFGSYTELPKQMMEE  300

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             IAQGL++S+ PFLWV+     GE   E L CKEELE QGKIV WC+QVEVLQHPS+GCFL
Sbjct  301   IAQGLLQSERPFLWVVN----GENTMENLSCKEELEKQGKIVSWCSQVEVLQHPSLGCFL  356

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESL SG+P+VACPLW DQ  N+KLIQDVWK GVRV+ NE+G V+  E+KRC
Sbjct  357   THCGWNSTLESLVSGIPVVACPLWTDQGCNSKLIQDVWKTGVRVNVNEDGFVEGAEFKRC  416

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             IE VM  G++GEELR NAKKW++ AK  +++DGSS +NLKAY+DE+L+S
Sbjct  417   IEIVMADGKEGEELRKNAKKWRDSAKDTIQEDGSSNVNLKAYVDEVLNS  465



>ref|XP_009778637.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
 ref|XP_009778638.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=463

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/461 (60%), Positives = 353/461 (77%), Gaps = 8/461 (2%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFS  1306
             + CHVLLV FP QG+INP +QF+KRLV LG  VT ST  +A NR+++ P I+GL FAPFS
Sbjct  6     DDCHVLLVTFPGQGNINPCIQFSKRLVKLGVNVTFSTSLTAFNRIANLPTIEGLTFAPFS  65

Query  1305  DGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D   + +  +  +F  S +T+GS+ V  L+  + +EG PF R++YT++  W G++A+
Sbjct  66    DGFDGNFKGSMNNFHEFNNSFRTQGSEFVINLVKTRAKEGNPFKRIVYTTLTGWVGLLAK  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              ++VP T LW QPATVLDIYY++F  Y D  +NC  +Q +E+ G+P L  RD PSF+F+ 
Sbjct  126   NINVPSTFLWIQPATVLDIYYYFFNGYEDTIKNCPKDQFLELHGLPLLFPRDLPSFVFAD  185

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                     DWA+ +M+D +E +N E N +VLVNTFDALE DALR +K V MVGIGPLIPS
Sbjct  186   SN------DWALLSMKDHVELMNSEINQRVLVNTFDALETDALRVLKNVNMVGIGPLIPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG D  DT+FG D+RQ+S DY+EWLDS+ K SV+Y+AFGSY+ +PN ++EEIAQGLV
Sbjct  240   AFLDGNDSFDTSFGADMRQDSRDYIEWLDSKAKESVIYIAFGSYSMIPNHLMEEIAQGLV  299

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
               K PFLWV+R+   GEKP EKL CKEELE  GK V WC+QVEVLQHPS+ CFLTHCGWN
Sbjct  300   LCKRPFLWVIRDGLNGEKPFEKLSCKEELEELGKTVSWCSQVEVLQHPSLACFLTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             ST+ESLASGVP+VACPLW DQ  NAKLIQDVWK GVRV+ N+EGV++ +E++RCIE V+G
Sbjct  360   STIESLASGVPVVACPLWTDQLCNAKLIQDVWKTGVRVNTNDEGVIERNEFERCIEIVVG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              GEK EELR +AKKW+ LAK AMK++GSS +NLKAY+ E+L
Sbjct  420   DGEKREELRKSAKKWRNLAKDAMKEEGSSNVNLKAYVHEVL  460



>ref|XP_009612650.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Nicotiana tomentosiformis]
Length=467

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/461 (59%), Positives = 355/461 (77%), Gaps = 9/461 (2%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CHVL+ IFP QGHINPS QF+K+L+NLG KVTLS   +A NR+ + P+I+GL FAPFSDG
Sbjct  8     CHVLIAIFPGQGHINPSFQFSKKLINLGVKVTLSCSLTAFNRIKNLPKIEGLTFAPFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD   + +  D     +++KT GS+ +A LI +  E G PFTR+IYT +M WAG VA+  
Sbjct  68    YDGNFKGSFDDYHLLNSAIKTHGSEFIANLIKSNAENGCPFTRVIYTILMDWAGSVAKKF  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC-SGNQVVEVPGVPALGVRDFPSFLFS-T  952
             ++P TL W QPATV DIYY+ FT + + F+N  S +Q++E+PG+P+L   +FPSF+F   
Sbjct  128   NIPSTLFWIQPATVFDIYYYRFTNFANYFKNFDSQDQIIELPGLPSLSSSEFPSFVFDDV  187

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             ++N     DWA+E+++ QIE +N EENP++LVNTFDALE +ALR +K V MVGIGP IPS
Sbjct  188   KSN-----DWAVESIKRQIEILNSEENPRILVNTFDALELNALRVLKNVTMVGIGPSIPS  242

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             ++LD +D  D  F  D+ +N N+Y+EWLD++   SV+Y+AFGSYA++ +  +EEI+QGL+
Sbjct  243   SFLDEKDRKDNFFTADMIENENNYMEWLDARANESVIYIAFGSYAEISSQWMEEISQGLL  302

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             K   PFLWV+RET  GEKPEEKL CK+EL   G IVRWC+Q+EVL+HPS+GCFLTHCGWN
Sbjct  303   KCGKPFLWVIRETLNGEKPEEKLTCKDELAKTGIIVRWCSQMEVLKHPSVGCFLTHCGWN  362

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLESLASGVP+VACP+WNDQ  NAKLIQDVWK+GVRV+ NEEG VK DE++RCIE V G
Sbjct  363   STLESLASGVPIVACPIWNDQVCNAKLIQDVWKIGVRVNTNEEGTVKRDEFRRCIEIVTG  422

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
               E+G ELR N +KWK+LAK AMK++ SS +NLKAY++E L
Sbjct  423   NNEEGVELRKNVQKWKDLAKEAMKENCSSNVNLKAYVNEFL  463



>ref|XP_004252977.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=463

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/461 (58%), Positives = 355/461 (77%), Gaps = 8/461 (2%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFS  1306
             + CHVL+V F  QG+INP +QF+K L+ LG  VT ST  +A NR+S+ P IQGL FAPFS
Sbjct  6     DDCHVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRISNLPTIQGLTFAPFS  65

Query  1305  DGYDAGLE-PAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DGYD   + P + + +F AS++T G++ V  L+  + ++G PF R+IYT++ +W G++A+
Sbjct  66    DGYDGNFKGPMNRIHEFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLAK  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              ++VP T LW QPA+VL+IYY++F  Y D  +NCS +Q  E+PG+P L  RDFPS LF+ 
Sbjct  126   KINVPSTFLWIQPASVLNIYYYFFNGYEDSIKNCSKDQSFELPGLPLLSRRDFPSILFND  185

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                     DW + AM++ +E +  E N KVLVNTFDALEFDA+  I+ V + GIGPLIPS
Sbjct  186   SN------DWTLLAMKEHVELLKSETNQKVLVNTFDALEFDAVNVIESVTISGIGPLIPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG D SDT+FG D+R++ + Y++WLDS+ K SV+Y+AFGSY+ +PN ++EEIA GLV
Sbjct  240   AFLDGNDSSDTSFGVDMRRSLDKYMDWLDSKAKESVIYIAFGSYSQIPNQLMEEIAHGLV  299

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
               K PFLW++RE + GEKP EKL CKEELE  GK V WC+QVEVLQHPS+ CFLTHCGWN
Sbjct  300   LCKRPFLWIIREGANGEKPFEKLSCKEELEELGKTVDWCSQVEVLQHPSLACFLTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             S++ESLASGVP+VACPLW DQ  NAKLIQDVWK GVRV+AN+EGV++ +E+ RC+E V+G
Sbjct  360   SSMESLASGVPVVACPLWIDQLSNAKLIQDVWKTGVRVNANDEGVIERNEFARCMEIVVG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              GEKG+E+R NAKKW++LAK AMK++GSS +NLKAY++E+L
Sbjct  420   DGEKGDEIRKNAKKWRDLAKDAMKENGSSNVNLKAYVNEIL  460



>ref|XP_006349902.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=459

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/461 (57%), Positives = 349/461 (76%), Gaps = 12/461 (3%)
 Frame = -3

Query  1485  EGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFS  1306
             + CHVL+V F  QG+INP +QF+K L+ LG  VT ST  +A NR+S+ P IQGL FAPFS
Sbjct  6     DDCHVLVVSFTGQGNINPCIQFSKNLIKLGVNVTFSTSLTAFNRISNLPTIQGLTFAPFS  65

Query  1305  DGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D     +    ++F AS++T G++ V  L+  + ++G PF R+IYT++ +W G++A+
Sbjct  66    DGFDGNFNGSTNSFREFNASLRTHGTEFVTNLVEDRAKQGCPFKRIIYTTLTAWIGLLAK  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              ++VP T LW QPA+VL+IYY++F  Y D  +NCS +Q  E+PG+P L  RDFPS +F+ 
Sbjct  126   SINVPSTFLWIQPASVLNIYYYFFNGYEDSIKNCSKDQSFELPGLPLLSRRDFPSIVFND  185

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                     DW + AM++ +E +  E N KVLVNTFDALEFDAL  I+ V + GIGPLIPS
Sbjct  186   SN------DWTLLAMKEHVELLKSETNQKVLVNTFDALEFDALNVIENVTIFGIGPLIPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG D SDT+FG D+R++  +Y++WLDS+ K SV+Y+AFGSY+ +PN ++EEIA GLV
Sbjct  240   AFLDGNDSSDTSFGVDMRRSLENYMDWLDSKAKKSVIYIAFGSYSQIPNQLMEEIAHGLV  299

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
               K PFLW++RE + GEKP EKL CKEELE  GK V WC+QVEVLQHPS+ CFLTHCGWN
Sbjct  300   LCKRPFLWIIREGANGEKPFEKLSCKEELEELGKTVDWCSQVEVLQHPSLACFLTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             S++ESLASGVP+VACPLW DQ  NAKLIQDVWK GVRV+AN+EGV++ +E+ RCIE V+G
Sbjct  360   SSMESLASGVPVVACPLWIDQLSNAKLIQDVWKTGVRVNANDEGVIERNEFARCIEIVVG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              G    E+R NAKKW++LAK AMK++GSS +NLKAY++E+L
Sbjct  420   DG----EIRKNAKKWRDLAKDAMKENGSSNVNLKAYVNEIL  456



>dbj|BAG80537.1| putative glycosyltransferase [Lycium barbarum]
Length=471

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/467 (56%), Positives = 349/467 (75%), Gaps = 11/467 (2%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             + E  HVL+ IFP QGHINPSLQ +K+L+ LG +VTLS+  SA N++   P IQGL FAP
Sbjct  5     KNEKSHVLIAIFPGQGHINPSLQLSKQLIKLGVEVTLSSSLSAFNKIKKLPNIQGLRFAP  64

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDGYD   + +  +     +S+ + GS+ +  LI +  + G PF+ +IYT +M WAG V
Sbjct  65    FSDGYDGKFKGSFDEYHLLNSSIMSHGSEFILNLIKSNSKNGPPFSHVIYTPLMDWAGSV  124

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC-SGNQVVEVPGVPALGVRDFPSFL  961
             A+ +++P TL WTQPATV DIYY+ FT+Y D F+NC S ++++E+PG+P L   DFPSF+
Sbjct  125   AKKINIPSTLFWTQPATVFDIYYYRFTDYSDYFKNCDSQDKIIELPGLPPLSPIDFPSFV  184

Query  960   FS-TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             F   E N     +WA+E+++ QIE +N EE P +LVNTFD LEFDALR +K V MV IGP
Sbjct  185   FDDVECN-----NWAVESIKRQIEILNNEEYPSILVNTFDDLEFDALRILKNVTMVAIGP  239

Query  783   LIPSAYLD-GEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
              IPS +LD  ++P + +FG D+ + +S +Y+EWLD +P  SV+Y+AFGSY ++   ++EE
Sbjct  240   TIPSNFLDEKKNPCNNSFGADMIEISSKNYMEWLDLRPNESVIYIAFGSYTEISTQLMEE  299

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             I QGL+K   PFLWV+RE   GEKPEEKL CK+ LE +G+IVRWC+QVEVL+HPSIGCFL
Sbjct  300   IGQGLLKCGRPFLWVIREGPNGEKPEEKLSCKDALEKKGEIVRWCSQVEVLKHPSIGCFL  359

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLES+ASGVP+VACP+WNDQ  NAKL+QDVWK GVRV+  E  + +  E++RC
Sbjct  360   THCGWNSTLESIASGVPVVACPIWNDQVCNAKLVQDVWKNGVRVNVGEGSITQRIEFERC  419

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             IE  MGG ++GEELR NAKKW++LAK AMK++ SS +NLKAY++E L
Sbjct  420   IEIAMGGSKEGEELRKNAKKWRDLAKAAMKENDSSNVNLKAYVNEFL  466



>ref|XP_002263700.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/464 (56%), Positives = 349/464 (75%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H LLV FPAQGHINP+LQFAKR++  GA+V+ +T  SA  RM+ R   +GL+F PF
Sbjct  1     MGSPHFLLVTFPAQGHINPALQFAKRIIRTGAQVSFATSVSAHRRMAKRSTPEGLNFVPF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G +P D ++ + + +K RGS+ + +++    +EG+PFT ++YT ++ WA  VAR
Sbjct  61    SDGYDDGFKPTDDVQHYMSEIKRRGSETLREIVVRNADEGQPFTCIVYTLLLPWAAEVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLF  958
             GL VP  LLW QPATVLDIYY+YF  YGD+FRN S      VE+PG+P L  RD PSFL 
Sbjct  121   GLGVPSALLWIQPATVLDIYYYYFNGYGDVFRNISNEPSCSVELPGLPLLSSRDLPSFLV  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              +         + +   ++Q+E ++ E +PKVLVNTFDALE + LRA+ K+ ++GIGPL+
Sbjct  181   KSNAYT-----FVLPTFQEQLEALSQETSPKVLVNTFDALEPEPLRAVDKLHLIGIGPLV  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSAYLDG+DPSDT+FGGD+ Q S+DY+EWL+S+PKSSVVY++FGS + +  T  E+IA+ 
Sbjct  236   PSAYLDGKDPSDTSFGGDMFQGSDDYMEWLNSKPKSSVVYVSFGSISVLSKTQKEDIARA  295

Query  597   LVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L+    PFLWV+R    GE  K ++KL C+EELE +G IV WC+Q+EVL HPS+GCF++H
Sbjct  296   LLDCGHPFLWVIRAPENGEEVKEQDKLSCREELEQKGMIVSWCSQIEVLTHPSLGCFVSH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL SGVP+VA P W DQ  NAKLI+D+WK+G+RV+ NEEG+V++DE+KRC+E
Sbjct  356   CGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDMWKIGIRVTVNEEGIVESDEFKRCLE  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGGEKGEE+R NA+KWK LA+ A+KD GSS  NLK ++DE+
Sbjct  416   IVMGGGEKGEEMRRNAEKWKNLAREAVKDGGSSDKNLKGFVDEV  459



>ref|XP_006342284.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=467

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 344/466 (74%), Gaps = 14/466 (3%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             + E  HVL+ +FP QG INP LQF+K+L+NLG +VTL+T  SA +++   P ++GL FAP
Sbjct  5     KNEKPHVLIALFPGQGQINPCLQFSKQLINLGIEVTLTTSLSAFSKIKKLPNVEGLSFAP  64

Query  1311  FSDGYDAGLEPADLKDFW---ASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             FSDGYD   + + + DF+   +S+K+RGS  +  LI +  + G PF+ +IYT IM W G+
Sbjct  65    FSDGYDGKFQLSSVDDFYLFYSSVKSRGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGL  124

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPALGVRDFPSF  964
             VA+ ++VP TL W QPATV D+YY+ FT Y D F+NC+  ++++E+PG+P L   DFPSF
Sbjct  125   VAKKINVPSTLFWIQPATVFDVYYYRFTNYSDYFKNCTAKDKIIELPGLPPLSPIDFPSF  184

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             +F    + N    WA+++++ QIE +N EENP+VLVNTFDALEFDALR +K V MVGIGP
Sbjct  185   VFDDMESTN----WAVKSIKRQIEMLNSEENPRVLVNTFDALEFDALRILKHVTMVGIGP  240

Query  783   LIPSAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             LIPS  LD     D  F  D+ + +S +Y+ WL+S+ K SV+Y+AFGSY+++ + ++EEI
Sbjct  241   LIPSILLD-----DDTFRADMIEISSKNYINWLNSKDKGSVIYIAFGSYSEISSQLMEEI  295

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
               GL+K   PFLW +RE   GEK E+KL CKEELE QGKIV WC+QVEVL+HPS+GCFLT
Sbjct  296   GHGLLKCGRPFLWAIREGQDGEKMEDKLSCKEELEKQGKIVNWCSQVEVLKHPSVGCFLT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNSTLES+AS VP+VACPLWNDQ  NAKLIQD+WK GVRV+ +E GVV+ DE+ RCI
Sbjct  356   HCGWNSTLESIASKVPIVACPLWNDQVCNAKLIQDIWKNGVRVNVSEGGVVERDEFNRCI  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
                MG  E+GEELR NAKKW  LAK AMK++G+S L LK + +E L
Sbjct  416   TIAMGSDEEGEELRRNAKKWSNLAKEAMKENGTSSLKLKDFANEFL  461



>ref|XP_004229323.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=467

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/466 (55%), Positives = 344/466 (74%), Gaps = 14/466 (3%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             ++E  HVL+ +FP QG INP LQF+K+L+NLG  VTL+T  SA +++   P ++GL FAP
Sbjct  5     KIEKSHVLIALFPGQGQINPCLQFSKQLINLGIGVTLTTSLSAFSKLKCLPNVEGLSFAP  64

Query  1311  FSDGYDAGLEPADLKDF---WASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             FSDGYD   + + + DF   ++S+K+ GS  +  LI +  + G PF+ +IYT IM W G+
Sbjct  65    FSDGYDGQFQLSSVDDFHMFYSSVKSHGSKFIFNLIQSNAKNGTPFSHVIYTIIMEWVGL  124

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPALGVRDFPSF  964
             VA+ +++P TL W QPATV D+YY+ FT+Y D F+N    N+++E+PG+P L   DFPSF
Sbjct  125   VAKKINIPSTLFWIQPATVFDVYYYRFTDYSDYFKNNDAKNKIIELPGLPPLSPIDFPSF  184

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             +F    + N    WA+++++ QIE ++ EENP+VLVNTFDALEFDALR +K V MVGIGP
Sbjct  185   VFDNVESSN----WAVKSIKRQIEMLSSEENPRVLVNTFDALEFDALRILKHVTMVGIGP  240

Query  783   LIPSAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
              IPS ++D     D  F  D+ + +S  Y++WL+S+ + SV+Y+AFGSY+ +   ++EEI
Sbjct  241   SIPSIFID-----DNTFRADMIEISSKIYIDWLNSKDRGSVIYIAFGSYSKISTQLMEEI  295

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
               GL+K   PFLWV+RE   G+K E+KL CK+ELE QGKIV WC+QVEVL+HPS+GCFLT
Sbjct  296   GHGLLKCGRPFLWVIREEQDGDKMEDKLSCKDELEKQGKIVSWCSQVEVLKHPSVGCFLT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNS LES+AS VP+VACPLWNDQ  NAKLIQD+WK GVRV+ +E GVVK DE+ RCI
Sbjct  356   HCGWNSILESIASKVPIVACPLWNDQVCNAKLIQDIWKNGVRVNVSEGGVVKRDEFYRCI  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
               VMG G +G+ELR N KKW +LAK AMK++G+S +NLKA+ +E+L
Sbjct  416   TIVMGDGAEGKELRRNVKKWSDLAKEAMKENGTSSVNLKAFANEIL  461



>ref|XP_002262883.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=469

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/464 (55%), Positives = 346/464 (75%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H LLV FPAQGHINP+LQFAKR++  GA+V+ +T  SA  RM+ RP ++GL F PF
Sbjct  1     MGSPHFLLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPNLEGLQFVPF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G + +D ++ + + +K RGS+ + +++    +EGRPFT +++T ++ WA  VAR
Sbjct  61    SDGYDDGFKSSDDIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLF  958
             GL VP  LLW +PATVLDIYY+YF  YGD FRN S      +E+P +P L  RD PSFL 
Sbjct  121   GLVVPYALLWNEPATVLDIYYYYFNGYGDAFRNISNEPTCSIELPALPLLSSRDLPSFLV  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             ++     +     +  +++Q+E +N E NPKVLVN+FDALE +AL+A+ K+ ++GIGPL+
Sbjct  181   NSNAYTFF-----LPMLQEQLEALNQETNPKVLVNSFDALETEALKAVDKLHLIGIGPLV  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSAYL+ +DPSDT+FGGDL Q S+DY+EWL+S+PKS+VV ++FGS + +  T  EEIA+G
Sbjct  236   PSAYLNSKDPSDTSFGGDLFQGSDDYMEWLNSKPKSTVVNVSFGSISVLSKTQKEEIARG  295

Query  597   LVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L+    PFLWV+R    GE  K E+KL C+EELE +G IV WC+Q+EVL HPS+GCF++H
Sbjct  296   LLDCGQPFLWVIRAPENGEEVKEEDKLSCREELEKKGMIVPWCSQIEVLTHPSLGCFVSH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL SGVP+VA P W DQ  NAKLI+D+WK+G+RV  NEEG+V++DE KRC+E
Sbjct  356   CGWNSTLESLVSGVPVVAFPQWADQGTNAKLIEDIWKIGIRVIVNEEGIVESDEIKRCLE  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
               M GG KGEE++ NA+KWK LA+ A+KD GSS +NLK ++DE+
Sbjct  416   IAMRGGVKGEEMKRNAEKWKNLAREAVKDGGSSDMNLKGFVDEV  459



>emb|CDP15120.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/464 (56%), Positives = 336/464 (72%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS----SRPEIQGLD  1321
             ME CH L+V FP QGHINP+LQFAKRL  LG + T ST   A+NRMS    S PE   L 
Sbjct  1     MENCHFLVVTFPGQGHINPTLQFAKRLAKLGVRTTFSTSLGAINRMSRASDSLPE--KLS  58

Query  1320  FAPFSDGYDAG-LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
                FSDGYD G     D++++  S+ TRGS  + +LI A+  EGRP T ++Y  +M W G
Sbjct  59    IVAFSDGYDQGWTTDDDVQEYMTSLVTRGSQTLKELIMAQSNEGRPITHVVYAILMPWVG  118

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR L +P TLLW QPA +  +YY +F   G++  + S ++ +++PG+P L  RD P+F
Sbjct  119   QVARQLQIPSTLLWIQPAALFQLYYCFFNGCGEVIGDISSSKAIKLPGLPTLASRDLPTF  178

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L ++  +V     +A+  +    E +  EE PKVLVNTFDALE + L+A  K+++V +GP
Sbjct  179   LLASNPDV---YSFALPTINKHFELLQEEETPKVLVNTFDALESETLKAAVKLKLVAVGP  235

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPS++LDG D SD++FGGDL Q + D VEWL+S+  +SVVY+AFGS+ADVP   LEEIA
Sbjct  236   LIPSSFLDGRDSSDSSFGGDLLQETKDCVEWLNSKNDASVVYVAFGSFADVPLKQLEEIA  295

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             QGL++SK PFLWVLR++ KGEK EEKL CK+ELE QG IV WC+QVEVL HPS+GCF++H
Sbjct  296   QGLLQSKKPFLWVLRKSPKGEKLEEKLSCKDELEKQGLIVSWCSQVEVLSHPSVGCFVSH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNS+LESLASGVP+VA PLW DQ  NAK IQDVWK G+R +ANEEG V+ADE +R +E
Sbjct  356   CGWNSSLESLASGVPVVAIPLWTDQTTNAKFIQDVWKTGIRPTANEEGTVEADEIRRSLE  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GG +GEE+R  AKKW+ELA  A KD GSS LN+KA+++E+
Sbjct  416   IVMDGGVRGEEMRKTAKKWRELAVEAAKDGGSSSLNVKAFVNEV  459



>emb|CAN67608.1| hypothetical protein VITISV_036779 [Vitis vinifera]
Length=469

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/464 (55%), Positives = 344/464 (74%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H LLV FPAQGHINP+LQFAKR++  GA+V+ +T  SA  RM+ RP ++GL F PF
Sbjct  1     MGSPHFLLVTFPAQGHINPALQFAKRMIRTGAEVSFATSVSAHRRMAKRPNLEGLQFVPF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G + +D ++ + + +K RGS+ + +++    +EGRPFT +++T ++ WA  VAR
Sbjct  61    SDGYDDGFKSSDDIQQYMSEIKRRGSETLREIVVRNSDEGRPFTCIVHTLLVPWAAEVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLF  958
             GL VP  LLW +PATVLDIYY+YF  YGD FRN S      +E+P +P L  RD PSFL 
Sbjct  121   GLVVPYALLWNEPATVLDIYYYYFNGYGDAFRNISNEPTCSIELPALPLLSSRDLPSFLV  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             ++     +     +  +++Q+E +N E NPKVLVN+FDALE +AL+A+ K+ ++GIGPL+
Sbjct  181   NSNAYTFF-----LPMLQEQLEALNQETNPKVLVNSFDALETEALKAVDKLHLIGIGPLV  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
              SAYL+ +DPSDT+FGGDL Q S+DY+EWL+S+PKS+VV + FGS + +  T  EEIA+G
Sbjct  236   XSAYLNSKDPSDTSFGGDLFQGSDDYMEWLNSKPKSTVVNVXFGSISVLSKTQKEEIARG  295

Query  597   LVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L+    PFLWV+R    GE  K E+KL C+EELE +G IV WC+Q+EVL HPS+GCF++H
Sbjct  296   LLDCGQPFLWVIRAPENGEEVKEEDKLSCREELEKKGMIVPWCSQIEVLTHPSLGCFVSH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL SGVP+VA P W DQ  NAKLI+D+WK+G+RV  NEEG+V++DE KRC+E
Sbjct  356   CGWNSTLESLVSGVPVVAFPQWADQGTNAKLIEDIWKIGIRVIVNEEGIVESDEIKRCLE  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
               M GG KGEE++ NA+KWK LA+ A+KD GSS +NLK ++DE+
Sbjct  416   IAMRGGVKGEEMKRNAEKWKNLAREAVKDGGSSDMNLKGFVDEV  459



>dbj|BAG80544.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=469

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/464 (56%), Positives = 346/464 (75%), Gaps = 12/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGLDFAP  1312
             HVLLV FPAQGHINPSLQFAKRL+ LG +VT +T   A  RM     S+ PE  GL+F  
Sbjct  5     HVLLVTFPAQGHINPSLQFAKRLIKLGIEVTFATSVFAHRRMTKTAASTAPE--GLNFVA  62

Query  1311  FSDGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDG+D G  L+  D K + + +++RGS  +  +I    ++GRP T L+YT ++ WA  V
Sbjct  63    FSDGFDDGFKLDTDDGKRYMSEIRSRGSQTLRDIILKSSDDGRPVTSLVYTLLLPWAAEV  122

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSF  964
             AR  H+P  LLW QPA VLDIYY+YF  Y D  ++ + +    +++PG+P L  +D PSF
Sbjct  123   AREHHIPCALLWIQPAAVLDIYYYYFNGYEDEMKSSTDDPTWRIQLPGLPLLKSQDLPSF  182

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L ++ + +N     A+   ++Q++ ++GEENPKVLVNTFDALE +AL+AI+K  ++GIGP
Sbjct  183   LVASNSKLNGKYSSALPTFKEQLDTLDGEENPKVLVNTFDALEPEALKAIEKYNLIGIGP  242

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             L+PS++ DG+DP D+AFGGDL Q SNDY+EWLDSQPKSS+VY++FGS  ++     EEIA
Sbjct  243   LVPSSFFDGKDPLDSAFGGDLFQKSNDYMEWLDSQPKSSIVYISFGSLLNLSRNQKEEIA  302

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             +GL++ K PFLWV+R+  +  K EE+L C  ELE QGKIV WC+Q+EVL HPS+GCF++H
Sbjct  303   KGLIEIKRPFLWVIRD-QENVKEEEELSCMMELEKQGKIVPWCSQLEVLTHPSLGCFVSH  361

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL+SG+P+VA P W DQ  NAKLI+DVWK GVRV ANE+GVV+++E KRCIE
Sbjct  362   CGWNSTLESLSSGMPVVAFPHWTDQGTNAKLIEDVWKTGVRVKANEDGVVESEEIKRCIE  421

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GGE+GEE+R NAKKWKELA  A+K+ GSS +NLKA++ E+
Sbjct  422   IVMDGGEEGEEMRKNAKKWKELAGEALKEGGSSEMNLKAFVQEV  465



>ref|XP_004247896.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=476

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/466 (54%), Positives = 337/466 (72%), Gaps = 19/466 (4%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             R +  HVL+VIFPAQGHINPSLQ +KRL++LG KVTLST  SA N++   P I+GL FAP
Sbjct  24    RNDKSHVLIVIFPAQGHINPSLQLSKRLIDLGIKVTLSTSLSAFNKIKILPNIEGLSFAP  83

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDGYD   + +  +   +++S+K+ GS+ +  LI +  +   PFT +IYT +M W  +V
Sbjct  84    FSDGYDGNFKGSFNEFHLYYSSIKSHGSEFIFNLIKSNAKNCTPFTHVIYTVVMEWTALV  143

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN-QVVEVPGVPALGVRDFPSFL  961
             A+ L+ P TL W QPATV DIYY+ +T+Y D F+NC  N +++E+PG+P L   DFPSF+
Sbjct  144   AKELNTPSTLFWIQPATVFDIYYYRYTDYSDYFKNCDSNDKIIELPGLPPLSPIDFPSFV  203

Query  960   F-STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             F + E N     +WA E+++ QI+ +N E+NPK+LVNTFD LE DALR +  V M+GIGP
Sbjct  204   FDNVECN-----NWAAESIKTQIDLLNSEKNPKILVNTFDDLELDALRILNNVTMIGIGP  258

Query  783   LIPSAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             LIPS +LD     D +F  D+ + +SN+Y+ WLD   K SV+Y+AFGSY +  + ++EEI
Sbjct  259   LIPSIFLD-----DNSFRADMIEVSSNNYMNWLDLMTKGSVIYVAFGSYTETSSQLMEEI  313

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
              QGL+K   PFLWV+RE        + L CK+ELE +GK+V WC+Q EVL+HPS+GCFLT
Sbjct  314   GQGLLKCGRPFLWVIREGQN----RKNLTCKDELEKKGKLVSWCSQAEVLKHPSVGCFLT  369

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNSTLES+ASGVP+VACP+WNDQ  NAKL+QDVWK GVRV+  ++G+ + DE++RCI
Sbjct  370   HCGWNSTLESIASGVPVVACPIWNDQLCNAKLVQDVWKNGVRVNIGDKGIAERDEFERCI  429

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             E VMG  E+G +LRNN KKW  LAK AMK +GSS +NLK Y +E  
Sbjct  430   EIVMGNSEEGGKLRNNVKKWSNLAKEAMKKNGSSVMNLKTYANEFF  475



>emb|CDP15119.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/464 (56%), Positives = 329/464 (71%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS----SRPEIQGLD  1321
             ME CH L+V FPAQGHINP+LQFAKRL  LG K T ST   A+NRM+    S PE   L 
Sbjct  1     MEKCHFLIVTFPAQGHINPTLQFAKRLAKLGVKTTFSTSLGAINRMNKASGSLPE--KLS  58

Query  1320  FAPFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
                FSDGYD G  P D    +  S  TRGS  + +LI A+  EG P T ++YT +MSW G
Sbjct  59    IVAFSDGYDHGWNPNDDFGRYMTSAATRGSQTLKELIMAQSNEGHPITHVVYTILMSWVG  118

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR L +P TLLW QPA V  +YY +F    ++  + S ++ +++PG+P L  RD PS 
Sbjct  119   QVARQLQIPSTLLWIQPAAVFQLYYCFFNGCAEIIGDISSSKTIKLPGLPTLASRDLPSV  178

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L ++  +V     +A+ A+    E +  EE P VLVNTFDALE + L+A  K+++V +GP
Sbjct  179   LLASNPDV---YSFALPAINKHFELLQEEETPTVLVNTFDALESETLKAAVKLKLVAVGP  235

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+LDG D SD++FGGDL Q + D  EWL+S+  +SVVY+AFGS++D+P   LEEIA
Sbjct  236   LIPSAFLDGRDSSDSSFGGDLLQETKDCAEWLNSKNGASVVYVAFGSFSDLPLKQLEEIA  295

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             QGL++SK PFLWV+R++ KGEK  EKL CK+ELE QG IV WC+QVEVL HPS+GCF++H
Sbjct  296   QGLLQSKKPFLWVIRKSPKGEKLGEKLSCKDELEKQGLIVSWCSQVEVLSHPSVGCFVSH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNS+LESLASGVP+VA P+W DQ  NAK IQDVWK G+R   NEEG V+ADE +R +E
Sbjct  356   CGWNSSLESLASGVPVVAIPIWTDQTTNAKFIQDVWKTGIRPMGNEEGTVEADEIRRSLE  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GG +GEE+R  AKKW+ELA  A KD GSS LN+KA++DE+
Sbjct  416   IVMDGGVRGEEMRKTAKKWRELAVEAAKDGGSSSLNVKAFVDEV  459



>ref|XP_009601422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=470

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/464 (55%), Positives = 338/464 (73%), Gaps = 11/464 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI---QGLDFAPFS  1306
             HVLLV FPAQGHINP LQFA RL+ +G +VT +T   A  RM+        +GL+FA FS
Sbjct  5     HVLLVTFPAQGHINPCLQFANRLIRMGIEVTFATSVFAHRRMAKTTTFTLSKGLNFAAFS  64

Query  1305  DGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DGYD G   +  D + + + +K+RGS+ +  +I    +EGRP T L+Y+ ++ WA  VAR
Sbjct  65    DGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAAKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLF  958
               H+P  LLW QPATVLDIYY+YF  Y D  +  +   N  +++P +P L  +D PSFL 
Sbjct  125   EFHIPCALLWIQPATVLDIYYYYFNGYEDAIKGSTNDPNWCIQLPRLPLLKSQDLPSFLL  184

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             S+     Y   +A+   ++Q++ ++ EENPKVLVNTFDALE   L+AI+K  ++GIGPLI
Sbjct  185   SSSNEEKYS--FALPTFKEQLDTLDVEENPKVLVNTFDALEPKELKAIEKYNLIGIGPLI  242

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PS +LDG+DP D++FGGDL Q SNDY+EWL+S+  SSVVY++FGS  ++     EEIA+G
Sbjct  243   PSTFLDGKDPLDSSFGGDLFQKSNDYIEWLNSKANSSVVYISFGSLLNLSKDQKEEIAKG  302

Query  597   LVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L++ K PFLWV+R  E  KG++ EEKL C  ELE QGKIV WC+Q+EVL HPSIGCF++H
Sbjct  303   LIEIKKPFLWVIRDQENGKGDEKEEKLSCMMELEKQGKIVPWCSQLEVLTHPSIGCFVSH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK GVR+  NE+GVV+++E KRCIE
Sbjct  363   CGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNEDGVVESEEIKRCIE  422

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  423   MVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  466



>ref|XP_009790237.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=468

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/466 (56%), Positives = 341/466 (73%), Gaps = 17/466 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGLDFAP  1312
             HVLLV FPAQGHINP LQFA RL+ +G +VT +T   A  RM     S+ P  +GL+FAP
Sbjct  5     HVLLVTFPAQGHINPCLQFAMRLIRMGIEVTFATSLFAHRRMAKTATSTLP--KGLNFAP  62

Query  1311  FSDGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDGYD G   +  D + + + +K+RGS+ +  +I    +EGRP T L+Y+ ++ WA  V
Sbjct  63    FSDGYDDGFKADEHDSQHYMSEIKSRGSETLKDIILKSSDEGRPVTSLVYSLLLPWAANV  122

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPS  967
             AR  H+P  LLW QPATVLDIYY+YF  Y D  + CS N     +++P +P L  +D PS
Sbjct  123   AREFHIPCALLWIQPATVLDIYYYYFNGYEDAIK-CSTNDPNWCIQLPNLPLLKSQDLPS  181

Query  966   FLFSTETNV-NYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             FL S+  N  NY   +A+   ++Q++ ++ EENPKVLVNTFDALE + L+AI+K  ++GI
Sbjct  182   FLLSSSNNEGNYS--FALPTFKEQLDTLDVEENPKVLVNTFDALEQEELKAIEKYNLIGI  239

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIPS +LDG+DP D++FGGDL Q SNDY+EWL+S+  SSVVY++FGS  ++     EE
Sbjct  240   GPLIPSTFLDGKDPLDSSFGGDLFQKSNDYIEWLNSKANSSVVYISFGSLLNLSKDQKEE  299

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             IA+GL++ K PFLWV+R+   G K EEKL C  ELE  GKIV WC+Q+EVL HPS+GCF+
Sbjct  300   IAKGLIEIKRPFLWVIRDQENG-KEEEKLSCMMELEKHGKIVPWCSQLEVLTHPSLGCFV  358

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             +HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK GVR+  NE+GVV+ +E KRC
Sbjct  359   SHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNEDGVVENEEIKRC  418

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             IE VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  419   IEMVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  464



>dbj|BAB88935.1| glucosyltransferase [Nicotiana tabacum]
Length=470

 Score =   528 bits (1360),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/464 (55%), Positives = 338/464 (73%), Gaps = 11/464 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM---SSRPEIQGLDFAPFS  1306
             HVLLV FPAQGHINP LQFAKRL+ +G +VT +T   A  RM   ++    +GL+FA FS
Sbjct  5     HVLLVTFPAQGHINPCLQFAKRLIRMGIEVTFATSVFAHRRMAKTTTSTLSKGLNFAAFS  64

Query  1305  DGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DGYD G   +  D + + + +K+RGS  +  +I    +EGRP T L+Y+ ++ WA  VAR
Sbjct  65    DGYDDGFKADEHDSQHYMSEIKSRGSKTLKDIILKSSDEGRPVTSLVYSLLLPWAAKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLF  958
               H+P  LLW QPATVLDIYY+YF  Y D  +  +   N  +++P +P L  +D PSFL 
Sbjct  125   EFHIPCALLWIQPATVLDIYYYYFNGYEDAIKGSTNDPNWCIQLPRLPLLKSQDLPSFLL  184

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             S+     Y   +A+   ++Q++ ++ EENPKVLVNTFDALE   L+AI+K  ++GIGPLI
Sbjct  185   SSSNEEKYS--FALPTFKEQLDTLDVEENPKVLVNTFDALEPKELKAIEKYNLIGIGPLI  242

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PS +LDG+DP D++FGGDL Q SNDY+EWL+S+  SSVVY++FGS  ++     EEIA+G
Sbjct  243   PSTFLDGKDPLDSSFGGDLFQKSNDYIEWLNSKANSSVVYISFGSLLNLSKNQKEEIAKG  302

Query  597   LVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L++ K PFLWV+R  E  KG++ EEKL C  ELE QGKIV WC+Q+EVL HPSIGCF++H
Sbjct  303   LIEIKKPFLWVIRDQENGKGDEKEEKLSCMMELEKQGKIVPWCSQLEVLTHPSIGCFVSH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL+SGV +VA P W DQ  NAKLI+DVWK GVR+  NE+GVV+++E KRCIE
Sbjct  363   CGWNSTLESLSSGVSVVAFPHWTDQGTNAKLIEDVWKTGVRLKKNEDGVVESEEIKRCIE  422

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  423   MVMDGGEKGEEMRRNAQKWKELAREAVKEGGSSEMNLKAFVQEV  466



>ref|XP_002263301.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=464

 Score =   518 bits (1335),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 251/463 (54%), Positives = 336/463 (73%), Gaps = 10/463 (2%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
               +LLV +PAQGHINPSLQ AK L   GA VT  T  SA  RMS  P ++GL+F  FSDG
Sbjct  3     AQILLVTYPAQGHINPSLQLAKLLTRAGAHVTFVTSSSASTRMSKPPTLEGLEFVTFSDG  62

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +  D L++F + +   GS A+ +LI A+  EGRPFT L+Y  I+ W   VA+  H
Sbjct  63    YDHGFKHGDDLQNFMSELDRLGSQALTELIVARANEGRPFTCLLYGIIIPWVAEVAQSFH  122

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN---QVVEVPGVPALGVRDFPSFLFST  952
             +P  L+W+Q ATV DIYY+YF  YG+L  N  GN     +E+PG+P L   D PSFL   
Sbjct  123   LPSALVWSQAATVFDIYYYYFNGYGELIGN-KGNGSSSSIELPGLPLLSSSDLPSFL---  178

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             E +     ++ +++++ Q+E +N E NP+VLVN+FDALE +ALRA+ K +++GIGPL+P 
Sbjct  179   EPSKAIAFNFVLKSLQKQLEQLNRESNPRVLVNSFDALESEALRALNKFKLMGIGPLLPL  238

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG+DPSDT+FGGDL ++S DY++WL+S+P+SSV+Y++FGS + +     EEIA+GL+
Sbjct  239   AFLDGKDPSDTSFGGDLFRDSKDYIQWLNSKPESSVIYVSFGSLSVLSKQQSEEIARGLL  298

Query  591   KSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
              S  PFLWV+R    GE  K ++KL C EELE QG IV WC+QVEVL HPS+GCF++HCG
Sbjct  299   ASGRPFLWVIRAKENGEEEKEDDKLSCVEELEQQGMIVPWCSQVEVLSHPSLGCFVSHCG  358

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNSTLESLA GVP+VA P W DQ  NAKLI+DVWK G+RV  N+EG+V+  E K+C+E V
Sbjct  359   WNSTLESLACGVPVVAFPQWTDQTTNAKLIEDVWKTGLRVMVNQEGIVEGGEIKKCLELV  418

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             MG GEKG+E+R NAKKWK+LA+ A+K+ GSS  NLK +++E++
Sbjct  419   MGCGEKGQEVRRNAKKWKDLAREAVKEGGSSDKNLKNFVNEII  461



>ref|XP_011020320.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=472

 Score =   517 bits (1332),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 259/462 (56%), Positives = 338/462 (73%), Gaps = 14/462 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS---SRPEIQGLDFAPFS  1306
             H+LLV FPAQGHINP+LQFAKRLV +GA VT ST   A  RMS   + PE  GL FA F 
Sbjct  9     HILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKTGTYPE--GLSFAAFD  66

Query  1305  DGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             DG + G  P+D +  ++  ++  GS ++A+LI A  + GRPFTR++Y++++ W   VAR 
Sbjct  67    DGSEHGFRPSDDINHYFTELRLVGSKSLAELIVASSKNGRPFTRVVYSNLIPWVAKVARE  126

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFS  955
             L +P TLLW Q   +LDI+Y+YF  YGD  R    +    +++PG+P LG RD PSF   
Sbjct  127   LKLPSTLLWNQSPALLDIFYYYFNGYGDTIRENINDPTFSLKLPGLPPLGSRDLPSFFNP  186

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
               T+      +AI   R+ IE ++ E NPKVLVNTFDALE +AL +I K ++VG+GPLIP
Sbjct  187   RNTHA-----FAIPVNREHIEVLDEETNPKVLVNTFDALECEALNSIGKYKLVGVGPLIP  241

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             SA+LDGEDP+DT+FGGDL Q S D++EWL+S+P+SSV+Y+AFGS + +     EE+A+ L
Sbjct  242   SAFLDGEDPTDTSFGGDLFQGSKDHIEWLNSKPESSVIYIAFGSISALSKPQKEEMARAL  301

Query  594   VKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
             +++  PFLWV+R     EK E KL C EELE QGKIV WC+QVEVL HPSIGCF+THCGW
Sbjct  302   LETGRPFLWVIRADRGEEKEEGKLSCNEELEKQGKIVPWCSQVEVLSHPSIGCFVTHCGW  361

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV-SANEEGVVKADEYKRCIECV  238
             NST ESL+SGVP+VA P W DQ  NAK+++DVWK GVRV S+N+EGVV+ +E +RC+E V
Sbjct  362   NSTFESLSSGVPMVAFPQWTDQLTNAKMVEDVWKTGVRVTSSNKEGVVEGEEIERCLELV  421

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             MGGGE+G E+R NAKKWKELA+ + K+ GSSY NLKA++DE+
Sbjct  422   MGGGERGSEIRKNAKKWKELARQSSKEGGSSYNNLKAFVDEI  463



>ref|XP_002263975.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   515 bits (1327),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 336/461 (73%), Gaps = 9/461 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
              +LLV +PAQGHINPSLQ AK L+  GA VT  T  SA  RMS  P + GL+F  FSDGY
Sbjct  4     QILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSKSPTLDGLEFVTFSDGY  63

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G +  D L++F + ++  GS A+ KLI A+  EGRPFT L+Y  ++ W   VAR LH+
Sbjct  64    DHGFDHGDGLQNFMSELERLGSPALTKLIMARANEGRPFTCLLYGMLIPWVAEVARSLHL  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN---QVVEVPGVPALGVRDFPSFLFSTE  949
             P  L+W+QPA V DIYY+YF  YG+L  N  GN     +E+PG+P +   D PSFL  ++
Sbjct  124   PSALVWSQPAAVFDIYYYYFNGYGELIGN-KGNGSSSSIELPGLPLISSSDLPSFLVPSK  182

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
              + +   ++ ++  + Q+E +N E NP+VLVN+FDALE +ALRAI K +++GIGPL+PSA
Sbjct  183   VSAH---NFVLKLHQKQLEQLNRESNPRVLVNSFDALESEALRAINKFKLMGIGPLLPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDG+DPSDT+FGGDL + S DY++WL+S  +SSV+Y++FGS + +     EEIA+GL+ 
Sbjct  240   FLDGKDPSDTSFGGDLFRGSKDYIQWLNSNAESSVIYVSFGSLSVLSKQQSEEIARGLLD  299

Query  588   SKMPFLWVLRETSKGEKPEEK-LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             S  PFLWV+R     E+ +E  L C EELE  G IV WC+QVEVL HPS+GCF++HCGWN
Sbjct  300   SGRPFLWVIRAKENEEEEKEDKLSCVEELEQLGMIVPWCSQVEVLSHPSLGCFVSHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLESLASGVP+VA P W DQ  NAKLI+DVWK G+RV  N+EG+V+  E K+C+E VMG
Sbjct  360   STLESLASGVPVVAFPQWTDQTTNAKLIEDVWKTGLRVMVNQEGIVEGGEIKKCLELVMG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             GGE+G+E+R+NAKKWK+LA+ A+KD GSS  NLK ++DE++
Sbjct  420   GGERGQEVRSNAKKWKDLAREAVKDGGSSDKNLKNFVDEII  460



>ref|XP_002308970.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE92493.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=472

 Score =   512 bits (1318),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 336/460 (73%), Gaps = 10/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI-QGLDFAPFSDG  1300
             H+LLV FPAQGHINP+LQFAKRLV +GA VT ST   A  RMS      +GL FA F DG
Sbjct  9     HILLVTFPAQGHINPALQFAKRLVAIGAHVTFSTSMGAARRMSKTGTYPKGLSFAAFDDG  68

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
              + G  P+D +  ++  ++  GS ++A+LI A  + GRPFT ++Y++++ W   VAR L+
Sbjct  69    SEHGFRPSDDIDHYFTELRLVGSKSLAELIAASSKNGRPFTCVVYSNLVPWVAKVARELN  128

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTE  949
             +P TLLW Q   +LDI+Y+YF  YGD       +    +++PG+P LG RD PSF     
Sbjct  129   LPSTLLWNQSPALLDIFYYYFNGYGDTISENINDPTFSLKLPGLPPLGSRDLPSFFNPRN  188

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             T+      +AI   R+ IE ++ E NPKVLVNTFDALE +AL +I K ++VG+GPLIPSA
Sbjct  189   THA-----FAIPVNREHIEVLDEETNPKVLVNTFDALECEALNSIGKFKLVGVGPLIPSA  243

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDGEDP+DT+FGGDL Q S D++EWL+S+P+ SV+Y+AFGS + +     EE+A+ L++
Sbjct  244   FLDGEDPTDTSFGGDLFQGSKDHIEWLNSKPELSVIYIAFGSISALSKPQKEEMARALLE  303

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  PFLWV+R     EK E+KL CKEELE QGKIV WC+QVEVL HPSIGCF+THCGWNS
Sbjct  304   TGRPFLWVIRADRGEEKEEDKLSCKEELEKQGKIVPWCSQVEVLSHPSIGCFVTHCGWNS  363

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV-SANEEGVVKADEYKRCIECVMG  232
             T ESLASGVP+VA P W DQ  NAK+++DVWK GVRV S+N+EGVV+ +E +RC+E VMG
Sbjct  364   TFESLASGVPMVAFPQWTDQLTNAKMVEDVWKTGVRVTSSNKEGVVEGEEIERCLEVVMG  423

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             GGE+G E+R NAKKWKELA+ + K+ GSSY NLKA++DE+
Sbjct  424   GGERGNEMRKNAKKWKELARQSSKEGGSSYNNLKAFVDEI  463



>ref|XP_011024782.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   511 bits (1317),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 254/463 (55%), Positives = 323/463 (70%), Gaps = 13/463 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LL+ +PAQGHINP+LQFAK L  +G  VTL T  SA  RMS      G+ F  FSDGY
Sbjct  6     HFLLLTYPAQGHINPALQFAKGLTRIGVLVTLVTSLSAGRRMSKTLFPDGVSFVTFSDGY  65

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G +P D +D F + +K RGS  + +LI    +EG+P T L+YT ++ WA  VAR  H+
Sbjct  66    DDGFKPEDDRDHFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLQWAAEVARAQHL  125

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFSTETN  943
             P  LLW QPATV DIYY+YF  YGD+F NC      +E+PG+P    RD PSF+  + T 
Sbjct  126   PAALLWIQPATVFDIYYYYFNGYGDIFNNCKDTSYAIELPGLPPFASRDLPSFVLPSNTY  185

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                   +AI+  ++Q+E ++ E NPKVLVN+FDALE  A+ A +K  ++GIGPLIPSA+L
Sbjct  186   T-----FAIQMFQEQLEQLSQETNPKVLVNSFDALELGAMSATEKFNLIGIGPLIPSAFL  240

Query  762   DGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSK  583
             DG+DP D +FGGD+ Q S DY EWLDS+ KSSVVY++FGS+  +    +EEIA+GLV S 
Sbjct  241   DGKDPLDKSFGGDIFQGSEDYTEWLDSKTKSSVVYVSFGSFLVLSKQQIEEIARGLVDSG  300

Query  582   MPFLWVLRETSKGEKP-----EEKLRCKEE-LEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             +PFLWV+R+  K  +      +    C+E  LE QG IV WC QVEVL HPSIGCF+THC
Sbjct  301   LPFLWVIRDEQKKNEEKEEEEDHPSACREAILERQGMIVPWCCQVEVLSHPSIGCFVTHC  360

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNSTLESL S VP+VA P W DQ  NAKLI DVWK GVRV+ANEEG+VK DE KRC++ 
Sbjct  361   GWNSTLESLVSEVPVVAFPHWTDQGTNAKLIADVWKTGVRVAANEEGIVKGDEIKRCLDL  420

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VM  G+ GE++R NAKKWK+LA+ A+K+ GSS  NLKA++ E+
Sbjct  421   VMAHGKMGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFVQEV  463



>ref|XP_002321086.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|EEE99401.2| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=467

 Score =   509 bits (1311),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 255/462 (55%), Positives = 325/462 (70%), Gaps = 12/462 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV  P QGHINPS+QFAKRL  +GA+VTL+T  SA  RMS      GL F  FSDGY
Sbjct  6     HFLLVTLPLQGHINPSVQFAKRLTLIGARVTLATALSAQRRMSKTLFPDGLSFVTFSDGY  65

Query  1296  DAGLEPADLK-DFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D GL+P D +  + + +K RGS  + +LI    +EG+P T L+YT ++ WA  VAR  H+
Sbjct  66    DDGLKPEDDRVHYMSELKRRGSQTLNELIVDSAKEGKPITCLVYTVLLPWAVEVARAQHL  125

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPALGVRDFPSFLFSTETN  943
             P   LW QPATV DIY++YF  YGD+F NC   + V+ +PG+P    RD PSFL  + T+
Sbjct  126   PAAFLWIQPATVFDIYFYYFNCYGDIFSNCKDTSNVIALPGLPQFASRDLPSFLLPSNTS  185

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                    A+   ++Q+E +  E NPKVLVN+FDALE  A+ A +K  ++GIGPLIPSA+L
Sbjct  186   TA-----ALHLFQEQLEQLGQETNPKVLVNSFDALELGAMNATEKFSLIGIGPLIPSAFL  240

Query  762   DGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSK  583
             DG+DP D +FGGDL Q S DY EWL+S+PKSSVVY++FGS   + N  +EEI++GLV+  
Sbjct  241   DGKDPLDKSFGGDLFQGSEDYTEWLNSKPKSSVVYVSFGSILVLSNRQMEEISRGLVQGG  300

Query  582   MPFLWVLRETSKGEKPEEKLR----CKEE-LEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             +PFLWV+R+    +K +E+      C+E  LE QG +V WC QVEVL HPSIGCF+THCG
Sbjct  301   LPFLWVVRDEQNKKKEKEEDDQLSACREAILEKQGMVVPWCCQVEVLSHPSIGCFVTHCG  360

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNSTLESL SGVP+VA P W DQ  NAKLI+DVWK GVRV ANEEG+V+ DE KR ++ V
Sbjct  361   WNSTLESLVSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRVVANEEGIVEGDEIKRSLDLV  420

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             M  G+ GE+ R NAKKWK+LA  A+KD GSS  NLKA++DE+
Sbjct  421   MADGKTGEDFRKNAKKWKDLALDAVKDGGSSDKNLKAFVDEV  462



>ref|XP_002267526.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   506 bits (1302),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 248/459 (54%), Positives = 323/459 (70%), Gaps = 8/459 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H+L+V  P+QGHINP+LQ AK L+  GA VT  T  SA  RMS  P + GL+FA FSDGY
Sbjct  4     HILIVTLPSQGHINPTLQLAKLLIRAGAHVTFFTSTSAGTRMSKSPNLDGLEFATFSDGY  63

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D GL+  D ++ F + ++  GS A+ +LI A   EGRPF  L+Y   + W   VA  LH+
Sbjct  64    DHGLKQGDDVEKFMSQIERLGSQALIELIMASANEGRPFACLLYGVQIPWVAEVAHSLHI  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFLFSTET  946
             P  L+WTQPA V DIYY+YF  YG+L +N   +    +E+PG+P L   D PSFL   + 
Sbjct  124   PSALVWTQPAAVFDIYYYYFNGYGELIQNKGDHPSSTIELPGLPLLNNSDLPSFLIPPKG  183

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
             N      +A+   +  +E +N E NPKVL+N+FDALE +AL AI K  ++GIGPLIPSA+
Sbjct  184   NT---YKFALPGFQKHLEMLNCESNPKVLINSFDALESEALGAINKFNLMGIGPLIPSAF  240

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             LDG+DPSDT+FGGDL ++S DY++WL+S+PKSSV+Y++FGS   +     EEIA+GL+  
Sbjct  241   LDGKDPSDTSFGGDLFRSSKDYIQWLNSKPKSSVIYVSFGSLFVLSKQQSEEIARGLLDG  300

Query  585   KMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
               PFLWV+R     E  E+ L C EELE QG +V WC+QVEVL HPS+GCF+TH GWNST
Sbjct  301   GRPFLWVIRLEENEE--EKTLSCHEELERQGMMVPWCSQVEVLSHPSMGCFVTHSGWNST  358

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGG  226
             LESL SGVP+VA P W+DQ  NAKLI+ VWK G+R   N+EG+V+ADE KRC+E VMG G
Sbjct  359   LESLTSGVPVVAFPQWSDQATNAKLIEVVWKTGLRAMVNQEGIVEADEIKRCLELVMGSG  418

Query  225   EKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             E+GEE+R NA KWK LA+ A+K+ GSS  NLK +M+E++
Sbjct  419   ERGEEMRRNATKWKVLAREAVKEGGSSDKNLKNFMNEVM  457



>emb|CAN76093.1| hypothetical protein VITISV_027116 [Vitis vinifera]
Length=466

 Score =   506 bits (1302),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 245/461 (53%), Positives = 331/461 (72%), Gaps = 11/461 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++  P QGHINP+LQ AKRL+  GA VT +   SA  RM   P + GL   PFSDGY
Sbjct  5     HFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHRRMPKDPTLPGLTLVPFSDGY  64

Query  1296  DAGLEPAD--LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             D GL+ ++   + + + +K  GS+ + ++     ++GRP T L++T +++WA  +AR L 
Sbjct  65    DDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAAELARSLQ  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGVPAL-GVRDFPSFLFST  952
             VP  LLW Q ATV  IYYHYF  YGD+  +CS  G+  +E+PG+P L    D PSFL S+
Sbjct  125   VPSALLWIQSATVFTIYYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCDIPSFLLSS  184

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
               N+   L   +   ++++E +  E NPKVLVNTFDALE +ALRA+ KV+++GIGPL+PS
Sbjct  185   --NIYASL---LSTFQEEMEALRQETNPKVLVNTFDALEAEALRAVDKVKLIGIGPLVPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LD  DPSD++FGGD+ Q+ +D ++WL+S+PKSSVVY++FG+   +    +E+IA+ L+
Sbjct  240   AFLDDNDPSDSSFGGDIFQDPSDCIDWLNSKPKSSVVYVSFGTLCVLSKQQMEKIARALL  299

Query  591   KSKMPFLWVLRET-SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
              S  PFLWV+R     GE  EEKL C+EELE +G IV WC Q++VL HPS+GCF+THCGW
Sbjct  300   HSGRPFLWVIRSAPGXGEVEEEKLSCREELEEKGMIVAWCPQLDVLSHPSLGCFITHCGW  359

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NST E LASGVP+VA P W DQ  NAKLI+D+WK GVRV+ANEEG+V+++E KRC+E VM
Sbjct  360   NSTFECLASGVPVVAFPQWTDQGTNAKLIEDLWKTGVRVTANEEGIVESEEIKRCLEVVM  419

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G GE+GEELR NA KWK+LA+ A+KD GSS  NLKA++DE+
Sbjct  420   GRGERGEELRRNAGKWKDLAREAVKDGGSSDYNLKAFLDEL  460



>ref|XP_004247894.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   505 bits (1301),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 254/463 (55%), Positives = 342/463 (74%), Gaps = 15/463 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGLDFAP  1312
             HVLLV FPAQGHINPSLQFAKRL+ +G +VT +T   A  RM     S+ P  +GL+ A 
Sbjct  5     HVLLVTFPAQGHINPSLQFAKRLIEMGIEVTFTTSVFAHRRMAKIAASTAP--KGLNLAA  62

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDG+D G +    D K + + +++RGS  +  +I    +EGRP T L+YT ++ WA  V
Sbjct  63    FSDGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDVILKSSDEGRPVTSLVYTLLLPWAAEV  122

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPS  967
             AR LH+P  LLW QPATVLDIYY+YF  Y D  +  S N     +++P +P L  +D PS
Sbjct  123   ARELHIPSALLWIQPATVLDIYYYYFNGYEDEMKCSSSNDPNWSIQLPRLPLLKSQDLPS  182

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL S+ +  +    +A+   ++Q++ ++GEENPKVLVNTFDALE + L+AI+K  ++GIG
Sbjct  183   FLVSSSSKDDKYS-FALPTFKEQLDTLDGEENPKVLVNTFDALELEPLKAIEKYNLIGIG  241

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSND-YVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             PLIPS++L G+D  +++FGGDL Q SND Y+EWL+++PKSS+VY++FGS  ++     EE
Sbjct  242   PLIPSSFLGGKDSLESSFGGDLFQKSNDDYMEWLNTKPKSSIVYISFGSLLNLSRNQKEE  301

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             IA+GL++ + PFLWV+R+  + ++ EEKL C  ELE QGKIV WC+Q+EVL HPS+GCF+
Sbjct  302   IAKGLIEIQRPFLWVIRDQEEEKE-EEKLSCMMELEKQGKIVPWCSQLEVLTHPSLGCFV  360

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             +HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK GVR+  NE+GVV++DE KRC
Sbjct  361   SHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVNEDGVVESDEIKRC  420

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             IE VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++
Sbjct  421   IEIVMDGGEKGEEMRKNAQKWKELARAAVKEGGSSEVNLKAFV  463



>gb|ABQ02258.1| O-glucosyltransferase 3 [Vitis labrusca]
Length=464

 Score =   505 bits (1300),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 242/461 (52%), Positives = 330/461 (72%), Gaps = 11/461 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++  P QGHINP+LQ AKRL+  GA VT +   SA  RM   P + GL   PFSDGY
Sbjct  5     HFLIISHPLQGHINPALQLAKRLIRTGAHVTFAVSVSAHCRMPKDPTLPGLTLVPFSDGY  64

Query  1296  DAGLEPAD--LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             D GL+ ++   + + + +K  GS+ + ++     ++GRP T L++T +++WA  +AR L 
Sbjct  65    DDGLKYSNDHAQHYMSEIKRCGSETLRRITAMSADQGRPVTCLLHTILLTWAAELARSLQ  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGVPAL-GVRDFPSFLFST  952
             VP  LLW Q ATV  IYYHYF  YGD+  +CS  G+  +E+PG+P L    D PSFL S+
Sbjct  125   VPSALLWIQSATVFTIYYHYFNGYGDVVGDCSNEGSSPIELPGLPILLSSCDIPSFLLSS  184

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                 +      +   ++++E +  E NPKVLVNTFDALE +AL+A+ KV+++GIGPL+PS
Sbjct  185   NIYASM-----LSIFQEEMEALRQETNPKVLVNTFDALEVEALQAVDKVKLIGIGPLVPS  239

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LD  DPSD++FGGD+ Q+ +D ++WL+S+PKSSVVY++FG+   +    +E+IA+ L+
Sbjct  240   AFLDANDPSDSSFGGDIFQDPSDCIDWLNSKPKSSVVYVSFGTLCVLSKQQMEKIARALL  299

Query  591   KSKMPFLWVLRET-SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
              S  PFLWV+R     GE  EEKL C+EELE +G IV WC Q++VL HPS+GCF+THCGW
Sbjct  300   HSSRPFLWVIRSAPGNGEVEEEKLSCREELEEKGMIVAWCPQLDVLSHPSLGCFITHCGW  359

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLE LASGVP+VA P W DQ  NAKLI+D+WK GVRV+ANEEG+V+++E KRC++ VM
Sbjct  360   NSTLECLASGVPVVAFPQWTDQGTNAKLIEDLWKTGVRVTANEEGIVESEEIKRCLDVVM  419

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G GE+GEELR NA KWK+LA+ A+KD GSS  NLKA++DE+
Sbjct  420   GRGERGEELRRNAGKWKDLAREAVKDGGSSDYNLKAFLDEL  460



>dbj|BAM28983.1| UDP-glucose crocetin glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/462 (54%), Positives = 331/462 (72%), Gaps = 11/462 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM--SSRPEIQGLDFAPFSD  1303
             HVLL+ +PAQGHINP+LQFA+RL+ +G +VTL+T   A++RM  SS    +GL FA FSD
Sbjct  6     HVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMTKSSGSTPKGLTFATFSD  65

Query  1302  GYDAGLEP--ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             GYD G  P   D  ++ +S+  +GS+ +  +I    ++G P T L+YT ++ WA  VAR 
Sbjct  66    GYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATVARE  125

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFS  955
              H+P  LLW QP  V+DIYY+YF  Y D  +N S +    ++ PG+P++  +D PSF+  
Sbjct  126   CHIPSALLWIQPVAVMDIYYYYFRGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLPSFILP  185

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             +  N+     +A+   + Q+E ++ EE PKVLVNTFDALE  AL+AI+   ++ IGPL P
Sbjct  186   SSDNI---YSFALPTFKKQLETLDEEERPKVLVNTFDALEPQALKAIESYNLIAIGPLTP  242

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             SA+LDG+DPS+T+F GDL Q S DY EWL+S+P  SVVY++FGS   +P   +EEIA+GL
Sbjct  243   SAFLDGKDPSETSFSGDLFQKSKDYKEWLNSRPDGSVVYVSFGSLLTLPKQQMEEIARGL  302

Query  594   VKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             +KS  PFLWV+R  E  + EK E++L C EELE QG IV WC+Q+EVL HPS+GCF+THC
Sbjct  303   LKSGRPFLWVIRAKENGEEEKEEDRLICMEELEEQGMIVPWCSQIEVLTHPSLGCFVTHC  362

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNSTLESL  GVP+VA P W DQ  NAKLI+DVW+ GVRV  NE+G V++DE KRCIE 
Sbjct  363   GWNSTLESLVCGVPVVAFPHWTDQGTNAKLIEDVWETGVRVVPNEDGTVESDEIKRCIET  422

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             VM  GEKG ELR NAKKWKELA+ AM++DGSS  NLKA++++
Sbjct  423   VMDDGEKGVELRRNAKKWKELAREAMQEDGSSDKNLKAFVED  464



>sp|F8WKW0.1|UGT1_GARJA RecName: Full=Crocetin glucosyltransferase, chloroplastic; AltName: 
Full=UDP-glucose glucosyltransferase 1; Short=GjUGT1; 
AltName: Full=UDP-glycosyltransferase 75L6; Flags: Precursor 
[Gardenia jasminoides]
 dbj|BAK55736.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=474

 Score =   502 bits (1293),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 331/462 (72%), Gaps = 11/462 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM--SSRPEIQGLDFAPFSD  1303
             HVLL+ +PAQGHINP+LQFA+RL+ +G +VTL+T   A++RM  SS    +GL FA FSD
Sbjct  6     HVLLITYPAQGHINPALQFAQRLLRMGIQVTLATSVYALSRMKKSSGSTPKGLTFATFSD  65

Query  1302  GYDAGLEP--ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             GYD G  P   D  ++ +S+  +GS+ +  +I    ++G P T L+YT ++ WA  VAR 
Sbjct  66    GYDDGFRPKGVDHTEYMSSLAKQGSNTLRNVINTSADQGCPVTCLVYTLLLPWAATVARE  125

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFS  955
              H+P  LLW QP  V+DIYY+YF  Y D  +N S +    ++ PG+P++  +D PSF+  
Sbjct  126   CHIPSALLWIQPVAVMDIYYYYFRGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLPSFILP  185

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             +  N+     +A+   + Q+E ++ EE PKVLVNTFDALE  AL+AI+   ++ IGPL P
Sbjct  186   SSDNI---YSFALPTFKKQLETLDEEERPKVLVNTFDALEPQALKAIESYNLIAIGPLTP  242

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             SA+LDG+DPS+T+F GDL Q S DY EWL+S+P  SVVY++FGS   +P   +EEIA+GL
Sbjct  243   SAFLDGKDPSETSFSGDLFQKSKDYKEWLNSRPAGSVVYVSFGSLLTLPKQQMEEIARGL  302

Query  594   VKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             +KS  PFLWV+R  E  + EK E++L C EELE QG IV WC+Q+EVL HPS+GCF+THC
Sbjct  303   LKSGRPFLWVIRAKENGEEEKEEDRLICMEELEEQGMIVPWCSQIEVLTHPSLGCFVTHC  362

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNSTLE+L  GVP+VA P W DQ  NAKLI+DVW+ GVRV  NE+G V++DE KRCIE 
Sbjct  363   GWNSTLETLVCGVPVVAFPHWTDQGTNAKLIEDVWETGVRVVPNEDGTVESDEIKRCIET  422

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             VM  GEKG EL+ NAKKWKELA+ AM++DGSS  NLKA++++
Sbjct  423   VMDDGEKGVELKRNAKKWKELAREAMQEDGSSDKNLKAFVED  464



>ref|XP_006358760.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   501 bits (1291),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 344/469 (73%), Gaps = 18/469 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGLDFAP  1312
             HVLLV FPAQGHINPSLQFAKRL+ +G +VT +T   A  RM     S+ P  +GL+ A 
Sbjct  5     HVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSVFAHRRMAKTAASNAP--KGLNLAA  62

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDG+D G +    D K + + +++RGS  +  +I    +EGRP T L+YT ++ WA  V
Sbjct  63    FSDGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEV  122

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPS  967
             AR LH+P  LLW QPATVLDIYY+YF  Y D  + CS N     +++P +P L  +D PS
Sbjct  123   ARELHIPSALLWIQPATVLDIYYYYFNGYEDEMK-CSSNDPNWSIQLPRLPLLKSQDLPS  181

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL S+ +  +    +A+   ++Q++ ++GEENPKVLVNTFDALE + L+AI+K  ++GIG
Sbjct  182   FLVSSSSKDDKYS-FALPTFKEQLDTLDGEENPKVLVNTFDALELEPLKAIEKYNLIGIG  240

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSND-YVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             PLIPS++L G+D  +++FGGDL Q S+D Y+EWL+++PKSS+VY++FGS  ++     EE
Sbjct  241   PLIPSSFLGGKDSLESSFGGDLFQKSDDDYMEWLNTKPKSSIVYISFGSLLNLSRNQKEE  300

Query  609   IAQGLVKSKMPFLWVLRETSK---GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIG  439
             IA+GL++ K PFLWV+R+       EK EEKL C  ELE QGKIV WC+Q+EVL HPS+G
Sbjct  301   IAKGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQLEVLTHPSLG  360

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF++HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK GVR+  +E+GVV+++E 
Sbjct  361   CFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVSEDGVVESEEI  420

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             KRCIE VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  421   KRCIEIVMDGGEKGEEMRKNAQKWKELAREAVKEGGSSEVNLKAFVQEV  469



>ref|XP_006368000.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=473

 Score =   500 bits (1288),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 344/469 (73%), Gaps = 18/469 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGLDFAP  1312
             HVLLV FPAQGHINPSLQFAKRL+ +G +VT +T   A  RM     S+ P  +GL+ A 
Sbjct  5     HVLLVTFPAQGHINPSLQFAKRLIKMGIEVTFTTSIFAHRRMAKTAASTAP--KGLNLAA  62

Query  1311  FSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDG+D G +    D K + + +++RGS  +  +I    +EGRP T L+YT ++ WA  V
Sbjct  63    FSDGFDDGFKSNVDDSKCYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEV  122

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPS  967
             AR LH+P  LLW QPATVLDIYY+YF  Y D  + CS N     +++P +P L  +D PS
Sbjct  123   ARELHIPSALLWIQPATVLDIYYYYFNGYEDEMK-CSSNDPNWSIQLPRLPLLKSQDLPS  181

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL S+ +  +    +A+   ++Q++ ++GEENPKVLVNTFDALE + L+AI+K  ++GIG
Sbjct  182   FLVSSSSKDDKYS-FALPTFKEQLDTLDGEENPKVLVNTFDALELEPLKAIEKYNLIGIG  240

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSND-YVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             PLIPS++L G+D  +++FGGDL Q S+D Y+EWL+++PKSS+VY++FGS  ++     EE
Sbjct  241   PLIPSSFLGGKDSLESSFGGDLFQKSDDDYMEWLNTKPKSSIVYISFGSLLNLSRNQKEE  300

Query  609   IAQGLVKSKMPFLWVLRETSK---GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIG  439
             IA+GL++ K PFLWV+R+       EK EEKL C  ELE QGKIV WC+Q+EVL HPS+G
Sbjct  301   IAKGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQLEVLTHPSLG  360

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF++HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK GVR+  +E+GVV+++E 
Sbjct  361   CFVSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKLIEDVWKTGVRMRVSEDGVVESEEI  420

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             KRCIE VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  421   KRCIEIVMDGGEKGEEMRKNAQKWKELAREAVKECGSSEVNLKAFVQEV  469



>ref|XP_002301753.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
 gb|ABK96313.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81026.1| INDOLE-3-ACETATE BETA-D-GLUCOSYLTRANSFERASE family protein [Populus 
trichocarpa]
Length=472

 Score =   499 bits (1286),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/467 (54%), Positives = 323/467 (69%), Gaps = 17/467 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LL+ +PAQGHINP+LQFAK L  +GA VTL T  SA  RMS      GL F  FSDGY
Sbjct  6     HFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTLFPDGLSFVTFSDGY  65

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G +P D +D F + +K RGS  + +LI    +EG+P T L+YT ++ WA  VAR  H+
Sbjct  66    DDGFKPEDDRDHFTSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMLLHWASEVARAQHL  125

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFSTETN  943
             P  LLW QPATV DIYY+YF  YGD+F NC      +E+PG+P L  RD PSF+  + T 
Sbjct  126   PAALLWIQPATVFDIYYYYFNGYGDIFNNCKDTSYAIELPGLPPLASRDLPSFVLPSNTY  185

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                   +A++  ++Q+E ++ E NPKVLVN+FDALE  A+ A +K  ++GIGPLIPSA+L
Sbjct  186   T-----FALQMFQEQLEQLSQETNPKVLVNSFDALELGAMNATEKFNLIGIGPLIPSAFL  240

Query  762   DGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSK  583
             DG+DP D +FGGD+   S DY EWL+S+ KSSVVY++FGS   +    +EEIA+GLV S 
Sbjct  241   DGKDPLDKSFGGDIFHGSEDYTEWLNSKTKSSVVYVSFGSILVLSKRQIEEIARGLVDSG  300

Query  582   MPFLWVLRETSKGEKPE--------EKLR-CKEE-LEAQGKIVRWCAQVEVLQHPSIGCF  433
             + FLWV+R+  K  + +        + LR C+E  LE QG IV WC QVEVL HPSIGCF
Sbjct  301   LTFLWVIRDEQKKNEVKEEEEEEEEDHLRACREAILERQGMIVPWCCQVEVLSHPSIGCF  360

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGWNSTLESL   VP+VA P W DQ  NAKLI DVWK GVRV ANEEG+V+ DE KR
Sbjct  361   VTHCGWNSTLESLVCEVPVVAFPHWTDQGTNAKLIADVWKTGVRVVANEEGIVEGDEIKR  420

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             C++ VM  G+ GE++R NAKKWK+LA+ A+K+ GSS  NLKA++ ++
Sbjct  421   CLDLVMAHGKTGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFVQDV  467



>ref|XP_010650398.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=463

 Score =   499 bits (1284),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 330/460 (72%), Gaps = 7/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
              +LLV +PAQGHINPSLQ AK L+  GA VT  T  SA  RMS  P + GL+F  FSDGY
Sbjct  4     QILLVTYPAQGHINPSLQLAKLLIRAGAHVTFVTSSSAGTRMSISPTLDGLEFVTFSDGY  63

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D      D L++F + ++  GS A+ +LI A+  EGRPFT L+Y  ++ W   VAR LH+
Sbjct  64    DHRFNHGDGLQNFMSELERLGSPALTELIMARANEGRPFTCLLYGMLIPWVAEVARSLHL  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTET  946
             P  L+W+QPA V DIYY+YF  Y +L  N S      +E+PG+P L   D PSFL  ++ 
Sbjct  124   PSALVWSQPAAVFDIYYYYFNGYRELIGNKSNGSSSSIELPGLPLLSSSDLPSFLVPSKA  183

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
             + +   ++ ++  + Q+E +N E NP+VLVN+FDALE +ALRAI K +++GIGPL+PSA+
Sbjct  184   SAH---NFVLKLHQKQLEQLNRESNPRVLVNSFDALESEALRAINKFKLMGIGPLLPSAF  240

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             LDG+DPSD++FGGD+ + S DY++WL+S  +SSV+Y++FGS + +P    EEIA+GL+ S
Sbjct  241   LDGKDPSDSSFGGDIFRGSKDYIQWLNSNAESSVIYVSFGSLSVLPKQQSEEIARGLLDS  300

Query  585   KMPFLWVLRETSKGEKPEEK-LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
               PFLWV+R     E+ +E  L C EELE  G IV WC+QVEVL HPS+GCF++HCGWNS
Sbjct  301   GQPFLWVIRAKENEEEEKEDKLSCVEELEQLGMIVPWCSQVEVLSHPSLGCFVSHCGWNS  360

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
              LESLASGVP+VA P W DQ  NAKLI+DVWK G+RV  N+EG+V+  E K+C+E VMGG
Sbjct  361   ALESLASGVPVVAFPQWTDQTINAKLIEDVWKTGLRVMVNQEGLVEGGEIKKCLELVMGG  420

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             GE+G+E+R+NAKKWK+LA   +KD GSS  NLK ++DE++
Sbjct  421   GERGQEVRSNAKKWKDLATEVVKDGGSSDKNLKNFVDEII  460



>ref|XP_002266628.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=498

 Score =   499 bits (1286),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 246/490 (50%), Positives = 336/490 (69%), Gaps = 23/490 (5%)
 Frame = -3

Query  1527  HLTPHIIFH-----HHPRMEGC-------HVLLVIFPAQGHINPSLQFAKRLVNLGAKVT  1384
             H  P II +     H P+ +         H L++  P QGHINP+LQFAKRL+  GA VT
Sbjct  8     HNLPQIIIYITHATHGPQTQSSVTAMGQHHFLIISLPLQGHINPALQFAKRLIRTGAHVT  67

Query  1383  LSTGFSAMNRMSSRPEIQGLDFAPFSDGYDAGLEPAD--LKDFWASMKTRGSDAVAKLIT  1210
              +   SA  RM   P + GL    FSDGYD G++ +D  ++   + +K  G + + ++  
Sbjct  68    FAVSVSAHRRMPKDPTLPGLTLVLFSDGYDDGIKYSDDHVQHSMSEIKRCGPETLRRITA  127

Query  1209  AKKEEGRPFTRLIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC  1030
                ++GRP T L++T +++WA  +AR L VP  LLW Q ATV  I+YHYF  YGD+  +C
Sbjct  128   MSADQGRPVTCLLHTILLTWAAELARSLQVPSALLWIQSATVFTIFYHYFNGYGDVVGDC  187

Query  1029  S--GNQVVEVPGVPAL-GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVL  859
             S  G+  +E+PG+P L    D PSFL S+    +      +   ++++E +  E NPK+L
Sbjct  188   SNEGSSPIELPGLPILLSSCDIPSFLLSSNIYAS-----VLSTFQEEMEALRKETNPKML  242

Query  858   VNTFDALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQ  679
             VNTFDALE +ALRA+ KV ++GIGPL+P A+LD +DPSDT+FGGD+ Q+ +D ++WL+S+
Sbjct  243   VNTFDALEAEALRAVDKVEVMGIGPLVPYAFLDAKDPSDTSFGGDILQDPSDCIDWLNSK  302

Query  678   PKSSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRET-SKGEKPEEKLRCKEELE  502
             PKSSVVY++FG+   +    +E+IA+ L+ S  PFLWV+R     GE  EEKL C+EELE
Sbjct  303   PKSSVVYVSFGTLCVLSKQQMEKIARALLHSGRPFLWVIRSAPGNGEVEEEKLSCREELE  362

Query  501   AQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQD  322
              +G IV WC Q++VL HPS+GCF+THCGWNSTLE LASGVP+VA P W DQ  NAKLI+D
Sbjct  363   EKGMIVAWCPQLDVLSHPSLGCFITHCGWNSTLECLASGVPVVAFPQWTDQGTNAKLIED  422

Query  321   VWKLGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSY  142
             +WK GVRV+ANEEG+V+++E KRC+E VMG GE+GEELR NA KWK+LA+ A+KD GSS 
Sbjct  423   LWKTGVRVTANEEGIVESEEIKRCLEVVMGRGERGEELRRNAGKWKDLAREAVKDGGSSD  482

Query  141   LNLKAYMDEM  112
              NLK ++DE+
Sbjct  483   YNLKVFLDEL  492



>ref|XP_002266967.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=465

 Score =   498 bits (1283),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 331/460 (72%), Gaps = 10/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++  P QGHINP+LQFAKRL+  GA VT +   SA  RM   P + GL   PFSDGY
Sbjct  5     HFLIISLPLQGHINPALQFAKRLIRTGAHVTFAVSVSAHRRMPKGPTLPGLTLVPFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G++  D  + + + +K  GS+ + ++     ++GRP T L++T +++WA  +AR L +
Sbjct  65    DDGIKLEDHAQHYLSEIKRCGSETLRRITAISSDQGRPVTCLVHTMLLAWAAELARSLQL  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGVPAL-GVRDFPSFLFSTE  949
             P  LLW Q ATV  I++HYF  YGD+  NCS  G+  +E+PG+P L   RD PSF  S+ 
Sbjct  125   PSALLWIQSATVFIIFHHYFDGYGDVVGNCSNEGSDPIELPGLPMLLSSRDIPSFFLSSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                ++     I A ++ +E +  E NPKVLVNTFDALE +ALRA+ KV+++GIGPL+PSA
Sbjct  185   IYASW-----IPAFQEDMEALRQETNPKVLVNTFDALEAEALRAVDKVKLIGIGPLVPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LD  DPSD++FGGD+ Q+ ++ ++WL+S+PKSSVVY++FG+   +    +EEIA  L+ 
Sbjct  240   FLDANDPSDSSFGGDIFQDPSNCIDWLNSKPKSSVVYVSFGTLCVLSKQQMEEIAHALLH  299

Query  588   SKMPFLWVLRETSK-GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             S  PFLWV+R  S+ GE  EEKL C++ELE +G IV WC Q++VL HPS+GCF+THCGWN
Sbjct  300   SGRPFLWVIRSASENGEVEEEKLSCRKELEEKGMIVVWCPQLDVLSHPSLGCFITHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLE LASGVP+VA P W DQ  N KLI+DVWK GVRV+ANEEG+V+ +E KRC+E VMG
Sbjct  360   STLECLASGVPVVAFPQWTDQGTNGKLIEDVWKTGVRVTANEEGIVEGEEIKRCLEVVMG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             GGE+GEELR NA KWK+LA+ A+KD GSS  NLKA++DE+
Sbjct  420   GGERGEELRRNAGKWKDLAREAVKDGGSSDCNLKAFLDEL  459



>gb|AAK54465.1| cold-induced glucosyl transferase [Solanum sogarandinum]
Length=473

 Score =   498 bits (1282),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/467 (54%), Positives = 339/467 (73%), Gaps = 14/467 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS---SRPEIQGLDFAPFS  1306
             HVLLV FP QGHINPSLQFAK+L+ +G +VT +T   A  RM+   +    +GL+ A FS
Sbjct  5     HVLLVTFPTQGHINPSLQFAKKLIKMGIEVTFTTSVFAHRRMAKTATSTAPKGLNLAAFS  64

Query  1305  DGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G +    D K + + +++RGS  +  +I    +EGRP T L+YT ++ WA  VAR
Sbjct  65    DGFDDGFKSNVDDSKRYMSEIRSRGSQTLRDIILKSSDEGRPVTSLVYTLLLPWAAEVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFL  961
              LH+P  LLW QPATVLDIYY+YF  Y D  + CS N     +++P +P L  +D PSFL
Sbjct  125   ELHIPSALLWIQPATVLDIYYYYFNGYEDEMK-CSSNDPNWSIQLPRLPLLKSQDLPSFL  183

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
              S+ +  +    +A+   ++Q++ ++GEENPKVLVNTFDALE + L+AI K  ++GIGPL
Sbjct  184   VSSSSKDDKYS-FALPTFKEQLDTLDGEENPKVLVNTFDALELEPLKAIGKYNLIGIGPL  242

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND-YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             IPS++L G+D  ++ FGGDL Q SND Y+EWL+++PKSS+VY++FGS  ++     EEIA
Sbjct  243   IPSSFLGGKDSLESRFGGDLFQKSNDDYMEWLNTKPKSSIVYISFGSLLNLSRNQKEEIA  302

Query  603   QGLVKSKMPFLWVLRETSK---GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             +GL++ K PFLWV+R+       EK EEKL C  ELE QGKIV WC+Q+EVL HPS+GCF
Sbjct  303   KGLIEIKRPFLWVIRDQENIKEVEKEEEKLSCMMELEKQGKIVPWCSQLEVLTHPSLGCF  362

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             ++HCGWNSTLESL+SGVP+VA P W DQ  NAK I+DVWK GVR+  NE+GVV+++E KR
Sbjct  363   VSHCGWNSTLESLSSGVPVVAFPHWTDQGTNAKWIEDVWKTGVRMRVNEDGVVESEEIKR  422

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             CIE VM GGEKGEE+R NA+KWKELA+ A+K+ GSS +NLKA++ E+
Sbjct  423   CIEIVMDGGEKGEEMRKNAQKWKELAREAVKEGGSSEVNLKAFVQEV  469



>ref|XP_002301754.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
 gb|EEE81027.1| hypothetical protein POPTR_0002s23770g [Populus trichocarpa]
Length=469

 Score =   495 bits (1274),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/464 (54%), Positives = 320/464 (69%), Gaps = 14/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LL+ +PAQGHINP+LQFAK L  +GA VTL T  SA  RMS      GL F  FSDGY
Sbjct  6     HFLLLTYPAQGHINPALQFAKGLTRIGALVTLVTSLSAGRRMSKTLFPDGLSFVTFSDGY  65

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G +P D ++ F + +K RGS  + +LI    +EG+P T L+YT  + WA  VAR  H+
Sbjct  66    DDGFKPEDDREHFKSELKRRGSQTLNELIVDSAKEGKPVTCLVYTMFLHWAAEVARAQHL  125

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFSTETN  943
             P  LLW Q ATV DIYY+YF  YGD+F NC      +E+PG+P L  RD PS +  + T 
Sbjct  126   PAALLWIQLATVFDIYYYYFNGYGDIFNNCKDTSYAIELPGLPPLASRDLPSLVLPSNTY  185

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                   WA++  ++Q+E ++ E NPKVLVN+FDALE  A+ A +K  + GIGPLIPSA+L
Sbjct  186   A-----WALQMFQEQLEQLSQETNPKVLVNSFDALELGAMNATEKFNLTGIGPLIPSAFL  240

Query  762   DGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSK  583
             DG+DP D +FGGD+   S DY EWL+S+ KSSVVY++FGS   +    +EEIA+GLV S 
Sbjct  241   DGKDPLDKSFGGDIFHGSEDYTEWLNSKTKSSVVYVSFGSILVLSKRQMEEIARGLVDSD  300

Query  582   MPFLWVLRE-----TSKGEKPEEKLR-CKEE-LEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             +PFLWV+R+       K E+ E+ LR C+E  LE QG IV WC QV VL HPSIGCF+TH
Sbjct  301   LPFLWVIRDEQNKNEVKEEEEEDHLRACREAILERQGMIVPWCCQVGVLSHPSIGCFVTH  360

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL   VP+VA P W DQ  NAKLI DVWK GVRV ANEEG+V+ DE KRC++
Sbjct  361   CGWNSTLESLVCEVPVVAFPHWTDQGTNAKLIADVWKTGVRVVANEEGIVEGDEIKRCLD  420

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM  G+ GE++R NAKKWK+LA+ A+K+ GSS  NLKA++ ++
Sbjct  421   LVMAHGKTGEDIRKNAKKWKDLARDAVKEGGSSDKNLKAFVQDV  464



>ref|XP_003632054.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=465

 Score =   493 bits (1268),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 241/465 (52%), Positives = 327/465 (70%), Gaps = 8/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H +++ +PAQGHINPSLQ AKRL+  GA VT  T   A  RM+  P + GL F  F
Sbjct  1     MTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMTKTPTMDGLKFVTF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
              DG D+GL+ +D L+ F + ++  GS A+  L+ A   EGRP T +IY  ++ W   VA 
Sbjct  61    PDGCDSGLKQSDALQGFMSELERLGSQALTDLLIASANEGRPVTCIIYGILIPWVAEVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN--CSGNQVVEVPGVPALGVRDFPSFLF  958
              LH+P  L W+QP +V +IYY+YF  YG++ R      +  +E+PG+P LG RD P FL 
Sbjct  121   SLHIPSALFWSQPVSVFNIYYYYFCGYGEVIRKKVSDSSPSIELPGLPLLGSRDIPCFLL  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              +  N   + ++ + A +  +E ++ + NP VL+NTFDALE +ALRA+ K + +G+GPL 
Sbjct  181   PSNAN---EYNFVLSAFQKHVEMLHRDTNPTVLINTFDALEPEALRAVSKFKSIGVGPLF  237

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             P+A+L G+DPSDT+FGGDL + S DY+EWL+S+P+SSV+Y++FGS A +     EEIA+G
Sbjct  238   PTAFLGGKDPSDTSFGGDLFRRSKDYIEWLNSKPESSVIYVSFGSLAVLSKQQSEEIARG  297

Query  597   LVKSKMPFLWVLRETSKGEKPEEK--LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             L+ S  PFLWV+R   KGE+ +E+  L C  ELE QG IV WC+QVEVL +PS+GCF+TH
Sbjct  298   LLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVLSNPSLGCFVTH  357

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESLASGVP+VA P W DQ  NAKL +DVWK GVRV+ N+EG+V++DE KRC+E
Sbjct  358   CGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVESDEIKRCLE  417

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
              VMG GE+ +E+R NAKKWK LA+ A+ + GSS  NLK +MDE++
Sbjct  418   LVMGDGEEAKEMRRNAKKWKGLAREAVMEGGSSDKNLKNFMDEVI  462



>ref|XP_008380455.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=481

 Score =   492 bits (1267),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 331/472 (70%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV FPAQGHINPSLQFAKRL+N  GA VT  T  SA  R+ +     GL +APFSDGYD
Sbjct  7     LLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D + D+ + ++ RG  A+  L+ A   EG P+T L+Y+ ++ W+  +A  LH+P
Sbjct  67    DGFKPGDNIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSG---NQV----VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ +    N V    +E+PG+P +   RD PSF+
Sbjct  127   SVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLSFTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q+E +  E NP +LVNTFDALE +AL+AI K  ++G+GPL
Sbjct  187   VDTNP-----YNFALPLFQEQMELLERETNPTILVNTFDALEPEALKAIDKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DPSD +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPSAFLDGKDPSDKSFGGDLFQKSKDSSYLEWLNSKPEGSVIYVSFGSISVLGKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+   +PFLWV+R+        ++ +K EE LRC+EELE  G IV WC+QVEVL  P
Sbjct  302   AKGLLDCGLPFLWVIRDKVDKKGDDNEAKKEEEMLRCREELEELGMIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ NEEG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDYWKTGVRVTPNEEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC++ V+G GE GE++R NAKKWK+LA+ A+ +  SS  NLKA++D++
Sbjct  422   EELKRCLDLVLGSGEIGEDVRRNAKKWKDLAREAVSEGDSSDKNLKAFLDQI  473



>ref|XP_010023602.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=470

 Score =   491 bits (1265),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/466 (53%), Positives = 326/466 (70%), Gaps = 18/466 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSS-RPEIQGLDFAPFSDG  1300
             H LLV FPAQGHINP+LQFAKRL+  GA+VT +T  SA +RMS  R   +GL FAPFSDG
Sbjct  5     HFLLVTFPAQGHINPALQFAKRLLRSGAEVTFATSVSACHRMSKGRASPEGLHFAPFSDG  64

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +  D +  F + ++ RGS+ +  L+ +   EGRP+T L+Y+ ++ WA  VAR  H
Sbjct  65    YDDGFKMGDNVSQFMSELRHRGSEKLKDLMASSAGEGRPYTCLVYSLLLPWAAEVAREFH  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRN------CSGNQVVEVPGVP-ALGVRDFPSF  964
             VP  LLW QPATVLD+YY+YF  YG+   N      CS     ++PG+P     RD PSF
Sbjct  125   VPSALLWIQPATVLDMYYYYFNGYGEFIENNCIDPSCS----FQLPGLPYKFTSRDLPSF  180

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
                + ++  YD+  A+   +DQ++ +N E N ++LVNTFD+LE +ALRAI +  +VGIGP
Sbjct  181   FLPSRSDA-YDV--ALPTFKDQLDTLNQENNARILVNTFDSLEPEALRAIDRYNLVGIGP  237

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+LDG+DPSDT+FGGDL   S +Y +WLDS+  +SVVY++FGS A++     EE+A
Sbjct  238   LIPSAFLDGKDPSDTSFGGDLFHKSKEYTDWLDSKAPASVVYVSFGSIAEISKRQAEELA  297

Query  603   QGLVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
               L+    PFLWV+R    GE  K E++L   +ELE +G IV WC+Q+EVL HPS+GCFL
Sbjct  298   CALLDCGRPFLWVIRAKQNGEEEKDEDRLSRMQELEEKGMIVPWCSQLEVLSHPSLGCFL  357

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             +HCGWNSTLESLA G+P+VA P W DQ  NAKLI+DVW+ G+RV  N EG+V+A E +RC
Sbjct  358   SHCGWNSTLESLALGIPVVAFPQWTDQGTNAKLIEDVWRTGIRVRPNGEGLVEAGEIRRC  417

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E VM  GE  EE+R NA KWKE A+ A ++ GSS  NLKA+++E+
Sbjct  418   LETVMADGEMREEVRRNAAKWKESAREAAREGGSSDRNLKAFIEEV  463



>ref|XP_007034187.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034188.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 ref|XP_007034189.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05113.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05114.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
 gb|EOY05115.1| Indole-3-acetate beta-D-glucosyltransferase, putative isoform 
1 [Theobroma cacao]
Length=463

 Score =   491 bits (1264),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/462 (54%), Positives = 323/462 (70%), Gaps = 13/462 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDF-AP  1312
             M   HVLLV  P QGHINPSLQFAKRL++LG +VT +T  SA+ RM     ++GL + A 
Sbjct  2     MAQPHVLLVTLPGQGHINPSLQFAKRLIHLGLRVTFATAVSAIRRMKPMSPLEGLTYVAA  61

Query  1311  FSDGYDAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             +SDGYD GL+P D  D +    + +G + +++ I A  EEG  FT ++Y  +M W  +VA
Sbjct  62    YSDGYDDGLKPGDDIDRYILESRRKGLETLSEFIGASIEEGIRFTCIVYGIMMPWVALVA  121

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFL  961
             R  H+P TLLW QPA+V   YY+YF +YGD+ R    +   +VE+PG+P L  RD PSF 
Sbjct  122   REFHIPSTLLWNQPASVFVTYYYYFKDYGDIIRKTVKDPSSIVELPGLPPLASRDMPSFF  181

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                      + D A+ +++  +E ++ E  PKVLVNTFDALE +A++ I K  +VGIGPL
Sbjct  182   LPAN-----EYDCALPSLKQHVEILDEETKPKVLVNTFDALEPEAIKVIDKYNLVGIGPL  236

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG D SD++FGGDL + +ND+V+WLDS PKSSV+Y++FGS   +    +EEIA 
Sbjct  237   IPSAFLDGNDHSDSSFGGDLFKGTNDFVQWLDSMPKSSVIYVSFGSILMLTKQQMEEIAN  296

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL+ +  PFLWV+RE + GEK EEKL   EEL+ QG IV WC+QVEVL HPS+GCFLTHC
Sbjct  297   GLLGTGYPFLWVIREGA-GEK-EEKLSRIEELKKQGMIVPWCSQVEVLSHPSVGCFLTHC  354

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN--EEGVVKADEYKRCI  247
             GWNS LESL SGVP+V  P   DQ  NAKL++D+WK GVRV+ N  E  VV+  E KRC+
Sbjct  355   GWNSALESLVSGVPMVTFPQLTDQGTNAKLVEDLWKTGVRVTRNPEERIVVEGHEIKRCL  414

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             E +M GGEKGEELR N KKWK LA+ A+K+DGSS  NL+A++
Sbjct  415   ELIMEGGEKGEELRKNGKKWKYLAREAVKEDGSSLKNLEAFV  456



>ref|XP_002322699.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
 gb|EEF04460.1| hypothetical protein POPTR_0016s05290g [Populus trichocarpa]
Length=471

 Score =   491 bits (1263),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 244/459 (53%), Positives = 334/459 (73%), Gaps = 9/459 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAPFSDG  1300
             H+LLV FPAQGHINP+LQFAKRLV +GA VT +T   A  RMS S    +GL FA F DG
Sbjct  9     HILLVTFPAQGHINPALQFAKRLVAMGAHVTFATSMGAKRRMSKSGTYPKGLYFAAFDDG  68

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
              + G  P+D ++ +++ ++  GS ++A LI    + G PFT +++++++ W   VAR  +
Sbjct  69    SEHGFRPSDDIEHYFSELRHVGSKSLADLICQVPKNGGPFTCVVHSNLIPWVAKVARQHN  128

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTE  949
             +P TLLW Q   +LDI+Y+YF  YGD  +    +    +++PG+P LG RD PSFL    
Sbjct  129   LPSTLLWNQSPALLDIFYYYFNGYGDTIKKNINDPSFSLKLPGLPPLGSRDLPSFLNPRN  188

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             T+      +A+   ++ IE ++ E NPKVLVNTFDALE +AL +I K ++VG+GPLIPSA
Sbjct  189   THA-----FALPVNKEHIEVLDEETNPKVLVNTFDALECEALNSIGKFKLVGVGPLIPSA  243

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             YLDG+DPSDT+FGGDL Q+S DY+EWL+S+P+SSV+Y++FGS + +     EE+A+ L+ 
Sbjct  244   YLDGKDPSDTSFGGDLFQDSKDYIEWLNSKPESSVIYISFGSISVISKPQKEEMARALLD  303

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  PFLWV+R     EK E+KL C EELE QGKIV WC+QV VL HPSIGCF+THCGWNS
Sbjct  304   TGRPFLWVIRTDGGEEKEEDKLSCTEELEKQGKIVPWCSQVVVLSHPSIGCFVTHCGWNS  363

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             T ESLASGVP+VA P W DQ  NAK+++ VW+ GVRVSAN+EG+V+ +E ++C+E VMGG
Sbjct  364   TFESLASGVPVVAFPQWTDQLTNAKMVEAVWETGVRVSANKEGIVEGEEIEKCLELVMGG  423

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             GE+G+E+R NAKKWK+LA+ + K+ GSSY NL+ + +E+
Sbjct  424   GERGKEMRKNAKKWKDLARESSKEGGSSYQNLQDFFNEI  462



>ref|XP_007221319.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
 gb|EMJ22518.1| hypothetical protein PRUPE_ppa021645mg [Prunus persica]
Length=474

 Score =   491 bits (1263),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 329/472 (70%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LL+ FPAQGHINPSLQFAK L+   GA VT  T  SA  R+ +     GL ++ FSDGYD
Sbjct  7     LLLTFPAQGHINPSLQFAKHLIRTTGAHVTYVTCLSAHRRLGNGSTPHGLTYSLFSDGYD  66

Query  1293  AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +  D  D + S ++ RG+ A+  LI +  +EGRP+T LIYT ++ WA VVAR LH+P
Sbjct  67    NGFKDGDDYDHYMSELRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVVARELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-------VVEVPGVP-ALGVRDFPSFL  961
               L+W QPATV DIYY+YF+ Y DL +N +           +E+PG+P +L  RD PSF+
Sbjct  127   SVLVWIQPATVFDIYYYYFSGYKDLIQNSTSATHTNGALCSIELPGLPQSLTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                ++N+     +A+    +Q E    E  P +LVNTFDALE +AL+AI K  ++GIGPL
Sbjct  187   --VDSNL---YSFALLLFEEQFEVFERETKPIILVNTFDALESEALKAIDKYNLIGIGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPS+ LDG+DPSD +F GDL Q S D  Y++WL+S+P+ SVVY++FGS + +    +EEI
Sbjct  242   IPSSLLDGKDPSDKSFRGDLFQKSEDSSYIKWLNSRPEGSVVYVSFGSMSVLSKPQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET--SKGE-----KPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+ S  PFLWV+RE   SKG+     K EEKL C+EELE  GKIV WC+QVEVL  P
Sbjct  302   AKGLLDSGRPFLWVIREKEESKGQDKEADKEEEKLSCREELEELGKIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N+EG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTPNDEGIVVG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E VMG GE GEELR NAKKWK LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>gb|AAX16493.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Malus domestica]
Length=481

 Score =   491 bits (1264),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 243/472 (51%), Positives = 330/472 (70%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV FPAQGHINPSLQFAKRL+N  GA VT  T  SA  R+ +     GL +APFSDGYD
Sbjct  7     LLVTFPAQGHINPSLQFAKRLINTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D + D+ + ++ RG  A+  L+ A   EG P+T L+Y+ ++ W+  +A  LH+P
Sbjct  67    DGFKPGDNVDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLLLPWSAGMAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ + +         +E+PG+P +   RD PSF+
Sbjct  127   SVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLSFTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q+E +  E NP +LVNTFDALE +AL+AI K  ++G+GPL
Sbjct  187   VDTNP-----YNFALPLFQEQMELLERETNPTILVNTFDALEPEALKAIDKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DPSD +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPSAFLDGKDPSDKSFGGDLFQKSKDSSYLEWLNSKPEGSVIYVSFGSISVLGKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+   +PFLWV+R+        ++ +K EE LRC+EELE  G IV WC+QVEVL  P
Sbjct  302   AKGLLDCGLPFLWVIRDKVGKKGDDNEAKKEEEMLRCREELEELGMIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ NEEG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDYWKTGVRVTPNEEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC++ V+G GE GE++R NAKKWK+LA+ A+ +  SS  NL+A++D++
Sbjct  422   EELKRCLDLVLGSGEIGEDVRRNAKKWKDLAREAVSEGDSSDKNLRAFLDQI  473



>ref|XP_007034186.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY05112.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=465

 Score =   490 bits (1262),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 323/461 (70%), Gaps = 11/461 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV +PAQGHINP+LQFAK L+ +G +VT +T  SA  RM+  P  QGL F  FSDGY
Sbjct  5     HFLLVTYPAQGHINPTLQFAKCLIRIGVRVTFTTCVSARRRMTKVPSAQGLSFLTFSDGY  64

Query  1296  DAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D GL+P D KD + S  + RG + +  ++     EG+P T ++Y+ ++ WA  VAR  H+
Sbjct  65    DDGLKPGDDKDHYMSEFRRRGKENLNDIVVGSDNEGKPVTCIVYSLLLPWAMEVAREHHI  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLFSTET  946
             P  +LW QPATVLDIYY+YF  Y +  +  +G  N ++E+PG+P L  RD PSF+ ++  
Sbjct  125   PSAMLWIQPATVLDIYYYYFNGYEETIKGQAGESNCLIELPGLPPLASRDLPSFVAASNA  184

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
               +     A+   + Q E +  E N +VLVNTFDALE +AL+AI+  +M  +GPLI S +
Sbjct  185   YPS-----ALSLFQQQFELLAEETNARVLVNTFDALEPEALKAIENYKMFAVGPLILSTF  239

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             L G+DPSD +F GDL Q S DY++WLDS+PKS+V+Y++FG+ A +    +EEIA+ L+ S
Sbjct  240   LGGKDPSDGSFKGDLFQCSKDYLQWLDSKPKSTVIYVSFGTMAVLAKQQVEEIARALLAS  299

Query  585   KMPFLWVLR---ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
               PFLWV+R   +  + EK E+KL C+EELE  G IV WC+QVEVL HPS+GCF+THCGW
Sbjct  300   GRPFLWVIRNQKQNGEEEKEEDKLSCREELEQFGMIVPWCSQVEVLSHPSLGCFVTHCGW  359

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLESL +GV +VA P W DQ  NAKLIQDVW+ GVRVSANEEG+V+  E  RC++ VM
Sbjct  360   NSTLESLVAGVSVVAFPQWTDQGTNAKLIQDVWETGVRVSANEEGIVERGEINRCLDLVM  419

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G GE+  ELR  A+KWK+LA+ A K+ GS  +NLKA++D++
Sbjct  420   GDGERANELRRTAEKWKDLAREAAKEGGSLDMNLKAFIDDV  460



>ref|XP_011033298.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=468

 Score =   490 bits (1262),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 243/459 (53%), Positives = 333/459 (73%), Gaps = 9/459 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAPFSDG  1300
             H+LLV FPAQGHINP+LQFAKRLV +GA VT +T   A  RMS S    +GL FA F DG
Sbjct  6     HILLVTFPAQGHINPALQFAKRLVAIGAHVTFATSMGAKRRMSKSGTYPKGLYFAAFDDG  65

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
              + G  P+D ++ +++ ++  GS ++A LI    + G PFT ++Y++++ W   VAR  +
Sbjct  66    SEHGFRPSDDIEHYFSELRRVGSKSLADLICQGPKNGGPFTCVVYSNLIPWVAKVARQHN  125

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTE  949
             +P TLLW Q   +LDI+Y+YF  YGD  +    +    +++PG+P LG RD PSFL    
Sbjct  126   LPSTLLWNQSPALLDIFYYYFNGYGDTIKKSINDPSFSLKLPGLPPLGSRDLPSFLNPRN  185

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             T+      +A+   ++ IE ++ E NPKVLVNTFDALE +AL +I K ++VG+GPLIPSA
Sbjct  186   THA-----FALPVNKEHIEVLDEETNPKVLVNTFDALECEALNSIGKFKLVGVGPLIPSA  240

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             YLD +DPSDT+FGGDL Q+S DYVEWL+S+P+SSV+Y++FGS + +     EEIA+ L+ 
Sbjct  241   YLDEKDPSDTSFGGDLFQDSKDYVEWLNSKPESSVIYISFGSISVISKPQKEEIARALLD  300

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  PFLWV+R     EK E+KL C EELE QGKIV WC+QV VL HPSIGCF+THCGWNS
Sbjct  301   TGRPFLWVIRTDGGEEKEEDKLSCTEELEKQGKIVPWCSQVVVLSHPSIGCFVTHCGWNS  360

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             T ESLASGVP+VA P W DQ  NAK+++ VW+ GVRVSAN+EG+++ +E ++C+E VMGG
Sbjct  361   TFESLASGVPVVAFPQWTDQLTNAKMVEAVWETGVRVSANKEGIIEGEEIEKCLELVMGG  420

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             GE+G+E+R NAKKWK+LA+ + ++ G+SY NL+ + +E+
Sbjct  421   GERGKEMRKNAKKWKDLARESSREGGTSYQNLQDFFNEI  459



>ref|XP_011081386.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=475

 Score =   490 bits (1262),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 244/466 (52%), Positives = 326/466 (70%), Gaps = 14/466 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPE---IQGLDFAPFS  1306
             HVLLV FPAQGHINPSLQFAKRLVN+G +VT +T   A  RM    +    +GL F P+S
Sbjct  5     HVLLVTFPAQGHINPSLQFAKRLVNMGIEVTFATSVYAQRRMEETADGDLPKGLKFTPYS  64

Query  1305  DGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             DGYD G   +D  K +   +++R S  +   + A  + GRP +  I+T ++ W   VAR 
Sbjct  65    DGYDDGFTFSDDGKKYMMEIRSRASKTLKDTVMAAAKRGRPISCFIHTLLLPWVSKVARE  124

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPAL-GVRDFPSFLF  958
             +H+P  LLW Q ATV + YY+YF  YGD  +  S +    +++PG+P L    D PSF+ 
Sbjct  125   VHIPSALLWIQSATVFNAYYYYFNGYGDQIKAQSNDPTWKIQLPGIPILLSKHDIPSFML  184

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             +T +       +A+ +  +Q+E ++ E  PKVLVNTFD+LE D L +I K  ++G+GPLI
Sbjct  185   ATSSE---RYSYALTSFNEQLEVLDVETKPKVLVNTFDSLEPDVLMSIDKYELIGVGPLI  241

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+LDG+DP DT+FGGDL Q S+DY+EWL+S+PKSSVVY++FGS   +P + +EEIA+G
Sbjct  242   PSAFLDGKDPLDTSFGGDLFQKSDDYIEWLESKPKSSVVYVSFGSLLSLPKSQMEEIAKG  301

Query  597   LVKSKMPFLWVLR----ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             L+ S  PFLWV R       + ++  E L C EELE  G+IV WC+Q+EVL HPS+GCF+
Sbjct  302   LLDSGRPFLWVRRVNEKAKEEKKEENENLSCMEELEKVGRIVSWCSQLEVLTHPSLGCFM  361

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLES++ GVP+VA P W DQ  NAKLI+DVWK GVRV ANE+GVV+  E +RC
Sbjct  362   THCGWNSTLESISCGVPVVAFPHWTDQGTNAKLIEDVWKTGVRVRANEDGVVECAEIRRC  421

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             IE VM GGEK  ELR+NA+KWK LA  AM+++GSS +NLKA+++E+
Sbjct  422   IEEVMDGGEKSIELRHNAEKWKSLAGEAMEENGSSNMNLKAFLEEV  467



>emb|CAN75179.1| hypothetical protein VITISV_018406 [Vitis vinifera]
Length=497

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 241/467 (52%), Positives = 325/467 (70%), Gaps = 8/467 (2%)
 Frame = -3

Query  1494  PRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             P M   H +++ +PAQGHINPSLQ AKRL+  GA VT  T   A  RM+  P + GL F 
Sbjct  31    PTMTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYASERMAKTPTMDGLKFV  90

Query  1314  PFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
              F DG D+GL+ +D L+ F + ++  GS A+  L+ A   EGRP   +IY  ++ W   V
Sbjct  91    TFPDGCDSGLKQSDALQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVAEV  150

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN--CSGNQVVEVPGVPALGVRDFPSF  964
             A  LH+P  L W+QP +V +IYY+YF  YG+L R      +  +E+PG+P L  RD P F
Sbjct  151   AHSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVSDSSPSIELPGLPLLSSRDIPCF  210

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  +  N   + ++ + A    +E ++ + NP VL+NTFDALE +ALRA+ K + +G+GP
Sbjct  211   LLPSNAN---EYNFVLSAFEKHLEMLHRDTNPTVLINTFDALEPEALRAVSKFKSIGVGP  267

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             L P+A+L G+DPSDT+FGGDL + S DY+EWL+S+P+SSV+Y++FGS A +     EEIA
Sbjct  268   LFPTAFLGGKDPSDTSFGGDLFRRSKDYIEWLNSKPESSVIYVSFGSLAVLSKHQSEEIA  327

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEK--LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             +GL+ S  PFLWV+R   KGE+ +E+  L C  ELE QG IV WC+QVEVL +PS+GCF+
Sbjct  328   RGLLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVLSNPSLGCFV  387

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESLASGVP+VA P W DQ  NAKL +DVWK GVRV+ N+EG+V++DE KRC
Sbjct  388   THCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVESDEIKRC  447

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +E VMG GE+ +E+R NAKKWK LA+ A+ + GSS  NLK +MDE++
Sbjct  448   LELVMGDGEEAKEMRRNAKKWKGLAREAVMEXGSSDKNLKNFMDEVI  494



>ref|XP_002267330.2| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=497

 Score =   491 bits (1263),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 241/467 (52%), Positives = 326/467 (70%), Gaps = 8/467 (2%)
 Frame = -3

Query  1494  PRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             P M   H +++ +PAQGHINPSLQ AKRL+  GA VT  T   A  RM+  P + GL F 
Sbjct  31    PTMTQPHFIVITYPAQGHINPSLQLAKRLIRAGAHVTFVTSTYAGERMAKTPTMDGLKFV  90

Query  1314  PFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
              F DG D+GL+ +D L+ F + ++  GS A+  L+ A   EGRP T +IY  ++ W   V
Sbjct  91    TFPDGCDSGLKQSDALQGFMSELERLGSQALIGLLIASANEGRPVTCIIYGILIPWVAEV  150

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN--CSGNQVVEVPGVPALGVRDFPSF  964
             AR LH+P  L W+QP +V +IYY+YF  YG+L R      +  +E+PG+P L  RD P F
Sbjct  151   ARSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVSDSSPSIELPGLPLLSSRDIPCF  210

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  +  N   + ++ + A +  +E ++ + NP VL+NTFDALE +ALRA+ K + +G+GP
Sbjct  211   LLPSNAN---EYNFVLSAFQKHLEMLHRDTNPTVLINTFDALEPEALRAVSKFKSIGVGP  267

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             L P+A+L G+DPSDT+FGGDL + S DY+EWL+S+P+SSV+Y++FGS A +     EEIA
Sbjct  268   LFPTAFLGGKDPSDTSFGGDLFRRSKDYIEWLNSKPESSVIYVSFGSLAVLSKQQSEEIA  327

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEK--LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             +GL+ S  P LWV+R   KGE+ +E+  L C  ELE QG IV WC+QVEVL +PS+GCF+
Sbjct  328   RGLLDSGRPLLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVLSNPSLGCFV  387

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESLASGVP+VA P W DQ  NAKL +DVWK GVRV+ N+EG+V+AD+ KRC
Sbjct  388   THCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVEADKIKRC  447

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +E VMG GE+ +E+R NA KWK+LA+ A+ + GSS  NLK +MDE +
Sbjct  448   LELVMGDGEEAKEMRRNANKWKDLAREAVMEGGSSDKNLKNFMDEFM  494



>ref|XP_010650395.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=497

 Score =   491 bits (1263),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 242/467 (52%), Positives = 326/467 (70%), Gaps = 8/467 (2%)
 Frame = -3

Query  1494  PRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             P M   H +++ +PAQGHINPSLQ AKRL+ +GA VT  T   A  RM+  P + GL F 
Sbjct  31    PTMTQPHFIVITYPAQGHINPSLQLAKRLIRVGAHVTFVTSTYASERMAKTPTMDGLKFV  90

Query  1314  PFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
              F DG D+GL+ +D L+ F + ++  GS A+  L+ A   EGRP   +IY  ++ W   V
Sbjct  91    TFPDGCDSGLKQSDALQGFMSELERLGSQALTDLLIASANEGRPVACIIYGILIPWVAEV  150

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC--SGNQVVEVPGVPALGVRDFPSF  964
             A  LH+P  L W+QP +V +IYY+YF  YG+L R      +  +E+PG+P L  RD P F
Sbjct  151   AHSLHIPSALFWSQPVSVFNIYYYYFCGYGELIRKKVRDSSPSIELPGLPLLSSRDIPCF  210

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  +  N   + ++ + A    +E ++ + NP VL+NTFDALE +ALRA+ K + +G+GP
Sbjct  211   LLPSNAN---EYNFVLSAFEKHLEMLHRDTNPTVLINTFDALEPEALRAVSKFKSIGVGP  267

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             L P+A+L G+DPSDT+FGGDL + S DY+EWL+S+P+SSV+Y++FGS A +     EEIA
Sbjct  268   LFPTAFLGGKDPSDTSFGGDLFRRSKDYIEWLNSKPESSVIYVSFGSLAVLSKQQSEEIA  327

Query  603   QGLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             +GL+ S  PFLWV+R  E  + EK E+KL C  ELE QG IV WC+QVEVL +PS+GCF+
Sbjct  328   RGLLDSGRPFLWVIRAKEKGEEEKEEDKLSCYAELEQQGMIVPWCSQVEVLSNPSLGCFV  387

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESLASGVP+VA P W DQ  NAKL +DVWK GVRV+ N+EG+V++DE KRC
Sbjct  388   THCGWNSTLESLASGVPVVAFPQWTDQSTNAKLAEDVWKTGVRVTVNQEGIVESDEIKRC  447

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +E VMG GE+ +E+R NAKKWK LA+ A+ + GSS  NLK +MDE++
Sbjct  448   LELVMGDGEEAKEMRRNAKKWKGLAREAVMEGGSSDKNLKNFMDEVI  494



>ref|XP_003601705.1| O-glucosyltransferase [Medicago truncatula]
 gb|AES71956.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=478

 Score =   489 bits (1260),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/472 (51%), Positives = 336/472 (71%), Gaps = 22/472 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++ +P QGHINP+LQF KRL++LGAKVT +T     +R+ ++P I GL FA FSDGY
Sbjct  6     HFLIITYPLQGHINPALQFTKRLISLGAKVTFATTIHLYSRLINKPTIPGLSFATFSDGY  65

Query  1296  DAGLEP---ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D G +     D+  + +    RGS+ +  +I + K+E  PFT LIYT I+SWA  VA  L
Sbjct  66    DDGQKSFGDEDIVSYMSEFTRRGSEFLTNIILSSKQENHPFTCLIYTLILSWAPKVAHEL  125

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVP-ALGVRDFPSFLFS  955
             H+P TLLW Q ATV DI+Y+YF E+GD   N S ++  ++ +PG+  +L  RD PSFL +
Sbjct  126   HLPSTLLWIQAATVFDIFYYYFHEHGDYITNKSKDETCLISLPGLSFSLKSRDLPSFLLA  185

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK--KVRMVGIGPL  781
             + T       +A+ ++++QI+ +N E NP+VLVNT +  E DAL  +   K++M+ IGPL
Sbjct  186   SNTYT-----FALPSLKEQIQLLNEEINPRVLVNTVEEFELDALNKVDVGKIKMIPIGPL  240

Query  780   IPSAYLDGEDPSDTAFGGDLRQ--NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DP+D +FGGD+ +  + +DY++WLDS+ + SVVY++FG+ A +    +EEI
Sbjct  241   IPSAFLDGKDPTDNSFGGDVVRVDSKDDYIQWLDSKDEKSVVYVSFGTLAVLSKRQMEEI  300

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEK-----LRCKEELE--AQGKIVRWCAQVEVLQHP  448
             A+ L+ S   FLWV+R+    ++ EE+     L C+EELE    GKIV+WC+QVEVL H 
Sbjct  301   ARALLDSGFSFLWVIRDKKLQQQKEEEVDDDELSCREELENNMNGKIVKWCSQVEVLSHR  360

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLESL SGVP+VA P W DQ  NAKLI+DVWK G+R+  +EEG+VK 
Sbjct  361   SLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDVWKTGLRMEHDEEGMVKV  420

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E ++C+E VMG GEKGEELR NAKKWK+LA+ A+K+ GSS  NL++Y++++
Sbjct  421   EEIRKCLEVVMGKGEKGEELRRNAKKWKDLARAAVKEGGSSNRNLRSYLNDI  472



>ref|XP_010023603.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59914.1| hypothetical protein EUGRSUZ_H02638 [Eucalyptus grandis]
Length=470

 Score =   488 bits (1257),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 247/466 (53%), Positives = 321/466 (69%), Gaps = 18/466 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAPFSDG  1300
             H LLV FPAQGHINP+LQFAKRL+  GA+VT +T  SA   MS  R   +GL FA FSDG
Sbjct  5     HFLLVTFPAQGHINPALQFAKRLLGSGAEVTFATSISACRHMSKGRASPEGLHFAAFSDG  64

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD GL+  D +  F + ++ RGS+ +  LI +K  EGRP+T L+Y+ ++ WA  VAR   
Sbjct  65    YDDGLKTGDNVSQFMSELRRRGSEKLRDLIASKVGEGRPYTCLVYSLLLPWAAEVAREFR  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRN------CSGNQVVEVPGVP-ALGVRDFPSF  964
             VP  LLW QPATVLD+YY+YF  YG+  +N      CS     E+P +P     RD PSF
Sbjct  125   VPSALLWIQPATVLDMYYYYFNGYGEFIKNNCIDPSCS----FELPSLPYKFTSRDLPSF  180

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
                  ++       A+   +DQ++ +N E NP++LVNTFD+LE +ALRAI +  +VGIGP
Sbjct  181   FVPGRSDAYAH---AMPIFKDQLDVLNQENNPRILVNTFDSLEPEALRAIDRYNLVGIGP  237

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+LDG+DPSDT+FGGDL   S DY +WLDS  ++SVVY++FGS A +     EE+A
Sbjct  238   LIPSAFLDGKDPSDTSFGGDLFHKSKDYTDWLDSMAQASVVYVSFGSIAVISMRQAEELA  297

Query  603   QGLVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
               L+    PF+WV+R    GE  K E++L C +ELE +G IV WC+Q+EVL HPS+GCFL
Sbjct  298   CALLDCGRPFMWVIRAKQNGEEEKDEDRLSCMQELEEKGMIVPWCSQLEVLSHPSLGCFL  357

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             +HCGWNSTLESLA GVP+VA P W DQ  NAKLI+DVW+ GVRV  N EG+V+A E +RC
Sbjct  358   SHCGWNSTLESLALGVPMVAFPQWTDQGTNAKLIEDVWRTGVRVRPNGEGLVEAGEIRRC  417

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E VM  GE+ EE+R NA KWKE A+   ++ GSS  NLKA+++E+
Sbjct  418   LETVMADGERREEVRRNAAKWKESAREVAREGGSSDRNLKAFIEEV  463



>ref|XP_002266919.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   488 bits (1256),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 247/460 (54%), Positives = 318/460 (69%), Gaps = 10/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV +PAQGHINP+L+ AKRL+  GA+VT  T   A  RM     + GL FAPFSDGY
Sbjct  5     HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVCGLSFAPFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G E  D L    + +K +G+  + +L+    ++GRP   ++YT I  WA  VAR + V
Sbjct  65    DDGCENKDNLHHVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQEVARRVQV  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGV-PALGVRDFPSFLFSTE  949
                  W Q  TV DIYY+YF  YGD  RN S   +  +E+PG+ P    RD PSFL S+ 
Sbjct  125   LSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDLPSFLLSSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                   L + +E+ +   E ++ +ENPKVL+NTFDALE  ALRA+ K++++GIGPLIPSA
Sbjct  185   K-----LTFVLESFQKNFEALSQDENPKVLLNTFDALEPKALRALDKLKLIGIGPLIPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LD +DP+D +FGGD  Q S DY+EWL+S+PKSSV+Y++FGS A +    +EEIA GL+ 
Sbjct  240   FLDAKDPTDISFGGDQFQGSTDYIEWLNSKPKSSVIYISFGSLAILSKPQMEEIACGLLN  299

Query  588   SKMPFLWVLRETSKGE-KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             S  PFLWV+RE  KGE K EE L C+EELE +G IV WC+Q+EVL HPS+GCF+THCGWN
Sbjct  300   SDRPFLWVIREPDKGEMKDEEMLGCREELEQRGMIVPWCSQLEVLTHPSLGCFVTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLES+  GVP+VA P   DQ  NAKLI D+WK G+RV  NEEG+V+ DE K C+E VMG
Sbjct  360   STLESMVCGVPVVAFPQGTDQATNAKLITDMWKTGIRVWVNEEGMVERDEIKMCLEIVMG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              GE+ E LR NA+KWKELA+ AMK+ G S  NLKA++DE+
Sbjct  420   DGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>emb|CDP15112.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   488 bits (1256),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 243/466 (52%), Positives = 330/466 (71%), Gaps = 11/466 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS--SRPEIQGLDFA  1315
             +E  HVLLV +PAQGHINPSLQFAKRL+ +  +VT +T   A++RM+  S    +GL FA
Sbjct  2     VEQRHVLLVTYPAQGHINPSLQFAKRLLRMDVQVTFATSVFALSRMTKFSGSIPKGLSFA  61

Query  1314  PFSDGYDAGLEPADLK--DFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             PFSDGYD G +P  ++  ++ + ++ +GS+ +  +I    ++GRP T L+YT ++ WA  
Sbjct  62    PFSDGYDDGFQPKGVEPTEYMSGIEKQGSNTLRNVINTSADQGRPVTCLVYTLLLPWAAT  121

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPS  967
             VA   H+P  LLW QPATV+DIYY+YF  Y D  +N S +    ++ PG+P++   D PS
Sbjct  122   VAHECHIPSALLWIQPATVMDIYYYYFHGYEDDVKNNSSDPTWSIQFPGLPSMKTTDLPS  181

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             F+  +   +     +A+   + Q+E ++ EE PKVLVNTFDALE  AL+AI+   ++ IG
Sbjct  182   FILPSSDAI---YSFALPTFKRQLETLDEEEKPKVLVNTFDALEPQALKAIESYNLIAIG  238

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             PL PSA+LDG+DPS+T+F GDL Q S DY EWL+S+  +SVVY++FG+   +P   +EEI
Sbjct  239   PLTPSAFLDGKDPSETSFSGDLFQKSKDYKEWLNSRAIASVVYVSFGTLVKLPKKQMEEI  298

Query  606   AQGLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             A GL+KS  PFLWV+R  E  + EK E++L C EELE +G IV WC+Q+EVL HPS+GCF
Sbjct  299   ASGLLKSGRPFLWVIRAKEDGEEEKEEDRLSCMEELEEKGMIVPWCSQIEVLTHPSLGCF  358

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGWNSTLESL  GV ++A P W+DQ  NAKLI+DVW+ GVRV  NE+G V++DE KR
Sbjct  359   VTHCGWNSTLESLVCGVRMIAFPHWSDQGTNAKLIEDVWETGVRVIPNEDGTVESDEIKR  418

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             CIE VMG G KG ELR NA  WKELA+ AM++ GSS  NLKA++++
Sbjct  419   CIETVMGDGAKGIELRRNAMNWKELAREAMQEGGSSDKNLKAFVED  464



>dbj|BAD90935.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score =   488 bits (1255),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 319/465 (69%), Gaps = 11/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V FPAQG INP+LQFAKRL++ GA VT +T  SA  RM+     QGL FA F
Sbjct  1     MAPLNYLVVAFPAQGLINPALQFAKRLLHAGAHVTFATAASAYRRMAKSDPPQGLSFASF  60

Query  1308  SDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG + GL P  D + + A  +  GS+ +  L+     EGR F  + YT+I+ WAG VA 
Sbjct  61    SDGSEEGLRPGIDFEQYMADAERLGSETLRDLVVTSLNEGRKFECMFYTTIVPWAGQVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFL  961
              L +P TL+W QPAT+LDIYY+YF  YGD+ RN   +     + +PG+P L  RD PSF 
Sbjct  121   SLQIPSTLIWAQPATLLDIYYYYFNGYGDIIRNLGKDDPSASLHLPGLPPLTSRDVPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
             F+ E    + L      MR Q E    E+NP+VLVNTFDALE   L+AI  V M+GIGPL
Sbjct  180   FTPENQYAFTLS----LMRVQFEVFKEEKNPRVLVNTFDALETGPLKAIGNVTMLGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DP D +FGGDL Q S DY+ WLD++PK SV+Y++FGS + +     EE+A+
Sbjct  236   IPSAFLDGQDPLDKSFGGDLFQGSKDYIRWLDTKPKGSVIYVSFGSISVLSKEQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSK--GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+ +  PFLWV+R+  +  GE  +++L C EELE +G IV WC+QVEVL H S+GCF+T
Sbjct  296   GLLGTGRPFLWVIRKDKREEGEGEDDQLSCVEELEQKGMIVPWCSQVEVLSHASVGCFVT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             H GWNST ESLA GVP+VA P W DQ  NA L+++ WK+GVRVS NE G+V+ DE KRC+
Sbjct  356   HSGWNSTFESLACGVPMVAFPQWTDQQTNAMLVENEWKVGVRVSTNERGIVEGDELKRCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E V+G GE+GEE+R NA+KWK LA+ A K+ GSS  NLK +++E+
Sbjct  416   ELVVGDGEEGEEIRRNAEKWKGLAREAAKEGGSSDRNLKEFLEEI  460



>gb|AAY27090.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Pyrus communis]
Length=481

 Score =   488 bits (1255),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 245/472 (52%), Positives = 328/472 (69%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQGHINPSLQFAKRL N  GA VT  T  SA  R+ +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGHINPSLQFAKRLTNTTGAHVTYVTSLSAHRRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D + D+ + ++ RG+ A+  L+ A   EG P+T L+Y+ I+ W+  VA  LH+P
Sbjct  67    DGFKPGDNIDDYMSELRHRGAQAITDLVVASANEGHPYTCLVYSLIVPWSAGVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ + +         +E+PG+P +   RD PSF+
Sbjct  127   SVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLSFTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q+E +  E NP +LVNTFDALE +AL+AI K  ++G+GPL
Sbjct  187   VDTNP-----YNFALPLFQEQMELLERETNPTILVNTFDALEPEALKAIDKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DPSD +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPSAFLDGKDPSDKSFGGDLVQKSRDSSYLEWLNSKPEGSVIYVSFGSISVLGKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET--SKGEKPEEK-----LRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+   +PFLWV+R+    KG+  E K     L C+ ELE  G+IV WC+QVEVL  P
Sbjct  302   AKGLLDCGLPFLWVIRDKVDKKGDDNEAKQEEAMLSCRVELEELGRIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N EG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDFWKTGVRVTPNVEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC++ V+G GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLDLVLGSGEIGEEVRRNAKKWKDLAREAVNEGGSSDKNLKAFLDQI  473



>ref|XP_008380456.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   487 bits (1253),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 241/472 (51%), Positives = 330/472 (70%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQGHINPSLQFAKRL+N  GA VT  T FSA +R+ +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGHINPSLQFAKRLINTTGAHVTFVTSFSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D +  +W+ ++ RG+ A+  L+ +   EG P+T L+YT ++ WA  VA  LH+P
Sbjct  67    DGFKPGDNIDHYWSELRRRGAQAITDLVVSSANEGHPYTCLVYTILLPWAADVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRN--CSGNQ-----VVEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+   SG        +E+PG+P +L  +D PSF+
Sbjct  127   NVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDALPCAIELPGLPLSLTSQDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T         + +  +++ ++ +  E +P +LVNTFDALE +AL+AI+K  ++G+GPL
Sbjct  187   VDTNPYT-----FVLPLLQEHMDLLERETHPTILVNTFDALEPEALKAIEKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IP+ +LDG+DPSD + GGDL Q S D  Y+EWL+ +P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPTTFLDGKDPSDKSSGGDLFQKSKDSPYLEWLNLKPEGSVIYVSFGSISVLEKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+    PFLWV+RE        ++ ++ EE L C+EELE  G+IV WC+QVEVL  P
Sbjct  302   AKGLLDCGRPFLWVIREKVDKKGDDNESKEEEEMLSCREELEKLGRIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LES+ASGVP+VA P W DQ  NAKLI+D WK GVRV+ NE+G+V  
Sbjct  362   SLGCFVTHCGWNSSLESMASGVPVVAFPQWTDQGTNAKLIEDAWKTGVRVTPNEKGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E VMG GE GEE+R NAKKWK+LA+ A+ + GSS  NL+A++D +
Sbjct  422   EELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLRAFLDRI  473



>ref|XP_004504379.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14114.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   486 bits (1252),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/459 (51%), Positives = 324/459 (71%), Gaps = 17/459 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H+LL+ +P QGHINP+ QFAKRL++LGA VTLST     NR++ +P +  L + PFSDGY
Sbjct  6     HILLIPYPVQGHINPAFQFAKRLISLGAHVTLSTTLHMHNRITHKPTLPNLSYLPFSDGY  65

Query  1296  DAGLEPADLKDFW---ASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D G +      +    +  K RGS+ +A LI +  ++G PFT L+Y+ ++ WA   ARG 
Sbjct  66    DDGFQSTGTDAYLLYTSEFKRRGSEFIANLILSNSQKGTPFTCLVYSLLLPWAAETARGF  125

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTET  946
             H+P  LLW QPAT+ DI YHYF  Y +  +N S +  +++PG+P L  RD PSFL  T  
Sbjct  126   HLPTALLWVQPATMFDILYHYFHGYSESIKNPSVS--IKLPGLPLLSARDLPSFLLDTCP  183

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPK-VLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             + +Y L   +    +Q ++++ E NP  +LVN+F+ALE DALRA++ + M+ IGPLIPSA
Sbjct  184   S-SYAL--MLSFFEEQFKELDVETNPTTILVNSFEALEPDALRAVENLNMISIGPLIPSA  240

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDG+DP+D +FGG + Q SN+ VEWLDS+ ++SVVY++FGS   +P   +EEIA+ L+ 
Sbjct  241   FLDGKDPTDNSFGGHIFQPSNNCVEWLDSKQENSVVYVSFGSLCVLPKKQMEEIARALLD  300

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
                PFLWV++E       EE+L C+EELE +GKIV+WC+Q+E+L HPS+GCFLTHCGWNS
Sbjct  301   CGFPFLWVIKEK------EEELNCREELEEKGKIVKWCSQLEILSHPSLGCFLTHCGWNS  354

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--SANEEGVVKADEYKRCIECVM  235
             T+ESL SGVPLV  P W DQ  NAKL++DVWK+GVRV    N++G+V  ++ + C+E VM
Sbjct  355   TIESLVSGVPLVVFPQWADQMTNAKLVEDVWKIGVRVDHKMNQDGIVIGEDIRNCLEVVM  414

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             G G K EELR N+KKWKEL++ A+K+ GSS  NL+ ++D
Sbjct  415   GSGGKCEELRENSKKWKELSREAVKEGGSSENNLRGFLD  453



>gb|AHL68667.1| UDP-glucose: anthocyanin 5-O-glucosyltransferase [Vitis amurensis]
Length=464

 Score =   486 bits (1250),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 331/462 (72%), Gaps = 13/462 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++ FPAQGHINP+L+ AKRL+ +GA VT +T   A +R+   P + GL F+ FSDG 
Sbjct  7     HFLIITFPAQGHINPALELAKRLIGVGADVTFATTIHAKSRLVKNPTVDGLRFSTFSDGQ  66

Query  1296  DAGLE--PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             + G++  P +L  F    +   S+ +++LI A   EGRP + LIY+ ++  A  +AR  +
Sbjct  67    EEGVKRGPNELPVF----QRLASENLSELIMASANEGRPISCLIYSILIPGAAELARSFN  122

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTE  949
             +P   LW QPATVLDIYY+YF  +GDL R+ S +    +E+PG+P+L  +D PSF   ++
Sbjct  123   IPSAFLWIQPATVLDIYYYYFNGFGDLIRSKSSDPSFSIELPGLPSLSRQDLPSFFVGSD  182

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
              N     + A+ A +  +E +  EENPKVLVNTFDALE +ALRA++K+++  +GPL+PS 
Sbjct  183   QNQE---NHALAAFQKHLEILEQEENPKVLVNTFDALEPEALRAVEKLKLTAVGPLVPSG  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             + DG+D SDT  GGDL   S DY+EWL S+P+S+VVY++FGS +      +EEIA+GL++
Sbjct  240   FSDGKDASDTPSGGDLSDGSRDYMEWLKSKPESTVVYVSFGSISMFSMQQMEEIARGLLE  299

Query  588   SKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
             S  PFLWV+R  E  +  K E+KL C+EELE QG +++WC+Q+EVL HPS+GCF+THCGW
Sbjct  300   SGRPFLWVIRAKENGEENKEEDKLSCQEELEKQGMLIQWCSQMEVLSHPSLGCFVTHCGW  359

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NS++ESLASGVP++A P W DQ  N KLI+DVWK GVR+  NEE +V +DE +RC+E VM
Sbjct  360   NSSIESLASGVPMIAFPQWADQGTNTKLIKDVWKTGVRLMVNEEEIVTSDELRRCLELVM  419

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             G GEKG+E+R NAKKWK LAK A+K+ GSS+ NLK ++DE++
Sbjct  420   GDGEKGQEMRKNAKKWKILAKEALKEGGSSHKNLKNFVDEVI  461



>ref|XP_003552552.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=465

 Score =   485 bits (1249),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 241/461 (52%), Positives = 323/461 (70%), Gaps = 19/461 (4%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             LL+ +P QGHINPS+QFAKRLV++G  VT +T      RM  +P I GL FA FSDGYD 
Sbjct  7     LLITYPIQGHINPSIQFAKRLVSMGVHVTFATSLYLHRRMLKKPTIPGLSFATFSDGYDD  66

Query  1290  GLEPAD---LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             G +  D   L  + + +K RGS+ +  +ITA K+EG+PFT L YT ++ WA  VAR LH+
Sbjct  67    GYKATDDSSLSSYMSELKRRGSEFLRNIITAAKQEGQPFTCLAYTILLPWAAKVARELHI  126

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVP-ALGVRDFPSFLFSTETN  943
             P  LLW Q ATV DIYY+YF EYGD F N   +  +E+PG+P +L  RD PSFL  +   
Sbjct  127   PGALLWIQAATVFDIYYYYFHEYGDSF-NYKSDPTIELPGLPFSLTARDVPSFLLPSNI-  184

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL-IPSAY  766
                   +A+  +++Q +D++ E NP +LVNTF  LE DALRA+ K  M+ IGPL IPSA+
Sbjct  185   ----YRFALPTLQEQFQDLDDETNPIILVNTFQDLEPDALRAVDKFTMIPIGPLNIPSAF  240

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             LDG+DP+DT++GGDL   SNDYVEWLDSQP+ SVVY++FG+ A + +  ++E+A+ L+ S
Sbjct  241   LDGKDPADTSYGGDLFDASNDYVEWLDSQPELSVVYVSFGTLAVLADRQMKELARALLDS  300

Query  585   KMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
                FLWV+R+    E       C+EELE +GKIV+WC+QVEVL H S+GCF+THCGWNST
Sbjct  301   GYLFLWVIRDMQGIED-----NCREELEQRGKIVKWCSQVEVLSHGSLGCFVTHCGWNST  355

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN---EEGVVKADEYKRCIECVM  235
             +ESL SGVP+VA P W DQ  NAK++QDVWK GVRV      EEG+V+A+E ++C++ VM
Sbjct  356   MESLGSGVPMVAFPQWTDQGTNAKMVQDVWKTGVRVDDKVNVEEGIVEAEEIRKCLDVVM  415

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G G KG+E R NA KWK LA+ A+ + GSS  N++ ++ ++
Sbjct  416   GSGGKGQEFRRNADKWKCLAREAVTEGGSSDSNMRTFLHDV  456



>ref|XP_007099701.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
 gb|EOY20331.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Theobroma cacao]
Length=466

 Score =   485 bits (1248),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 237/461 (51%), Positives = 320/461 (69%), Gaps = 11/461 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L+V +P QGHINP+LQFAK L+ +GA+VT +T  SA  RM+  P  QGL F  FSDGY
Sbjct  5     HFLVVTYPNQGHINPTLQFAKCLIRIGARVTFTTSVSARRRMTKVPSAQGLSFLTFSDGY  64

Query  1296  DAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D GL+P D K  + S  + RG + +  L+ +  +EG+P T ++++ ++ WA  VAR  H+
Sbjct  65    DDGLKPGDDKGHYMSEFRRRGKENLNDLVVSSDKEGKPVTCIVHSLLLPWAMEVAREHHI  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTET  946
             P  +LW QPATVL IYY+YF  Y +  +  +G     +E+PG+P L  RD PSF+ ++  
Sbjct  125   PSAILWIQPATVLGIYYYYFNGYEETIKGQAGESKCPIELPGLPPLASRDLPSFVAASNA  184

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
               +     A+   + Q E +  E N +VLVNTFDALE  AL+AI   +M  +GPL PS +
Sbjct  185   YPS-----ALSLFQQQFEVLAEETNARVLVNTFDALEPQALKAIANYKMFAVGPLTPSTF  239

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             L G+DPSD +F GDL Q S DY +WLDS+PKS+V+Y++FGS A +    +EEIA+ L+ S
Sbjct  240   LGGKDPSDGSFKGDLFQCSKDYFQWLDSKPKSTVIYVSFGSIAVLAKLQVEEIARALLAS  299

Query  585   KMPFLWVLR---ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
               PFLWV+R   +  + EK E+KL C+EELE  G IV WC+QVEVL HPS+GCF+THCGW
Sbjct  300   GRPFLWVVRNQKQNGEKEKEEDKLSCREELEQFGMIVPWCSQVEVLSHPSLGCFVTHCGW  359

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLESL +GVP++A P W DQ  NAKLIQDVW+ GVRV+ANEEG+V+  E  RC++ VM
Sbjct  360   NSTLESLVAGVPVMAFPQWTDQGTNAKLIQDVWETGVRVTANEEGIVERGEINRCLDLVM  419

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G GE+  ELR NA+KWK+LA+ A K+ GS  +NLKA++D++
Sbjct  420   GNGERANELRRNAEKWKDLAREAAKEGGSLDMNLKAFIDDV  460



>ref|XP_002263498.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=463

 Score =   485 bits (1248),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/460 (53%), Positives = 317/460 (69%), Gaps = 10/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV +PAQGHINP+L+ AKRL+  GA+VT  T   A   M     + GL FAPFSDGY
Sbjct  5     HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRHMVKPLSVCGLSFAPFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G E  D L    + +K +G+  + +L+    ++GRP   ++YT I  WA  VAR + V
Sbjct  65    DDGCENKDNLHHVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQEVARRVQV  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGV-PALGVRDFPSFLFSTE  949
                  W Q  TV DIYY+YF  YGD  RN S   +  +E+PG+ P    RD PSFL S+ 
Sbjct  125   LSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDLPSFLLSSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                   L + +E+ ++  E ++ +ENPKVL+NTFDALE  ALRA+ K++++GIGPLIPSA
Sbjct  185   K-----LTFVLESFQNNFEALSQDENPKVLLNTFDALEPKALRALDKLKLIGIGPLIPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LD +DP+D +FGGD  Q S DY+EWL+S+PKSSV+Y++FGS A +    +EEIA GL+ 
Sbjct  240   FLDAKDPTDISFGGDRFQGSTDYIEWLNSKPKSSVIYISFGSLAILSKPQMEEIACGLLN  299

Query  588   SKMPFLWVLRETSKGE-KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             S  PFLWV+RE  KGE K EE L C+EELE +G IV WC+Q+EVL HPS+GCF+THCGWN
Sbjct  300   SDRPFLWVIREPDKGEVKDEEMLGCREELEQRGMIVPWCSQLEVLTHPSLGCFVTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLES+  GVP+VA P   DQ   AKLI D+WK G+RV  NEEG+V+ DE K C+E VMG
Sbjct  360   STLESMVCGVPVVAFPQGTDQATTAKLITDMWKTGIRVWVNEEGMVERDEIKMCLEIVMG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              GE+ E LR NA+KWKELA+ AMK+ G S  NLKA++DE+
Sbjct  420   DGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>ref|XP_009373578.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=481

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/472 (52%), Positives = 327/472 (69%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQGHINPSLQFAKRL+N  GA VT  T  SA  R+ +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGHINPSLQFAKRLINTTGAHVTYVTSLSANRRIGNVSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D + D+ + ++ RG  A+  L+ A   EG P+T L+Y+ I+ WA  VA  LH+P
Sbjct  67    DGFKPGDNIDDYMSELRRRGVQAITDLVVASANEGHPYTCLVYSLIVPWAAGVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSG---NQV----VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ +    N V    +E+PG+P +    D PSF+
Sbjct  127   SVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNNVLPCSIELPGLPLSFTSGDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q+E +  E NP +LVNTFDALE +AL+AI K  ++G+GPL
Sbjct  187   VDTNP-----YNFALPLFQEQMELLERETNPTILVNTFDALEPEALKAIDKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DPSD +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPSAFLDGKDPSDKSFGGDLYQKSKDSSYLEWLNSKPEGSVIYVSFGSISVLGKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+   +PF WV+R+        ++ +K E  L C+ ELE  G+IV WC+QVEVL  P
Sbjct  302   AKGLLDCGLPFFWVIRDNVDKKGDDNEAKKEEAMLSCRVELEELGRIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N EG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDFWKTGVRVTPNVEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC++ V+G GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLDLVLGSGEIGEEVRRNAKKWKDLAREAVNEGGSSDKNLKAFLDQI  473



>gb|KDP32582.1| hypothetical protein JCGZ_13132 [Jatropha curcas]
Length=463

 Score =   484 bits (1245),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 250/464 (54%), Positives = 321/464 (69%), Gaps = 12/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FP QGHINP+LQFAKRL+ +G +VTL+T   A  RM+     +GL    FSDGY
Sbjct  5     HFLLVTFPTQGHINPALQFAKRLIRIGVEVTLATSAYAKRRMTKTSFPKGLSLTTFSDGY  64

Query  1296  DAGLEPADLK---DFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D G + +D      + + ++ RGS+ ++ LI     EG+P T L+YT ++ WA  VAR  
Sbjct  65    DDGYKGSDSDAHDKYMSEIRLRGSETLSDLIITSANEGKPVTCLVYTLLLPWAAEVARAH  124

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-VEVPGVPALGVRDFPSFLFSTE  949
             H+P  LLW QPATVLDIYY+Y   Y D+F  CS     VE+PG+  L  RD PSFL  + 
Sbjct  125   HLPCALLWIQPATVLDIYYYYLNGYEDMFSKCSDPLYRVELPGLEPLTSRDLPSFLVPSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                     + +    +Q+E +N E NPK+LVNTFDALE  AL+ I K  M+GIGPL+PSA
Sbjct  185   AYA-----FVLSLFAEQLEMLNKETNPKILVNTFDALEHRALKVIDKFNMIGIGPLLPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNS-NDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
              LDG DPSDT FG DL QNS   Y EWL+SQPKSSVVY++FGS   +     EEIA+GL+
Sbjct  240   ILDGNDPSDTCFGADLFQNSKTSYKEWLNSQPKSSVVYVSFGSICILSKKQTEEIARGLL  299

Query  591   KSKMPFLWVLRETSKGEKPEEK--LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             KS  PFLWV+RE    ++ EE   + C++ELE +G IV WC QVEVL + S+GCF++HCG
Sbjct  300   KSNRPFLWVIREDPNKKQEEEDGDISCRKELEEKGMIVPWCDQVEVLSNQSLGCFISHCG  359

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNSTLESL SGVP+VA P W DQ  NAKLI+D W++GVRV  NEEG+V+ +E  RC++ V
Sbjct  360   WNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDDWEIGVRVVPNEEGIVEGEEITRCLDLV  419

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             MG GEKG+++R NAKKWK+LA+ A+K+ GSS  NLKA++DE+LS
Sbjct  420   MGDGEKGKDVRKNAKKWKDLAREAVKESGSSDKNLKAFVDEVLS  463



>dbj|BAA89009.1| anthocyanin 5-O-glucosyltransferase [Petunia x hybrida]
Length=468

 Score =   483 bits (1242),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 249/462 (54%), Positives = 326/462 (71%), Gaps = 9/462 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI---QGLDFAPFS  1306
             HV+L  FPAQGHINP+LQFAK LV +G +VT ST   A +RM  +  +   +GL+F PFS
Sbjct  5     HVILTTFPAQGHINPALQFAKNLVKMGIEVTFSTSIYAQSRMDEKSILNAPKGLNFIPFS  64

Query  1305  DGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             DG+D G + +    F+ S ++  GS+ V K+I    E G+P T L+Y+  + WA  VAR 
Sbjct  65    DGFDEGFDHSKDPVFYMSQLRKCGSETVKKIILTCSENGQPITCLLYSIFLPWAAEVARE  124

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLFS  955
             +H+P  LLW+QPAT+LDIYY  F  Y     N S   N  +++PG+P L  RD PSFL  
Sbjct  125   VHIPSALLWSQPATILDIYYFNFHGYEKAMANESNDPNWSIQLPGLPLLETRDLPSFLLP  184

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
                     L  A+   ++ I+ ++ E  PK+LVNTFD LE +AL AI+  +  GIGPLIP
Sbjct  185   Y--GAKGSLRVALPPFKELIDTLDAETTPKILVNTFDELEPEALNAIEGYKFYGIGPLIP  242

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             SA+L G DP D +FGGDL QNSNDY+EWL+S+P SSVVY++FGS  +   + +EEI++GL
Sbjct  243   SAFLGGNDPLDASFGGDLFQNSNDYMEWLNSKPNSSVVYISFGSLMNPSISQMEEISKGL  302

Query  594   VKSKMPFLWVLRETSKGEKPEEK-LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             +    PFLWV++E  KG++ E K L C EELE  GKIV WC+Q+EVL+HPS+GCF++HCG
Sbjct  303   IDIGRPFLWVIKENEKGKEEENKKLGCIEELEKIGKIVPWCSQLEVLKHPSLGCFVSHCG  362

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNS LESLA GVP+VA P W DQ  NAK ++DVWK GVRV  NE+GVV+++E KRCIE V
Sbjct  363   WNSALESLACGVPVVAFPQWTDQMTNAKQVEDVWKSGVRVRINEDGVVESEEIKRCIELV  422

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             M GGEKGEELR NAKKWKELA+ A+K+ GSS+ NLKA++D++
Sbjct  423   MDGGEKGEELRKNAKKWKELAREAVKEGGSSHKNLKAFIDDV  464



>ref|XP_010246531.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   482 bits (1240),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 327/470 (70%), Gaps = 17/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H LLV FPAQGHINPSLQFAKRL+ +GA+VT +T  SA  RMS+     GL FAPF
Sbjct  1     MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACNPDGLTFAPF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G +  D ++ F + +K RGS+ + +LI +   EGRP + L++T ++ WA  VAR
Sbjct  61    SDGYDDGFKLTDSVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVPALGVRDFPSFLF  958
              L VP  LLW QPATV DIYY+ FT YGDL  N   +    VE+PG+P L  RD PSFL 
Sbjct  121   NLDVPWALLWIQPATVFDIYYYNFTGYGDLICNNKNDNSYTVELPGLPPLTSRDLPSFLL  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              + T       +A+    +QIE +  E  P+VLVNTFDALE +ALR ++K+ ++G+GPLI
Sbjct  181   PSNTYA-----FALPIFHEQIETLERETKPRVLVNTFDALEPEALRVVEKIDLIGVGPLI  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+LDG+DPSD +FGGDL   S DY+EWL+S+  SSVVY++FGS A +P   +EE+A  
Sbjct  236   PSAFLDGKDPSDKSFGGDLFHGSADYMEWLNSKADSSVVYVSFGSIALLPKRQMEELASA  295

Query  597   LVKSKMPFLWVLRE----TSKGEKPEEKLRCK-EELEAQGKIVRWCAQVEVLQHPSIGCF  433
             L++S  PFLWV+R+    + + +K EE    + EE + +G IV WC+QVEVL HPS+GCF
Sbjct  296   LIESGRPFLWVIRKNENASEETKKEEEAFLSRIEEQKREGMIVPWCSQVEVLSHPSVGCF  355

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANE---EGVVKADE  262
             L+HCGWNSTLESL +GV +VA P W DQ  NA LI+ V+  GVRV   E   +GVV+ +E
Sbjct  356   LSHCGWNSTLESLVTGVRVVAFPQWTDQATNAMLIEGVFGTGVRVREKEGEGDGVVEREE  415

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              KRC++ V   GE GEE++ NA+KWKELAK A+K+DGSS  NL+ +++E+
Sbjct  416   IKRCLDMVT-EGENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEI  464



>ref|XP_010243149.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=471

 Score =   481 bits (1239),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 249/470 (53%), Positives = 327/470 (70%), Gaps = 17/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H LLV FPAQGHINPSLQFAKRL+ +GA+VT +T  SA  RMS+     GL FAPF
Sbjct  1     MSHPHFLLVTFPAQGHINPSLQFAKRLIRIGAQVTFATSVSAHRRMSNACNPDGLTFAPF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G +  D ++ F + +K RGS+ + +LI +   EGRP + L++T ++ WA  VAR
Sbjct  61    SDGYDDGFKLTDSVEHFLSELKRRGSETLRELILSLAREGRPVSCLVHTLLLPWAADVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVPALGVRDFPSFLF  958
              L VP  LLW QPATV DIYY+ FT YGDL  N   +    VE+PG+P L  RD PSFL 
Sbjct  121   NLDVPWALLWIQPATVFDIYYYNFTGYGDLICNNKNDNSYTVELPGLPPLTSRDLPSFLL  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              + T       +A+    +QIE +  E  P+VLVNTFDALE +ALR ++K+ ++G+GPLI
Sbjct  181   PSNTYA-----FALPIFHEQIETLERETKPRVLVNTFDALEPEALRVVEKIDLIGVGPLI  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+LDG+DPSD +FGGDL   S DY+EWL+S+  SSVVY++FGS A +P   +EE+A  
Sbjct  236   PSAFLDGKDPSDKSFGGDLFHGSADYMEWLNSKADSSVVYVSFGSIALLPKRQMEELASA  295

Query  597   LVKSKMPFLWVLRE----TSKGEKPEEKLRCK-EELEAQGKIVRWCAQVEVLQHPSIGCF  433
             L++S  PFLWV+R+    + + +K EE    + EE + +G IV WC+QVEVL HPS+GCF
Sbjct  296   LIESGRPFLWVIRKNENASEETKKEEEAFLSRIEEQKREGMIVPWCSQVEVLSHPSVGCF  355

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANE---EGVVKADE  262
             L+HCGWNSTLESL +GV +VA P W DQ  NA LI+ V   GVRV A E   +GVV+ +E
Sbjct  356   LSHCGWNSTLESLVTGVRVVAFPQWTDQATNAMLIEGVCGTGVRVRAKEGEGDGVVEREE  415

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
               RC++ VM  GE GEE++ NA+KWKELAK A+K+DGSS  NL+ +++E+
Sbjct  416   IMRCLDMVM-EGENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEI  464



>ref|XP_010246537.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=472

 Score =   481 bits (1238),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 326/470 (69%), Gaps = 16/470 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H L+V FPAQGHINPSLQFAKRL+ +GA+VT +T  SA  RM +     GL FAPF
Sbjct  1     MSPPHFLVVTFPAQGHINPSLQFAKRLIGIGAQVTFATSVSAHRRMLNACNPDGLTFAPF  60

Query  1308  SDGYDAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG+D G +P   ++ F + +K RGS+ + +LI +   EG P T L+YT ++ WA  VAR
Sbjct  61    SDGHDDGFKPIGSIEHFLSELKRRGSETLRELILSLAREGCPVTCLVYTLLLPWAADVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVPALGVRDFPSFLF  958
              L VP  LLW Q ATV DIYY+ FT YGDL  N   +    +E+PG+P L  RD PSFL 
Sbjct  121   NLDVPSALLWIQSATVFDIYYYNFTGYGDLICNNKNDSSYTIELPGLPPLTSRDLPSFLL  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              + T   +    A+    +QIE +  E  P+VLVNTFDALE +ALRA++K+ ++G+GPLI
Sbjct  181   PSNTAYPF----ALPTFHEQIETLERETKPRVLVNTFDALEPEALRAVEKIDLIGVGPLI  236

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+LDG+DPSD +FGGDL   S DY+EWL+S+  SSVVY++FGS A +P   +EE+A  
Sbjct  237   PSAFLDGKDPSDKSFGGDLFHGSTDYMEWLNSKEDSSVVYVSFGSIAVLPMQQMEELASA  296

Query  597   LVKSKMPFLWVLRE---TSKGEKPEEK--LRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             L++S  PFLWV+R+    S+  K EE+  L   EE + +G  V WC+QVEVL HPS+GCF
Sbjct  297   LIESGRPFLWVIRKNENASEETKKEEEAFLSGIEEQKREGMKVPWCSQVEVLSHPSVGCF  356

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANE---EGVVKADE  262
             L+HCGWNSTLESL +GV +VA PLW DQ  NA LI+ V   GVRV A E   +GVV+ +E
Sbjct  357   LSHCGWNSTLESLVTGVRVVAFPLWTDQATNAMLIEGVCGTGVRVRAKEGEGDGVVEREE  416

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              KRC++ VM  GE GEE++ NA+KWKELAK A+K+DGSS  NL+ +++EM
Sbjct  417   IKRCLDMVM-EGENGEEMKRNARKWKELAKKAVKEDGSSDKNLRRFVEEM  465



>ref|XP_010650447.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=665

 Score =   488 bits (1255),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 245/481 (51%), Positives = 334/481 (69%), Gaps = 20/481 (4%)
 Frame = -3

Query  1509  IFHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ  1330
             + HHH        LL+ +PAQGHINP+LQFAKRL+ +G +VTL TG SA++RM+  P   
Sbjct  1     MLHHH-------FLLITYPAQGHINPTLQFAKRLIRMGMEVTLVTGVSALSRMAKAPSSA  53

Query  1329  GLDFAPFSDGY-DAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS  1153
             GL F  F DGY +     AD     + +K  GS A+  +I    E+GRP T L++T ++ 
Sbjct  54    GLTFTTFPDGYAEWDKARADFSHQLSEIKRSGSQALTDIILRSAEQGRPVTCLVHTLLLP  113

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVR  979
             W   VAR LHVP  LLW Q ATVLDIYY+YF  YGD+ R  S N    +E+PG+P L   
Sbjct  114   WVTGVARRLHVPSALLWIQTATVLDIYYYYFNYYGDVVRKNSNNPSCSIELPGLPLLTCG  173

Query  978   DFPSFLFSTETNVNYDLDWAIEAM-----RDQIEDINGEENPKVLVNTFDALEFDALRAI  814
             D PSFL + +   ++     ++++     ++Q+E +  E NPKVLVNTF+ LE +ALR++
Sbjct  174   DLPSFLLTGDDLTSFLCSSTLDSISFSTFQEQVEVLTQETNPKVLVNTFNELEAEALRSV  233

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
              K++++GIGPLIPSA+LD +DPSDT+FG D+   S D ++WL+S+PKSSV+Y++FG+  D
Sbjct  234   DKLKLIGIGPLIPSAFLDAKDPSDTSFGADIFHGSTDCIQWLNSKPKSSVIYVSFGTLCD  293

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKG-----EKPEEKLRCKEELEAQGKIVRWCAQ  469
             +P   +EEIA+ L+ S  PFLWVLR    G     ++ EEK  C+EELE +G IV WC+Q
Sbjct  294   LPKPQMEEIARALLDSGRPFLWVLRSQGSGNVKDKDQEEEKWSCREELEEKGMIVPWCSQ  353

Query  468   VEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN  289
             +EVL HPS+GCF+THCGWNSTLE LA GVP+VA P W+DQ  NAKLI ++WK GVR   N
Sbjct  354   LEVLSHPSLGCFVTHCGWNSTLEGLACGVPIVAFPQWSDQRTNAKLITEMWKTGVRALVN  413

Query  288   EEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             EEG+V++DE KRC+E VM  GE+  E+R NA+KWK+LA+ A+K+ GSS  NLKA++DE++
Sbjct  414   EEGIVESDEMKRCLEIVMEDGERAREMRRNAEKWKDLAREAVKEGGSSDRNLKAFVDEVV  473

Query  108   S  106
             +
Sbjct  474   A  474



>ref|XP_007163802.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
 gb|ESW35796.1| hypothetical protein PHAVU_001G265400g [Phaseolus vulgaris]
Length=531

 Score =   483 bits (1242),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 236/459 (51%), Positives = 315/459 (69%), Gaps = 13/459 (3%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             LLV +P QGHINP++QFAKRL  +G  VT +T      RM ++  + GL F  FSDGYD 
Sbjct  67    LLVTYPVQGHINPAIQFAKRLTAIGVHVTFATSTFLHRRMINKLTVPGLTFVTFSDGYDD  126

Query  1290  GLE---PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             G E    +++  + A +K RGS+    +IT+ K+EG+PFT + YT ++ W   VAR   +
Sbjct  127   GYEGTNDSNVISYMAELKLRGSEFFRNIITSAKQEGKPFTCVAYTLMLPWVAKVAREFRI  186

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVP-ALGVRDFPSFLFSTE  949
             P  LLW Q ATVLDIYYHYF EY D        +   +E PG+P +   RD PSFL  + 
Sbjct  187   PGVLLWIQAATVLDIYYHYFHEYRDYINIIHKKEDPTIEFPGLPFSFAARDIPSFLLPSN  246

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                     +AI  + +Q +  + E NP+V+VNTF+ LE ++LRAI K+ M+ IGPLIPSA
Sbjct  247   I-----YSFAIPPLEEQFQLFDEESNPRVIVNTFEDLEPESLRAIDKLTMISIGPLIPSA  301

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDG+DP+DT+FGGD+   S DYVEWLDS+P  SVVY++FGS A +    +EEIA+ L+ 
Sbjct  302   FLDGKDPADTSFGGDIFHGSKDYVEWLDSKPALSVVYVSFGSLAVLSQRQMEEIARALLD  361

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             S  PFLWV+RE++  E   ++L C++ELE +GKIV+WC QVEVL H S+GCF+THCGWNS
Sbjct  362   SGYPFLWVIRESNGKEGTLQELSCRKELEQRGKIVKWCTQVEVLSHGSVGCFVTHCGWNS  421

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--SANEEGVVKADEYKRCIECVM  235
             T+ESL+SGVP+V  P W DQ  NAKL++DVWK GVRV    NEEG+V+A E ++C+E VM
Sbjct  422   TMESLSSGVPMVGFPQWTDQGTNAKLVEDVWKTGVRVDDKVNEEGIVEAMEIRKCLEVVM  481

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             G G K EELR NA+KWK LA+ A+K+ GSS  N+  ++D
Sbjct  482   GNGGKAEELRRNAQKWKCLAREAVKEGGSSDRNMNTFLD  520



>ref|XP_004298223.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   480 bits (1235),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/473 (51%), Positives = 325/473 (69%), Gaps = 21/473 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEI-QGLDFA  1315
             M     LLV FPAQGHINPSLQF KRL+    A +T  T  SA  R+++   + +GL FA
Sbjct  1     MTQHRFLLVTFPAQGHINPSLQFVKRLIRTTDADMTFVTALSAHRRIANGSSMPRGLTFA  60

Query  1314  PFSDGYDAGLEPADL--KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             PFSDGYD G +P D+    + + ++ RGS A+  ++ +   EGRP+T ++YT ++SW   
Sbjct  61    PFSDGYDDGFKPGDIDIHHYMSELRRRGSQAITDIVMSSANEGRPYTCIVYTILLSWVAK  120

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN------CSGNQVVEVPGVP-ALGV  982
             VA  L +P  L+W QPATV DIY++YF  Y +L RN      C     V++PG+P +L  
Sbjct  121   VASELQLPAALVWIQPATVFDIYFYYFNGYKNLIRNSAMTNNCDPCHGVQLPGLPLSLKS  180

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVR  802
             RD PSF+  + +N     D+A+    +Q E +  E  P +LVNTFDALE +AL+AI+K  
Sbjct  181   RDLPSFMVDSNSN---PYDFALPLFEEQFEQLGKESKPTILVNTFDALEPEALKAIEKYN  237

Query  801   MVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVP  628
             ++GIGPLIPS +LDG+DPSD +FGGDL   S D  Y+ WL+S+PK SVVY++FGS + + 
Sbjct  238   LIGIGPLIPSFFLDGKDPSDESFGGDLFDKSKDSAYLAWLNSKPKESVVYVSFGSISVLS  297

Query  627   NTMLEEIAQGLVKSKMPFLWVLRETSK-GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                +EEIA+GL+ S  PFLWV+RE  K GEK E+K+ C+EELE  G IV WC+QVEVL +
Sbjct  298   KIQMEEIAKGLLISGRPFLWVIRENQKNGEKEEDKVSCREELEELGMIVPWCSQVEVLSN  357

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF+THCGWNSTLESL SGVP+VA P W DQ  NAKLI+D WK GVRV  NEEGVV 
Sbjct  358   PSLGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVEPNEEGVVV  417

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +E KRC++ VM    + +++R NAKKWK+LA+ A+ + GSS  N+K ++D++
Sbjct  418   GEEIKRCLDLVM----ESDKMRMNAKKWKDLAREAVSEGGSSGKNMKVFLDQI  466



>ref|XP_003531212.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=465

 Score =   479 bits (1234),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 233/460 (51%), Positives = 322/460 (70%), Gaps = 10/460 (2%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             LL+++PAQGHI+P+ Q AKRLV+LGA VT+ST      R++++P +  L F PFSDGYD 
Sbjct  7     LLILYPAQGHIHPAFQLAKRLVSLGAHVTVSTTVHMHRRITNKPTLPHLSFLPFSDGYDD  66

Query  1290  GLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVPVT  1111
             G   +D     +  K RGS+ V  LI +  +EG PFT L+YT+++SW   VAR  H+P  
Sbjct  67    GFTSSDFSLHASVFKRRGSEFVTNLILSNAQEGHPFTCLVYTTLLSWVAEVAREFHLPTA  126

Query  1110  LLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFLFSTETNV  940
             +LWTQPAT+LDI+Y+YF E+G+  ++   +    +        L  RD PSFL  +   +
Sbjct  127   MLWTQPATILDIFYYYFHEHGEYIKDKIKDPSCFIELPGLPLLLAPRDLPSFLLGSNPTI  186

Query  939   NYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYLD  760
             +    + +        D++ E  P++LVNTF+ALE +ALRA+ K  M+ IGPLIPSA+LD
Sbjct  187   D---SFIVPMFEKMFYDLDVETKPRILVNTFEALEAEALRAVDKFNMIPIGPLIPSAFLD  243

Query  759   GEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSKM  580
             G+D +DT+FGGD+ + SN   EWLDS+P+ SVVY++FGS   +P T +EE+A+ L+    
Sbjct  244   GKDTNDTSFGGDIFRLSNGCSEWLDSKPEMSVVYVSFGSLCVLPKTQMEELARALLDCGS  303

Query  579   PFLWVLRETSKGEKPE--EKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
             PFLWV++E     + E  E+L C EELE +GKIV WC+QVEVL H S+GCF+THCGWNST
Sbjct  304   PFLWVIKEKENKSQVEGKEELSCIEELEQKGKIVNWCSQVEVLSHGSVGCFVTHCGWNST  363

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--SANEEGVVKADEYKRCIECVMG  232
             +ESLASGVP+VA P W +Q  NAKLI+DVWK GVRV    NE+G+V+ +E +RC+E VMG
Sbjct  364   MESLASGVPMVAFPQWVEQKTNAKLIEDVWKTGVRVDKQVNEDGIVENEEIRRCLEEVMG  423

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              GEKG+ELRNNA+KW+ LA+ A+K+ GSS  NL+A++D++
Sbjct  424   SGEKGQELRNNAEKWRGLAREAVKEGGSSDKNLRAFLDDV  463



>emb|CAN62622.1| hypothetical protein VITISV_001655 [Vitis vinifera]
Length=463

 Score =   479 bits (1233),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 315/460 (68%), Gaps = 10/460 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV +PAQGHINP+L+ AK L+  GA+VT  T   A   M     + GL FAPFSDGY
Sbjct  5     HFLLVSYPAQGHINPTLRLAKXLIQTGAQVTFVTTVYAQRHMVKPLSVCGLSFAPFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G E  D L    + +K +G+  + +L+    ++GRP   ++YT I  WA  VAR + V
Sbjct  65    DDGCENKDNLHHVLSEIKRQGTRKLTELVLECADQGRPVACIVYTMIFDWAQEVARRVQV  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGV-PALGVRDFPSFLFSTE  949
                  W Q  TV DIYY+YF  YGD  RN S   +  +E+PG+ P    RD PSFL S+ 
Sbjct  125   LSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDLPSFLLSSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                   L + +E+ ++  E ++ +ENPKVL+NTFDALE  ALRA+ K++++GIGPLIPS 
Sbjct  185   K-----LTFVLESFQNNFEALSQDENPKVLLNTFDALEPKALRALDKLKLIGIGPLIPSX  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LD +DP+D +FGGDL Q S DY+EWL+S+PKSSV+Y++FGS A +    +EEIA GL+ 
Sbjct  240   FLDAKDPTDISFGGDLFQGSTDYIEWLNSKPKSSVIYISFGSLAILSKPQMEEIACGLLN  299

Query  588   SKMPFLWVLRETSKGE-KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
             S  PFLWV+RE  KGE K EE L C+EELE +G IV WC+Q+EVL HPS+GCF+THCGWN
Sbjct  300   SDRPFLWVIREPDKGEVKDEEMLGCREELEQRGMIVPWCSQLEVLTHPSLGCFVTHCGWN  359

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             STLES+  GV +VA P   DQ   AKLI D+WK G+RV  NEEG+V+ DE K C+E VMG
Sbjct  360   STLESMVCGVLVVAFPQGTDQATTAKLITDMWKTGIRVWVNEEGMVERDEIKMCLEIVMG  419

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              GE+ E LR NA+KWKELA+ AMK+ G S  NLKA++DE+
Sbjct  420   DGERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  459



>ref|XP_009337747.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   479 bits (1232),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 329/472 (70%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVN-LGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQGHINPSLQFAKRL+N  GA VT  T  SA +R+ +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGHINPSLQFAKRLINATGAHVTFITSLSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D +  +++ ++  G+ A+  L+ +   EG P+T L+YT ++ WA  VA  LH+P
Sbjct  67    DGFKPDDNIDHYFSELRRCGAQAITDLVVSSANEGHPYTCLVYTILLPWAADVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV D+YY+YF  Y D+ R+ + +         +E+PG+P +L  RD PSF+
Sbjct  127   NVLLWIQPATVFDVYYYYFNGYKDIIRDNTSSGTNDALPYSIELPGLPLSLTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+  +++ ++    E +P +LVNTFDALE +AL+AI+   ++G+GPL
Sbjct  187   VDTNP-----YNFALPLLQEHMDLPERETHPIILVNTFDALEPEALKAIETYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IP+ +LDG+DPSD +FGGD+ Q S D  Y+EWL+ +PK SV+Y++FGS   +    +EEI
Sbjct  242   IPTTFLDGKDPSDKSFGGDIFQKSKDSPYLEWLNLKPKGSVIYVSFGSICVLEKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRE--TSKGE----KPEEK-LRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+    PFLWV+R+    KGE    K EEK L C+EELE  G+IV WC+QVEVL  P
Sbjct  302   AKGLLDCGRPFLWVIRDKVNKKGEDNEAKEEEKMLSCREELEELGRIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESLASGVP+VA P W DQ  NAKLI+D WK GVRV+ NE+G+V  
Sbjct  362   SLGCFVTHCGWNSSLESLASGVPVVAFPQWTDQGTNAKLIEDAWKTGVRVTPNEKGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E VM  GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D+M
Sbjct  422   EELKRCLELVMESGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQM  473



>dbj|BAF49301.1| putative glycosyltransferase [Clitoria ternatea]
Length=469

 Score =   478 bits (1231),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 326/464 (70%), Gaps = 14/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG-  1300
             H L+V FPAQGHINP+LQ AK+L+ +GA+VTL       NR++++  I GL   PFSDG 
Sbjct  5     HFLIVTFPAQGHINPALQLAKKLIAMGAQVTLPITLYVYNRIANKTTIPGLSLLPFSDGG  64

Query  1299  YDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             Y+     A+ K + + ++ RGS+ V+ LI +  +EG+PFT L+YT ++  A  VAR  ++
Sbjct  65    YNTAGGGANYKLYVSELRRRGSEFVSNLILSSAKEGQPFTCLVYTLLLPCAADVARSFNL  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNC---SGNQVVEVPGVP-ALGVRDFPSFLFST  952
             P  LLW +PA VLDI Y+YF +Y D        S +  + +PG+P +L   D PSFL   
Sbjct  125   PFALLWIEPAAVLDILYYYFHDYRDYINQKTQKSSSCSISLPGLPFSLSSCDIPSFLLVW  184

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             +T+V     + +E+ ++QI+ ++ E NP VLVNTF+ALE +ALRA+ K+ M+ IGPLIPS
Sbjct  185   KTSV---FSFVLESFQEQIQQLDLETNPTVLVNTFEALEPEALRAVDKLNMIPIGPLIPS  241

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LDG+D +D+ FGGDL Q SNDYVEWLDS+P+ SVVY+AFGSY ++     EEIA+ L+
Sbjct  242   AFLDGKDHTDSCFGGDLFQVSNDYVEWLDSRPEKSVVYVAFGSYFELSKRQTEEIARALL  301

Query  591   KSKMPFLWVLRETS----KGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
                  FLWV+RE       G K EE++  +EEL  +GK+V WC+Q+EVL HPS+GCFL+H
Sbjct  302   DCGCQFLWVIREKKDSQVDGTKSEEEMSFREELGKKGKMVTWCSQMEVLSHPSLGCFLSH  361

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS--ANEEGVVKADEYKRC  250
              GWNST+ESL SGVP+VA P W DQ  NAKLI+DVWK+GVRV    NE+GVV+A++ KRC
Sbjct  362   SGWNSTMESLVSGVPIVAFPQWTDQKTNAKLIEDVWKIGVRVDDHVNEDGVVEAEKIKRC  421

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             +E VMG G+KGEELR NAKKWK LA+ A K  GSS  NL+ ++D
Sbjct  422   LEVVMGCGKKGEELRKNAKKWKALARDASKKGGSSEKNLRVFLD  465



>ref|XP_011101592.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Sesamum 
indicum]
Length=472

 Score =   478 bits (1231),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 331/470 (70%), Gaps = 18/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM-----SSRPEIQGL  1324
             M   HVLLV FP QGHINP+LQFAK+L+N+G +VT +T   A  RM     SS P  +GL
Sbjct  1     MASHHVLLVTFPVQGHINPALQFAKKLINMGIEVTFATTVLARQRMEKAAASSLP--KGL  58

Query  1323  DFAPFSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWA  1147
              FA FSDG D G + + D + +   ++ RG+ ++   + +  E+GRP T LIYT ++ WA
Sbjct  59    TFAAFSDGLDDGFKASNDPQKYMREIRRRGTKSLKDTVLSAAEQGRPITCLIYTLLLPWA  118

Query  1146  GVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVR-D  976
               VAR +H+P  LLW Q ATVLDIYY+YF  +GD     S +    +++ G+P L  + D
Sbjct  119   SEVAREVHIPSALLWIQAATVLDIYYYYFNGFGDEIIASSNDPSWKLQLHGIPILLSQCD  178

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSF+  T ++ NY   +A+   ++Q+E ++ E  PKVLVNT+D+LE DAL+AI +  ++
Sbjct  179   LPSFMLPTSSD-NYS--FALTVFKEQLETLDAETKPKVLVNTYDSLEPDALKAIDRYELI  235

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTML  616
             GIGPLIPSA+LDG+D SDT+FGGDL Q S+D + WL+S PKSSV+Y+AFGS   +P   +
Sbjct  236   GIGPLIPSAFLDGKDASDTSFGGDLFQKSDDCIGWLNSMPKSSVIYVAFGSILSLPRAQM  295

Query  615   EEIAQGLVKSKMPFLWVLR----ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             EEIA+GL+ S  PFLWV+R       + ++ +EKL C EELE  G+IV WC+Q+EVL HP
Sbjct  296   EEIAKGLLDSSRPFLWVIRVNEKANEEKKEEDEKLSCIEELEKAGRIVPWCSQLEVLTHP  355

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LES++ GVP+VA P W DQ  NAKLI+DVW+ GVRV  NE+GV ++
Sbjct  356   SLGCFMTHCGWNSSLESISCGVPMVAFPHWTDQCTNAKLIEDVWRTGVRVRRNEDGVAES  415

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
              E +RCIE VM GGEK  ELR N +KWK LA+ A++++GSS  NLKA+++
Sbjct  416   SEIRRCIEEVMDGGEKSRELRENVEKWKGLAREAVEENGSSNKNLKAFLE  465



>ref|XP_004502258.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cicer arietinum]
 gb|AGU14117.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   477 bits (1228),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/466 (52%), Positives = 322/466 (69%), Gaps = 18/466 (4%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             L+V +P QGHINP+LQFAKRLV +GA VT +T      R+ ++P I  L FA FSDGYD 
Sbjct  8     LIVTYPLQGHINPALQFAKRLVTMGAHVTFTTTIYLHRRLINKPTIPNLSFAAFSDGYDD  67

Query  1290  GLEP---ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             G       DL  +   + +RGS+ +  +I + K    PFT L YT ++ WA  VAR L +
Sbjct  68    GYNSNAIVDLSTYMLELSSRGSEFLRNIILSAKHGNHPFTCLAYTLLLPWAANVARELQL  127

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP-ALGVRDFPSFLFSTE  949
             P  LLW Q ATV DIYY+Y  E+GD   N S +    +E+PG+  +L  RD PSFL ++ 
Sbjct  128   PYALLWIQAATVFDIYYYYLHEHGDYITNKSKDATCNIELPGLSFSLKSRDLPSFLQASN  187

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK-KVRMVGIGPLIPS  772
                     + + +M++Q   ++ E NP VLVNT D  E +++RAI  K++M+ IGPLIPS
Sbjct  188   IYT-----FILSSMKEQFRILDEETNPIVLVNTVDEFELESVRAIDDKIKMIPIGPLIPS  242

Query  771   AYLDGEDPSDTAFGGD-LRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             AYLDG+D +DT+FGGD +R +S DY+EWLDS+ +SSVVY++FGS++ +P   +EE A+ L
Sbjct  243   AYLDGKDLTDTSFGGDVIRVDSEDYIEWLDSKDESSVVYVSFGSFSVLPKKQMEEFARAL  302

Query  594   VKSKMPFLWVLRETSKGEKPEE-KLRCKEELE--AQGKIVRWCAQVEVLQHPSIGCFLTH  424
             + S + FLWV+RE    EK E+ +L CKEELE    GKIV+WC+QVEVL H S+GCF+TH
Sbjct  303   LDSGLNFLWVIREKKVDEKKEDDELSCKEELEKNVNGKIVKWCSQVEVLSHSSVGCFVTH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN--EEGVVKADEYKRC  250
             CGWNST ESL SGVP+VA P W DQ  NAKLI+DVWK GVR+  N  EEG+VKADE +RC
Sbjct  363   CGWNSTTESLVSGVPMVAFPQWTDQSTNAKLIEDVWKCGVRMDNNRDEEGIVKADEIRRC  422

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E V+GGGEKGEEL+ NA+KWK L + A+K+ GSS  NLK+++  +
Sbjct  423   LELVIGGGEKGEELKRNAEKWKSLGREAVKEGGSSDKNLKSFLHHI  468



>ref|XP_004297003.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   476 bits (1226),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 325/469 (69%), Gaps = 27/469 (6%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRM---SSRPEIQGLDFAPFSD  1303
             LLV +PAQGHINPSLQF K L+   GA+VT  T  SA  R+   SS+P  +GL FAPFSD
Sbjct  7     LLVTYPAQGHINPSLQFVKCLIRTTGAEVTYVTALSAHRRIGNSSSKP--RGLTFAPFSD  64

Query  1302  GYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             GYD GL+P D +  + + ++ RGS A+A ++ +   EGRP+T ++YT ++ W   VA  L
Sbjct  65    GYDDGLKPGDDIPHYLSELRRRGSHALADIVVSSANEGRPYTCIVYTILLPWVAQVASEL  124

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRN------CSGNQVVEVPGVP-ALGVRDFPS  967
             H+P  L+W QPATV DIYY+Y   Y DL RN      C     VE+PG+P AL  RD PS
Sbjct  125   HLPAALVWIQPATVFDIYYYYLNGYKDLIRNNATAKSCDPCHGVELPGLPLALKSRDLPS  184

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             F+  +        D+A+   ++Q E +  E  P +LVNTFDALE +AL+AI K  ++GIG
Sbjct  185   FMVDSNP-----YDFALPLFKEQFEQLGKESKPTILVNTFDALEPEALKAIDKYNLIGIG  239

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             PLIPSAYLDG+DPSD +FGGDL + S D  Y+ WL+S+PK SVVY++FGS + +    +E
Sbjct  240   PLIPSAYLDGKDPSDKSFGGDLFEKSKDSVYLGWLNSKPKESVVYVSFGSISVLSKIQME  299

Query  612   EIAQGLVKSKMPFLWVLRETSK-GE-KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIG  439
             EIA+GL+ S  PFLWV+RE  K GE K E+K+ C+EELE  G IV WC+QVEVL +PS+G
Sbjct  300   EIAKGLLLSGRPFLWVIRENQKNGEGKEEDKVSCREELEELGMIVPWCSQVEVLSNPSLG  359

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+THCGWNST+ESL SGVP+VA P W DQ  NAKLI+D WK GVRV  NEEG V  +E 
Sbjct  360   CFVTHCGWNSTMESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVEPNEEGGVVGEEI  419

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             KRC++ VM    + +++R NAKKWK LA+ A+ + GSS  N+K ++D++
Sbjct  420   KRCLDLVM----ESDKMRMNAKKWKGLAREAVGEGGSSDKNMKVFLDQI  464



>ref|XP_010039945.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45604.1| hypothetical protein EUGRSUZ_L00636 [Eucalyptus grandis]
Length=460

 Score =   476 bits (1224),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 238/465 (51%), Positives = 323/465 (69%), Gaps = 11/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V FP+QG INP+LQFAKRL++ GA VT +T  SA  RM+     +GL FA F
Sbjct  1     MAPVNYLVVAFPSQGLINPALQFAKRLLHTGAHVTFATAGSAYRRMAKSNPPEGLFFASF  60

Query  1308  SDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG D GL P  D++ + A ++  GS+ +  L+      GR F  + YT+I+ W   VA 
Sbjct  61    SDGSDEGLMPGIDIEKYMADVERLGSETLRDLVITSLNRGRTFACIFYTTIVPWVAQVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG---NQVVEVPGVPALGVRDFPSFL  961
              L +P TL+W QPAT+LDIYY+YF  YGD+ +N      +  +++PG+P L  RD PSF 
Sbjct  121   SLEIPSTLIWAQPATLLDIYYYYFNGYGDIIKNLGNGDPSASLQLPGLPPLTPRDVPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
             F+ +    + L      MR Q E    E+NP+VLVNTFDALE   L+AI  V M+GIGPL
Sbjct  180   FTAKNQYAFSL----PLMRVQFEVFKEEKNPRVLVNTFDALEPGPLKAIGNVTMLGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DP D +FGGDL Q+S DY++WLD++P+ SV+Y++FGS + + N   EE+A+
Sbjct  236   IPSAFLDGQDPLDKSFGGDLFQSSKDYIQWLDTKPEGSVIYVSFGSISVLSNAQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSKGEKPEE--KLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+ +  PFLWV+R+  + E   E  +L C EEL+ +G IV WC+QVEVL H S+GCF+T
Sbjct  296   GLLGTGRPFLWVIRKDKEEEGEGEEDQLSCMEELKQKGMIVSWCSQVEVLSHASVGCFVT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNST ESLA GVP+VA P W DQ  NA L+++ WK+GVRV+ NE G+V+ DE+KRC+
Sbjct  356   HCGWNSTFESLACGVPMVAFPQWTDQQTNAMLVENEWKVGVRVNTNEGGIVEGDEFKRCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E V+G GE+GEE+R NAKKWK LA+ A K+ GSS  NLKA+++++
Sbjct  416   ELVVGNGEEGEEIRRNAKKWKGLAREAAKEGGSSDRNLKAFLEKI  460



>ref|XP_008348418.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   476 bits (1224),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 327/472 (69%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQGHINPSLQFAKRL+N  GA VT  T  SA +R+ +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGHINPSLQFAKRLINTTGAHVTFITSLSAHHRIGNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +P D  D + S ++  G+ A+  L+ + + EG P+T ++YT ++ WA  VA  LH+P
Sbjct  67    DGFKPGDNIDHYLSELRHHGAQAITDLVVSSENEGHPYTCMVYTILLPWAADVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  + DL R+ + +         +E+PG+P +L  RD PSF+
Sbjct  127   NVLLWIQPATVFDIYYYYFNGFKDLIRDNTSSGTNDALPCSIELPGLPLSLTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q++ +  E NP +LVNTFDALE +AL+A +K  ++G+GPL
Sbjct  187   VDTNP-----YNFALPLFQEQMDLLERETNPIILVNTFDALEPEALKATEKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IP+ +LDG+DPSD +FGGDL + S D  Y+EWL+ +P+ SV+Y++FGS   +    +EEI
Sbjct  242   IPTTFLDGKDPSDKSFGGDLLKKSKDSPYLEWLNLKPEGSVIYVSFGSICVLEKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRE--TSKGEKPEEK-----LRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+    PFLWV+R+    KGE  E K     L C+EELE  G+IV WC+QVEVL  P
Sbjct  302   AKGLLDCGRPFLWVIRDKVNKKGEDNEAKEEEEMLSCREELEELGRIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LES ASGVP+VA P W DQ  NAKLI+D WK G+RV+ NE+G+V  
Sbjct  362   SLGCFVTHCGWNSSLESFASGVPVVAFPQWTDQGTNAKLIEDAWKTGLRVTPNEKGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             DE KRC+E VMG GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D +
Sbjct  422   DELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDRI  473



>ref|XP_008222735.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=473

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 318/471 (68%), Gaps = 23/471 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV FPAQGHINPSLQFAK L+   GA VT  T  SA   + +     GL ++ FS GYD
Sbjct  7     LLVTFPAQGHINPSLQFAKHLIRTTGAHVTYVTSLSAHGCIGNGSTPHGLTYSLFSHGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +  D +  +   +K RG+ A+  LI +  +EGRP+T LIYT ++ WA VVA  LH+P
Sbjct  67    NGFKDGDDIDHYMLELKRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVVASELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV------VEVPGVP-ALGVRDFPSFLF  958
               L+W QPATV DIYY+YF  Y DL +N S          +E+PG+P +L  RD PS + 
Sbjct  127   SVLMWIQPATVFDIYYYYFGGYKDLIQNISTTHTNGALCSIELPGLPQSLASRDLPSLM-  185

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
               ++N+     +A+    +  E +  E  P +LVNTFDALE +AL+AI K  ++GIGPLI
Sbjct  186   -VDSNL---YSFALPLFEEHFELLERETKPIILVNTFDALEPEALKAIDKYNLIGIGPLI  241

Query  777   PSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             PSA+LDG+DPSD  F GDL Q S D  Y+EWL+S P+ SVVY++FGS + +    +EEIA
Sbjct  242   PSAFLDGKDPSDKLFRGDLFQKSEDSSYIEWLNSMPEGSVVYVSFGSMSVLSKPQMEEIA  301

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEK-------LRCKEELEAQGKIVRWCAQVEVLQHPS  445
             +GL+ S  PFLWV+RE  K    +++       L C+EELE  GKIV WC+QVEVL  PS
Sbjct  302   KGLLDSGRPFLWVIREKEKSNGQDKEAEKEEEKLSCREELEELGKIVPWCSQVEVLSSPS  361

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             +GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N+EG+V  +
Sbjct  362   LGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTPNDEGIVVGE  421

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E KRC+E VMG GE G+ELR NAKKWK LA+ A+ + GSS  NLKA++D++
Sbjct  422   ELKRCLELVMGSGEIGKELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  472



>ref|XP_007221281.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
 gb|EMJ22480.1| hypothetical protein PRUPE_ppa005161mg [Prunus persica]
Length=474

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 321/472 (68%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV FPAQGHINPSLQFAK LV   GA VT  T  SA +R+ +     GL ++ +SDGYD
Sbjct  7     LLVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAQSRIGNGSTPHGLTYSLYSDGYD  66

Query  1293  AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +  D  D + S ++  G+ A+  LI +  +EGRP+T LIYT ++ WA   AR LH+P
Sbjct  67    NGFKDGDDIDHYMSELRRCGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAEAARELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFR--NCSGNQ-----VVEVPGVP-ALGVRDFPSFL  961
               L+W QPATV DIYY+YF+ Y DL R   C+ +       +E+PG+P +L  RD PSF+
Sbjct  127   SVLVWIQPATVFDIYYYYFSGYKDLIRKNTCTTHPNGALCSIELPGLPLSLASRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +         +A+    +Q E +  E  P +LVNTFDALE +AL+AI K  ++GIGPL
Sbjct  187   VGSNP-----YGFALPLFEEQFELLERETKPIILVNTFDALEPEALKAIDKYNLIGIGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DPSD +F GD  Q S D  Y+EWL+S+P+ SVVY++FGS + +    +EEI
Sbjct  242   IPSAFLDGKDPSDKSFPGDRFQKSEDSSYIEWLNSRPEGSVVYVSFGSISVLSKPQMEEI  301

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEK-------LRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+ S  PFLWV+RE       +++       L C+EELE  GKIV WC+QVEVL  P
Sbjct  302   AKGLLDSGRPFLWVIREKEGSNGRDKEAEKEEEKLSCREELEELGKIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N+EG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTPNDEGIVAG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E VMG GE GEELR NAKKWK LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>ref|XP_007221288.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
 gb|EMJ22487.1| hypothetical protein PRUPE_ppa016890mg [Prunus persica]
Length=474

 Score =   473 bits (1216),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 322/471 (68%), Gaps = 23/471 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             L + +PAQGHINP+LQ AKRL+ N GA+VT  T   A  R+ +     GL +AP+SDGYD
Sbjct  7     LFLTYPAQGHINPALQLAKRLIRNTGAQVTYVTSLYAYRRIVNGSTPNGLTYAPYSDGYD  66

Query  1293  AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G + +D  D + S ++  GS  +  L+ +  +EG P+T L+YT ++ WA  +AR LH+P
Sbjct  67    DGFKFSDDVDHYMSELRRAGSQVITDLVASSAKEGHPYTCLVYTILLPWAADLARELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV------VEVPGVPA-LGVRDFPSFLF  958
               L W Q AT+ D+YY+Y + Y DL R   G         +++PG+P  L  RD PSF+ 
Sbjct  127   SVLAWIQAATLFDVYYYYLSGYKDLIRESFGTDTNDPSCSIQLPGLPLDLASRDLPSFMV  186

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             + E + N+    A+     Q E +  E  P +LVNTFDALE +AL+AI K  ++GIGPLI
Sbjct  187   A-ENSYNF----ALPLFEKQFELLERETKPIILVNTFDALEPEALKAIDKYNLIGIGPLI  241

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDY--VEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             PSA+LDG+DPSDT+FGGDL Q S D   +EWL+S+P+ SV+Y++FGS + +    +EEIA
Sbjct  242   PSAFLDGKDPSDTSFGGDLFQKSMDSSCIEWLNSKPEGSVIYVSFGSVSALSKDQMEEIA  301

Query  603   QGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPS  445
             +GL+    PFLWV+RE        ++ EK EEK  C+EEL+  GKIV WC+Q+EVL +PS
Sbjct  302   KGLLDYGRPFLWVIREKEERNGQDNETEKEEEKFSCREELKELGKIVLWCSQLEVLSNPS  361

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             +GCF+THCGWNS++ESL SGVP+VA PLW DQ  NAKLI+D WK GVRV+ NEEG+V  +
Sbjct  362   LGCFVTHCGWNSSMESLVSGVPVVAFPLWTDQRTNAKLIEDTWKTGVRVAPNEEGIVVGE  421

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E KRC+E VMG GE GEELR NAKKWK LA+ A+ + GSS  NL A++D++
Sbjct  422   ELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDKNLMAFLDQI  472



>ref|XP_006349903.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=470

 Score =   472 bits (1214),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/464 (51%), Positives = 318/464 (69%), Gaps = 11/464 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG-----LDFAP  1312
             HV+L  FPAQGHINP+LQFAK LV  G +VT ST   A   M  +  I       ++F P
Sbjct  5     HVILTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLMNFVP  64

Query  1311  FSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G + + D   + + ++  GS+ V  +I    E G P T L+Y+  + WA  VA
Sbjct  65    FSDGFDDGFDHSKDPVCYMSQLRKCGSETVKNIIINCSENGSPITCLLYSIFLPWAAEVA  124

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFL  961
             R +++P  LLW+QPAT+LDIYY  F  Y     N S   N  +++PG+P L  +D PSFL
Sbjct  125   REVNIPSALLWSQPATILDIYYFNFHGYEKEMANESNDPNWSIQLPGLPQLKTKDLPSFL  184

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +  NV   L  A+   ++ I  ++ E NPK+LVNTFD LE +AL+AI+     GIGPL
Sbjct  185   LPS--NVKGSLRVALPPFKELINTLDSEINPKILVNTFDELEPNALKAIENYNFYGIGPL  242

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG DP D+ FG DL   SNDY+EWL++   SSVVY++FGS  +   + ++EI++
Sbjct  243   IPSAFLDGNDPLDSCFGADLFDKSNDYIEWLNTNENSSVVYISFGSLMNPSISQMDEISK  302

Query  600   GLVKSKMPFLWVLRETSKGEKPEEK-LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             GL+    PFLW+++E  K ++ E+K + C EELE  GKIV WC+Q+EVL+HPS+GCF++H
Sbjct  303   GLIDIGRPFLWIIKEDEKNKENEKKTIGCIEELEKIGKIVPWCSQLEVLRHPSLGCFVSH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNS LESLA GVP+VA P W DQ  NAK I+DVWK GVRV+ NE+G+V+++E KRCIE
Sbjct  363   CGWNSALESLACGVPVVAFPQWTDQMTNAKQIEDVWKSGVRVNVNEDGIVESEELKRCIE  422

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VM GG KGEE+R NAKKWKELA+ A+K+ GSS+ NLKA+++E+
Sbjct  423   LVMDGGVKGEEMRKNAKKWKELAREAVKEGGSSHKNLKAFIEEI  466



>ref|XP_009373577.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=474

 Score =   472 bits (1215),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/472 (51%), Positives = 326/472 (69%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             L++ FPAQGHINPSLQFAKRL+N  GA VT  T  SA +R+ +     GL ++ FSDGYD
Sbjct  7     LVLTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRIDNDSIPDGLTYSLFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G   AD + D+ + ++ RG+ A++ L+ +  +EG P+T L+YT ++ WA  VA  LH+P
Sbjct  67    NGFNSADNIDDYMSELRRRGAQAISDLVVSSAKEGHPYTCLVYTILLPWAADVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ + +         +E+PG+  +L  RD PSF+
Sbjct  127   NVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDVLPCSIELPGLSLSLTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T         +A+   ++Q++ +  E NP +LVNTFDALE +AL+AI K  ++G+GPL
Sbjct  187   VDTNP-----YSFALPLFQEQMDLLERETNPTILVNTFDALEPEALKAIDKYNLIGVGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA L G+ P D +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IPSASLYGKVPLDKSFGGDLFQKSKDSSYLEWLNSKPEGSVIYVSFGSISVLEKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET--SKGE-----KPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+    PFLWV+R+    KG+     K EE L C+EELE  G+IV WC+QV VL  P
Sbjct  302   AKGLLDCGRPFLWVIRDKVEKKGDNNEVKKEEEMLSCREELEELGRIVPWCSQVAVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK G+R++ NEEG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGLRMTQNEEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E V+G GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLELVVGSGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQI  473



>ref|XP_008380454.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Malus domestica]
Length=474

 Score =   472 bits (1214),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/472 (50%), Positives = 322/472 (68%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV FPAQGHINPSLQFAKRL+N  GA VT  T  SA +R+ +     GL ++ FSDGYD
Sbjct  7     LLVTFPAQGHINPSLQFAKRLINTTGAHVTFVTCLSARHRIGNDSIPDGLTYSLFSDGYD  66

Query  1293  AGLEPADLKDFWA-SMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G    +  D +A  ++ RG+ A+  L+ +   EG P+T L+YT+ + WA  VA  LH+ 
Sbjct  67    DGFNRTNNNDHYALELRRRGAQAITDLVVSSANEGHPYTCLVYTTFLPWAADVAYELHLQ  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-------VEVPGVP-ALGVRDFPSFL  961
               LLW QPATV DIYY+YF  Y DL R+ + +         +E+PG+P +L  RD PSF+
Sbjct  127   NVLLWIQPATVFDIYYYYFNGYKDLIRDNTSSGTNDVLPCSIELPGLPLSLTSRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               T        ++A+   ++Q++ +  E NP +LVNTFDALE +AL+AI K  ++GIGPL
Sbjct  187   VDTNP-----YNFALPLFQEQMDLLERETNPTILVNTFDALEPEALKAIDKYNLIGIGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             I SA LD + PSD +FGGDL Q S D  Y+EWL+S+P+ SV+Y++FGS + +    +EEI
Sbjct  242   IRSASLDSKVPSDKSFGGDLFQKSKDSSYLEWLNSKPEGSVIYVSFGSISVLEKAQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET-------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+ L+    P+LWV+R+        ++ +K EE L C+EELE  G+IV WC+QV VL  P
Sbjct  302   AKALLDCGRPYLWVIRDKVEKKGDDNEAKKEEEMLSCREELEELGRIVPWCSQVAVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK G+RV+ NEEG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGLRVTQNEEGIVTG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E+KRC+E VMG GE GEE+R NAKKWK+LA+ A+ + GSS  N KA++D++
Sbjct  422   EEFKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGGSSNKNFKAFLDQI  473



>ref|XP_003532736.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=512

 Score =   473 bits (1216),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/464 (53%), Positives = 321/464 (69%), Gaps = 15/464 (3%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             LLV +PAQ HINP+LQ AKRL+ +GA VT+        R+S++P I GL F PFSDGYDA
Sbjct  41    LLVTYPAQSHINPALQLAKRLIAMGAHVTILLTLHVYRRISNKPTIPGLSFLPFSDGYDA  100

Query  1290  GLEP--ADLKDFW---ASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             G +   A   DF+   + +K R SD ++ LI +   EGRPFT L+YT ++ W   VAR  
Sbjct  101   GFDALHATDSDFFLYESQLKHRTSDLLSNLILSSASEGRPFTCLLYTLLLPWVADVARQF  160

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVP-ALGVRDFPSFLFSTE  949
             ++P  LLW +PATVLDI YH+F  Y D   + +   +V +PG+  +L  RD PSFL   +
Sbjct  161   YLPTALLWIEPATVLDILYHFFHGYADFINDETKENIV-LPGLSFSLSPRDVPSFLLLWK  219

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
              +V     + + +  +QI+ ++ E NP VLVNTF+ALE +ALRAI K+ M+ IGPLIPSA
Sbjct  220   PSV---FSFTLPSFENQIKQLDLETNPTVLVNTFEALEEEALRAIDKINMIPIGPLIPSA  276

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDG DP+DT+FGGD+ Q SNDYVEWLDS+ + SVVY++FGSY ++    +EEIA+GL+ 
Sbjct  277   FLDGNDPTDTSFGGDIFQVSNDYVEWLDSKEEDSVVYVSFGSYFELSKRQMEEIARGLLD  336

Query  588   SKMPFLWVLRE---TSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
                PFLWV+RE     K E+ EE    +EELE  GKIV WC+QVEVL H S+GCFLTHCG
Sbjct  337   CGRPFLWVVREKVINGKKEEEEELCCFREELEKWGKIVTWCSQVEVLSHSSVGCFLTHCG  396

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS--ANEEGVVKADEYKRCIE  244
             WNST+ESL SGVP+VA P W DQ  NAKLI+DVWK+GVRV    N  G+V+  E + C++
Sbjct  397   WNSTMESLVSGVPMVAFPQWTDQMTNAKLIEDVWKIGVRVDHHVNANGIVEGKEIEACLD  456

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMG G++  E R NAKKWK LA+ A K+ GSS  NL+A++D++
Sbjct  457   VVMGSGDRASEFRKNAKKWKVLARDAAKEGGSSEKNLRAFVDDV  500



>ref|XP_004252978.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=470

 Score =   471 bits (1212),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 235/464 (51%), Positives = 316/464 (68%), Gaps = 11/464 (2%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG-----LDFAP  1312
             HV++  FPAQGHINP+LQFAK LV  G +VT ST   A   M  +  I       ++F P
Sbjct  5     HVIVTTFPAQGHINPALQFAKNLVKNGIQVTFSTSIYAQRLMDEKKSIDNFPKGLMNFVP  64

Query  1311  FSDGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G + +    F+ S ++  GS  V  +I    E G P T L+Y+  + WA  VA
Sbjct  65    FSDGFDDGFDHSKDPVFYMSQLRKCGSQTVKNIIINCSENGSPITCLLYSIFLPWAAEVA  124

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFL  961
             R +++P  LLW+QPAT+LDIYY  F  Y     N S   N  +++P +P L  +D PSFL
Sbjct  125   REVNIPSALLWSQPATILDIYYFNFHGYEKEMSNESNDPNWSIQLPHLPQLKTKDLPSFL  184

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +  N    L  A+   ++ I  ++ E NPK+LVNTFD LE  AL+AI+  +  GIGPL
Sbjct  185   LPS--NAKGSLRVALPPFKELINTLDSEINPKILVNTFDELEPHALKAIENYKFYGIGPL  242

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG DP D+ FG DL   SNDY+EWL+++  SSVVY++FGS  +   + +EEI++
Sbjct  243   IPSAFLDGNDPLDSCFGADLFDKSNDYIEWLNTKENSSVVYISFGSLMNPSISQMEEISK  302

Query  600   GLVKSKMPFLWVLRETSKGEKPEEK-LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             GL+    PFLW++++  K ++ E+  + C EELE  GKIV WC+Q+EVL+HPS+GCF++H
Sbjct  303   GLIGIGRPFLWIIKQDEKNKENEKNVIGCIEELEKIGKIVPWCSQLEVLRHPSLGCFVSH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNS LESLA GVP+VA P W DQ  NAK I+DVWK GVRV+ NE+G+V+++E KRCIE
Sbjct  363   CGWNSALESLACGVPVVAFPQWTDQMTNAKQIEDVWKSGVRVNVNEDGIVESEELKRCIE  422

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             CVM GG KGEE+R NAKKWKELA+ A+K+ GSS+ NLKA++DE+
Sbjct  423   CVMDGGVKGEEMRKNAKKWKELAREAVKEGGSSHKNLKAFIDEV  466



>ref|XP_010673328.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   471 bits (1212),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 240/473 (51%), Positives = 323/473 (68%), Gaps = 23/473 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGH+NP+LQFAKRL+  GA VT ST  SA           G+ FA FSDGY
Sbjct  7     HFLLVTFPAQGHVNPALQFAKRLLRTGAHVTFSTAASAHRCFDKAKIPSGMSFATFSDGY  66

Query  1296  DAGLEPAD--LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             DAG    D  + D+ ++ + RG++ +A L+     EGRP T L+YT ++ W   VAR  H
Sbjct  67    DAGFRATDGDVLDYLSTFRQRGAETLATLLENSVAEGRPVTCLVYTLLLPWVAEVARKFH  126

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP-ALGVRDFPSFLFST  952
             VP  LLW QPATV DIYY+YF  Y D+  +C  + +  +E+P +P  L   D PSFL  +
Sbjct  127   VPSALLWIQPATVFDIYYYYFNGYHDIIYDCEKDPLWSLELPNLPLKLKSHDIPSFLLPS  186

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
                  +   +A+    +Q+E+++ EE PK+LVNTF+ALE DAL+AI+K +++ IGPL+PS
Sbjct  187   NP---FLYTFALPTFEEQMEELDKEEKPKILVNTFEALEVDALKAIEKFKLIPIGPLLPS  243

Query  771   AYLDGEDPSDTAFGGDLRQNS--NDYVEWLDSQPK-SSVVYLAFGSYADVPNTMLEEIAQ  601
             A+L+G+DP D +FGGDL Q +  +DY++WLDSQ + SSV+Y++FGS + +    +EE+A+
Sbjct  244   AFLNGKDPFDKSFGGDLFQKTKNSDYMKWLDSQEEYSSVIYVSFGSISVLSKAQMEELAK  303

Query  600   GLVKSKMPFLWVLRETSKGEKP------EEKLRCKEELEAQGKIVRWCAQVEVLQHPSIG  439
              L++   PFLWV+RE  K EK       E +L C EEL+A G IV WC+QVEVL HPSIG
Sbjct  304   ALIQIHRPFLWVIRENEKDEKDLREEHNEGELSCMEELKALGLIVPWCSQVEVLSHPSIG  363

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE--GVVKAD  265
             CF+THCGWNSTLESL  GVP+V  P W DQ  N+KLI+DVWK+GVRV  ++E  G+VK++
Sbjct  364   CFVTHCGWNSTLESLTCGVPMVGFPQWTDQTTNSKLIEDVWKIGVRVKVSKEEGGLVKSE  423

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             E KRC+E VM    + EE++ NAK WKELA  A K+ GSS  NLKA+M+E+ +
Sbjct  424   EIKRCLEVVM----ESEEMKENAKNWKELAVEAAKEGGSSDRNLKAFMEELFN  472



>ref|XP_008222736.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Prunus mume]
Length=474

 Score =   471 bits (1211),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 250/472 (53%), Positives = 322/472 (68%), Gaps = 24/472 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             L+V FPAQGHINPSLQFAK LV   GA VT  T  SA +R+ +     GL ++ +SDGYD
Sbjct  7     LIVTFPAQGHINPSLQFAKHLVRTTGAHVTYVTSLSAHSRIGNGSTPYGLTYSLYSDGYD  66

Query  1293  AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G +  D  D + S ++ RG+ A+  LI +  +EGRP+T LIYT ++ WA V AR LH+P
Sbjct  67    NGFKDGDDIDHYMSEIRRRGAQAITDLIVSSAKEGRPYTCLIYTILLPWAAVAARELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-------VVEVPGVP-ALGVRDFPSFL  961
               L+W QPATV DIYY+YF  Y DL RN +           +E+PG+P +L  RD PSF+
Sbjct  127   SVLVWIQPATVFDIYYYYFRGYKDLIRNGTSTTHTNGALCSIELPGLPLSLASRDLPSFM  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +         +A+    +Q E +  E  P +LVNTFDALE +AL+AI K  ++GIGPL
Sbjct  187   VDSNP-----YGFALPLFEEQFELLERETKPIILVNTFDALEPEALKAIDKYNLIGIGPL  241

Query  780   IPSAYLDGEDPSDTAFGGDLRQNS--NDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LD +DPSD +F GDL Q S  +  +EWL+S+ + SVVY++FGS + +    +EEI
Sbjct  242   IPSAFLDAKDPSDKSFRGDLFQKSEGSSNIEWLNSRAEGSVVYVSFGSISVLSKPQMEEI  301

Query  606   AQGLVKSKMPFLWVLRET--SKGE-----KPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             A+GL+ S  PFLWV+RE   S G      K EEKL C+EELE  GKIV WC+QVEVL  P
Sbjct  302   AKGLLDSGRPFLWVIREKEGSNGRDKEAEKEEEKLSCREELEELGKIVPWCSQVEVLSSP  361

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ N+EG+V  
Sbjct  362   SLGCFVTHCGWNSSLESLVSGVPVVAFPQWTDQGTNAKLIEDTWKTGVRVTPNDEGIVVG  421

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E KRC+E VMG GE GEELR NAKKWK LA+ A+ + GSS  NLKA++D++
Sbjct  422   EELKRCLELVMGSGEIGEELRRNAKKWKGLAREAVSEGGSSDRNLKAFLDQI  473



>ref|XP_009373576.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=572

 Score =   474 bits (1220),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 331/493 (67%), Gaps = 24/493 (5%)
 Frame = -3

Query  1533  KLHLTPHIIFHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMN  1357
             +LH  P      +  M     LLV +PAQGHINPS QFAKRL+N  GA+VT  T  SA +
Sbjct  84    QLHAPPRTSTIAYAAMVQHRFLLVTYPAQGHINPSFQFAKRLINTTGAQVTFVTCLSASH  143

Query  1356  RMSSRPEIQGLDFAPFSDGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFT  1180
             R+ +     GL +A FSDGYD G +P D  D + S ++ RG+ A+  L+ +   EG P+T
Sbjct  144   RVGNDSIPDGLTYALFSDGYDDGFKPGDNIDHYMSELRRRGTQAITDLVVSSANEGHPYT  203

Query  1179  RLIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-----  1015
              L+ T ++ WA  VA  LH+P  LLW QPATV DIYY+YF  Y DL R+ +G+       
Sbjct  204   CLVCTILLPWAANVAHELHLPNVLLWIQPATVFDIYYYYFNGYKDLIRDNTGSGTNDALP  263

Query  1014  --VEVPGVP-ALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFD  844
               +++PG+P +L  RD PSF+  T         +A+   ++Q++ +  E +P +LVNTFD
Sbjct  264   CSIQLPGLPLSLTSRDLPSFMVDTNPYT-----FALLLFQEQMDLLERETHPTILVNTFD  318

Query  843   ALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKS  670
             ALE +AL+AI+K  ++ +GPLIP+ +LD +DPSD +FGGDL Q S D  Y+EWL+ +P+ 
Sbjct  319   ALEPEALKAIEKYNLIEVGPLIPTTFLDAKDPSDKSFGGDLFQKSKDSPYLEWLNLKPEG  378

Query  669   SVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRET--SKGEKPEEK-----LRCKE  511
             SV+Y++FGS   +    +EEIA+GL+    PFLWV+R+    KGE  E K     L C+E
Sbjct  379   SVIYVSFGSLCVLEKAQMEEIAKGLLDCGRPFLWVIRDKVDKKGEDNEVKEEEEMLSCRE  438

Query  510   ELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKL  331
             ELE  GKIV WC+QVEVL  PS+GCF+THCGWNS+LESLASGVP+VA P W DQ  NAKL
Sbjct  439   ELEELGKIVPWCSQVEVLSSPSLGCFVTHCGWNSSLESLASGVPVVAFPQWTDQGTNAKL  498

Query  330   IQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDG  151
             I+D WK G RV+ NE+G+V  +E KRC+E VMG GE GEE+R NAKKWK+LA+ A+ + G
Sbjct  499   IEDTWKTGARVTPNEKGIVTGEELKRCLELVMGSGEIGEEMRRNAKKWKDLAREAVSEGG  558

Query  150   SSYLNLKAYMDEM  112
             SS  NLKA++D++
Sbjct  559   SSDKNLKAFLDQI  571



>sp|Q9ZR25.1|5GT_VERHY RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase; 
AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
HGT8; Flags: Precursor [Glandularia x hybrida]
 dbj|BAA36423.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase [Glandularia 
x hybrida]
Length=461

 Score =   469 bits (1206),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 321/470 (68%), Gaps = 21/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG--LDFA  1315
             M   HVLL  FPAQGHINP+LQFAKRL N   +VT  T   A  RMS         ++F 
Sbjct  1     MSRAHVLLATFPAQGHINPALQFAKRLANADIQVTFFTSVYAWRRMSRTAAGSNGLINFV  60

Query  1314  PFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKK--EEGRPFTRLIYTSIMSWAG  1144
              FSDGYD GL+P D  K++ + MK+RG  A++  + A    ++    T ++Y+ + +WA 
Sbjct  61    SFSDGYDDGLQPGDDGKNYMSEMKSRGIKALSDTLAANNVDQKSSKITFVVYSHLFAWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPG-VPALGVRDFPS  967
              VAR  H+   LLW +PATVLDI+Y YF  Y D     +G+  + +PG +P L  RD PS
Sbjct  121   KVAREFHLRSALLWIEPATVLDIFYFYFNGYSDEID--AGSDAIHLPGGLPVLAQRDLPS  178

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL  +       L      M++++E + GEE PKVLVN+FDALE DAL+AI K  M+ IG
Sbjct  179   FLLPSTHERFRSL------MKEKLETLEGEEKPKVLVNSFDALEPDALKAIDKYEMIAIG  232

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQ---NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTML  616
             PLIPSA+LDG+DPSD +FGGDL +   N +D +EWL + P+SSVVY++FGS+ +   + +
Sbjct  233   PLIPSAFLDGKDPSDRSFGGDLFEKGSNDDDCLEWLSTNPRSSVVYVSFGSFVNTTKSQM  292

Query  615   EEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             EEIA+GL+    PFLWV+R  ++GE  E  + C EEL+  GKIV WC+Q+EVL HPS+GC
Sbjct  293   EEIARGLLDCGRPFLWVVR-VNEGE--EVLISCMEELKRVGKIVSWCSQLEVLTHPSLGC  349

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEG-VVKADEY  259
             F+THCGWNSTLES++ GVP+VA P W DQ  NAKL++DVW+ GVRV ANEEG VV  DE 
Sbjct  350   FVTHCGWNSTLESISFGVPMVAFPQWFDQGTNAKLMEDVWRTGVRVRANEEGSVVDGDEI  409

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +RCIE VM GGEK  +LR +A KWK+LA+ AM++DGSS  NLK ++DE++
Sbjct  410   RRCIEEVMDGGEKSRKLRESAGKWKDLARKAMEEDGSSVNNLKVFLDEVV  459



>emb|CDP15111.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   469 bits (1207),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/464 (52%), Positives = 319/464 (69%), Gaps = 13/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM--SSRPEIQGLDFAPFSD  1303
             H+LLV +P QGHINPSLQFAKRL+ +G +VT +T   A+ RM  SS    +GL FA FSD
Sbjct  6     HILLVSYPVQGHINPSLQFAKRLLRMGIQVTFATSVFALGRMTKSSGSIPKGLSFATFSD  65

Query  1302  GYDAGLEPADL--KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS--WAGVVA  1135
             GYD G +P  +   +  + M+  GS+A+  +I     +G P T L+ T ++   WA  VA
Sbjct  66    GYDNGFQPKGVGHSEHMSGMEKHGSNALKNVINTSANQGCPVTCLVCTFLLPCPWATTVA  125

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFL  961
             R  H+P  LLW QPATV+DI+Y YF  Y D  +N S +    ++ PG+P++  +D PSF+
Sbjct  126   RECHIPSALLWIQPATVMDIFYDYFHGYEDDVKNNSNDPTWSIQFPGLPSMKAKDLPSFI  185

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +   +   +   + A + Q E ++ EE PKVL+NTFDALE  AL+AI+   ++ IGPL
Sbjct  186   LPSSDAIYGSV---LSAFKRQFETLDEEEKPKVLLNTFDALEPQALKAIESYNLIAIGPL  242

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
              PSA+LDG+DPS+T+F GDL Q S DY EW +S+P +SVVY++FGS   +P   +EEIA 
Sbjct  243   TPSAFLDGKDPSETSFSGDLFQKSEDYKEWFNSRPAASVVYVSFGSLLRLPKKQMEEIAS  302

Query  600   GLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+KS  PFLWV+R  E  + EK E++L C EELE +G IV WC+Q+EVL+HPS+GCFLT
Sbjct  303   GLLKSGRPFLWVIRAKEDGEEEKEEDRLSCMEELEEKGMIVPWCSQIEVLRHPSLGCFLT  362

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNSTLESL  GVP++A P W DQ  NAKLI+DVW+ GV+V  NE+G V +DE  RCI
Sbjct  363   HCGWNSTLESLVCGVPVIAFPHWVDQGTNAKLIEDVWETGVKVVPNEDGTVDSDEINRCI  422

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             E VM   EKG ELR NA KWKELA+ A ++ GSS  N+KAY++E
Sbjct  423   ETVMDDEEKGIELRRNAMKWKELAREATQEGGSSDKNIKAYVEE  466



>dbj|BAF49300.1| putative glycosyltransferase [Clitoria ternatea]
Length=472

 Score =   469 bits (1206),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 247/474 (52%), Positives = 321/474 (68%), Gaps = 19/474 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             M G H +LV+FPAQGHINP+ Q AKRL+ + GA+VT+ST      R++++P +  L F P
Sbjct  1     MSGHHFILVLFPAQGHINPAFQLAKRLIISFGARVTISTTLRMHRRLTNKPSLPSLSFLP  60

Query  1311  FSDGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D     A+    +AS +K RGS  +  LI +  +EG PFT L+YT ++ WA  VA
Sbjct  61    FSDGFDDTAATANQSSLYASELKRRGSQFLTNLILSHAQEGHPFTCLLYTPLLPWAAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVP---ALGVRDF  973
             RG H+P  +LWTQPATVLDI YHYF  Y D   + +       +E+PG+P    L  RD 
Sbjct  121   RGFHLPTAILWTQPATVLDILYHYFHGYRDYINDKTKEDPSCSIELPGLPRVLMLTPRDL  180

Query  972   PSFLFSTETNVNYDLDWAIEAM-RDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
             PSFL     N N  LD  I +M  +Q  D++ E  P++LVNTF+ALE  ALRA+ K  M+
Sbjct  181   PSFLL----NSNPSLDPLIVSMFEEQFNDLDVETKPRILVNTFEALETQALRAVDKFSMI  236

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTML  616
              IGPLIPSA+LDG+DPSDT+FGGD+   SN YVEWLDS  + SVVY++FGS+  +    +
Sbjct  237   PIGPLIPSAFLDGKDPSDTSFGGDMLHFSNGYVEWLDSMAEMSVVYVSFGSFCVLSKIQM  296

Query  615   EEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEA----QGKIVRWCAQVEVLQHP  448
             EE+A+ L+ S  PFLWV+RE  K     E+   +         +GKIV+WC+QVEVL HP
Sbjct  297   EELARALLDSGRPFLWVIREKEKKVGETEEEEEELRCREELEQRGKIVKWCSQVEVLSHP  356

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS--ANEEGVV  274
             S+GCF+THCGWNSTLESL SG+P+VA P W DQ  NAKL++DVWK GVRV    NEEG+V
Sbjct  357   SLGCFVTHCGWNSTLESLVSGIPMVAFPQWTDQKTNAKLVEDVWKTGVRVDHHVNEEGIV  416

Query  273   KADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             + +E KRC+E VMG GEKGEELR NAKKWK+L K  +K+ GS   N+K ++D +
Sbjct  417   EGEEIKRCLEVVMGSGEKGEELRMNAKKWKDLVKETVKEGGSLEKNMKTFLDSV  470



>ref|XP_010039944.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45603.1| hypothetical protein EUGRSUZ_L00635 [Eucalyptus grandis]
Length=467

 Score =   468 bits (1203),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 314/465 (68%), Gaps = 11/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V FPAQG INP+LQ AKRL++ GA VT +T  SA +RM+     +GL FA F
Sbjct  1     MAPLNYLVVAFPAQGLINPALQLAKRLLHTGAHVTFATAGSAYHRMAKSDPPEGLSFASF  60

Query  1308  SDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG + GL P  DL+ + A +   GS+ +  L+     EG  F  + YT+I+ W   VA 
Sbjct  61    SDGSEEGLRPGIDLEQYMADIVRLGSETLRDLVVTSLNEGCKFACIFYTTIIPWVAQVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFL  961
              L +P TL+W QPAT+LDIYY+YF  YGD+ RN   +     + +PG+P L  RD PSF 
Sbjct  121   SLQIPSTLVWVQPATLLDIYYYYFDSYGDIIRNLGKDDPSASLHLPGLPPLTSRDVPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
             F+ E    + L      MR Q +    E+NP+VLVNTFDALE   L+ I  V M GIGPL
Sbjct  180   FTPENQYAFSL----PLMRVQFKVFKEEKNPRVLVNTFDALEPRPLKVIGNVTMFGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +PSA+LDG+DP D +FG DL + S DY++WLD++P+ SV+Y++FGS + + N   EE+A+
Sbjct  236   VPSAFLDGQDPLDKSFGADLFRGSKDYIQWLDTKPEGSVIYVSFGSISVLSNAQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSKGE--KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+ +  PFLWV+R+  + E    E++L C EELE +G IV WC+QVEVL H S+GCF+T
Sbjct  296   GLLSTSHPFLWVIRKDKEEEVGGQEDQLSCMEELEQKGMIVPWCSQVEVLSHASVGCFVT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             H GWNST ESL  GVP+VA P W DQ  NA L+++ WK+GVRV+ NE G+V+ DE KRC+
Sbjct  356   HSGWNSTFESLTCGVPMVAFPQWGDQQTNAMLVENEWKVGVRVNTNERGIVEGDEIKRCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E V+G GE+GEE+R NAKKWK LA+ A K+ GSS  NL A+++E+
Sbjct  416   ELVVGDGEEGEEIRRNAKKWKGLAREAAKEGGSSDRNLNAFLEEI  460



>ref|XP_008380634.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Malus domestica]
Length=472

 Score =   466 bits (1198),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 316/470 (67%), Gaps = 22/470 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             LLV +PAQG INPSLQF KRL+N  GA VT  T  SA + + +     GL +APFSDGYD
Sbjct  7     LLVTYPAQGQINPSLQFVKRLINTTGAHVTYVTSLSARHCLDNGSIPDGLTYAPFSDGYD  66

Query  1293  AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
              G  P D + ++ + ++ RG+ A+  L+ +   EG P+T L+YTS + W   VA  LH+P
Sbjct  67    DGFMPGDSIDNYLSELRRRGAQAITDLVVSSANEGHPYTCLVYTSFLPWVAEVAHELHLP  126

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLFR---NCSGNQV---VEVPGVP-ALGVRDFPSFLF  958
               L W QPATV DI+Y+YF  Y DL R   N   N V   +E+PG+P AL  RD PSF+ 
Sbjct  127   NVLFWIQPATVFDIHYYYFNGYKDLIRDNTNSGTNNVPCSIELPGLPLALTSRDLPSFMV  186

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              T        ++ +   ++Q++ +  E N  +LVNTFDALE +AL AI K  ++G+GPLI
Sbjct  187   DTNL-----YNFVLSLFQEQMDLLERETNQTILVNTFDALEPEALEAIDKYNLIGVGPLI  241

Query  777   PSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             PSA+LD +DP D +FGGDL Q S D  Y+EWL+ +P+ SV+Y++FGS   +     EEIA
Sbjct  242   PSAFLDRKDPLDKSFGGDLFQKSKDSSYLEWLNLKPEGSVIYVSFGSICVLEKAQTEEIA  301

Query  603   QGLVKSKMPFLWVLRET--SKGE----KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSI  442
             +GL+    PFLWV+R+    KG+    K EE L C+EELE  G+I+ WC QVEVL   S+
Sbjct  302   KGLLDCGRPFLWVIRDKIEKKGDDNESKKEEILSCREELEELGRILPWCGQVEVLSSASL  361

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNS+LESL SGVP+VA P W DQ  NAKLI+D WK GVRV+ NEEG+V  +E
Sbjct  362   GCFVTHCGWNSSLESLVSGVPMVAFPQWMDQGTNAKLIEDSWKTGVRVTPNEEGIVTGEE  421

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              KRC+E VM  GE GEE+R NAKKWK+LA+ A+ + GSS  NLKA++D++
Sbjct  422   LKRCLELVMESGEIGEEMRRNAKKWKDLAREAVSEGGSSDKNLKAFLDQI  471



>ref|XP_010023609.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59919.1| hypothetical protein EUGRSUZ_H02643 [Eucalyptus grandis]
Length=465

 Score =   465 bits (1197),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 334/466 (72%), Gaps = 15/466 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI-QGLDFAP  1312
             M   H LLV FP QGHINPSLQFAKRLV +GA VT +T   A  RM+    I +GL FA 
Sbjct  1     MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRARPRMAESESIPEGLSFAS  60

Query  1311  FSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDGYD G +  D ++++   +K RG++ ++ LI +  + GR F+ ++YT ++ WA  VA
Sbjct  61    FSDGYDDGFDNWDEMEEYMDKIKRRGTETLSDLIASNLKSGRRFSGVLYTILLPWAAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV--EVPGVPALGVRDFPSFL  961
             R   +P T +W QPATVLD YY+YF  YGDL R+  GN  V  ++PG+P L   D PSF 
Sbjct  121   RSHGIPSTFVWIQPATVLDFYYYYFHGYGDLIRSTGGNPSVPIQLPGLPPLMACDIPSF-  179

Query  960   FSTETNVNYDL---DWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             F+++   N+ L    W  + + +       E  P++L NTFDALE DA+RAI +  ++GI
Sbjct  180   FNSKNEYNFSLPLFQWHFKILLE-------EAKPRILANTFDALEPDAIRAINEFEVIGI  232

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIPSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+Y++FGS + +     EE
Sbjct  233   GPLIPSAFLDGQDPSDTSFGGDLFKSSSGYMEWLDTKPKASVIYVSFGSISVLSKPQKEE  292

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             +A+ LV++  PFLWV+RE+ K E+ E++L  KEEL+  G IV WC+QVEVL HPS+ CF+
Sbjct  293   MARALVEAGRPFLWVIRESGKEERDEDRLSFKEELDKIGMIVPWCSQVEVLSHPSVACFV  352

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNST ESL  GVP+VA P W+DQ  NAKL+ DVW+ GVR++ NE+G+V++ E +RC
Sbjct  353   THCGWNSTSESLVCGVPMVAFPQWSDQQTNAKLVADVWRTGVRITPNEQGLVESGEMRRC  412

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E VMG G++GEE+R NA+K+++LA+ A+K+ GSS  NL+A++DE+
Sbjct  413   LELVMGDGKEGEEMRRNARKFRDLAREAVKEGGSSDKNLRAFVDEV  458



>emb|CAN62624.1| hypothetical protein VITISV_001657 [Vitis vinifera]
Length=456

 Score =   465 bits (1196),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 319/464 (69%), Gaps = 19/464 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             ME  H L++  P QGHINP+L FAKRL+  GA VT +   SA  RM   P + GL   PF
Sbjct  1     MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPRGPALPGLTLVPF  60

Query  1308  SDGYDAGLEPADL-KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G +  D  + + + +K  GS+ + ++     ++GRP T L++T +++WA  +AR
Sbjct  61    SDGYDDGFKLEDHPQHYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAAELAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPAL-GVRDFPSFL  961
              L VP  LLW Q ATV  IYYHYF  YG +  +CS   +  +++PG+P L   RD PS L
Sbjct  121   SLQVPSVLLWIQRATVFTIYYHYFNGYGYVVGDCSNEDSSPIQLPGLPMLLSSRDIPSLL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
              S+  +  +     +   +++IE +  E NPKVL NTFDALE +ALRA+ KV+++GIGPL
Sbjct  181   VSSNIHALW-----LSKFQEEIEALRQETNPKVLANTFDALEAEALRAMDKVKVIGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +PS         DT+FG D+ Q+ +D ++WL+S+ KSSVVY++FG+   V    +EEIA+
Sbjct  236   VPS---------DTSFGVDIFQDPSDCIDWLNSKHKSSVVYVSFGTLCVVSKQQMEEIAR  286

Query  600   GLVKSKMPFLWVLRETS-KGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
              L+ S  PFLWV+R  S  GE  EEKL C+EELE +G IV WC Q++VL HPS+GCF+TH
Sbjct  287   ALLHSGRPFLWVIRSASGNGEVEEEKLSCREELEEKGMIVAWCPQLDVLSHPSLGCFITH  346

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLE LASGVP+VA P W DQ  N KLI+DVWK GVRV+ANEEG+V+ +E KRC+E
Sbjct  347   CGWNSTLECLASGVPVVAFPQWTDQGTNGKLIEDVWKTGVRVTANEEGIVEGEEIKRCLE  406

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGGE+GEELR NA KWK+LA+ A+KD GSS  NLKA++DE+
Sbjct  407   VVMGGGERGEELRRNAGKWKDLAREAVKDGGSSDNNLKAFLDEL  450



>ref|XP_002263422.1| PREDICTED: crocetin glucosyltransferase, chloroplastic [Vitis 
vinifera]
Length=456

 Score =   463 bits (1191),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/464 (52%), Positives = 319/464 (69%), Gaps = 19/464 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             ME  H L++  P QGHINP+L FAKRL+  GA VT +   SA  RM   P + GL   PF
Sbjct  1     MEQHHFLIISHPMQGHINPALLFAKRLIRTGAHVTFAVSVSAHRRMPRGPALPGLTLVPF  60

Query  1308  SDGYDAGLEPADL-KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD G +  D  + + + +K  GS+ + ++     ++GRP T L++T +++WA  +AR
Sbjct  61    SDGYDDGFKLEDHPQHYLSEIKRCGSETLRRITAISADQGRPVTCLVHTILLAWAAELAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPAL-GVRDFPSFL  961
              L VP  LLW Q ATV  IYYHYF  YG +  +CS   +  +++PG+P L   RD PS L
Sbjct  121   SLQVPSVLLWIQRATVFTIYYHYFNGYGYVVGDCSNEDSSPIQLPGLPMLLSSRDIPSLL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
              S+  +  +     +   +++IE +  E NPKVL NTFDALE +ALRA+ KV+++GIGPL
Sbjct  181   VSSNIHALW-----LSKFQEEIEALRQETNPKVLANTFDALEAEALRAMDKVKVIGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +PS         DT+FG D+ Q+ +D ++WL+S+ +SSVVY++FG+   V    +EEIA+
Sbjct  236   VPS---------DTSFGVDIFQDPSDCIDWLNSKHESSVVYVSFGTLCVVSKQQMEEIAR  286

Query  600   GLVKSKMPFLWVLRETS-KGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
              L+ S  PFLWV+R  S  GE  EEKL C+EELE +G IV WC Q++VL HPS+GCF+TH
Sbjct  287   ALLHSGRPFLWVIRSASGNGEVEEEKLSCREELEEKGMIVAWCPQLDVLSHPSLGCFITH  346

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLE LASGVP+VA P W DQ  N KLI+DVWK GVRV+ANEEG+V+ +E KRC+E
Sbjct  347   CGWNSTLECLASGVPVVAFPQWTDQGTNGKLIEDVWKSGVRVTANEEGIVEGEEIKRCLE  406

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGGE+GEELR NA KWK+LA+ A+KD GSS  NLKA++DE+
Sbjct  407   VVMGGGERGEELRRNAGKWKDLAREAVKDGGSSDNNLKAFLDEL  450



>dbj|BAD90934.1| monoterpene glucosyltransferase [Eucalyptus perriniana]
Length=467

 Score =   462 bits (1188),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 319/476 (67%), Gaps = 17/476 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V FPAQG INP+LQ AKRL++ GA VT +T  SA  RM+     +GL FA F
Sbjct  1     MAPLNYLVVAFPAQGLINPALQIAKRLLHAGAHVTFATAGSAYRRMAKSDPPEGLSFASF  60

Query  1308  SDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG D GL+P  D   +   ++  GS+ +  L+     EGR F  + YT+I+ W   VA 
Sbjct  61    SDGSDEGLKPGIDFNQYMVDVERLGSETLRDLVVTSLNEGRKFACIFYTTIIPWVAQVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFL  961
              L +P TL+WTQPAT+LDIYY+YF  YGD+ RN   +    ++ +PG+P L   D PSF 
Sbjct  121   SLQIPSTLIWTQPATLLDIYYYYFNGYGDIIRNLGKDDPSALLHLPGLPPLTPPDIPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
             F+ +    + L      M+ Q E    E+ P+VLVNTFDALE   L+AI  V M GIGPL
Sbjct  180   FTPDNQYAFTL----PLMQMQFELFKEEKYPRVLVNTFDALEPGPLKAIGNVTMFGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DP D +FGGDL Q S  Y++WLD++PK SV+Y++FGS + +     EE+A+
Sbjct  236   IPSAFLDGQDPLDKSFGGDLFQGSKGYIQWLDTKPKGSVIYVSFGSISVLSKAQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETS--KGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+ +  PFLWV+R+    +GE  ++ L C EELE +G IV WC+QVEVL H S+GCF+T
Sbjct  296   GLLGTGHPFLWVIRKDKDEEGEGEQDHLSCMEELEQKGMIVPWCSQVEVLSHASVGCFVT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             H GWNST ESLA GVP+VA P WNDQ  NA L+++ WK+GVRV+ NE GVV+ DE KRC+
Sbjct  356   HSGWNSTFESLACGVPMVAFPQWNDQLTNAMLVENEWKVGVRVNVNEGGVVEGDEIKRCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSSP*ISIEIN  79
             E V+G GE+GEE+R NAKKWK LA+ A K+ GSS  NLKA+++E      I IE N
Sbjct  416   ELVVGDGEQGEEIRRNAKKWKHLAREAAKEGGSSDRNLKAFLEE------IQIEAN  465



>ref|XP_002516389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF46006.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   461 bits (1187),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 311/461 (67%), Gaps = 13/461 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGL-DFAPFSDG  1300
             H+L+V FP+QGHINP LQ AKRLV LG KVT +T  S   RMS   +  GL  FA FSDG
Sbjct  5     HILVVTFPSQGHINPGLQLAKRLVTLGLKVTFATTISTHRRMSRTDDSNGLLSFATFSDG  64

Query  1299  YDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             +D G  L   D     + +   G     K+I    ++G P T +IY+ ++SW   VAR  
Sbjct  65    HDDGYNLLGGDFAHCLSELTHYGQQTFPKIILRSAKDGHPVTCIIYSLLVSWVAKVARDF  124

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEY-GDLFRNCSGNQV-VEVPGVPALGVRDFPSFLFST  952
             H+P   LW QPATVLD+YYHYF  Y GD+ ++ +   + V +PG+P L   D PSF FS 
Sbjct  125   HLPSIFLWNQPATVLDVYYHYFHGYEGDIEKSINSPTISVNLPGLPPLRSSDLPSF-FSP  183

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             ++N      +A+ A+++    ++ E NP++LVNTFD LE +AL +IKK  ++G+GPLIPS
Sbjct  184   KSNTKLH-GFALPALKEHFHILDAETNPRILVNTFDELEHEALNSIKKYNLIGVGPLIPS  242

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
             A+LD +DPSDT+FG DL Q SN Y EWLDS+PKSSV+Y++FGS A +    +EE A+ L+
Sbjct  243   AFLDEKDPSDTSFGADLVQGSNSYTEWLDSKPKSSVIYISFGSIAMLSEKQMEETAKALI  302

Query  591   KSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWN  412
                 PFLWV+RE   G      ++ ++EL+ +G IV WC QVEVL HPS+GCF+THCGWN
Sbjct  303   DIDRPFLWVMRENDIG------VKHRKELQQKGIIVDWCCQVEVLSHPSVGCFVTHCGWN  356

Query  411   STLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMG  232
             ST+ES  SGVP+VA P W+DQ  NAKL+ DVW  G+R+  NE G+ + ++ K+ ++ VMG
Sbjct  357   STMESFVSGVPVVALPQWSDQGTNAKLVTDVWMTGIRMVPNERGIFEGEQLKKGVQLVMG  416

Query  231   GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
               EK +E+R NA+KWK+LA+ A+K+ G+S  NLK ++DE++
Sbjct  417   EREKAKEMRKNARKWKDLARDAVKEGGTSDKNLKTFLDEII  457



>ref|XP_003601706.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES71957.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score =   461 bits (1186),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 234/472 (50%), Positives = 324/472 (69%), Gaps = 22/472 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++ +P  GHINP+LQFAKRL++LGA+VT +T      R++++  I GL FA FSDG+
Sbjct  6     HFLIITYPLHGHINPALQFAKRLISLGAQVTFATTIYLHTRLTNKSTISGLSFATFSDGH  65

Query  1296  DAGLEPADLKDFWA---SMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D G +    +DF      +K R S+ +  +I + K+EGRPFT L Y  I+ W   VAR L
Sbjct  66    DDGPKFESNEDFVTYEYELKRRCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKVAREL  125

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP-ALGVRDFPSFLFS  955
             H+P  LLW Q ATV DIYY+YF E+GD   N S ++   + +PG+  +L  RD PSFL S
Sbjct  126   HLPSALLWIQAATVFDIYYYYFHEHGDYVTNKSKDETCSISLPGLSFSLESRDLPSFLLS  185

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK--KVRMVGIGPL  781
             +     Y +  A ++ ++QI+ +  E NPKVLVNT +  E +AL+A+   K++M+ IGPL
Sbjct  186   SNI---YTI--ATQSFKEQIQVLYEETNPKVLVNTVEEFELEALKAVDVGKIKMIPIGPL  240

Query  780   IPSAYLDGEDPSDTAFGGDLR--QNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IP  +L G+DP+DT+  G +   ++ ++Y EWLDS+ +SSVVY++FG+ A + N  +EEI
Sbjct  241   IPYTFLGGKDPNDTSSSGGVVGVESEDNYFEWLDSKDESSVVYVSFGTLAILSNRQMEEI  300

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEK-----LRCKEELE--AQGKIVRWCAQVEVLQHP  448
              + L+ S   FLWV+R+    ++ EE+     L C+EELE    GKIV+WC+QVEVL H 
Sbjct  301   GRALLDSGFYFLWVIRDEKVMQQKEEEGDSDELSCREELERNVNGKIVKWCSQVEVLSHR  360

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLESL SGVP+VA P W DQ  NAKLI+DVWK GVR+  +EEG+VKA
Sbjct  361   SLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDVWKTGVRMECDEEGMVKA  420

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E ++C E VMG GEKGEELR NA KWK+LA+ A+K+ GSS  NL  ++D++
Sbjct  421   EEIRKCFEVVMGKGEKGEELRRNAMKWKDLARAAVKEGGSSNKNLSNFLDDI  472



>ref|XP_010023606.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59917.1| hypothetical protein EUGRSUZ_H02641 [Eucalyptus grandis]
Length=463

 Score =   461 bits (1185),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 238/463 (51%), Positives = 328/463 (71%), Gaps = 9/463 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAP  1312
             M   H LLV FP QGHINPSLQFAKRLV +GA VT  T   A  R + S+   +GL FA 
Sbjct  1     MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFVTAIRAHLRTAESKSPPEGLSFAS  60

Query  1311  FSDGYDAGL-EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDGYD G+ E  DL+ +   +K RGS+ ++ LI +  E GR    + YT+++ W   VA
Sbjct  61    FSDGYDEGVKEGQDLEVYMDDLKRRGSETLSDLIASNLENGRRLLGVFYTTLLPWVADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFL  961
             R   +P TL+W QPATVLD YY+YF  YGDL R+   N    +++PG+P L   D PSF 
Sbjct  121   RSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIRSTGDNPSLPIQLPGLPPLMASDIPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                  N   + ++++   +   E +  E NP+VL NTFDALE DA+RAI K +++GIGPL
Sbjct  180   ----CNSKNEYNFSLPLFQRHFEILLEEANPRVLTNTFDALEPDAIRAIDKFKVIGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+YL+FGS + +     EE+A+
Sbjct  236   IPSAFLDGQDPSDTSFGGDLFKSSSGYIEWLDTKPKASVIYLSFGSISVLSKPQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
              LV++  PFLWV+R + K E+ E++L C+EEL+  G IV WC+QVEVL H S+GCF+THC
Sbjct  296   ALVEAGRPFLWVIRTSGKEERDEDRLSCEEELKNLGMIVPWCSQVEVLSHHSVGCFVTHC  355

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST ESL  GVP+VA P W+DQ  NAKL+ DVW+ GV+V+ NE+G+V++ E +RC+E 
Sbjct  356   GWNSTSESLVCGVPVVAFPQWSDQQTNAKLVTDVWRTGVKVTPNEQGLVESGEMRRCLEL  415

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VMG  ++G+E+R NA+K+++LA+ A K+ GSS  NL+A++DE+
Sbjct  416   VMGDEKEGDEMRRNAQKFRDLAREAAKEGGSSDKNLRAFVDEV  458



>ref|XP_003524180.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Glycine max]
Length=460

 Score =   460 bits (1184),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 318/459 (69%), Gaps = 14/459 (3%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             L+V++PAQGHINP+ QFAKRLV+LGA VT+ST      R++++P +  L F PFSDGYD 
Sbjct  7     LIVMYPAQGHINPAFQFAKRLVSLGAHVTVSTTVHMHRRITNKPTLPHLSFLPFSDGYDD  66

Query  1290  GLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVPVT  1111
             G    D     +  K RGS+ V  LI +K +EG PFT L++T ++ WA   ARG H+P  
Sbjct  67    GYTSTDYALQASEFKRRGSEFVTNLIASKAQEGHPFTCLVHTVLLPWAARAARGFHLPTA  126

Query  1110  LLWTQPATVLDIYYHYFTEYGDLFRNC---SGNQVVEVPGVPALGVRDFPSFLFSTETNV  940
             LLWTQPAT+LDI+Y YF E+GD  +       + +        L  RD PSFL  +   +
Sbjct  127   LLWTQPATILDIFYCYFHEHGDYIKGKIKDPSSSIELPGLPLLLAPRDLPSFLLGSNPTI  186

Query  939   NYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYLD  760
             +     A+    +Q+ D++ +  P++LVNTF+ALE +ALRA+    M+ IGPLIPSA+LD
Sbjct  187   D---SLAVSMFEEQLHDLDMQAKPRILVNTFEALEHEALRAVDNFNMIPIGPLIPSAFLD  243

Query  759   GEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSKM  580
             G+DP+DT+FGGD+ + SND  EWLDS+P+ SVVY++FGS+  +    +EE+A  L+    
Sbjct  244   GKDPTDTSFGGDIFRPSNDCGEWLDSKPEMSVVYVSFGSFCVLSKKQMEELALALLDCGS  303

Query  579   PFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLE  400
             PFLWV R     EK EE+L C+EELE +GKIV WC+QVEVL H S+GCF+THCGWNST+E
Sbjct  304   PFLWVSR-----EKEEEELSCREELEQKGKIVNWCSQVEVLSHRSVGCFVTHCGWNSTME  358

Query  399   SLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--SANEEGVVKADEYKRCIECVMGGG  226
             SLASGVP+ A P W +Q  NAKLI+DVWK GVRV    NEEG+V+ +E  +C+E  MG G
Sbjct  359   SLASGVPMFAFPQWIEQKTNAKLIEDVWKTGVRVDKQVNEEGIVEKEEIIKCLEVAMGSG  418

Query  225   EKGEELRNNAKKWKELAKGAMKD-DGSSYLNLKAYMDEM  112
             +KG+ELRNNAK WK LA+ A+K+  GSS  NL+A++D++
Sbjct  419   KKGQELRNNAKNWKGLAREAVKEGSGSSDKNLRAFLDDL  457



>ref|XP_010246964.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=476

 Score =   459 bits (1180),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 234/468 (50%), Positives = 313/468 (67%), Gaps = 16/468 (3%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             CH LLV FPAQGHINP+LQFAKRL   G +VT  T  SA   M++ P    L + PFSDG
Sbjct  5     CHFLLVTFPAQGHINPALQFAKRLTLTGVQVTFVTSVSAFRLMTNLPTQDALTYFPFSDG  64

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G + +D   +F + ++ RGS A+   + +  +E RP T LIYT ++ WA  VA  L 
Sbjct  65    YDDGCKSSDDFDNFMSELRCRGSQALTDYVESSAKERRPVTCLIYTILLPWAAEVASNLG  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTE  949
             VP  LLW QPA VLDIYY YF  YGDL  N   + +  +E+PG+P L  RD PSF   + 
Sbjct  125   VPSALLWIQPAAVLDIYYFYFNGYGDLMANFKNDPLYAIELPGLPLLTGRDVPSFFLPSS  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                +  L    E +    E    E  P+VLVNTFDALE +AL A+ K+ MVGIGPLIPSA
Sbjct  185   AFTSTVLSLFEELLHKLFER---EPKPRVLVNTFDALEREALGAVDKLNMVGIGPLIPSA  241

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LDG+DPSD +FGGDL   S DY++WL+++P+ SVVY++FG+ A++    ++EIA+GL+ 
Sbjct  242   FLDGKDPSDKSFGGDLFNCSADYIKWLNTKPEGSVVYVSFGTVANLQQQQMKEIARGLLD  301

Query  588   SKMPFLWVLR-----ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             S+ PFLWV+R       +K    E  +   EEL+ +G IV WC+QVEVL HPS+GCFLTH
Sbjct  302   SRRPFLWVIRTPLMSSEAKEIGTEAIMDNIEELKREGMIVSWCSQVEVLCHPSVGCFLTH  361

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEG----VVKADEYK  256
             CGWNSTLE + +GVP+V  P W+DQ  NAKLI+DVWK GVR+   E G    +V A+E K
Sbjct  362   CGWNSTLEGIVAGVPMVGFPQWSDQGTNAKLIEDVWKTGVRLRVKEGGEGGDLVDAEEIK  421

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             RC+ C++  GE G+E+R NAK W++L+  A+K+ GS+  NL+A+++E+
Sbjct  422   RCL-CMVMEGETGKEMRKNAKNWRDLSLEAVKEGGSTDKNLRAFLEEI  468



>ref|XP_010023605.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59916.1| hypothetical protein EUGRSUZ_H02640 [Eucalyptus grandis]
Length=463

 Score =   458 bits (1178),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 327/463 (71%), Gaps = 9/463 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAP  1312
             M   H LLV FP QGHINPSLQFAKRLV +GA VT +T   A  RM+ S+   +GL FA 
Sbjct  1     MAPPHFLLVTFPGQGHINPSLQFAKRLVRVGAHVTFATAIRAHLRMAESKSPPEGLSFAS  60

Query  1311  FSDGYDAGL-EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDGYD G+ E  D++ +   +K RGS+ ++ LI +  E G     + YT+++ W   VA
Sbjct  61    FSDGYDEGVKEGQDIEVYMDDLKRRGSETLSDLIASNLENGLRLLGVFYTTVLPWVADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFL  961
             R   +P TL+W QPATVLD YY+YF  YGDL R+   N    +++PG+P L   D PSF 
Sbjct  121   RSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIRSTGDNPSLPIQLPGLPPLMASDIPSF-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                  N   + ++ +   +   E +  E NP+VL NTFDALE DA++AI K +++GIGPL
Sbjct  180   ----CNSKDEYNFTLPLFQRHFEILLEEANPRVLANTFDALEPDAIQAIDKFKVIGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+YL+FGS + +     EE+A+
Sbjct  236   IPSAFLDGQDPSDTSFGGDLFKSSSGYIEWLDTKPKASVIYLSFGSISVLSKPQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
              LV++  PFLWV+R + K E+ E++L C+EEL+  G IV WC+QVEVL H S+GCF+THC
Sbjct  296   ALVEAGRPFLWVIRTSGKEERDEDRLSCEEELKNLGMIVPWCSQVEVLSHHSVGCFVTHC  355

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST ESL  GVP+VA P W DQ  NAKL+ DVW+ GV+V+ NE+G+V++DE + C+E 
Sbjct  356   GWNSTSESLVCGVPVVAFPQWGDQQTNAKLVTDVWRTGVKVTPNEQGLVESDEMRSCLEL  415

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VMG  ++G+E+R NA+K+++LA+ A K+ GSS  NL+A++DE+
Sbjct  416   VMGDEKEGDEMRRNAQKFRDLAREAAKEGGSSDKNLRAFVDEV  458



>gb|AFI71902.1| flavonol 5-O-glucosyltransferase [Paeonia lactiflora]
Length=465

 Score =   457 bits (1177),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 240/466 (52%), Positives = 324/466 (70%), Gaps = 22/466 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAPFSDG  1300
             H LL+ FPAQGHINP+LQFAKRL+ L A VT  T  SA  +++ + P +  L FA FSDG
Sbjct  5     HFLLITFPAQGHINPALQFAKRLIKLDAHVTFVTSISAHRQITKTTPSLGNLSFATFSDG  64

Query  1299  YDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +   D + + + ++ R S+A+ +LI     EGRP T LIY+ ++ WAG VAR LH
Sbjct  65    YDEGTKAGYDARHYMSELRRRSSEALPELIENCANEGRPVTCLIYSLLLPWAGKVARELH  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEY-----GDLFRNCSGNQVVEVPGVPALGVRDFPSFLF  958
             +P  LLW QPAT+LDIYY+YF  Y      ++ +  SG   +++PG+P L V D PS   
Sbjct  125   IPSALLWIQPATILDIYYYYFNGYGNVISDNIHKKDSG--CIKLPGLPLLTVHDLPSHFI  182

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             +T         +A+ + ++ +E +  E NPKVLVNTFDALE +ALRAI K+  + IGPLI
Sbjct  183   TTP--------FALPSFKEHLETLCEEANPKVLVNTFDALEHEALRAINKLSFIAIGPLI  234

Query  777   PSAYLDGEDPSDTAFGGDL--RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             PSA+ DGED +DT+FGGD   +  S +Y+EWLDS+ ++SV+Y++FGS + +P   +EE+ 
Sbjct  235   PSAFSDGEDLNDTSFGGDSVSQSCSKNYIEWLDSKHENSVIYISFGSVSVLPKRQMEEMV  294

Query  603   QGLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             +GLV + +PFLWV+R  E   G+K EE+ +  E+LE QG +V WC Q+EVL   S+GCFL
Sbjct  295   RGLVDTALPFLWVVRVEENRDGDK-EEEYKLSEDLEKQGMVVPWCNQLEVLSRKSVGCFL  353

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNS+LESL  G P+VA P W DQ  NAK I+DVWK GVR+  NE+GVV+  E KRC
Sbjct  354   THCGWNSSLESLVCGAPVVAFPQWADQATNAKPIEDVWKTGVRMVVNEDGVVEGCEIKRC  413

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E VMGGGE+GEE+R N +KWKELA+ A+KD  SS  NLKA+++E+
Sbjct  414   LEMVMGGGERGEEMRRNVEKWKELAREAVKDGESSDKNLKAFVNEV  459



>ref|XP_003629628.1| UDP-glucose flavonoid 7-O-glucosyltransferase [Medicago truncatula]
 gb|AET04104.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=465

 Score =   457 bits (1176),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 235/463 (51%), Positives = 316/463 (68%), Gaps = 17/463 (4%)
 Frame = -3

Query  1473  VLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYD  1294
             +LLV +P QGHINP+ +FAKRL+ LGA VT+ST     NR++++P +  L + PFSDGYD
Sbjct  5     ILLVPYPVQGHINPAFEFAKRLITLGAHVTISTTVHMHNRITNKPTLPNLSYYPFSDGYD  64

Query  1293  AGLEPAD---LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
              G +        ++ A  + RGS+ V+ +I    +EG PFT L+++ ++ WA   AR  H
Sbjct  65    DGFKGTGSDAYLEYHAEFQRRGSEFVSDIILKNSQEGTPFTCLVHSLLLQWAAEAAREFH  124

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPAL-GVRDFPSFLFSTET  946
             +P  LLW QPATV DI Y+YF  + D  +N S +  +E+PG+P L   RD PSFL ++  
Sbjct  125   LPTALLWVQPATVFDILYYYFHGFSDSIKNPSSS--IELPGLPLLFSSRDLPSFLLASCP  182

Query  945   NVNYDLDWAIEAMRDQIEDINGEEN--PKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             +  Y L        +Q  +++ E N    +LVN+F++LE  ALRA+KK  M+ IGPLIPS
Sbjct  183   DA-YSL--MTSFFEEQFNELDVETNLTKTILVNSFESLEPKALRAVKKFNMISIGPLIPS  239

Query  771   AYLDGEDPS-DTAFGGD--LRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
              +LD +D + D ++GG   + Q SND VEWLDS+PKSSVVY++FGSY  +     EEIA 
Sbjct  240   EHLDEKDSTEDNSYGGQTHIFQPSNDCVEWLDSKPKSSVVYVSFGSYFVLSERQREEIAH  299

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
              L+    PFLWVLRE       EE  + +EELE +GKIV+WC+Q+E+L HPS+GCFLTHC
Sbjct  300   ALLDCGFPFLWVLREKEGENN-EEGFKYREELEEKGKIVKWCSQMEILSHPSLGCFLTHC  358

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--SANEEGVVKADEYKRCI  247
             GWNSTLESL  GVP+VA P W DQ  NAKLI+DVWK+GVRV    NE+G+V+ DE +RC+
Sbjct  359   GWNSTLESLVKGVPMVAFPQWTDQMTNAKLIEDVWKIGVRVDEEVNEDGIVRGDEIRRCL  418

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             E VMG GEKGEELR + KKWKELA+ A+K+ GSS  NL++++D
Sbjct  419   EVVMGSGEKGEELRRSGKKWKELAREAVKEGGSSEKNLRSFLD  461



>ref|XP_010052789.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=472

 Score =   457 bits (1176),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 241/467 (52%), Positives = 331/467 (71%), Gaps = 8/467 (2%)
 Frame = -3

Query  1506  FHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQ  1330
             F     M   H LLV FP+QGHINPSLQFAKRLV +GA VT +T   A +RM+ S+    
Sbjct  5     FVQASSMAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSPPV  64

Query  1329  GLDFAPFSDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSW  1150
             GL FA FSDGYD G++  DL  +   +K +GS+ ++ LI +  E GR F  + YT+++ W
Sbjct  65    GLSFASFSDGYDDGIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPW  124

Query  1149  AGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV--EVPGVPALGVRD  976
                VAR   +P TL+W QPATVLD YY+YF  YGDL ++ S N  V  ++PG+P L   D
Sbjct  125   VADVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTSDNPSVPIQLPGLPPLMACD  184

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSF      N     ++++  ++   E +  E  P++L NTFDALE DA+RAI K  ++
Sbjct  185   IPSF-----CNSKNVYNFSLPFLQRHFEILLEEAKPRILTNTFDALEPDAIRAIDKFEVI  239

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTML  616
             GIGPLIPSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+YL+FGS + +     
Sbjct  240   GIGPLIPSAFLDGQDPSDTSFGGDLFKSSSGYMEWLDTKPKASVIYLSFGSISVLSKPQK  299

Query  615   EEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             EE+A+ LV+   PFLWV+RE+ K E+ E++L  +EEL+  G IV WC+QVEVL HPS+GC
Sbjct  300   EEMARALVEVGRPFLWVIRESGKEERDEDRLSFQEELDKLGMIVLWCSQVEVLSHPSVGC  359

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNST ESL  GVP+VA P W+DQ  NAKL+ DVW+ GV+++ NE G+V++ E K
Sbjct  360   FVTHCGWNSTSESLVCGVPMVAFPQWSDQLTNAKLVADVWRTGVKMTPNELGLVESGEMK  419

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             RC+E V+G GE+GEE+R NA+K+++LA+ A+K+ GSS  NL+A++DE
Sbjct  420   RCLELVVGDGEEGEEMRRNARKFRDLAREAVKEGGSSDKNLRAFVDE  466



>ref|XP_003524181.2| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Glycine max]
Length=488

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 319/459 (69%), Gaps = 14/459 (3%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGYDA  1291
             LLVI+P QG INP+LQFAKRL  +GA+VT+        RM++   + GL  APFSDGYD 
Sbjct  33    LLVIYPGQGQINPALQFAKRLTAMGARVTIPITLDMHRRMTNTTAVPGLSLAPFSDGYDD  92

Query  1290  GLEP-----ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             G        +D   + + +K R S  V+ LI +   EG PFT L+YT ++ WA  VARGL
Sbjct  93    GFHAIRGTDSDYNLYASELKRRASVFVSNLILSSANEGHPFTCLLYTLLVPWAPQVARGL  152

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVP-ALGVRDFPSFLFSTE  949
             ++P  +LW QPATVLDI YHYF  Y D   + +   +V +PG+  +L  RD PSFL +++
Sbjct  153   NLPTAMLWIQPATVLDILYHYFHGYADYINDETKENIV-LPGLSFSLSPRDIPSFLLTSK  211

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
              ++   L +      +QI+ ++ E NPKVLVNTF+ALE +ALRA+ K+ M+ IGPLIP+A
Sbjct  212   PSL---LSFVFPLFEEQIKQLDLEANPKVLVNTFEALEEEALRAVDKLNMIPIGPLIPTA  268

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +L G+DP DT+FGGDL Q SN YVEWLDS+   SVVY++FGSY ++     EEIA+ L+ 
Sbjct  269   FLGGKDPEDTSFGGDLLQVSNGYVEWLDSKEDKSVVYVSFGSYFELSKRQTEEIARALLG  328

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
                PFLWV+R   + ++ EE+L  +EELE +GK+V+WC+QVEVL H S+GCF+THCGWNS
Sbjct  329   CSFPFLWVIRVKEEEKEEEEELCFREELEGKGKLVKWCSQVEVLSHGSVGCFVTHCGWNS  388

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             T+ESL SGVP+VA P W+DQ  NAKLI+DVWK+GVRV  + +G+V+ +E ++C+E VMG 
Sbjct  389   TMESLVSGVPMVAFPQWSDQKTNAKLIEDVWKIGVRVENDGDGIVEKEEIRKCVEEVMGS  448

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             G    ELR NA+KWK LA+ A K+ G S  NLKA++D M
Sbjct  449   G----ELRRNAEKWKGLAREAAKEGGPSERNLKAFLDAM  483



>ref|XP_003601707.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES71958.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=479

 Score =   453 bits (1165),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 235/473 (50%), Positives = 319/473 (67%), Gaps = 23/473 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L++ +P  GHINP+LQFAKRL++ GA+VT +T       + ++P I GL FA FSDGY
Sbjct  6     HFLIITYPLHGHINPALQFAKRLISFGAQVTFATTIYLHTGLINKPTIPGLSFATFSDGY  65

Query  1296  DAGLEPADLKDFWA---SMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D G      +DF A    +K   S+ +  +I + K+EGRPFT L Y  I+ W   VAR L
Sbjct  66    DDGKNFESNEDFIAYRSELKCHCSEFLTNIILSGKQEGRPFTCLAYGIIIPWVAKVAREL  125

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP-ALGVRDFPSFLFS  955
             H+P  LLW Q ATV DIYY+YF E+GD   N S ++   + +PG+  +L  RD PSFL S
Sbjct  126   HLPSALLWIQAATVFDIYYYYFHEHGDYITNKSKDETCSISLPGLSFSLESRDLPSFLLS  185

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK--KVRMVGIGPL  781
             +     Y +  A  + ++QI+ ++ E NP VLVNT +  E +AL+A+   K++M+ IGPL
Sbjct  186   SNI---YTI--ATRSFKEQIQVLDEETNPTVLVNTVEEFELEALKAVDVGKIKMIPIGPL  240

Query  780   IPSAYLDGEDPSDTAFGGDLR--QNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IP A+L G+DP+DT+ GG +   ++ ++Y EWLDS+ +SSVVY++FG+ A +    +EEI
Sbjct  241   IPYAFLGGKDPNDTSSGGGVVDVESEDNYFEWLDSKDESSVVYVSFGTLAILSKRQMEEI  300

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEK-----LRCKEELE--AQGKIVRWCAQVEVLQHP  448
              + L+ S   FLWV+R+    ++ EE+     L C+EELE    GKIV+WC+QVEVL H 
Sbjct  301   GRALLDSGFYFLWVIRDEKVMQQKEEEGDSDELSCREELERNVNGKIVKWCSQVEVLSHR  360

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE-GVVK  271
             S+GCF+THCGWNSTLESL SGVP+VA P W DQ  NAKLI+D+WK G+RV  +EE G+VK
Sbjct  361   SLGCFMTHCGWNSTLESLGSGVPMVAFPQWTDQTTNAKLIEDLWKTGLRVERDEEAGIVK  420

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             A E  +C+E VMG GEKGEELR NAKKWK LA  AMK+ GSS  NL  ++D++
Sbjct  421   AGEIMKCLEVVMGKGEKGEELRRNAKKWKSLASEAMKEGGSSNKNLSKFLDDI  473



>gb|EYU32718.1| hypothetical protein MIMGU_mgv1a005538mg [Erythranthe guttata]
Length=480

 Score =   452 bits (1162),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 237/477 (50%), Positives = 320/477 (67%), Gaps = 26/477 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             HVLLV FPAQGHINPSLQFAKRL  LG  VT  T  SA+ RM++      ++FA FSDG+
Sbjct  8     HVLLVTFPAQGHINPSLQFAKRLAKLGVAVTFLTSSSAVRRMTT--TAAAINFASFSDGF  65

Query  1296  DAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVP  1117
             D G    + ++F A+++T GS AV   + A   E RPF+R+IYT ++ WAG VA  L VP
Sbjct  66    DGGWSNDETQNFMAALRTHGSKAVEDAVAAAAAENRPFSRVIYTLLVPWAGQVAHRLRVP  125

Query  1116  VTLLWTQPATVLDIYYHYFTEYGDLF--------RNCSGNQVVEVPGVPALGVRDFPSFL  961
             VTLLW QPA +  +Y++YF +Y D           N + N+++E+PG+P     D PSF+
Sbjct  126   VTLLWIQPAILFGVYFYYFNKYFDAAAMNEEDDGNNNNNNKIIELPGLPPFAPSDLPSFM  185

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
              ++  ++    D+A+    +  E ++ E +P VL+NTF +LE +AL AI K ++  IGPL
Sbjct  186   SASNPSM---YDFALPTFTENFEILDREISPTVLINTFQSLESEALTAITKYKLTAIGPL  242

Query  780   IPSAYLDGEDPSDTAFGGDL--RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             IPSA+LDG+DP+DT+FGGDL  +  S DY+++LDS+PKSSVVY+AFGSY+++    + EI
Sbjct  243   IPSAFLDGKDPTDTSFGGDLIKKPPSQDYLQYLDSKPKSSVVYVAFGSYSELSKPQMAEI  302

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEE----------KLRCKEELEAQGKIVRWCAQVEVL  457
             A+GL+KS  PFLWV+R     EK +            L  +EELE QGKIV WC QVEVL
Sbjct  303   AKGLIKSGKPFLWVIRGAESVEKLDGIFSGIFPGGGSLMYREELERQGKIVGWCTQVEVL  362

Query  456   QHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK-LGVRVSANEEG  280
              HPS+GCF THCGWNSTLESL  GVP+V  P W DQ  NAKL++D W+           G
Sbjct  363   SHPSVGCFFTHCGWNSTLESLVCGVPVVGFPQWTDQTTNAKLVEDFWRSGVRVGGGGGGG  422

Query  279   VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             VV+ DE +RC+  VMGGG++  E+R  A+KW+ LAK AM++DGSS +NLK+++DE+L
Sbjct  423   VVEGDEIERCLGVVMGGGDRAAEMRREAEKWRGLAKEAMEEDGSSNVNLKSFVDELL  479



>ref|XP_010246963.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nelumbo 
nucifera]
Length=459

 Score =   449 bits (1156),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 240/466 (52%), Positives = 311/466 (67%), Gaps = 27/466 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNR-MSSRPEIQGLDFAPFSDG  1300
             H LLV  P QGHINP+LQFAKRL+  GA+VT +  FSA  R M S   I GL FAPFSDG
Sbjct  7     HFLLVTLPMQGHINPTLQFAKRLLRTGAQVTFAISFSAYRRLMKSSTPIHGLTFAPFSDG  66

Query  1299  YDAGL-----EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             +D G      EP++ K        R S A+A LI A  +E RP T LIYT ++SWA  VA
Sbjct  67    FDDGYRVFFDEPSEFK-------LRASQALADLILAASKEHRPVTCLIYTLLLSWAADVA  119

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDFPSFL  961
               L V   LLW Q A V DIYYHYF  + +L  N   + +  +E+PG+P L  +D PSFL
Sbjct  120   NNLGVASALLWIQSAAVFDIYYHYFNGFRELIANSEDDPLSSIELPGLPRLTSQDVPSFL  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +    N+ L  A+   ++Q +    E   +VL+NTFDA+E +AL AI K+ M+GIGPL
Sbjct  180   LPS----NF-LPLAVPGFQEQFQSFERETKIQVLINTFDAMEPEALGAIDKINMIGIGPL  234

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LD EDPSD +FGGDL   S DY+EWL+S+P SSVVY++FGS A +     EEIA 
Sbjct  235   IPSAFLDDEDPSDKSFGGDLFHGSGDYIEWLNSKPDSSVVYVSFGSLAVLQT---EEIAN  291

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCK-EELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             GL++S  PFLWV+R  ++ E  EE +  + EEL+ +G IV WC QVEVL H S+GCF+TH
Sbjct  292   GLLESGRPFLWVIR-LNRNETGEETMLGRWEELKERGLIVPWCTQVEVLSHSSVGCFVTH  350

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSA-NEEGVVKADEYKRCI  247
             CGWNSTLESL +GVP+V  P  +DQ  N++LI+DVW+ GVR     EEG+V++ E KRC+
Sbjct  351   CGWNSTLESLVAGVPVVTLPQISDQTTNSRLIEDVWRTGVRTKVKTEEGIVESGEIKRCL  410

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             + VM G E G E+  N KKWKE++K A+KD GSS  NLK +++E++
Sbjct  411   DLVM-GSESGNEMTRNVKKWKEMSKEAVKDGGSSDKNLKRFLEEIV  455



>ref|XP_010023610.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 ref|XP_010023611.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW59920.1| hypothetical protein EUGRSUZ_H02644 [Eucalyptus grandis]
Length=462

 Score =   447 bits (1150),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 235/462 (51%), Positives = 326/462 (71%), Gaps = 8/462 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAP  1312
             M   H LLV FP QGHINPSLQFAKRL+ +GA VT +T   A++RM+ S+   +GL FA 
Sbjct  1     MAPPHFLLVTFPGQGHINPSLQFAKRLMRVGAHVTFATAIHALHRMAESKSPPEGLSFAS  60

Query  1311  FSDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             FSDGYD G +  DL  +    K RGS+ ++ LI +  E GR F  + YT+++ W   VA 
Sbjct  61    FSDGYDDGFDWDDLDKYADEFKRRGSETLSDLIASNLENGRRFLGVFYTTLLPWVADVAC  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV--EVPGVPALGVRDFPSFLF  958
                +P TL+W QPATVLD YY+YF  YGDL ++   N  V  ++PG+P L   D PSF  
Sbjct  121   SHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTGDNPSVPIQLPGLPPLMACDIPSF--  178

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
                 N     ++++  ++   E +  E  P++L NTFDALE DA+RA+ K  ++GIGPLI
Sbjct  179   ---CNTKNVYNFSLPLLQRHFEILLEEAKPRILTNTFDALEPDAIRAMDKFEVIGIGPLI  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+YL+FGS + +     EE+A+ 
Sbjct  236   PSAFLDGQDPSDTSFGGDLFKSSSGYMEWLDTKPKASVIYLSFGSISVLSKPQKEEMARA  295

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             LV+   PFLW++RE+ K E+ E++L  +EEL+  G IV WC+QV VL HPS+GCFLTHCG
Sbjct  296   LVEVGRPFLWIIRESGKEERDEDRLSFQEELDKLGMIVPWCSQVAVLSHPSVGCFLTHCG  355

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNST ESL  GVP+VA P W+DQ  NAKL+ DVW+ GV+++ NE G+V++ E KRC++ V
Sbjct  356   WNSTSESLVCGVPVVAFPQWSDQQTNAKLLADVWRTGVKLTPNELGLVESSEVKRCLDLV  415

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +G GE+G E+R NAKK+++LA+ A+K+ GSS  NL+A++DE+
Sbjct  416   VGDGEEGNEMRRNAKKFRDLAREAVKEGGSSDKNLRAFVDEV  457



>ref|XP_003629627.1| Indole-3-acetate beta-glucosyltransferase [Medicago truncatula]
 gb|AET04103.1| flavonoid glucosyltransferase [Medicago truncatula]
Length=472

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 239/483 (49%), Positives = 310/483 (64%), Gaps = 41/483 (8%)
 Frame = -3

Query  1503  HHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM----SSRPE  1336
             HHH R     +LLV +PAQGHINP+LQFAKRL+++GA VTL        R+     S   
Sbjct  3     HHHHR-----ILLVTYPAQGHINPALQFAKRLISMGAHVTLPITLHLYRRLILLNPSITT  57

Query  1335  IQGLDFAPFSDGYDAGL-----EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLI  1171
             I  L   PFSDGY+ G        AD   + +   TRGSD +  LI + K+E +PFT L+
Sbjct  58    ISNLSITPFSDGYNDGFIAITNTDADFHQYTSQFNTRGSDFITNLILSAKQESKPFTCLL  117

Query  1170  YTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGD---LFRNCSGNQVVEVPG  1000
             YT I+ WA  VARG ++    LW +PATV DI Y+YF  Y +             +E+PG
Sbjct  118   YTIIIPWAPRVARGFNLRSAKLWIEPATVFDILYYYFHGYSNHINNQNQNQNQTTIELPG  177

Query  999   VP-ALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDAL  823
             +P  L  RD PSFLF++  +V   L +     +    +++ E NP +LVNTF+ALE +AL
Sbjct  178   LPFTLSPRDIPSFLFTSNPSV---LSFVFPYFQQDFHELDVETNPIILVNTFEALEPEAL  234

Query  822   RAI---KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLA  652
             RA+     ++M+ IGPLIPS         DT+F GDL Q SNDY+EWL+S+ KSSVVY++
Sbjct  235   RAVDTHHNLKMIPIGPLIPS---------DTSFSGDLLQPSNDYIEWLNSKSKSSVVYVS  285

Query  651   FGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCA  472
             FGSY  +     EEIA  L+     FLWV+RE       EE+L+ K+ELE +GKIV+WC+
Sbjct  286   FGSYFVLSERQTEEIASALLNCGFSFLWVMREK------EEELKFKDELEKKGKIVKWCS  339

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--  298
             QVEVL H S+GCFLTHCGWNSTLESL SGVPLVA P W DQ  NAKLI+DVWK+GVRV  
Sbjct  340   QVEVLSHSSLGCFLTHCGWNSTLESLVSGVPLVAFPQWTDQKTNAKLIEDVWKIGVRVDD  399

Query  297   SANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
               +E+G+V  +E K+C+E VMG GEKGEELR NA KWK LA+ A K+ G +  NL+ ++D
Sbjct  400   KVDEDGIVGGNEIKKCLEEVMGRGEKGEELRKNAMKWKGLAREAGKEGGPAEKNLRKFLD  459

Query  117   EML  109
             ++L
Sbjct  460   DIL  462



>ref|XP_004298222.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   446 bits (1147),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 238/473 (50%), Positives = 314/473 (66%), Gaps = 27/473 (6%)
 Frame = -3

Query  1476  HVLLVI-FPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQ-GLDFAPFS  1306
             H  +VI +PAQGHINPSLQ AKRL+   GA VT      A  RM++   I   L FAPFS
Sbjct  4     HRFIVIAYPAQGHINPSLQLAKRLIRTTGAHVTFVNTVYAHRRMANSLTIPCRLTFAPFS  63

Query  1305  DGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             DGYD G +P D  +   S +++R S A+  L+     EG P+T ++YT ++SW G VA  
Sbjct  64    DGYDDGTKPEDDSEHVLSELRSRSSKAIVDLVKTGANEGHPYTCIVYTLLLSWVGGVATE  123

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-------VVEVPGVPALGVRDFP  970
             LH+P  L W QPATV DIYY+YF  Y DL RN +G++       +        L  RD P
Sbjct  124   LHLPSALAWIQPATVFDIYYYYFNGYKDLIRNNTGDENNDPSFALELPGLPLLLKKRDLP  183

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SF+ ++    +     A+    DQ E +     P +LVNTF+ALE +ALRAI K  ++GI
Sbjct  184   SFILASNPYSS-----ALPLFEDQFEKLGKLSKPIILVNTFNALEPEALRAIDKYNLIGI  238

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTML  616
             GPL+PSA+LDG+DPSD +FGGDL Q S +  Y+EWL+S+P  SV+Y++FGS++ +  T +
Sbjct  239   GPLMPSAFLDGKDPSDKSFGGDLIQKSKNSAYLEWLNSKPVESVIYVSFGSFSVLSKTQM  298

Query  615   EEIAQGLVKSKMPFLWVLRETSKGEKPEEK-----LRCKEELEAQGKIVRWCAQVEVLQH  451
             EE+A+GL+    PFLWV+RE  K    +E+     L C+ ELE  GKIV WC+QVEVL +
Sbjct  299   EELAKGLLDYGRPFLWVIRENQKNGGGKEEKEEQELSCRAELEELGKIVPWCSQVEVLSN  358

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF+THCGWNS++ESL SGVP+VA P W DQ  NAKLI++ WK G+RV+ NEEGVV 
Sbjct  359   PSLGCFVTHCGWNSSMESLVSGVPVVAFPQWTDQCTNAKLIEETWKTGIRVAPNEEGVVV  418

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +E  RC+E VMG    GEELR NAKKWKELA+ A+ + GSS  NLKA+++E+
Sbjct  419   DEELTRCLELVMG----GEELRRNAKKWKELAREAVSEGGSSDKNLKAFLEEI  467



>sp|Q9ZR27.1|5GT1_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R4; Short=p3R4; Flags: Precursor [Perilla frutescens]
 dbj|BAA36421.1| UDP-glucose:anthocysnin 5-O-glucosyltransferase [Perilla frutescens 
var. crispa]
Length=460

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 308/465 (66%), Gaps = 22/465 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ-----GLDFAP  1312
              VLL  FPAQGHINP+LQFAKRL+  G  VT  T   A  RM++          GLDF  
Sbjct  5     RVLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGLDFVA  64

Query  1311  FSDGYDAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDGYD GL+P  D K + + MK RGS+A+  L+    +     T ++Y+ + +WA  VA
Sbjct  65    FSDGYDDGLKPCGDGKRYMSEMKARGSEALRNLLLNNHD----VTFVVYSHLFAWAAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFS  955
             R   VP  LLW +PATVL IYY YF  Y D     +G+  +++P +P L  R  P+FL  
Sbjct  121   RESQVPSALLWVEPATVLCIYYFYFNGYADEID--AGSDEIQLPRLPPLEQRSLPTFLLP  178

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
              ET   + L      M++++E ++GEE  KVLVNTFDALE DAL AI +  ++GIGPLIP
Sbjct  179   -ETPERFRL-----MMKEKLETLDGEEKAKVLVNTFDALEPDALTAIDRYELIGIGPLIP  232

Query  774   SAYLDGEDPSDTAFGGDLRQNS--NDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             SA+LDG DPS+T++GGDL + S  N+ VEWLD++PKSSVVY++FGS    P   +EEI +
Sbjct  233   SAFLDGGDPSETSYGGDLFEKSEENNCVEWLDTKPKSSVVYVSFGSVLRFPKAQMEEIGK  292

Query  600   GLVKSKMPFLWVLRETSK--GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+    PFLW++RE     GE+ EE+L C  EL+  GKIV WC+Q+EVL HP++GCF+T
Sbjct  293   GLLACGRPFLWMIREQKNDDGEEEEEELSCIGELKKMGKIVSWCSQLEVLAHPALGCFVT  352

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNS +ESL+ GVP+VA P W DQ  NAKLI+D W  GVRV  NE G V   E +RC+
Sbjct  353   HCGWNSAVESLSCGVPVVAVPQWFDQTTNAKLIEDAWGTGVRVRMNEGGGVDGSEIERCV  412

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E VM GGEK + +R NA KWK LA+ AM +DGSS  NL A++ ++
Sbjct  413   EMVMDGGEKSKLVRENAIKWKTLAREAMGEDGSSLKNLNAFLHQV  457



>ref|XP_010039943.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45602.1| hypothetical protein EUGRSUZ_L00634 [Eucalyptus grandis]
Length=467

 Score =   443 bits (1140),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 313/465 (67%), Gaps = 11/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V FPAQG INP+LQFAKRL+  GA VT +T  SA  RM+     +GL FA F
Sbjct  1     MAPLNYLVVAFPAQGLINPALQFAKRLLRTGAHVTFATAGSAYRRMAKSDPPEGLSFASF  60

Query  1308  SDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG + GL P  D + + A +   GS+ +  L+     EG  F  + YT+I+ W   VA 
Sbjct  61    SDGSEEGLRPGIDPEHYMADVVRLGSETLRDLVVTSLNEGCKFACIFYTTIIPWVAQVAH  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPSFL  961
              L +P TL+W QPAT+LDI Y+YF  YGD+ RN   +    ++ +PG+P L  RDFPS+ 
Sbjct  121   SLQIPSTLIWVQPATLLDINYYYFDGYGDIIRNLGKDDPSALLHLPGLPPLTPRDFPSY-  179

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
             F+ E    ++L      M+ Q E    E+NP+VLVNTFDALE   L+ I  V M GIGPL
Sbjct  180   FTPENQFAFNL----PIMQVQFEVFKEEKNPRVLVNTFDALEPRQLKVIGNVTMFGIGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+LDG+DP D + G DL ++S DY++WLD+QP+ SV+Y++FGS + + N   EE+A+
Sbjct  236   IPSAFLDGQDPLDKSIGADLFRSSKDYIQWLDTQPEGSVIYVSFGSLSVLSNAQKEEMAR  295

Query  600   GLVKSKMPFLWVLRETSKGEKPEE--KLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL+ +  PFLWV+R+  + E  E+  +L C EELE +G IV WC+QVEVL H S+GCF+T
Sbjct  296   GLLGTDRPFLWVIRKDKEEEVEEDEDQLSCLEELEQKGMIVPWCSQVEVLSHASVGCFVT  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             H GWNST ESL  GVP+VA P W DQ  NA L+++ WK+GVRV+ NE G+V+ DE KRC+
Sbjct  356   HSGWNSTFESLTCGVPMVAFPQWGDQQTNAMLVENEWKVGVRVNTNERGIVEGDEIKRCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E V+G GE+GEE+R NAKKWK LA+ A K  GSS  NL A+++E+
Sbjct  416   ELVVGDGEEGEEIRRNAKKWKGLAREAAKKGGSSDRNLNAFLEEI  460



>ref|XP_004297014.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   438 bits (1127),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/471 (48%), Positives = 315/471 (67%), Gaps = 25/471 (5%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEI-QGLDFAPFSDGY  1297
             +++ FPAQGHINP+LQ AK L+   GA VT  T  SA+ RM++      GL F+PFSDGY
Sbjct  7     IMIAFPAQGHINPALQLAKCLIRTTGAHVTFVTAVSALRRMANGSTTPSGLTFSPFSDGY  66

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G++P D K      +K   S A+  L+ +   EGRP+T ++YT ++SW   VA  LH+
Sbjct  67    DDGVKPEDDKQHVLNELKHGSSQAIVGLVHSGANEGRPYTCIVYTLLLSWVAEVATELHL  126

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ------VVEVPGVPAL-GVRDFPSFL  961
             P  L W QPATV DIYY+YF  Y DL +N +G         +E+PG+P L   RD PSF+
Sbjct  127   PTALAWIQPATVFDIYYYYFNGYKDLIKNNTGADNNDPSFALELPGLPLLFKSRDLPSFI  186

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
              ++   ++      I+   DQ ED+     P +LVNTFDALE  AL+AI K  ++G+GPL
Sbjct  187   LASSPIIHR---LVIQMFEDQFEDLGKLSKPIILVNTFDALEPGALKAIDKYNLIGVGPL  243

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             +PSA+LD ++ SD +FG D+ Q + +  Y+EWL+S+P+ SVVY++FGS + +    +EE+
Sbjct  244   MPSAFLDDKNSSDKSFGCDIFQKAKESSYMEWLNSKPEQSVVYVSFGSISVLSKNQMEEL  303

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEK------LRCKEELEAQGKIVRWCAQVEVLQHPS  445
             A+GL+    PFLWV+RE  K  + +E+      L C+ ELE  G IV WC+QVEVL +PS
Sbjct  304   AKGLLDCGRPFLWVIRENQKKGEGKEEKEEEEELSCRAELEELGMIVPWCSQVEVLSNPS  363

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             +GCF+THCGWNSTLESL  GVP+VA P W+DQ  NAKLI+D WK GVRV  NEEGVV  +
Sbjct  364   LGCFVTHCGWNSTLESLVCGVPVVAFPQWSDQGTNAKLIEDSWKTGVRVERNEEGVVVGE  423

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E KRC++ VM    + +++R NAKKWK+LA+ A+ + GSS+ NLKA+++E+
Sbjct  424   EIKRCLDLVM----ESDKMRRNAKKWKDLAREAVSEGGSSHKNLKAFLEEI  470



>gb|EYU31588.1| hypothetical protein MIMGU_mgv1a005398mg [Erythranthe guttata]
Length=485

 Score =   437 bits (1124),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 248/489 (51%), Positives = 330/489 (67%), Gaps = 29/489 (6%)
 Frame = -3

Query  1527  HLTPHIIFHHHPRMEGC-HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM  1351
             H   H+  H H  ME   HVLLV FPAQGHINPSLQFAKRL  +G KVT +T   A  RM
Sbjct  7     HTHSHVNSHTHTIMEQQRHVLLVTFPAQGHINPSLQFAKRLTAIGIKVTFATSLYARRRM  66

Query  1350  SSRPE--IQGLDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPF  1183
             +       +G+ FA FSDGYD G  P   D   +   +++RGS ++   I A  E+GRP 
Sbjct  67    ARTAAGLPKGVTFAAFSDGYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGRPV  126

Query  1182  TRLIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VE  1009
             T+L+Y+ ++ WA  VAR  HVP  LLW QPATVL+IYY+YF  YGD     S +    ++
Sbjct  127   TQLVYSLLLPWAPEVAREFHVPSALLWIQPATVLNIYYYYFNGYGDEIATNSDDPTWQIQ  186

Query  1008  VPGVPALGV--RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEE-NPKVLVNTFDAL  838
              PG+PAL    RD PSF+  + ++      + + + ++Q+E ++ E+  PKVLVNTFDAL
Sbjct  187   FPGIPALNFSKRDLPSFILPSSSD-----KYTLPSFKEQLETLDAEKLKPKVLVNTFDAL  241

Query  837   EFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND-YVE-WLDSQPKSSV  664
             E  AL++I    ++G+GPLIPSA      PSD +F GDL + S+D  VE WL+S+P+SSV
Sbjct  242   EPHALKSIDNYELIGVGPLIPSA------PSDKSFRGDLFEKSDDNSVELWLNSKPESSV  295

Query  663   VYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLR----ETSKGEKPEEKLRCKEELEAQ  496
             VY++FGS   +P   +E IA+GL++S  PFLWV+R    + ++ E+ EEKL C +ELE  
Sbjct  296   VYVSFGSILKLPKAQMEGIAKGLLESDRPFLWVIRINEDKKNEEEEEEEKLSCLDELEKI  355

Query  495   GKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVW  316
             GKIV WC+Q+EVL HPSIGCF++HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVW
Sbjct  356   GKIVPWCSQLEVLTHPSIGCFVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVW  415

Query  315   K--LGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSY  142
             K  + VR     +GVV++ E KRCIE VM GGE+  ELR NA++WK  A+ AM ++GSS+
Sbjct  416   KSGVRVRGVGGGDGVVESGEIKRCIEEVMDGGERSRELRANAREWKSFAREAMDENGSSF  475

Query  141   LNLKAYMDE  115
              NLKA+++E
Sbjct  476   NNLKAFLEE  484



>ref|XP_010099953.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB80936.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=493

 Score =   436 bits (1121),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/484 (48%), Positives = 318/484 (66%), Gaps = 39/484 (8%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS----------SRPEIQGLD  1321
             LLV +PAQGHINP LQFAKRLV  GA VT  T + A   M+          +R  +  + 
Sbjct  8     LLVTYPAQGHINPCLQFAKRLVGAGADVTFVTTYFAHRHMTKSRGDTTAAANRNGVVSIS  67

Query  1320  FAPFSDGYDAGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
             + PFSDG+D G +P D  D + + ++ RGS A++ L+ +  +EG P+T L+Y+ ++ WA 
Sbjct  68    YVPFSDGHDDGFKPGDSVDHYLNEIRRRGSQAISDLVISAAKEGHPYTCLVYSLLLPWAA  127

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-------NQVVEVPGVP-AL  988
             + A  L +P  LLW QPATV DIYY+YF  Y D+    S        N    +PG+   L
Sbjct  128   LTAEELCLPSVLLWIQPATVFDIYYYYFHGYEDIIIENSTKDPSTDHNSSTTLPGLSLTL  187

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK  808
               RD PSF+ +  T       +AI   ++Q+E ++  +NPK+LVNTFD LE +AL+AI+K
Sbjct  188   TRRDLPSFMDAANT-----YSFAIPLFKEQLEVLDKIKNPKILVNTFDQLELEALKAIEK  242

Query  807   VRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSN-DYVEWLDSQPKSSVVYLAFGSYADV  631
             + ++ IGPLIPSA+LD +DPSDT+FGGDL    N +Y+EWL+S+PK S++Y++FGS  ++
Sbjct  243   LNLIAIGPLIPSAFLDEKDPSDTSFGGDLFHVDNQNYIEWLNSKPKGSIIYVSFGSMVEL  302

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEK----------LRCKEELEAQGKIVR  481
                 +EEIA+GL+    PFLWV+RE +K ++ E+K          L C EEL   G IV 
Sbjct  303   SRPQMEEIAKGLLDCGRPFLWVIREKAKKKESEKKNEEREEEEEKLSCHEELSKLGMIVP  362

Query  480   WCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVR  301
             WC QVEVL   S+GCF+THCGWNSTLESL  GVP+VA P W DQ  NAKLI+D+WK GVR
Sbjct  363   WCRQVEVLSSASLGCFVTHCGWNSTLESLVCGVPVVAFPQWTDQGTNAKLIEDMWKTGVR  422

Query  300   VSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             V  NE+G+V++ + KRC++ VM    +GEELR NA +W++LA+ A K+ GSS  NLKA++
Sbjct  423   VKPNEKGIVESQDIKRCLDLVM----EGEELRRNAVRWRDLAREAAKEGGSSDKNLKAFV  478

Query  120   DEML  109
              EM+
Sbjct  479   AEMI  482



>gb|KHN12357.1| UDP-glycosyltransferase 75D1 [Glycine soja]
Length=424

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/422 (50%), Positives = 293/422 (69%), Gaps = 10/422 (2%)
 Frame = -3

Query  1356  RMSSRPEIQGLDFAPFSDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTR  1177
             R++++P +  L F PFSDGYD G   +D     +  K RGS+ V  LI +  +EG PFT 
Sbjct  4     RITNKPTLPHLSFLPFSDGYDDGFTSSDFSLHASVFKRRGSEFVTNLILSNAQEGHPFTC  63

Query  1176  LIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEV  1006
             L+YT+++SW   VAR  H+P  +LWTQPAT+LDI+Y+YF E+G+  ++   +    +   
Sbjct  64    LVYTTLLSWVAEVAREFHLPTAMLWTQPATILDIFYYYFHEHGEYIKDKIKDPSCFIELP  123

Query  1005  PGVPALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDA  826
                  L  RD PSFL  +   ++    + +        D++ E  P++LVNTF+ALE +A
Sbjct  124   GLPLLLAPRDLPSFLLGSNPTID---SFIVPMFEKMFYDLDVETKPRILVNTFEALEAEA  180

Query  825   LRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFG  646
             LRA+ K  M+ IGPLIPSA+LDG+D +DT+FGGD+ + SN   EWLDS+P+ SVVY++FG
Sbjct  181   LRAVDKFNMIPIGPLIPSAFLDGKDTNDTSFGGDIFRLSNGCSEWLDSKPEMSVVYVSFG  240

Query  645   SYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPE--EKLRCKEELEAQGKIVRWCA  472
             S   +P T +EE+A+ L+    PFLWV++E     + E  E+L C EELE +GKIV WC+
Sbjct  241   SLCVLPKTQMEELARALLDCGSPFLWVIKEKENKSQVEGKEELSCIEELEQKGKIVNWCS  300

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--  298
             QVEVL H S+GCF+THCGWNST+ESLASGVP+VA P W +Q  NAKLI+DVWK GVRV  
Sbjct  301   QVEVLSHGSVGCFVTHCGWNSTMESLASGVPMVAFPQWVEQKTNAKLIEDVWKTGVRVDK  360

Query  297   SANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
               NE+G+V+ +E +RC+E VMG GEKG+ELRNNA+KW+ LA+ A+K+ GSS  NL+A++D
Sbjct  361   QVNEDGIVENEEIRRCLEEVMGSGEKGQELRNNAEKWRGLAREAVKEGGSSDKNLRAFLD  420

Query  117   EM  112
             ++
Sbjct  421   DV  422



>emb|CDP15115.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   432 bits (1110),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 228/459 (50%), Positives = 302/459 (66%), Gaps = 17/459 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM--SSRPEIQGLDFA  1315
             M   H+L+V +PAQGHINPSLQ A +L+ +G +VT +T   A+  +  +S        FA
Sbjct  1     MAQPHILIVSYPAQGHINPSLQLANKLIKIGVEVTFATSHFALPVVPKASCKVSNDFHFA  60

Query  1314  PFSDGYDAGLEPADLK-DFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
               SDGY  G +P  L  +   ++K  G + +  +I A  E GRP T +++T  ++WA  V
Sbjct  61    AISDGYPDGFKPQGLDVNHVNALKKYGPETLRNVIQASAETGRPVTCIVHTLTLTWAAEV  120

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC-SGNQVVEVPGVPALGVRDFPSFL  961
             AR  H+P TLLW QPATVL I Y+YF  Y D  RNC   +  +++PGVP L   D PSF+
Sbjct  121   AREYHIPWTLLWIQPATVLGITYYYFNGYEDEIRNCYEPSWSIQMPGVPLLTTLDLPSFM  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               + ++     + A+  +++Q++ I+ EENP VLVNTFDALE  AL+AI K  ++GIGPL
Sbjct  181   LPSSSSTQ---NVALLMVKEQMKMIDEEENPYVLVNTFDALEPHALKAIDKYNLIGIGPL  237

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             I   + +G         GD+ Q    Y+ WL SQP+SSVVY+AFGS        +EEIA+
Sbjct  238   IDFPFSEG--------SGDVMQEEEYYMGWLKSQPRSSVVYVAFGSLLTPSKHQMEEIAR  289

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++ K PFLWV+R    GE  EEKL C +ELE +G IV W +Q++VL+HPS+GCF+THC
Sbjct  290   GLLECKRPFLWVIRARDDGE--EEKLSCIKELEQKGLIVPWSSQLQVLKHPSLGCFVTHC  347

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNSTLE++  GVP+VA PLW DQ  NAKLIQDVWK+GVRV  NE+G+V++DE KRCIE 
Sbjct  348   GWNSTLETITLGVPVVAFPLWADQGTNAKLIQDVWKIGVRVVPNEDGLVESDEIKRCIEL  407

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAY  124
             VM GGE G E   NAKKWK+LA  AM + G S  NLKA+
Sbjct  408   VMDGGENGLEFGGNAKKWKDLAGEAMVEGGLSDTNLKAF  446



>ref|XP_008458144.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Cucumis melo]
Length=468

 Score =   431 bits (1108),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 227/466 (49%), Positives = 310/466 (67%), Gaps = 17/466 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLG-AKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
              VLL+ + AQGHINP+LQ AKRL+  G   VT  T  SA  RM   P +  L FA FSDG
Sbjct  11    RVLLITYSAQGHINPTLQLAKRLIRHGDLHVTFLTSLSAYRRMGQTPTLPHLSFASFSDG  70

Query  1299  YDAGLEPADLKDFWASMKTR-GSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +P D  D + S   R GSDA+  +I   + +G+PFT ++Y+ ++ W   VAR L 
Sbjct  71    YDDGFKPGDDIDHYVSELERCGSDALKNIIQESRNQGQPFTCIVYSILLPWVATVARSLD  130

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGD-LFRNCSGNQ-----VVEVPGVPALGVRDFPSFL  961
             V   LLW QPA V  +YY+YF  Y D + R  SG+       +++PG+P L  RD PSF 
Sbjct  131   VASVLLWIQPAVVFALYYYYFNGYYDEIQRIISGDDPGSSMSIKLPGLPLLSARDLPSFF  190

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEE-NPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
               ++        +A+   R Q E +  EE NP +L+NTF+ LE DA++AIKK  ++ IGP
Sbjct  191   GGSDVYA-----FALIIFRKQFELLEEEESNPNILINTFEELEKDAVKAIKKFHLMPIGP  245

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPS + DG DPS+ + G DL ++++ Y++WL+S+PK+SVVY++ GS   + N   EE+A
Sbjct  246   LIPSVFFDGTDPSEASSGCDLYRSTSSYIDWLNSKPKASVVYVSSGSITKLSNQQKEEMA  305

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             +GL+ +K PFLWV+R+T   E  E+ L  KE+LE QGKIV WC+Q+EVL  P+ GCFLTH
Sbjct  306   RGLLSTKRPFLWVIRDT---EAEEDSLSFKEKLETQGKIVPWCSQLEVLSSPATGCFLTH  362

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNS LESLA GVP VA P W+DQ  N+K+IQD+ + GVR+ A E+GVVK +E +RC+ 
Sbjct  363   CGWNSCLESLACGVPTVAFPQWSDQATNSKIIQDLSETGVRLEAGEDGVVKGEEIERCLT  422

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
              VMG  +KGE++R NA KWK+LAK A  + GSS+ N KA++D++ S
Sbjct  423   LVMGDSKKGEDIRRNALKWKKLAKEAASEGGSSFANFKAFVDQVCS  468



>ref|XP_006442002.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
 gb|ESR55242.1| hypothetical protein CICLE_v10019912mg [Citrus clementina]
Length=484

 Score =   427 bits (1097),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 240/496 (48%), Positives = 327/496 (66%), Gaps = 27/496 (5%)
 Frame = -3

Query  1554  TQNLLCLKLHLTPHIIFHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLST  1375
             TQ  +C ++    H+     P     H LL+ FP QGHINPSLQFA+RL  +G +VT + 
Sbjct  3     TQTQVCTQMPKNKHMEQQQQP-----HFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAI  57

Query  1374  GFSAMNRMSSRPEIQ-GLDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAK  1204
               SA  R+++ P  + GL FA FSDGYD G      D   + +  K R S+A+A+LIT  
Sbjct  58    AISAYRRIANNPTPEDGLSFASFSDGYDDGFNSKQNDRTHYMSEFKRRSSEALAELITTS  117

Query  1203  KEEG-RPFTRLIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCS  1027
             + EG +PFT L+Y  ++ WA  VAR  H+P  LLW QPA V D+YY+YF  YGDL     
Sbjct  118   QNEGGQPFTCLVYPQLLPWAAEVARAYHLPSALLWLQPALVFDVYYYYFYGYGDLIEG-K  176

Query  1026  GNQVVEVPGVPALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTF  847
              N ++E+PG+P L  RD PSFL    +N  Y   + + + ++Q+E I  E NP++LVNTF
Sbjct  177   VNDLIELPGLPPLTGRDLPSFLDPRNSNDAYS--FVLPSFKEQMEAIVEETNPRILVNTF  234

Query  846   DALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPK  673
             DALE + L+AI K  M+ IGPL+ SA LDG++     +GGDL QNS+   Y+EWL S+PK
Sbjct  235   DALEAETLKAIDKFNMIAIGPLVASALLDGKE----QYGGDLCQNSSIEYYMEWLSSKPK  290

Query  672   SSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEK------LRCKE  511
             SSV+Y+AFG+   +    +EEIA+GL+ S  PFLWV RE+   +K ++K      ++ KE
Sbjct  291   SSVIYVAFGTICVLEKRQVEEIARGLLDSGHPFLWVSRESDNKDKDKDKGEDDVMMKYKE  350

Query  510   ELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKL  331
             EL  +G IV WC+QVEVL H ++GCF+THCGW+S+LESL  GVP+VA P W DQ  NAK+
Sbjct  351   ELNEKGMIVPWCSQVEVLSHEAVGCFVTHCGWSSSLESLVYGVPVVAFPQWTDQGTNAKI  410

Query  330   IQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDG  151
             I D  K GVRV ANEEG+V++DE  RC+E VMG   +G++ R N+ KWK+LA+ A+K  G
Sbjct  411   IVDFCKTGVRVKANEEGIVESDEINRCLELVMG---EGDDFRRNSLKWKDLARDAVKQGG  467

Query  150   SSYLNLKAYMDEMLSS  103
             SS+ NLKA++D+  +S
Sbjct  468   SSHKNLKAFVDDFSTS  483



>gb|EYU31586.1| hypothetical protein MIMGU_mgv1a005918mg [Erythranthe guttata]
Length=465

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 237/468 (51%), Positives = 316/468 (68%), Gaps = 23/468 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPE--IQGLDFAPFSD  1303
             HVLLV FP QGHINPSLQFAKRL  +G KVT +T   A  RMS       +G+ FA FSD
Sbjct  6     HVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSD  65

Query  1302  GYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             GYD G  P   D   +   +++RGS ++   I A  E+G P T+L+YT ++ WA  VAR 
Sbjct  66    GYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEVARE  125

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGV--RDFPSFL  961
              HVP  LLW QPATVL+IYY+YF  YGD     S +    ++ PG+PAL    RD PSF+
Sbjct  126   FHVPSALLWIQPATVLNIYYYYFNGYGDEIAANSNDATWQIQFPGIPALNFSKRDLPSFI  185

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEEN-PKVLVNTFDALEFDALRAIKKVRMVGIGP  784
               + ++ +      + + ++Q+E ++ E+  PKVLVNTF+ALE  AL++I    ++G+GP
Sbjct  186   LPSSSDKH---SVELPSFKEQLETLDAEKTKPKVLVNTFEALEPHALKSIDNYELIGVGP  242

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSND-YVE-WLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             LIPSA      PSD +F GDL + S+D  VE WL+++P+SSVVY++FGS   +P   +EE
Sbjct  243   LIPSA------PSDKSFRGDLFEKSDDNSVELWLNAKPESSVVYVSFGSILKLPKAQMEE  296

Query  609   IAQGLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             IA+GL++S  PFLWV+R  E +K E+ EEKL C +ELE  GK V WC+Q+EVL H S+GC
Sbjct  297   IAKGLLESDRPFLWVIRINEDNKNEEEEEKLSCLDELEKIGKFVPWCSQLEVLTHASVGC  356

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK-LGVRVSANEEGVVKADEY  259
             F++HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK          +GVV++ E 
Sbjct  357   FVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDGVVESGEI  416

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
              RCIE VM GGE+  ELR NA++WK LA+ AM ++GSS  NLKA++++
Sbjct  417   NRCIEEVMDGGERSRELRANAREWKSLAREAMDENGSSCNNLKAFLED  464



>gb|EYU31587.1| hypothetical protein MIMGU_mgv1a018203mg [Erythranthe guttata]
Length=465

 Score =   425 bits (1093),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 237/468 (51%), Positives = 316/468 (68%), Gaps = 23/468 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPE--IQGLDFAPFSD  1303
             HVLLV FP QGHINPSLQFAKRL  +G KVT +T   A  RMS       +G+ FA FSD
Sbjct  6     HVLLVTFPVQGHINPSLQFAKRLTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSD  65

Query  1302  GYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             GYD G  P   D   +   +++RGS ++   I A  E+G P T+L+YT ++ WA  VAR 
Sbjct  66    GYDDGFNPGNDDAGKYMTEIRSRGSQSLRDTILAAAEQGCPVTQLVYTLLLPWAPEVARE  125

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGV--RDFPSFL  961
              HVP  LLW QPATVL+IYY+YF  Y D     S +    ++ PG+PAL    RD PSF+
Sbjct  126   FHVPSALLWIQPATVLNIYYYYFNGYRDEIAANSNDATWQIQFPGIPALNFSKRDLPSFI  185

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEEN-PKVLVNTFDALEFDALRAIKKVRMVGIGP  784
               + ++ +      + + ++Q+E ++ E+  PKVLVNTF+ALE  AL++I    ++G+GP
Sbjct  186   LPSSSDKH---SVELPSFKEQLETLDAEKTKPKVLVNTFEALEPHALKSIDNYELIGVGP  242

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSND-YVE-WLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             LIPSA      PSD +F GDL + S+D  VE WL+++P+SSVVY++FGS   +P   +EE
Sbjct  243   LIPSA------PSDKSFRGDLFEKSDDNSVELWLNAKPESSVVYVSFGSILKLPKAQMEE  296

Query  609   IAQGLVKSKMPFLWVLR--ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             IA+GL++S  PFLWV+R  E +K E+ EEKL C +ELE  GK V WC+Q+EVL H S+GC
Sbjct  297   IAKGLLESDRPFLWVIRINEDNKNEEEEEKLSCLDELEKIGKFVPWCSQLEVLTHASVGC  356

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK-LGVRVSANEEGVVKADEY  259
             F++HCGWNSTLESL+SGVP+VA P W DQ  NAKLI+DVWK          +GVV++ E 
Sbjct  357   FVSHCGWNSTLESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDGVVESGEI  416

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             KRCIE VM GG++  ELR NA++WK LA+GAM ++ SS  NLKA+++E
Sbjct  417   KRCIEEVMDGGKRSRELRANAREWKSLARGAMDENRSSCKNLKAFLEE  464



>sp|Q9ZR26.1|5GT2_PERFR RecName: Full=Anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2; AltName: Full=UDP-glucose:anthocyanin 5-O-glucosyltransferase 
3R6; Short=p3R6; Flags: Precursor [Perilla frutescens]
 dbj|BAA36422.1| UDP-glucose:anthocyanin 5-O-glucosyltransferase homologue [Perilla 
frutescens var. crispa]
Length=443

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/450 (50%), Positives = 297/450 (66%), Gaps = 24/450 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ-----GLDFAP  1312
              VLL  FPAQGHINP+LQFAKRL+  G  VT  T   A  RM++          GLDF  
Sbjct  5     RVLLATFPAQGHINPALQFAKRLLKAGTDVTFFTSVYAWRRMANTASAAAGNPPGLDFVA  64

Query  1311  FSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDGYD GL+P  D K + + MK RGS+A+  L+    +     T ++Y+ + +WA  VA
Sbjct  65    FSDGYDDGLKPGGDGKRYMSEMKARGSEALRNLLLNNDD----VTFVVYSHLFAWAAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFS  955
             R  HVP  LLW +PATVL IY+ YF  Y D     +G+  +++P +P+L  R  P+FL  
Sbjct  121   RLSHVPTALLWVEPATVLCIYHFYFNGYADEID--AGSNEIQLPRLPSLEQRSLPTFLLP  178

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
               T   + L      M++++E ++GEE  KVLVNTFDALE DAL AI +  ++GIGPLIP
Sbjct  179   A-TPERFRL-----MMKEKLETLDGEEKAKVLVNTFDALEPDALTAIDRYELIGIGPLIP  232

Query  774   SAYLDGEDPSDTAFGGDLRQNS--NDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             SA+LDGEDPS+T++GGDL + S  N+ VEWL+S+PKSSVVY++FGS    P   +EEI +
Sbjct  233   SAFLDGEDPSETSYGGDLFEKSEENNCVEWLNSKPKSSVVYVSFGSVLRFPKAQMEEIGK  292

Query  600   GLVKSKMPFLWVLRETSKGE----KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             GL+    PFLW++RE    +    + EE+L C  EL+  GKIV WC+Q+EVL HP++GCF
Sbjct  293   GLLACGRPFLWMIREQKNDDGEEEEEEEELSCIGELKKMGKIVSWCSQLEVLAHPALGCF  352

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGWNS +ESL+ G+P+VA P W DQ  NAKLI+D W  GVRV  NE G V   E +R
Sbjct  353   VTHCGWNSAVESLSCGIPVVAVPQWFDQTTNAKLIEDAWGTGVRVRMNEGGGVDGCEIER  412

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAM  163
             C+E VM GG+K + +R NA KWK LA+ AM
Sbjct  413   CVEMVMDGGDKTKLVRENAIKWKTLARQAM  442



>ref|XP_006442000.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
 gb|ESR55240.1| hypothetical protein CICLE_v10023445mg [Citrus clementina]
Length=500

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 332/510 (65%), Gaps = 31/510 (6%)
 Frame = -3

Query  1554  TQNLLCLKLHLTPHIIFHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLST  1375
             TQ  +C ++    H+     P     H LL+ FP QGHINPSLQFA+RL  +G +VT +T
Sbjct  3     TQTQVCTQMPKNKHMEQQQQP-----HFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAT  57

Query  1374  GFSAMNRMSSRPEIQ-GLDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAK  1204
               SA   M + P  + GL FA FSDGYD G      D   F +  K R S+A+A+LITA 
Sbjct  58    AISAYRLMPNNPTAEDGLSFASFSDGYDDGFNSKQNDQTHFMSEFKRRSSEALAELITAS  117

Query  1203  KEEG-RPFTRLIYTSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCS  1027
             + EG +PFT L+Y  ++ WA  VAR  H+P  LLW QP  V D+YY+YF  YGDL     
Sbjct  118   RNEGGQPFTCLVYPQLLIWAAEVARAYHLPSALLWLQPVLVFDVYYYYFYGYGDLIEG-K  176

Query  1026  GNQVVEVPGVPALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTF  847
              N ++E+PG+P L  RD PSFL    +N  Y   + + + ++Q+E I  E +P++LVNTF
Sbjct  177   VNDLIELPGLPPLTGRDLPSFLDPRNSNDAYS--FVLPSFKEQMEAIVEETDPRILVNTF  234

Query  846   DALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPK  673
             DALE + L+AI K  M+ IGPL+ SA LDG++     +GGDL QNS+   Y+EWL S+PK
Sbjct  235   DALEAETLKAIDKFNMIAIGPLVASALLDGKE----QYGGDLCQNSSIEYYMEWLSSKPK  290

Query  672   SSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEK----------L  523
             SSV+Y+AFG+   +    +EEIA+GL+ S  PFLWV RE    +K ++K          +
Sbjct  291   SSVIYVAFGTICVLEKRQVEEIARGLLDSGHPFLWVSRENDNKDKDKDKDKDEGEDDVMM  350

Query  522   RCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFP  343
             + KEEL  +G IV WC+QVEVL H ++GCF+THCGW+S+LESL  GVP+VA P W DQ  
Sbjct  351   KYKEELNEKGMIVPWCSQVEVLSHEAVGCFVTHCGWSSSLESLVYGVPVVAFPQWTDQGT  410

Query  342   NAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAM  163
             NAK+I D  K GVRV ANEEG+V++DE  RC+E V+G   +G++ R N+ KWK+LA+ A+
Sbjct  411   NAKIIVDFCKTGVRVKANEEGIVESDEINRCLELVIG---EGDDFRRNSLKWKDLARDAV  467

Query  162   KDDGSSYLNLKAYMDEMLSSP*ISIEINLS  73
             K  GSS+ NLKA++D+  +S  ++++ NL+
Sbjct  468   KQGGSSHKNLKAFVDDFSTSKLVAVKANLN  497



>ref|XP_009765810.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X2 [Nicotiana sylvestris]
Length=313

 Score =   417 bits (1073),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 252/308 (82%), Gaps = 6/308 (2%)
 Frame = -3

Query  1029  SGNQVVEVPGVPALGVRDFPSFLFS-TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVN  853
             S +Q++E+PG+P+L   DFPSF+F   ++N     DWA+E+++ QIE +N EENP++LVN
Sbjct  7     SKDQIIELPGLPSLSSSDFPSFVFDDVKSN-----DWAVESIKRQIEILNSEENPRILVN  61

Query  852   TFDALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPK  673
             TFDALE +ALR +K V MVGIGPLIPS++LD +D  D  F  D+ ++ N+Y+EWLD++  
Sbjct  62    TFDALELNALRVLKNVTMVGIGPLIPSSFLDEKDRKDNFFAADMIESENNYMEWLDARAN  121

Query  672   SSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQG  493
              SV+Y+AFGSYA++ +  +EEI+QGL+K   PFLWV+RET  GEKPEEKL CK+ELE  G
Sbjct  122   KSVIYIAFGSYAEISSQWMEEISQGLLKCGRPFLWVIRETLNGEKPEEKLTCKDELEKIG  181

Query  492   KIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK  313
             +IV WC+Q+EVL+H S+GCFLTHCGWNSTLESLASGVP+VACP+WNDQ  NAKLIQDVWK
Sbjct  182   RIVCWCSQMEVLKHSSVGCFLTHCGWNSTLESLASGVPIVACPIWNDQICNAKLIQDVWK  241

Query  312   LGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNL  133
             +GVRV+AN+EG+VK DE+++CIE VMG  E+GEELR NA+KWK+LAK + K++ SS +NL
Sbjct  242   IGVRVNANKEGIVKRDEFQKCIEIVMGDAEEGEELRKNAQKWKDLAKESTKENSSSNVNL  301

Query  132   KAYMDEML  109
             KAY++E L
Sbjct  302   KAYVNECL  309



>ref|XP_006492998.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Citrus sinensis]
Length=470

 Score =   422 bits (1086),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 233/468 (50%), Positives = 318/468 (68%), Gaps = 20/468 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ-GLDFAPFSDG  1300
             H LLV FPAQGHINP+LQ A+RL+ +G +VT +T   A  RM++ P  + GL FA FSDG
Sbjct  12    HFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRMANSPTPEDGLSFASFSDG  71

Query  1299  YDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGVVARG  1129
             YD G   +  D + + +  K R S+A+ +LIT  + +G +PFT L+Y+ ++ W   VAR 
Sbjct  72    YDDGFNSKQIDPRRYVSEFKRRSSEALTELITGSENQGAQPFTCLVYSLLLPWTAEVARA  131

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTE  949
              H+P  LLW QPA V D+YY+YF  YGDL      N ++E+PG+P L   D PSF+   +
Sbjct  132   YHLPSALLWIQPALVFDVYYYYFYGYGDLIEE-KVNDLIELPGLPPLTGCDLPSFMDPRK  190

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             +N  Y   + +   ++Q+E I  E +PK+LVNTFDALE + LRAI K  M+ IGPL+ SA
Sbjct  191   SNDAYS--FILPYFKEQMEAIVEETDPKILVNTFDALEAETLRAIDKFNMIAIGPLVASA  248

Query  768   YLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
              LDG++     +GGDL +NS+   Y+EWL S+PKSSV+Y+AFG+   +    +EEIA+GL
Sbjct  249   LLDGKE----LYGGDLCKNSSKEYYMEWLSSKPKSSVIYVAFGTICVLEKRQVEEIARGL  304

Query  594   VKSKMPFLWVLRETSKGEKPEEK----LRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             + S  PFLWV+RE    +K + +    ++ KEEL  +G IV WC+QVEVL H ++GCF+T
Sbjct  305   LDSGHPFLWVIREHENKDKDKGEDDVVMKYKEELNEKGMIVPWCSQVEVLSHEAVGCFVT  364

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNS+LESL  GVP+VA P W DQ  NAK+I D  K GVRV ANEEG++++DE KRC+
Sbjct  365   HCGWNSSLESLVCGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANEEGILESDEIKRCL  424

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             E VMG   +G+E R N+ KWK+LA+ A K  GSSY NLKA++D+  +S
Sbjct  425   ELVMG---EGDEFRGNSLKWKDLAREAAKQGGSSYKNLKAFVDDFSTS  469



>ref|XP_009612651.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X2 [Nicotiana tomentosiformis]
Length=313

 Score =   415 bits (1066),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 247/308 (80%), Gaps = 6/308 (2%)
 Frame = -3

Query  1029  SGNQVVEVPGVPALGVRDFPSFLFS-TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVN  853
             S +Q++E+PG+P+L   +FPSF+F   ++N     DWA+E+++ QIE +N EENP++LVN
Sbjct  7     SKDQIIELPGLPSLSSSEFPSFVFDDVKSN-----DWAVESIKRQIEILNSEENPRILVN  61

Query  852   TFDALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPK  673
             TFDALE +ALR +K V MVGIGP IPS++LD +D  D  F  D+ +N N+Y+EWLD++  
Sbjct  62    TFDALELNALRVLKNVTMVGIGPSIPSSFLDEKDRKDNFFTADMIENENNYMEWLDARAN  121

Query  672   SSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQG  493
              SV+Y+AFGSYA++ +  +EEI+QGL+K   PFLWV+RET  GEKPEEKL CK+EL   G
Sbjct  122   ESVIYIAFGSYAEISSQWMEEISQGLLKCGKPFLWVIRETLNGEKPEEKLTCKDELAKTG  181

Query  492   KIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK  313
              IVRWC+Q+EVL+HPS+GCFLTHCGWNSTLESLASGVP+VACP+WNDQ  NAKLIQDVWK
Sbjct  182   IIVRWCSQMEVLKHPSVGCFLTHCGWNSTLESLASGVPIVACPIWNDQVCNAKLIQDVWK  241

Query  312   LGVRVSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNL  133
             +GVRV+ NEEG VK DE++RCIE V G  E+G ELR N +KWK+LAK AMK++ SS +NL
Sbjct  242   IGVRVNTNEEGTVKRDEFRRCIEIVTGNNEEGVELRKNVQKWKDLAKEAMKENCSSNVNL  301

Query  132   KAYMDEML  109
             KAY++E L
Sbjct  302   KAYVNEFL  309



>ref|XP_010069411.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=456

 Score =   420 bits (1079),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 222/464 (48%), Positives = 310/464 (67%), Gaps = 22/464 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV    +  +NP+LQ A+RL  +G++VT  +   A   M      +G+ F  FSDGY
Sbjct  5     HFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVCAHRCMIDPVCPEGVTFTTFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G  P D L+ + A MK RGS+A+  LI     +G  FT +++T I+ W   VAR L +
Sbjct  65    DDGYVPGDDLERYRAEMKRRGSEALRDLIEHSSGQGLSFTCVLHT-IVPWVHDVARSLQI  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRN-----CSGNQVVEVPGVPALGVRDFPSFLFS  955
                L+W QPATV DIYYHYF+ Y D+ ++     C    ++ +PGVP L  R+ PSFL  
Sbjct  124   KSVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNRNIPSFL--  181

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKV-LVNTFDALEFDALRAIKKVRMVGIGPLI  778
                +V     +A+  ++  +E++   ENPKV LVNTFDALE +ALRAI  + +VGIGPL+
Sbjct  182   ---HVENKYAFALPEIQSLLENLKEGENPKVVLVNTFDALELEALRAIGTLNLVGIGPLV  238

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             P ++LD    SD +  GD    S DYV+WL+++ ++SV+Y+AFGS A +      E+A+G
Sbjct  239   PLSFLD----SDQSSRGDRFLGSEDYVKWLNAKEEASVIYVAFGSIAMLSKAQKREMARG  294

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             L+++  PFLWV+    KG+  +++L  KEE++ +G IV WC+Q+EVL HPSIGCFLTHCG
Sbjct  295   LLETGRPFLWVM---GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVLSHPSIGCFLTHCG  351

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS-ANEEG-VVKADEYKRCIE  244
             WNST+ESL  G+P+VA P W DQ  NAKL++DVWK+GVRVS  ++EG +V+A E K+C+E
Sbjct  352   WNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSEIDQEGIIVEAGEIKKCLE  411

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGGE+G+E+R NAKKWK+L   A KD GSS  NLKA+++E+
Sbjct  412   LVMGGGERGDEIRRNAKKWKDLVMEASKDGGSSDKNLKAFVEEI  455



>ref|XP_006421040.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|ESR34280.1| hypothetical protein CICLE_v10004909mg [Citrus clementina]
 gb|KDO49186.1| hypothetical protein CISIN_1g041902mg [Citrus sinensis]
Length=470

 Score =   419 bits (1077),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 233/477 (49%), Positives = 318/477 (67%), Gaps = 25/477 (5%)
 Frame = -3

Query  1503  HHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ-G  1327
              H P     H LLV FPAQGHINP+LQ A+RL+ +G +VT +T   A  RM++ P  + G
Sbjct  8     QHQP-----HFLLVTFPAQGHINPALQLARRLIRIGTRVTFATTIFAYRRMANSPTPEDG  62

Query  1326  LDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIM  1156
             L FA FSDGYD G      D + + +  K R S+A+ ++IT  + +G +PFT L+Y+ ++
Sbjct  63    LSFASFSDGYDDGFNSKQNDPRRYVSEFKRRSSEALTEIITGSENQGAQPFTCLVYSLLL  122

Query  1155  SWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRD  976
              W   VAR  H+P  LLW QPA V D+YY+YF  YGDL      N ++E+PG+P L   D
Sbjct  123   PWTAEVARAYHLPSALLWIQPALVFDVYYYYFYGYGDLIEE-KVNDLIELPGLPPLTGWD  181

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSF+   ++N  Y   + +   ++Q+E I  E +PK+LVNTFDALE + LRAI K  M+
Sbjct  182   LPSFMDPRKSNDAYS--FILTCFKEQMEAIVEETDPKILVNTFDALEAETLRAIDKFNMI  239

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNT  622
              IGPL+ SA  DG++     +GGDL +NS+   Y+EWL S+PKSSV+Y+AFG+   +   
Sbjct  240   AIGPLVASALWDGKE----LYGGDLCKNSSKEYYMEWLSSKPKSSVIYVAFGTICVLEKR  295

Query  621   MLEEIAQGLVKSKMPFLWVLRETSKGEKPEEK----LRCKEELEAQGKIVRWCAQVEVLQ  454
              +EEIA+GL+ S  PFLWV+RE    +K + +    ++ KEEL  +G IV WC+QVEVL 
Sbjct  296   QVEEIARGLLDSGHPFLWVIREHENKDKDKGEDDVVMKYKEELNEKGMIVPWCSQVEVLS  355

Query  453   HPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVV  274
             H ++GCF+THCGWNS+LESL  GVP+VA P W DQ  NAK+I D  K GVRV ANEEG++
Sbjct  356   HEAVGCFVTHCGWNSSLESLVCGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANEEGIL  415

Query  273   KADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             ++DE KRC+E VMG   +G+E R N+ KWK+LA+ A K  GSSY NLKA++D+  +S
Sbjct  416   ESDEIKRCLELVMG---EGDEFRGNSLKWKDLAREAAKQGGSSYKNLKAFVDDFGTS  469



>gb|ABL85474.1| glycosyltransferase UGT75L4 [Maclura pomifera]
Length=472

 Score =   417 bits (1073),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 234/476 (49%), Positives = 312/476 (66%), Gaps = 25/476 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSR--PEIQ---GL  1324
             M     LLV +PAQGHINP LQFAKRL   GA +T  T   A  +M +R  P IQ    L
Sbjct  1     MTKPRFLLVTYPAQGHINPGLQFAKRLARAGADITFVTANYAHRQMINRSDPTIQNGTSL  60

Query  1323  DFAPFS-DGYDAGLEPADLKDFWASMKTR-GSDAVAKLITAKKEEGRPFTRLIYTSIMSW  1150
               APFS DGY+ G +P    D + S   R GS A+  LI     EGRP+T L YT ++ W
Sbjct  61    SHAPFSVDGYEDGFKPGGDPDHYLSEFRRCGSQALTDLILTAVNEGRPYTCLAYTILLPW  120

Query  1149  AGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN------CSGNQVVEVPGVP-A  991
             A + A    +P  LLW QPATV DIYY+YF  YGD+ R        S + +  +PG+P  
Sbjct  121   AALTAEEHGLPSVLLWIQPATVFDIYYYYFHGYGDIIRTNSTKDPSSDDSLTTLPGLPWK  180

Query  990   LGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGE-ENPKVLVNTFDALEFDALRAI  814
                 D PSF+    T       +AI  +++Q E  + + +NPK+LVNTFD LE +A++AI
Sbjct  181   FSRSDLPSFMDPANTYT-----FAIPLLKEQFEIFDEKIKNPKILVNTFDQLESEAMKAI  235

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
              K+ ++GIGPLIPS +L+ ++PS T+ G     N ++Y+ WL+S+PK SV+Y++FG+ A 
Sbjct  236   VKLSLIGIGPLIPSDFLEEKEPSGTSSGQSKDDNEDEYIVWLNSKPKGSVIYVSFGTIAV  295

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEE-LEAQGKIVRWCAQVEVL  457
             +    +EEIA+GL++S  PFLW++RE  + EK EE+    EE L+  GKIV WC QVEVL
Sbjct  296   LSRAQMEEIAKGLLESGRPFLWIIREDKEKEKKEEEKLSFEEELQKLGKIVPWCRQVEVL  355

Query  456   QHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGV  277
              + S+GCF+THCGWNSTLESL SGVP+VA P W DQ  NAKLI+DVWK+GVRV  NE+G+
Sbjct  356   SNTSLGCFMTHCGWNSTLESLVSGVPVVAFPQWTDQGTNAKLIEDVWKIGVRVKPNEKGI  415

Query  276   VKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             V+++E  RC+E VM    +GEELR NAKKWK+LA+ A K+ GSS  NLKA++ E++
Sbjct  416   VESEEVTRCLELVM----EGEELRENAKKWKDLAREAAKEGGSSNENLKAFVAEVM  467



>ref|XP_004140483.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 ref|XP_004162374.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Cucumis sativus]
 gb|KGN46580.1| UDP-glucose:flavonoid 7-O-glucosyltransferase [Cucumis sativus]
Length=467

 Score =   416 bits (1068),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 228/464 (49%), Positives = 309/464 (67%), Gaps = 15/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLG-AKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
             HVLLV   AQGHINP+LQ AKRL   G   VT     SA  RM   P +  + FA FSDG
Sbjct  12    HVLLVTHCAQGHINPTLQLAKRLTRHGDLHVTFLISLSAYRRMGHTPTLPHITFASFSDG  71

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +P+D +K + + ++ RGSDA+  +I   + +G+PFT ++Y+ ++ W   VAR L 
Sbjct  72    YDDGFKPSDDIKLYISELERRGSDALKNIIQESRNKGQPFTCIVYSILIPWVATVARSLD  131

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGD-LFRNCSGNQ----VVEVPGVPALGVRDFPSFLF  958
             V    LW QPA V  +YY+Y   Y D + R  SG+      +++PG+P L  RD PSF  
Sbjct  132   VASVHLWIQPAVVFALYYYYNNGYYDEIQRIASGDDPSSTSIKLPGLPLLSARDLPSFFG  191

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             +++        +A+   R Q E +  E NPK+L+NTF+ LE DA++AIKK  ++ IGPLI
Sbjct  192   ASD-----GYSFALPMFRKQFELLEEESNPKILINTFEELEKDAVKAIKKFHLMPIGPLI  246

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PS  +DG DPS+ + G DL ++++ Y+EWL+S+PK+SVVY++ GS + V     EEIA+G
Sbjct  247   PSVLVDGNDPSEASSGCDLFRSTSSYMEWLNSKPKASVVYVSMGSISTVSKQQKEEIARG  306

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             L  +K PFLWV+R     E+ E+ L  KE+LE QGKIV WCAQ+EVL  P+ GCFLTHCG
Sbjct  307   LSLTKRPFLWVIRNI---EEEEDFLSFKEKLETQGKIVSWCAQLEVLSSPATGCFLTHCG  363

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNS LESLA GVP VA P W+DQ  N+K+I+D+ + GVR+   EEGVVK +E +RC+E V
Sbjct  364   WNSCLESLACGVPNVAFPQWSDQATNSKIIEDLSETGVRLEVEEEGVVKGEEIERCLELV  423

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             MG  +KGEE+R NA KWK+LAK A  + GSS+ NLKA++D + S
Sbjct  424   MGDSKKGEEIRRNALKWKKLAKEAASEGGSSFANLKAFVDHVCS  467



>ref|XP_010039940.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45599.1| hypothetical protein EUGRSUZ_L00632 [Eucalyptus grandis]
Length=456

 Score =   411 bits (1057),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 305/464 (66%), Gaps = 22/464 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV    +  +NP+LQ A+RL  +G++VT  +   A   M      +G+ F  FSDGY
Sbjct  5     HFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVYAHRCMIDPVCPEGVTFTTFSDGY  64

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G  P D  + + A MK RGS+A+  LI     +G  FT +++T I+ W   VAR L +
Sbjct  65    DDGYVPGDDPERYMAEMKRRGSEALRGLIEHSSGQGLSFTCVLHT-IVPWVHDVARSLQI  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRN-----CSGNQVVEVPGVPALGVRDFPSFLFS  955
                L+W QPATV DIYYHYF  Y D+ ++     C    ++ +PGVP L  R+ PS L  
Sbjct  124   KSVLVWIQPATVFDIYYHYFNGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNRNIPSLL--  181

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKV-LVNTFDALEFDALRAIKKVRMVGIGPLI  778
                +V     + +  ++  +E++   ENPKV LVNTFDALE +ALR I  + +VGIGPL+
Sbjct  182   ---HVENKYAFFLPEIQSLLENLKEGENPKVVLVNTFDALELEALRVIGTLNLVGIGPLV  238

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             P ++LD    SD +  GD    S DYV+WL+++ ++SV+Y+AFGS A +      E+A+G
Sbjct  239   PLSFLD----SDQSSRGDRFLGSEDYVKWLNAKEEASVIYVAFGSIARLSKAQKREMARG  294

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             L+++  PFLWV+R   K +  +++L CKEEL+ +G IV WC+Q+EVL HPSIGCFLTHCG
Sbjct  295   LLETGRPFLWVMR---KDDGDDDELICKEELDKRGVIVPWCSQIEVLSHPSIGCFLTHCG  351

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS-ANEEG-VVKADEYKRCIE  244
             WNST+ESL  G+P+VA P W DQ  NAKL++DVWK+GVRVS  ++EG +V+  E K+C+E
Sbjct  352   WNSTIESLVCGIPMVAFPQWIDQMTNAKLVEDVWKVGVRVSEIDQEGIIVEGGEIKKCLE  411

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGGE+G+E+R NAKKWK+L   A K+ GSS  NLKA+++E+
Sbjct  412   LVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  455



>dbj|BAF75879.1| glucosyltransferase [Dianthus caryophyllus]
Length=475

 Score =   410 bits (1053),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 225/475 (47%), Positives = 313/475 (66%), Gaps = 27/475 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI-QGLDFAPFSDG  1300
             H LLV FPAQGHINP+L+FAKRL+  G  VTL+T  S  NR   + ++ +GL FA FSDG
Sbjct  9     HFLLVTFPAQGHINPALEFAKRLLRAGVDVTLATSVSG-NRCLEKAKVPEGLRFAAFSDG  67

Query  1299  YDAGLEPAD--LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             YD G  P D  +  + +  K  GS ++A ++   ++EG+  T L YT ++ WA  VAR  
Sbjct  68    YDDGFRPNDDSVLTYMSKFKQNGSRSLADVLNKARDEGKKVTCLAYTLLLPWAAEVAREF  127

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP-ALGVRDFPSFLFS  955
             HVP  LLW QPA V D+YY+YF  YGD+ + C  N    + +P +P  L  RD PSFL  
Sbjct  128   HVPSALLWIQPAAVFDVYYYYFRGYGDVIKECENNPSWSINLPNLPFTLRTRDLPSFLLP  187

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             + T + Y   +A+    +QIE++  EE P +LVNTF+ALE +AL+AI++  ++ IGPL+ 
Sbjct  188   S-TPLPYT--FAVPTFLEQIEELEKEETPTILVNTFEALEVEALKAIERFTLIPIGPLLA  244

Query  774   SAYLDG-EDPS--DTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
                L+G +DP+    +  G+L+ +  DY+ WLDS   S V+Y++FGS + +     EE+A
Sbjct  245   LGNLEGIKDPARDQKSRAGELKDD-KDYMTWLDSHEDSKVIYVSFGSMSVLSRAQQEELA  303

Query  603   QGLVKSKMPFLWVLRETS--------KGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             + L+++  PFLWV+RE +        +G   E +L C EEL   GKIV WC+Q+EVL HP
Sbjct  304   RALIQTHRPFLWVIRENNDKKDKEVEEGNTDEGELSCMEELRRVGKIVPWCSQLEVLSHP  363

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE-GVVK  271
             S+GCF+THCGWNSTLES+  GVP+V  P W DQ  NAKL++DVWK+GVRV++NEE G+VK
Sbjct  364   SVGCFVTHCGWNSTLESITCGVPMVGFPQWTDQTTNAKLVEDVWKIGVRVNSNEEDGLVK  423

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
              +E  RC+E VM    + EE+RNNAKK+KELA  A K+ G S  NLK++++E+ S
Sbjct  424   DEEIMRCLERVM----ESEEIRNNAKKFKELAVQAAKEGGGSDNNLKSFIEEVTS  474



>gb|KDP32590.1| hypothetical protein JCGZ_13140 [Jatropha curcas]
Length=455

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/469 (45%), Positives = 299/469 (64%), Gaps = 30/469 (6%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  HVL+  FPAQGHINPSLQFA+RL  +G KVT +T   A  RM+       L FA  
Sbjct  1     MKNPHVLVASFPAQGHINPSLQFAQRLATMGLKVTFATTIGADRRMAKTGIPDNLSFAAL  60

Query  1308  SDGYDAGLEP-ADLKDFWA-SMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDG D G +P  ++ ++    ++  GS  + +LI     +G PFT ++Y+ ++ W   VA
Sbjct  61    SDGNDDGFKPIVNIGNYMTHDLRLHGSQTLRRLIQQASNDGHPFTFVVYSILIPWVAKVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNC--SGNQVVEVPGVPALGVRDFPSFL  961
             R  H+P  LLW+QPATV  IYYHYF  YG++      S   ++ +P +P L V D PSF 
Sbjct  121   REFHLPSALLWSQPATVFSIYYHYFNGYGEIIEKTINSATLLLNLPNLPVLSVYDLPSFF  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGE--ENPK--VLVNTFDALEFDALRAIKKVRMVG  793
                ++N   +  + +  +++ +E ++ E   NPK  +LVNTFDALE + L++I K ++VG
Sbjct  181   SPAKSN---EYAFVLPVVKEHLEILDEEIKHNPKSAILVNTFDALEVEVLKSIDKYKLVG  237

Query  792   IGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             +GPL+ S           +FGG L Q SN Y+EWL+S+P+ SV+Y++FGS + +    +E
Sbjct  238   VGPLLRSG----------SFGGSLFQESNGYIEWLNSKPQRSVIYISFGSISVMSEQQIE  287

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             E+A  L K   PFLWV+RE +           KE+L   G  V WC QVEVL +P+IGCF
Sbjct  288   EMAIALEKIGSPFLWVIRENAI---------VKEKLNKGGLTVPWCNQVEVLSNPAIGCF  338

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGWNST ESL  GVP+V  P W DQ  NAKL+QD+WK+GVRV  NEEG+V+A E +R
Sbjct  339   ITHCGWNSTFESLTCGVPMVGFPQWTDQMTNAKLVQDLWKVGVRVVVNEEGIVEAKEIRR  398

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             C+E VMG G+ G+E+R +AKKWK+LA+ A+ + GS+  N+KA++D + S
Sbjct  399   CLELVMGDGDGGKEMRKSAKKWKDLAREAINEGGSTDKNVKAFVDVITS  447



>ref|XP_006414807.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
 gb|ESQ56260.1| hypothetical protein EUTSA_v10025167mg [Eutrema salsugineum]
Length=455

 Score =   407 bits (1046),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/461 (46%), Positives = 299/461 (65%), Gaps = 24/461 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT +T  SA+ RM   P  QGL +A FSDG+
Sbjct  12    HYLLVTFPAQGHINPALQLANRLIHHGATVTYATAVSALRRMGEPPSAQGLSYAWFSDGF  71

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGVVARGLH  1123
             D GL+   D K + + +K RGSDA++ +I A   +G    T +IY+ ++ W   VAR  H
Sbjct  72    DDGLKSFEDQKIYMSELKRRGSDALSDIIRANLHDGATTITTVIYSVLVPWVSTVARDFH  131

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTETN  943
             +P TLLW +PATVLDIYY+YF    D  ++      +++P +P +   D PSFL   +  
Sbjct  132   LPTTLLWIEPATVLDIYYYYFN---DSHKHLFETDPIKLPNLPPISTGDLPSFLQPLKA-  187

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                 L  A+  +++ IE +  E +P++LVNTF  LE DAL ++KK+RM+ IGPL+ S+  
Sbjct  188   ----LPSALVTLQEHIEALESESDPRILVNTFSNLEHDALASVKKLRMIPIGPLVSSSS-  242

Query  762   DGEDPSDTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYA-DVPNTMLEEIAQGLVK  589
             DG+         DL R +  DY++WLDS+ + SVVY++ G++A D+P   +E +  G++ 
Sbjct  243   DGK--------ADLFRSSEEDYIKWLDSKQEKSVVYISLGTHAEDLPEKHMEALTSGVLA  294

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGK---IVRWCAQVEVLQHPSIGCFLTHCG  418
             +  PFLWV+RE ++ +  ++K R  + +   G+   +V WC+Q  VL HPS+GCF+THCG
Sbjct  295   TGRPFLWVVREKNQEDDKKKKNRFLDLIREDGRGGLVVGWCSQTAVLAHPSVGCFVTHCG  354

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECV  238
             WNSTLESL SGVP+VA P + DQ   AKL++  W++GVRV   EEG V+ DE +RC+E V
Sbjct  355   WNSTLESLESGVPVVAFPQFADQCTTAKLVEATWRIGVRVKEGEEGHVEGDEVRRCLEKV  414

Query  237   MGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             M GGE+ EE+R NA +WK LA  A  + G S LNLK +++E
Sbjct  415   MSGGEEAEEMRENAARWKTLAVDAAAEGGPSDLNLKRFVEE  455



>ref|XP_009108098.1| PREDICTED: UDP-glycosyltransferase 75C1 [Brassica rapa]
Length=454

 Score =   406 bits (1044),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 217/470 (46%), Positives = 298/470 (63%), Gaps = 34/470 (7%)
 Frame = -3

Query  1488  MEGC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLD  1321
             + GC    H L+V FPAQGHINP+L+ A RL++ GA +T +T  SA+ RM   P  +GL 
Sbjct  5     VNGCSHRPHYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPSTEGLS  64

Query  1320  FAPFSDGYDAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMS  1153
             +A FSDG+D G +   D K++ +  K RGSDA++ LI A  +      P T +IY+ ++ 
Sbjct  65    YAWFSDGFDEGPKSFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVP  124

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRD  976
             WA  VAR  H+P TLLW +PATVLDIYY+YF   +  LF      + +++P +P    RD
Sbjct  125   WASTVAREFHLPTTLLWIEPATVLDIYYYYFNASHSHLF----DKEPIKLPKLPPFSTRD  180

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSFL    +NV   L  A+  +R+ IE ++ E NPKVLVNTF  LE DAL ++KK+RM+
Sbjct  181   LPSFL--QPSNV---LPSALVTLREHIEALDSESNPKVLVNTFSELEPDALTSVKKLRMI  235

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTM  619
              +GPL+ S        SD       R +  DY++WLDS+ + SV+Y++ GS+ D +    
Sbjct  236   PVGPLVSS--------SDDGKADLFRSSDEDYIKWLDSKAEKSVIYVSLGSHGDGLWEKH  287

Query  618   LEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL---EAQGKIVRWCAQVEVLQHP  448
             +E +  G++ +  PFLWV++ET    K EEK  C  +L   + +G +V WC+Q  VL HP
Sbjct  288   MEALTSGVLATGRPFLWVVKET----KAEEKKSCFVDLIRGDDKGLVVGWCSQTAVLAHP  343

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLESL +GVP+VA P + DQ   AKL++DVW +GVRV   EEG V  
Sbjct  344   SVGCFVTHCGWNSTLESLENGVPVVAFPQFADQCTTAKLVEDVWGIGVRVKEGEEGHVDG  403

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             DE +RC+E VMG GE  EE+R NA +WK LA  A  + G S LNLK +M+
Sbjct  404   DELRRCLEKVMGDGEDAEEMRRNAARWKTLAVDAAAEGGPSDLNLKGFME  453



>ref|XP_010068983.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW57189.1| hypothetical protein EUGRSUZ_H00004 [Eucalyptus grandis]
Length=465

 Score =   405 bits (1042),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 298/466 (64%), Gaps = 20/466 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LL+ FP++G INP+LQ A+RL + G++VT  T  SA  RM     + G+ FA FSDGY
Sbjct  5     HFLLIAFPSRGAINPALQLAERLTHAGSRVTFFTTVSAHRRMIEPVCLDGVTFATFSDGY  64

Query  1296  DAGLEPADLKD-FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G E  D  D F A +K RGS+A+  LI      G  FT  ++T +  WA  VAR   +
Sbjct  65    DNGYELGDDVDHFMAELKRRGSEALRGLIEYSSGRGLRFTCALHT-MFRWADEVARSFQI  123

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRN-----CSGNQVVEVPGVPALGVRDFPSFLFS  955
                L+W QPATV  IYYHYF  Y D+ ++     C    ++ +PG+P L  RD PSF   
Sbjct  124   QSVLVWIQPATVFGIYYHYFNGYEDVIKSVTSQSCDTTSLIRLPGLPPLTDRDLPSFF--  181

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPK-VLVNTFDALEFDALRAIKKVRMVGIGPLI  778
                N +    + +  M+ Q + +     P  VL+NTFD LE + LRAI  + +VGIGPL+
Sbjct  182   ---NPDNKYAFGLPHMQSQFKQLKEGGKPNMVLLNTFDMLELEVLRAIGTLNLVGIGPLV  238

Query  777   PSAYLDGED--PSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             P  +L+ +D   SD +  GD  Q+S +YV+WL+++ ++SV+Y+AFGS A        EIA
Sbjct  239   PFRFLNAQDRNSSDESSRGDHFQSSKEYVQWLNTKKEASVIYVAFGSIAKFSKAQKLEIA  298

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
              GL+++  PFLWV+R+T      +++L  KEEL+ +G I+ WC+Q+EVL H SIGCF TH
Sbjct  299   HGLLETGRPFLWVVRKTVG---DDDELIYKEELDKRGMIIPWCSQMEVLSHRSIGCFFTH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSA-NEEG-VVKADEYKRC  250
             CGWNSTLESLA G+P+VA P + DQ  N+KL++DVWK+GVRVS  NE+G +VK  E K+C
Sbjct  356   CGWNSTLESLACGIPMVAFPQFTDQMTNSKLVEDVWKVGVRVSEINEDGIIVKGGEIKKC  415

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E VMG GE G+ +R NA+KWK LA  A K+ GSS  NL+A+++E 
Sbjct  416   LELVMGSGETGDGIRRNARKWKNLAMEASKEGGSSDKNLRAFVEEF  461



>emb|CDY27124.1| BnaA08g07620D [Brassica napus]
Length=454

 Score =   405 bits (1041),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/470 (46%), Positives = 298/470 (63%), Gaps = 34/470 (7%)
 Frame = -3

Query  1488  MEGC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLD  1321
             + GC    H L+V FPAQGHINP+L+ A RL++ GA +T +T  SA+ RM   P  +GL 
Sbjct  5     VNGCSHRPHYLIVTFPAQGHINPALKLANRLIHHGATITYATTISALRRMGEPPSTEGLS  64

Query  1320  FAPFSDGYDAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMS  1153
             +A FSDG+D G +   D K++ +  K RGSDA++ LI A  +      P T +IY+ ++ 
Sbjct  65    YAWFSDGFDEGPKSFEDQKNYMSEFKRRGSDALSDLIRANLDGNAAKHPITGVIYSVLVP  124

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRD  976
             WA  VAR  H+P TLLW +PATVLDIYY+YF   +  LF      + +++P +P    RD
Sbjct  125   WASTVAREFHLPATLLWIEPATVLDIYYYYFNASHSHLF----DKEPIKLPKLPPFSTRD  180

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSFL    +NV   L  A+  +R+ IE ++ E NPKVLVNTF  LE DAL +++K+RM+
Sbjct  181   LPSFL--QPSNV---LPSALVTLREHIEALDSESNPKVLVNTFSELEPDALTSVEKLRMI  235

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTM  619
              +GPL+ S        SD       R +  DY++WLDS+ + SV+Y++ GS+ D +    
Sbjct  236   PVGPLVSS--------SDDGKADLFRSSDEDYIKWLDSKAEKSVIYVSLGSHGDGLWEKH  287

Query  618   LEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL---EAQGKIVRWCAQVEVLQHP  448
             +E +  G++ +  PFLWV++ET    K EEK  C  +L   + +G +V WC+Q  VL HP
Sbjct  288   MEALTSGVLATGRPFLWVVKET----KAEEKKSCFVDLIRGDDKGLVVGWCSQTAVLAHP  343

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLESL +GVP+VA P + DQ   AKL++DVW +GVRV   EEG V  
Sbjct  344   SVGCFVTHCGWNSTLESLENGVPVVAFPQFADQCTTAKLVEDVWGIGVRVKEGEEGHVDG  403

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             DE +RC+E VMG GE  EE+R NA +WK LA  A  + G S LNLK +M+
Sbjct  404   DELRRCLEKVMGDGEDAEEMRRNAARWKTLAVDAAAEGGPSDLNLKGFME  453



>ref|XP_002868314.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44573.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   401 bits (1030),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 207/458 (45%), Positives = 295/458 (64%), Gaps = 22/458 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA F+DG+
Sbjct  12    HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  71

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D GL+   D K + + +K  GS+A+  +I A  +   P T +IY+ ++ W   VAR  H+
Sbjct  72    DDGLKSLEDQKIYMSELKRCGSNALRDIIRANLDATEPITGVIYSVLVPWVSTVAREFHL  131

Query  1119  PVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTETN  943
             P TLLW +PATVLDIYY+YF   Y  LF      + +++P +P +   D PSFL  ++  
Sbjct  132   PTTLLWIEPATVLDIYYYYFNASYKHLFHV----EPIKLPKLPLITTEDLPSFLQPSKA-  186

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                 L  A+  +++ IE +  E NPK+LVNTF ALE DAL +++ ++M+ IGPL+ S+  
Sbjct  187   ----LPSALVTLKEHIEALESESNPKILVNTFSALEHDALTSVEILKMIPIGPLVSSSS-  241

Query  762   DGEDPSDTAFGGDLRQNSN-DYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGLVK  589
             DG+         DL ++S+ DY +WLDS+ + SV+Y++ G++AD +P   +E + QG++ 
Sbjct  242   DGKT--------DLFKSSDEDYTKWLDSKLEKSVIYISLGTHADDLPEKHMEALTQGVLA  293

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  PFLW++RE +  EK + +         +G +V WC+Q  VL H ++GCF+THCGWNS
Sbjct  294   TNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGWNS  353

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             TLESL SGVP+VA P + DQ   AKL++D W++GV+V   EEG V  DE +RC+E VM G
Sbjct  354   TLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGGVDGDEIRRCLEKVMSG  413

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             GE+ EE+R NA KWK +A  A  + G S LNLK +++E
Sbjct  414   GEEAEEMRENAAKWKAMAVDAAAEGGPSDLNLKGFVEE  451



>gb|AAL69494.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=466

 Score =   400 bits (1028),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 294/460 (64%), Gaps = 24/460 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA F+DG+
Sbjct  23    HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  82

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMSWAGVVARG  1129
             D GL+   D K + + +K  GS+A+  +I A  +   E  P T +IY+ ++ W   VAR 
Sbjct  83    DDGLKSFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVARE  142

Query  1128  LHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              H+P TLLW +PATVLDIYY+YF T Y  LF      + +++P +P +   D PSFL  +
Sbjct  143   FHLPTTLLWIEPATVLDIYYYYFNTSYKHLF----DVEPIKLPKLPLITTGDLPSFLQPS  198

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             +      L  A+  +R+ IE +  E NPK+LVNTF ALE DAL +++K++M+ IGPL+ S
Sbjct  199   KA-----LPSALVTLREHIEALETESNPKILVNTFSALEHDALTSVEKLKMIPIGPLVSS  253

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGL  595
             +    E  +D       + +  DY +WLDS+ + SV+Y++ G++AD +P   +E +  G+
Sbjct  254   S----EGKTDL-----FKSSDEDYTKWLDSKLERSVIYISLGTHADDLPEKHMEALTHGV  304

Query  594   VKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
             + +  PFLW++RE +  EK + +         +G +V WC+Q  VL H ++GCF+THCGW
Sbjct  305   LATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGW  364

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLESL SGVP+VA P + DQ   AKL++D W++GV+V   EEG V  +E +RC+E VM
Sbjct  365   NSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIRRCLEKVM  424

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
              GGE+ EE+R NA+KWK +A  A  + G S LNLK ++DE
Sbjct  425   SGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGFVDE  464



>emb|CDY12370.1| BnaC08g08350D [Brassica napus]
Length=457

 Score =   400 bits (1027),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 212/470 (45%), Positives = 301/470 (64%), Gaps = 31/470 (7%)
 Frame = -3

Query  1488  MEGC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLD  1321
             + GC    H L+V FPAQGHINP+++ A RL++ GA +T +T  SA+ RM   P  +GL 
Sbjct  5     VNGCSHRPHYLIVTFPAQGHINPAIKLANRLIHHGATITYATTISALRRMGEPPSTEGLS  64

Query  1320  FAPFSDGYDAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMS  1153
             +A FSDG+D G +   D K++ +  K RGSDA++ +I A  +      P T +IY+ ++ 
Sbjct  65    YAWFSDGFDEGPKSFEDQKNYMSEFKRRGSDALSDIIRANLDGNAATEPITGVIYSVLVP  124

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRD  976
             WA  VAR  H+P TLLW +PATVLDIYY+YF   +  LF      + +++  +P L  RD
Sbjct  125   WASTVAREFHLPATLLWIEPATVLDIYYYYFNASHSHLF----DTEPIKLQKLPPLSTRD  180

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSFL    +NV   L  A+  +R+ IE ++ E NPKVLVNTF  LE +AL +++K+RM+
Sbjct  181   LPSFL--QPSNV---LPSALVTLREHIEALDSESNPKVLVNTFTELEPEALTSVEKLRMI  235

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTM  619
              +GPL+ S+     D S T      R +  DY++WLDS+ + SV+Y++ GS+ D +    
Sbjct  236   PVGPLVSSS-----DDSSTGKADLFRSSDEDYIKWLDSKAEKSVIYVSLGSHGDGLWEKH  290

Query  618   LEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL---EAQGKIVRWCAQVEVLQHP  448
             +E + +G++ +  PFLWV++ET    K EEK  C  +L   + +G +V WC+Q  VL HP
Sbjct  291   MEALTRGVLATGRPFLWVVKET----KAEEKKSCFVDLIRGDDKGLVVGWCSQTAVLAHP  346

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLESL +GVP+VA P + DQ   AKL++DVW +GVRV   +EG V  
Sbjct  347   SVGCFVTHCGWNSTLESLENGVPVVAFPQFADQCTTAKLVEDVWGIGVRVKEGDEGHVDG  406

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             DE + C+E VMGGGE  +E+R NA +WK LA  A  + G S LNLK +M+
Sbjct  407   DELRWCLEKVMGGGEDADEMRRNAARWKTLAVDAAAEGGPSDLNLKGFME  456



>ref|NP_193146.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 sp|Q0WW21.2|U75C1_ARATH RecName: Full=UDP-glycosyltransferase 75C1; AltName: Full=Anthocyanin 
5-O-glucosyltransferase; AltName: Full=UDP glucose:anthocyanin 
5-O-glucosyltransferase [Arabidopsis thaliana]
 emb|CAB10189.1| glucosyltransferase like protein [Arabidopsis thaliana]
 emb|CAB78452.1| glucosyltransferase like protein [Arabidopsis thaliana]
 gb|AAL32667.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM47973.1| glucosyltransferase [Arabidopsis thaliana]
 gb|AAM91686.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AEE83370.1| anthocyanin 5-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38699.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score =   399 bits (1026),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 294/460 (64%), Gaps = 24/460 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA F+DG+
Sbjct  13    HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  72

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMSWAGVVARG  1129
             D GL+   D K + + +K  GS+A+  +I A  +   E  P T +IY+ ++ W   VAR 
Sbjct  73    DDGLKSFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVARE  132

Query  1128  LHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              H+P TLLW +PATVLDIYY+YF T Y  LF      + +++P +P +   D PSFL  +
Sbjct  133   FHLPTTLLWIEPATVLDIYYYYFNTSYKHLF----DVEPIKLPKLPLITTGDLPSFLQPS  188

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             +      L  A+  +R+ IE +  E NPK+LVNTF ALE DAL +++K++M+ IGPL+ S
Sbjct  189   KA-----LPSALVTLREHIEALETESNPKILVNTFSALEHDALTSVEKLKMIPIGPLVSS  243

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGL  595
             +    E  +D       + +  DY +WLDS+ + SV+Y++ G++AD +P   +E +  G+
Sbjct  244   S----EGKTDL-----FKSSDEDYTKWLDSKLERSVIYISLGTHADDLPEKHMEALTHGV  294

Query  594   VKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
             + +  PFLW++RE +  EK + +         +G +V WC+Q  VL H ++GCF+THCGW
Sbjct  295   LATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGW  354

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLESL SGVP+VA P + DQ   AKL++D W++GV+V   EEG V  +E +RC+E VM
Sbjct  355   NSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIRRCLEKVM  414

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
              GGE+ EE+R NA+KWK +A  A  + G S LNLK ++DE
Sbjct  415   SGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGFVDE  454



>gb|EYU27003.1| hypothetical protein MIMGU_mgv1a024986mg [Erythranthe guttata]
Length=450

 Score =   397 bits (1021),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 230/469 (49%), Positives = 310/469 (66%), Gaps = 38/469 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPE--IQGLDFAPFSD  1303
             HVLLV FPAQGHI+PS QFAKR   +G KVT +T   A  RMS       +G+ FA FS 
Sbjct  4     HVLLVTFPAQGHISPSFQFAKRPTAMGIKVTFATSLYARRRMSRTAAGLPKGVTFAAFSG  63

Query  1302  GYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             GYD G              ++GS ++   I A  ++ RP T+L+YT ++ WA  VAR  H
Sbjct  64    GYDDG--------------SKGSQSLRDTILAAADQDRPVTQLVYTLLLPWAPEVAREFH  109

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGV--RDFPSFLFS  955
             VP  LLW QPATVL IYY+YF  YGD     S +    ++ PG+PAL    RD PSF+  
Sbjct  110   VPSALLWIQPATVLIIYYYYFNGYGDEIATNSDDTTWQIQSPGIPALNFAKRDLPSFVLP  169

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEE-NPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
             + ++      +A+ + ++ +E ++ E+  PKVLVN FDALE  AL++I K   +G+GPLI
Sbjct  170   SSSD---KYSFALPSFKEPLETLDAEKMKPKVLVNIFDALEPHALKSIDKYEPIGVGPLI  226

Query  777   PSAYLDGEDPSDTAFGGDLRQNSND-YVE-WLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
              SA      PSD +FGGDL + S+D  VE WL+S+P+SSVVY++FG+   +P   +EEIA
Sbjct  227   TSA------PSDKSFGGDLFEKSDDNSVELWLNSKPESSVVYVSFGNILKLPKAQMEEIA  280

Query  603   QGLVKSKMPFLWVLR----ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             +G+++S+ PFLWV+R    + ++ E+ EEKL C  ELE  GKIV WC+Q++VL HPSIGC
Sbjct  281   KGILESERPFLWVIRINEDKKNEEEEEEEKLSCLYELEKIGKIVPWCSQLDVLTHPSIGC  340

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWK--LGVRVSANEEGVVKADE  262
             F++HCGWN TLESL+SGV +VA P W DQ  NAKLI+DVWK  + VR     +GVV++ E
Sbjct  341   FVSHCGWNLTLESLSSGVLVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGGDGVVESGE  400

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
              KRCIE VM GG K  ELR NA++WK LA+  M ++GSS+ NLKA++++
Sbjct  401   IKRCIEEVMDGGGKSWELRANAREWKSLAREDMDENGSSFNNLKAFLED  449



>dbj|BAF49285.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   397 bits (1021),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 204/467 (44%), Positives = 293/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H+LLV+FPAQGHI+P+LQ A +LV  G ++T  T   A  RMS    I GL+F  F
Sbjct  1     MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTNISGLNFVYF  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
                     E    KD+   ++  GS  +  +I +    G P +R++YT+++ WA  +AR 
Sbjct  61    P-------EVTKGKDYMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLPWAADIARE  113

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLFS  955
              H+P  LLWTQP T L  +++YF  Y D+ +N     N  +++P +P L  RD  SFL  
Sbjct  114   SHIPSILLWTQPVTTLVTFHYYFNGYEDVIKNICNHENSTLQLPRLPLLSRRDLHSFLLP  173

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             +           +   +D ++ ++ +ENP VLVN+F+ALE +AL+AI K +MVG+GPL+P
Sbjct  174   SNP-----YKGVLRTFKDHLDALDMDENPTVLVNSFNALEEEALKAITKYKMVGVGPLVP  228

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             S+  + ++ S+ +   +L Q S D   WLDS+P  S++Y++FGSY     T ++EIA+GL
Sbjct  229   SSIFNTKNNSEDSLSSNLWQKSIDCTGWLDSKPHGSIIYVSFGSYVKQSMTQMKEIAKGL  288

Query  594   VKSKMPFLWVLR----ETSKGEKPEEKL--RCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             + S   FLWV+     ET K ++   ++     EELE +G IV WCAQ+EVL+HPSIGCF
Sbjct  289   LASGKAFLWVITSNNDETVKNQEDGIEILNNMMEELEEKGMIVPWCAQLEVLKHPSIGCF  348

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             LTHCGWNSTLES+  GVP+V  P   DQ   +KL+ DVWK+GVRV  NE+G+V  +E K+
Sbjct  349   LTHCGWNSTLESMVCGVPMVCFPKMFDQGTISKLVVDVWKVGVRVDENEDGIVCQEEIKK  408

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             CI+ VM GG+  +EL  NA+KW  L K A+ + GSSY NLKA+++E+
Sbjct  409   CIDHVMDGGKFAQELGENARKWMSLGKEAVLEGGSSYYNLKAFVEEI  455



>dbj|BAE98677.1| glucosyltransferase like protein [Arabidopsis thaliana]
Length=456

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 293/460 (64%), Gaps = 24/460 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA F+DG+
Sbjct  13    HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGF  72

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKE---EGRPFTRLIYTSIMSWAGVVARG  1129
             D GL+   D K + + +K  GS+A+  +I A  +   E  P T +IY+ ++ W   VAR 
Sbjct  73    DDGLKSFEDQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVARE  132

Query  1128  LHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
              H+P TLLW +PATVLDIYY+YF T Y  LF      + +++P +P +   D PSFL  +
Sbjct  133   FHLPTTLLWIEPATVLDIYYYYFNTSYKHLF----DVEPIKLPKLPLITTGDLPSFLQPS  188

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
             +      L  A+  +R+ IE +  E NPK+LVNTF ALE DAL +++K++M+ IGPL+ S
Sbjct  189   KA-----LPSALVTLREHIEALETESNPKILVNTFSALEHDALTSVEKLKMIPIGPLVSS  243

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGL  595
             +    E  +D       + +  DY +WLDS+ + SV+Y++ G++ D +P   +E +  G+
Sbjct  244   S----EGKTDL-----FKSSDEDYTKWLDSKLERSVIYISLGTHDDDLPEKHMEALTHGV  294

Query  594   VKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGW  415
             + +  PFLW++RE +  EK + +         +G +V WC+Q  VL H ++GCF+THCGW
Sbjct  295   LATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGW  354

Query  414   NSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVM  235
             NSTLESL SGVP+VA P + DQ   AKL++D W++GV+V   EEG V  +E +RC+E VM
Sbjct  355   NSTLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEEGDVDGEEIRRCLEKVM  414

Query  234   GGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
              GGE+ EE+R NA+KWK +A  A  + G S LNLK ++DE
Sbjct  415   SGGEEAEEMRENAEKWKAMAVDAAAEGGPSDLNLKGFVDE  454



>dbj|BAF49286.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
 dbj|BAF49287.1| anthocyanin 5-O-glucosyltransferase [Eustoma grandiflorum]
Length=463

 Score =   395 bits (1016),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 203/467 (43%), Positives = 293/467 (63%), Gaps = 20/467 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H+LLV+FPAQGHI+P+LQ A +LV  G ++T  T   A  RMS    I GL+F  F
Sbjct  1     MSTPHILLVVFPAQGHISPALQLAMKLVAQGIQLTFLTSSFAEARMSKPTNISGLNFVYF  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
                     E    KD+   ++  GS  +  +I +    G P +R++YT+++ WA  +AR 
Sbjct  61    P-------EVTKGKDYMFELRKHGSQTLKDIILSSINVGLPISRILYTTLLPWAADIARE  113

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPALGVRDFPSFLFS  955
              H+P  LLWTQP T L  +++YF  Y D+ +N     N  +++P +P L  RD  SFL  
Sbjct  114   SHIPSILLWTQPVTTLVTFHYYFNGYEDVIKNICNHENSTLQLPRLPLLSRRDLHSFLLP  173

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             +           +   +D ++ ++ +ENP VLVN+F+ALE +AL+AI K +MVG+GPL+P
Sbjct  174   SNP-----YKGVLRTFKDHLDALDMDENPTVLVNSFNALEEEALKAITKYKMVGVGPLVP  228

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             S+  + ++ S+ +   +L Q S D   WLDS+P  S++Y++FGS+     T ++EIA+GL
Sbjct  229   SSIFNTKNNSEDSLSSNLWQKSIDCTGWLDSKPHGSIIYVSFGSHVKQSMTQMKEIAKGL  288

Query  594   VKSKMPFLWVLR----ETSKGEKPEEKL--RCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             + S   FLWV+     ET K ++   ++     EELE +G IV WCAQ+EVL+HPSIGCF
Sbjct  289   LASGKAFLWVITSNNDETVKNQEDGIEILNNMMEELEEKGMIVPWCAQLEVLKHPSIGCF  348

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             LTHCGWNSTLES+  GVP+V  P   DQ   +KL+ DVWK+GVRV  NE+G+V  +E K+
Sbjct  349   LTHCGWNSTLESMVCGVPMVCFPKMFDQGTISKLVVDVWKVGVRVDENEDGIVCQEEIKK  408

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             CI+ VM GG+  +EL  NA+KW  L K A+ + GSSY NLKA+++E+
Sbjct  409   CIDHVMDGGKFAQELGENARKWMSLGKEAVLEGGSSYYNLKAFVEEI  455



>gb|KCW76863.1| hypothetical protein EUGRSUZ_D01218 [Eucalyptus grandis]
Length=430

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 303/467 (65%), Gaps = 50/467 (11%)
 Frame = -3

Query  1506  FHHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQ  1330
             F     M   H LLV FP+QGHINPSLQFAKRLV +GA VT +T   A +RM+ S+    
Sbjct  5     FVQASSMAPPHFLLVTFPSQGHINPSLQFAKRLVRVGAHVTFATAIHAHHRMAESKSPPV  64

Query  1329  GLDFAPFSDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSW  1150
             GL FA FSDGYD G++  DL  +   +K +GS+ ++ LI +  E GR F  + YT+++ W
Sbjct  65    GLSFASFSDGYDDGIDKDDLDGYMDELKRQGSETLSNLIASNLENGRRFLGVFYTTLLPW  124

Query  1149  AGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV--EVPGVPALGVRD  976
                VAR   +P TL+W QPATVLD YY+YF  YGDL ++ S N  V  ++PG+P L   D
Sbjct  125   VADVARSHGIPSTLVWIQPATVLDFYYYYFHGYGDLIQSTSDNPSVPIQLPGLPPLMACD  184

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSF  +++   N+ L +    ++   E +  E  P++L NTFDALE DA+RAI K  ++
Sbjct  185   IPSFC-NSKNVYNFSLPF----LQRHFEILLEEAKPRILTNTFDALEPDAIRAIDKFEVI  239

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTML  616
             GIGPLIPSA+LDG+DPSDT+FGGDL ++S+ Y+EWLD++PK+SV+YL+FGS + +     
Sbjct  240   GIGPLIPSAFLDGQDPSDTSFGGDLFKSSSGYMEWLDTKPKASVIYLSFGSISVLSKPQK  299

Query  615   EEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGC  436
             EE+A+ L                                          VEVL HPS+GC
Sbjct  300   EEMARAL------------------------------------------VEVLSHPSVGC  317

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNST ESL  GVP+VA P W+DQ  NAKL+ DVW+ GV+++ NE G+V++ E K
Sbjct  318   FVTHCGWNSTSESLVCGVPMVAFPQWSDQLTNAKLVADVWRTGVKMTPNELGLVESGEMK  377

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             RC+E V+G GE+GEE+R NA+K+++LA+ A+K+ GSS  NL+A++DE
Sbjct  378   RCLELVVGDGEEGEEMRRNARKFRDLAREAVKEGGSSDKNLRAFVDE  424



>ref|XP_011069457.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like, 
partial [Sesamum indicum]
Length=372

 Score =   390 bits (1002),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/375 (52%), Positives = 262/375 (70%), Gaps = 14/375 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM---SSRPEIQGLDF  1318
             M   HVLLV FPAQGHINPSLQFAKRL+++G +VT +T   A  RM   ++R   +GL F
Sbjct  1     MSRRHVLLVTFPAQGHINPSLQFAKRLIDMGIEVTFATSLYARRRMEKTAARDLPKGLSF  60

Query  1317  APFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             A FSDGYD G   +D  + +   +++RG+  +     +  E+GRP T LIYT ++ WA  
Sbjct  61    AAFSDGYDDGFTMSDDPRKYMTEIRSRGAKTLKDTALSAAEQGRPVTCLIYTLLLPWASE  120

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPAL-GVRDFP  970
             VAR +++P  LLW QPATVLDIYY+YF  Y D     S +    +++PG+P L   RD P
Sbjct  121   VAREVNIPSALLWIQPATVLDIYYYYFNGYADEIIASSNDPSWKLQLPGLPILLSKRDLP  180

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SF+     N +    +A+   ++Q+E ++ E  PKVLVNTFD+LE +AL+AI K  ++G+
Sbjct  181   SFMLP---NCSERYSFALTTFKEQLEALDVETKPKVLVNTFDSLESNALKAIDKYELIGV  237

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIPSA+L G+DPSDT+FGGDL Q S+DY+EWL+S+P+SSVVY++FGS   +P   +EE
Sbjct  238   GPLIPSAFLGGKDPSDTSFGGDLFQKSDDYIEWLNSKPESSVVYVSFGSLLRLPKAQMEE  297

Query  609   IAQGLVKSKMPFLWVLRETSKG--EKPE--EKLRCKEELEAQGKIVRWCAQVEVLQHPSI  442
             IA+GL+ S  PFLWV+R+  K   EK E  E+L C EELE  G+IV WC+Q+EVL HPS+
Sbjct  298   IAKGLLDSSRPFLWVIRDNEKANEEKKEDDERLSCMEELEKVGRIVPWCSQLEVLTHPSL  357

Query  441   GCFLTHCGWNSTLES  397
             GCF+THCGWNSTLES
Sbjct  358   GCFVTHCGWNSTLES  372



>ref|XP_010096066.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXC42235.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 222/488 (45%), Positives = 294/488 (60%), Gaps = 47/488 (10%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSR------------PEIQG  1327
             LLV+FPA GH+NP+LQ A+RLV +G +VT  T   A  RM ++                G
Sbjct  7     LLVVFPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNNFTPPNG  66

Query  1326  LDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS  1153
             + F  FSDGYD G  P   D   +   +++RGS A+  L+ + K EGRP+T +IYT IM 
Sbjct  67    MSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMIYTFIMP  126

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPA-LG  985
             W   VA  L +PV L   Q ATV D+ Y+YF  YGDL R+   N +   +  PG+P    
Sbjct  127   WVADVAAKLGIPVALFCVQTATVFDLCYYYFHGYGDLIRDKMVNDISCSLGFPGLPLDFA  186

Query  984   VRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI---  814
             VRD PSFL ++++     L   ++  ++Q + I  E  PK+LVNTFDALE +ALRA+   
Sbjct  187   VRDLPSFLDASDSK----LGSLVQLFQEQFDVIGQESQPKILVNTFDALEPEALRALCDN  242

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
              K+ ++GIGP I    L   D  +               +WL+S+PK SV+Y++FGS A 
Sbjct  243   YKLNLIGIGPSINPVELRNSDDKNYKIS-----------KWLNSKPKGSVIYVSFGSIAV  291

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEE-------KLRCKEELEAQGKIVRWC  475
             +    +EEIA+GL+    PFLWV+RE     K E        K+  KEELE  GKIV WC
Sbjct  292   LTKPQMEEIAKGLLDFGRPFLWVIRENDNKNKDERGGGEEEEKVSFKEELEKVGKIVPWC  351

Query  474   AQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS  295
              QVEVL + ++GCF+THCGWNSTLESL  GVP+VA P   DQ  NAKLI+D WK GV+V 
Sbjct  352   CQVEVLSNNALGCFVTHCGWNSTLESLVCGVPVVAFPQSVDQLTNAKLIEDFWKTGVKVK  411

Query  294   ANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             ANEEG+V+  E KRC+E VMG    GEE+R NA+KW++LA  A KD GSS  NLKA++ +
Sbjct  412   ANEEGIVEGQEIKRCLESVMG----GEEMRRNAQKWRDLAWEASKDGGSSDTNLKAFVSD  467

Query  114   MLSSP*IS  91
             ++    IS
Sbjct  468   VIGLKTIS  475



>ref|XP_006282890.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
 gb|EOA15788.1| hypothetical protein CARUB_v10007134mg [Capsella rubella]
Length=456

 Score =   389 bits (999),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 296/461 (64%), Gaps = 21/461 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA F+DG+
Sbjct  13    HYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFAWFTDGF  72

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAK-KEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             D GL+   D K + + +K  GS+A+  +I A    +  P T +IY+ ++ W   VAR  H
Sbjct  73    DDGLKSFEDQKIYTSELKRCGSNALRDIIRANLDSKTEPITGVIYSVLVPWVSSVAREFH  132

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTETN  943
             +P TLLW +PATVLDIYY+YF      F++      +++P +P +   D PSFL   +  
Sbjct  133   LPTTLLWIEPATVLDIYYYYFNTS---FKHLFDVNPIKLPKLPLITTEDLPSFLQPFKA-  188

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                 +  A+  +++ +E +  E NPK+LVNTF ALE DAL +++K+ M+ IGPL+ S+  
Sbjct  189   ----IPSALVTLKEHVEALESESNPKILVNTFSALEHDALTSVEKLNMIPIGPLVSSSS-  243

Query  762   DGEDPSDTAFGGDLRQNSN-DYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGLVK  589
             DG+         DL ++S+ DY +WLDS+ ++SV+Y++ G++AD +P   +E +  G++ 
Sbjct  244   DGKT--------DLFKSSDVDYTKWLDSKLENSVIYISLGTHADDLPEKHMEALTHGVLA  295

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  P+LW++RE +  EK + +       E +G +V WC+Q  VL H S+GCF+THCGWNS
Sbjct  296   TNRPYLWIVREKNPEEKKKNRFLELIRGEGRGLVVGWCSQTAVLGHRSVGCFVTHCGWNS  355

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             TLESL SGVP+VA P + DQ   AKL++D W++GV+V   E+G V  +E +RC+E VMG 
Sbjct  356   TLESLESGVPVVAFPQFADQCTTAKLVEDTWRIGVKVKVGEDGEVDGEEVRRCLEKVMGD  415

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             GE+ EE+R +A KWK+L   A  + G S LNLK +++E +S
Sbjct  416   GEEAEEMRESAAKWKKLMVDAAVEGGPSDLNLKGFVEEDVS  456



>ref|XP_010103920.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
 gb|EXB97437.1| UDP-glycosyltransferase 75D1 [Morus notabilis]
Length=475

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 221/488 (45%), Positives = 293/488 (60%), Gaps = 47/488 (10%)
 Frame = -3

Query  1470  LLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSR------------PEIQG  1327
             LLV+ PA GH+NP+LQ A+RLV +G +VT  T   A  RM ++                G
Sbjct  7     LLVVLPAHGHVNPALQLARRLVLIGCEVTFVTTVRAHRRMITKGGGTDDNNDNNFTPPNG  66

Query  1326  LDFAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS  1153
             + F  FSDGYD G  P   D   +   +++RGS A+  L+ + K EGRP+T +IYT IM 
Sbjct  67    MSFTQFSDGYDDGFGPKAIDFTVYSLELRSRGSQALIDLVDSSKNEGRPYTCMIYTFIMP  126

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPA-LG  985
             W   VA  L +PV L + Q ATV D+ Y+YF  YGDL R+   N     +  PG+P    
Sbjct  127   WVADVAAKLGIPVALFYVQTATVFDLCYYYFHGYGDLIRDKMVNDRSCSLGFPGLPLDFA  186

Query  984   VRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI---  814
             VRD PSFL ++++     L   ++  ++Q + I  E  PK+LVNTFDALE +ALRA+   
Sbjct  187   VRDLPSFLDASDSK----LGSLVQLFQEQFDVIGQESQPKILVNTFDALEPEALRALCDN  242

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
              K+ ++GIGP I    L   D  +               +WL+S+PK SV+Y++FGS A 
Sbjct  243   YKLNLIGIGPSINPVELRNSDDKNYKIS-----------KWLNSKPKGSVIYVSFGSIAV  291

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEE-------KLRCKEELEAQGKIVRWC  475
             +    +EEIA+GL+    PFLWV+RE     K E        K+  KEELE  GKIV WC
Sbjct  292   LTKPQMEEIAKGLLDFGRPFLWVIRENDNKNKDERGGGEEEEKVSFKEELEKVGKIVPWC  351

Query  474   AQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS  295
              QVEVL + ++GCF+THCGWNSTLESL  GVP+VA P   DQ  NAKLI+D WK GV+V 
Sbjct  352   CQVEVLSNNALGCFVTHCGWNSTLESLVCGVPVVAFPQSVDQLTNAKLIEDFWKTGVKVK  411

Query  294   ANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             ANEEG+V+  E KRC+E VMG    GEE+R NA+KW++LA  A KD GSS  NLKA++ +
Sbjct  412   ANEEGIVEGQEIKRCLESVMG----GEEMRRNAQKWRDLAWEASKDGGSSDTNLKAFVSD  467

Query  114   MLSSP*IS  91
             ++    IS
Sbjct  468   VIGLKTIS  475



>ref|XP_009778639.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=465

 Score =   389 bits (998),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/470 (43%), Positives = 289/470 (61%), Gaps = 20/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H L++  PAQGHINP+LQ AK L   GA+ T  T    + RM++ P  + L ++ F
Sbjct  1     MKQHHFLVISLPAQGHINPTLQMAKNLARAGARATFVTTVYGLKRMNNLPTQERLFYSSF  60

Query  1308  SDGYDAG-LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD   +   D  D+  ++K  GS  +  L+    +EG P T L+YT ++ W  VVAR
Sbjct  61    SDGYDDDWISNTDHNDYMNNLKYEGSKNLKNLLRKFSDEGHPVTFLVYTILLPWVAVVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV------EVPGVPALGVRDFP  970
              LHVP   L  Q  T   IY H F     ++ +   +  V      E P +P     D P
Sbjct  121   ELHVPSAFLVIQCGTAFAIYNHLFNSINGVYSSSVSDITVTPSFAIEFPELPLFSSNDIP  180

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             + +     + +      I  MR+ I+++  + N  VL+N+FDALE  ++R + K+R+  +
Sbjct  181   TIVLPNAPHSSV----MIPIMREHIQNLEKDPNSCVLINSFDALEEKSMRIVDKLRIFSV  236

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQN-SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPL+PSA+ DG DP D +FG +L +N   +Y +WLDS+P+ SV+Y++FGS A +     E
Sbjct  237   GPLVPSAFSDGNDPKDKSFGCELFENREKNYRQWLDSKPEGSVIYVSFGSIAVLEKEQKE  296

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEE-----LEAQGKIVRWCAQVEVLQHP  448
             EI  GL++S+ PFLWV+R+    E+ EE    K E     L  +G I+ WCAQ+EVL H 
Sbjct  297   EILHGLLESERPFLWVMRKGK--EEVEEGNNYKNEFDDILLNKKGIIIPWCAQMEVLFHK  354

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLES+ +GVP+V CP ++DQ  NAK++++VW  GVR +A  EGVV  
Sbjct  355   SVGCFVTHCGWNSTLESMVAGVPIVGCPQFSDQTTNAKMVEEVWGTGVRANA-VEGVVGR  413

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             +E KRC+E +MG GEKGEE++ N KKW++LA  A+K  GSSY NLK +++
Sbjct  414   EELKRCLEILMGNGEKGEEIKRNVKKWRDLAVEAVKVGGSSYDNLKKFLE  463



>ref|XP_010040348.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45291.1| hypothetical protein EUGRSUZ_L01047 [Eucalyptus grandis]
Length=468

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 297/474 (63%), Gaps = 20/474 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   + L+V F  Q HINP+ Q A RL+  GA VT +T  +A   MS       L FA +
Sbjct  1     MANPNFLIVAFAGQSHINPAFQLAGRLLRTGASVTFTTTTTAHRSMSGIQASDRLTFATY  60

Query  1308  SDGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDG + G  L    L+        R S+AV ++I A + +G  FT + YT++  W G VA
Sbjct  61    SDGAEEGPKLSNFSLEQHMEDSARRCSEAVRQIIEASRGKGENFTCIFYTAVAPWVGEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFL  961
             R   +P  +LW QPAT+ +IYY+Y   YGD   N S +     ++PG+P L  RD P+FL
Sbjct  121   RCYDIPSGVLWIQPATLFEIYYYYINGYGDSITNESNDPSSPTQLPGLPPLTGRDVPTFL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                         +    +  +I+ + G+   ++LVN+FDALE + L AI +++MV +GPL
Sbjct  181   -----TPGSPFRFLFTLIEKEIQSLKGDRKARLLVNSFDALESEQLNAIDELKMVAVGPL  235

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +PS  L+G   S  + GGDL   S DY+EWLD+QP +SVVY++FGS + +     EE+A+
Sbjct  236   LPS--LEGRGSSGASPGGDLFLGSRDYIEWLDTQPAASVVYISFGSISALSKPQKEEMAR  293

Query  600   GLVKSKMPFLWVLRET---------SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             GL+ +  PFLWV+++           K E+ E++L C EEL+ QG IV WC+QVEVL HP
Sbjct  294   GLLSTGRPFLWVIKKALIMDGGDGDGKQEESEDQLSCMEELQKQGMIVPWCSQVEVLSHP  353

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGWNSTLES+  GVP+VA PLW DQ  NA LIQDVWK+GVRVS NE GVV+ 
Sbjct  354   SVGCFVTHCGWNSTLESVVCGVPMVAFPLWADQLANAMLIQDVWKVGVRVSGNERGVVEG  413

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             +E  RC+E V+GGGE+ E +R NAK+ K+ A+ A K+ G +  NLKA ++E++S
Sbjct  414   EELTRCLEMVLGGGERSEGMRGNAKRLKDAAREAGKEGGCADKNLKALLEELVS  467



>ref|XP_006418014.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
 dbj|BAJ33712.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36367.1| hypothetical protein EUTSA_v10007593mg [Eutrema salsugineum]
Length=456

 Score =   387 bits (995),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 297/473 (63%), Gaps = 37/473 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDF  1318
             M   H LLV FPAQGH+NPSL+FA+RL+   GA+VT +T  S  +R  +S++ ++  L F
Sbjct  1     MAPLHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVFHRSMISTQSDLNNLSF  60

Query  1317  APFSDGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
               FSDG+D G      D ++   ++K  G   ++  I A ++   P T L+YT +++WA 
Sbjct  61    LTFSDGFDDGGVSTAEDRENRSVNLKINGDKTLSDFIEANRDGDSPVTCLVYTILLNWAP  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR   +P  LLW QPA V DIYY +F            N   E+  +P+L  RD PSF
Sbjct  121   KVARRFQLPSALLWIQPALVFDIYYDHFN---------GKNSGFELRNLPSLANRDLPSF  171

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  T+TN+  +++ A + +   +E +  E NPK+LVNTFD+LE +AL AI  + MV +GP
Sbjct  172   LTPTDTNMYKNVNAAFQEL---MEFLKEESNPKILVNTFDSLEPEALTAIPNIGMVAVGP  228

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             L+P          D   G +  +  + Y  WLDS+ +SSV+Y++FG+  ++    +EE+A
Sbjct  229   LLPP---------DIFTGSESVKELSSYKLWLDSKTESSVIYVSFGTMVELSKKQIEELA  279

Query  603   QGLVKSKMPFLWVLRETS------KGEKPEEKLRCKE---ELEAQGKIVRWCAQVEVLQH  451
             + L++ K PFLWV+ + S      +GE   E  +  E   ELE  G IV WC+QVEVL+H
Sbjct  280   RALIEWKRPFLWVITDKSNREAKTEGEDETEIEKIAEFRHELEDVGMIVSWCSQVEVLRH  339

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
              ++GCF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL++D WK GVRV  NEEG+V+
Sbjct  340   RAVGCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEDSWKTGVRVRENEEGLVE  399

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
               E +RC+E VM  GEK EELR NA+KWK LA  A ++ GSS  N++A++DE+
Sbjct  400   RGEIRRCLEAVM--GEKAEELRENAEKWKRLAVEAGREGGSSDKNMEAFVDEI  450



>ref|XP_006307449.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
 gb|EOA40347.1| hypothetical protein CARUB_v10009073mg [Capsella rubella]
Length=462

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/470 (45%), Positives = 293/470 (62%), Gaps = 36/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVN-LGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL FA+RL+   GA+VT  T  S   R  MS+   ++ L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLHFARRLIKKTGARVTFVTCLSFFQRSMMSNHNNVENLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++K  G  A++  I A +    P T LIYT +++WA  VAR
Sbjct  65    DGFDDGGISTSEDSQKRSVNLKVNGDKALSDFIKASRNGDSPVTCLIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFS  955
                +P  LLW QPA V DIYY+YFT          GN+   E+P + +L VRD PSFL  
Sbjct  125   RFQLPCALLWIQPALVFDIYYNYFT----------GNKSAFELPNLSSLEVRDLPSFLTP  174

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             + T+++     A  A ++ +E +  E NPKVL+NTFD+LE +AL A   ++MV +GPL+P
Sbjct  175   SNTHIS-----AYAAFQEMMEFLKEETNPKVLINTFDSLEPEALTAYPHIQMVAVGPLLP  229

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             +    G         G     S+DY  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L
Sbjct  230   TEMFSGSTKQPVKDQG----TSSDYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARAL  285

Query  594   VKSKMPFLWVLRET------SKGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSI  442
             ++ K PFLWV+ E       ++GE   E  +    ++ELE  G IV WC+QVEVL+H ++
Sbjct  286   IEGKRPFLWVITEKPNRQAKTEGEDETEVEKIAGFRDELEKVGMIVSWCSQVEVLRHRAV  345

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL+ + W+ GVRV  N EGVV++ E
Sbjct  346   GCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLDESWRTGVRVRENSEGVVESGE  405

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +RC+E VM   EK +ELR NA+KWK LA  A  + GSS  N++A+++E+
Sbjct  406   IRRCLEAVM--EEKSDELRENAEKWKRLAIEAGGEGGSSDKNVEAFVEEI  453



>ref|XP_010522273.1| PREDICTED: UDP-glycosyltransferase 75B2-like [Tarenaya hassleriana]
Length=548

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 210/481 (44%), Positives = 298/481 (62%), Gaps = 38/481 (8%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEI-QGLDF  1318
             +M   H+L+V FPA+GHINPSL F+ RL+   GA+VT +T  SA  R    P     L F
Sbjct  59    KMPQPHILIVTFPARGHINPSLHFSGRLIRTTGARVTFATCVSAFRRSMIPPAAADSLSF  118

Query  1317  APFSDGYDAGLEPADLKDF----WAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS  1153
               FSDG+D G   +   D+    W   ++  G+  ++  I + +    P T L+YT +++
Sbjct  119   LSFSDGFDDGHVSSTSSDYDHDQWMDRIRVDGTKTLSDFIESNRRGESPVTCLVYTLLLT  178

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLF-RNCSGNQVVEVPGVPALGVRD  976
             WA  VAR  H+P +LLW QPA V DIYY+YF  Y ++  +  + +  VE+P +P L  RD
Sbjct  179   WAPAVARRFHIPSSLLWIQPALVFDIYYYYFNGYAEVVSKALARSDPVELPKLPLLAARD  238

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              PSFL  T +N+     +A  A +DQI+ +  + NPK+LVNT DALE +ALRAI  + MV
Sbjct  239   LPSFL--TPSNM---YKYACAAFQDQIDRLREDPNPKILVNTCDALEREALRAIPNLEMV  293

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNT  622
              +GPL+P     G   ++  F GD  ++S D  Y  WLDS+P SSV+Y++FG+ A +P  
Sbjct  294   AVGPLLPMEIFPG---NNNRFSGDSIRDSEDHGYTLWLDSKPDSSVIYVSFGTLAVLPKK  350

Query  621   MLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRC-------------KEELEAQGKIVR  481
              ++E+A+ L+++K PFLWV+      +KP ++                ++ELE  G +V 
Sbjct  351   QMQELAKALIETKRPFLWVI-----TDKPNKRANEEEEGEEIGNIADFRQELEEIGMVVT  405

Query  480   WCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVR  301
             WC+Q +VL+H S+GCFLTHCGWNSTLESL  GVP+VA P W DQ  NAKL++D WK GVR
Sbjct  406   WCSQTQVLKHKSVGCFLTHCGWNSTLESLVLGVPVVAFPQWTDQPTNAKLLEDWWKTGVR  465

Query  300   VSANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             V  NEEG+V++ E +RC+E  M   +K EELR NA KW++LA  A  + GSS  N+ A++
Sbjct  466   VKENEEGLVESGEIRRCLEAAM--EDKAEELRRNAGKWRDLAAEAGGEGGSSDTNIAAFV  523

Query  120   D  118
             +
Sbjct  524   E  524



>ref|XP_002305226.2| hypothetical protein POPTR_0004s08200g [Populus trichocarpa]
 gb|EEE85737.2| hypothetical protein POPTR_0004s08200g [Populus trichocarpa]
Length=496

 Score =   387 bits (995),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/468 (43%), Positives = 296/468 (63%), Gaps = 14/468 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGA-KVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             ME  H LL+  P QGH+NP LQ AK L   GA +VT +T    + ++ + P + GL FA 
Sbjct  1     MENKHFLLITCPFQGHLNPMLQLAKNLRQAGAARVTFATTVHGLTQIKTFPSLDGLYFAS  60

Query  1311  FSDGYDAGLE-PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G++   + +D  + +K  GS  + KLI    +   P + LIYT I+ WA  VA
Sbjct  61    FSDGFDDGIKHTTNSQDMLSELKRAGSQTLTKLIMTFSKNRHPVSFLIYTLILPWAADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLF--RNCSGNQ---VVEVPGVPALGVRDFP  970
             R + +P   L+ Q AT L + +H+F  +G ++   N S N+    ++VPG+P     D P
Sbjct  121   RYMSIPSAFLYIQSATSLALCHHFFNRHGGVYDLYNSSENKPPSSIQVPGLPPFETEDIP  180

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SFL     + + +        +  I+ +  E +P VL+N+FD LE + + AI  +  + I
Sbjct  181   SFLLPNGPHSSLN-----PVFQQHIQVLEQEPSPWVLLNSFDCLEEEVIAAIGNISPIPI  235

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIP A LD    SDT+ G DL + S +Y++WL+S+PK+SV+Y++FGS A +    +EE
Sbjct  236   GPLIPFALLDKNHQSDTSCGCDLFEKSTEYIQWLNSKPKTSVIYISFGSVAVLQKNQMEE  295

Query  609   IAQGLVKSKMPFLWVLRET-SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             +  GL+ +  PFLW++R + +K  + EE +R K   E +G IV WC+Q+EVL H SIGC+
Sbjct  296   MLLGLIGTCRPFLWIIRSSDNKDTEFEEMVREKVNKE-KGLIVPWCSQMEVLAHESIGCY  354

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             + HCGWNST+ESL +G+P+V  P + DQ  NAK+I++VW  GVR   NE G+V+A+E +R
Sbjct  355   MMHCGWNSTMESLVAGIPVVGLPQFADQTINAKMIEEVWGNGVRARVNEGGIVEAEEIRR  414

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             C+E V+G GEKG+E+R+NAKKW  LA  A+KD GSS+ NLKA+++  L
Sbjct  415   CLEVVIGSGEKGQEIRSNAKKWSGLALDAVKDGGSSHNNLKAFLENAL  462



>ref|XP_010549173.1| PREDICTED: UDP-glycosyltransferase 75D1 [Tarenaya hassleriana]
Length=478

 Score =   387 bits (993),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/484 (42%), Positives = 297/484 (61%), Gaps = 34/484 (7%)
 Frame = -3

Query  1491  RMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI-QGLDFA  1315
             ++   H L V  PAQGHI P+L+FAKRL   GA VT +    A  RM  +  +   L FA
Sbjct  5     KVSEAHFLFVTLPAQGHITPALEFAKRLAVAGADVTFAACVYAFRRMVVKGSVPDRLSFA  64

Query  1314  PFSDGYDAGLEP--ADLKDFWASMKTRGSDAVAKLITAKKEEG-----RPFTRLIYTSIM  1156
              FSDG+D G +P   +   + + MK RGS+ VA+LI    E       RPFT +++T ++
Sbjct  65    TFSDGFDDGFKPDEKNPNKYASVMKLRGSETVAELIRDHNENAAQRGRRPFTCVVFTLLL  124

Query  1155  SWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ------VVEVPGVP  994
              W   VAR  H+PV LLW QPAT+ DI Y+Y   Y D+ +    +       ++ +PG+P
Sbjct  125   PWVITVAREFHLPVALLWVQPATLFDILYYYVNGYADVIKGTDHDHDHDDDGLIRLPGLP  184

Query  993   ALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI  814
              L  RD P+F+  + ++      + +   ++Q++ +  E NP +LVNTF  LE +AL ++
Sbjct  185   PLRRRDLPTFVLPSNSS-----SYFLPEFQEQMDMLKEETNPMILVNTFQELEPEALNSV  239

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
                +M+ +GPLI S         D +FG  + Q+  +Y++WLD++P SSVVY++FG+   
Sbjct  240   PDFKMIPVGPLITS--------KDDSFGVSMCQDPKNYLQWLDTKPDSSVVYISFGTIVV  291

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRE-TSKGEKPEEK-----LRCKEELEAQGKIVRWCA  472
             +     EEI++ L++S+ PFLWV+ E T K E+  +         +++L+ QG IV+WC 
Sbjct  292   LSKKQYEEISKALIRSRRPFLWVISEKTYKSEEDRDNEEDNITSFRQQLDEQGLIVQWCD  351

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSA  292
             Q++VL H SIGCF+THCGWNSTLESL SG+P+VA P  +DQ  NAKL+++ WK GVRV+ 
Sbjct  352   QLQVLNHRSIGCFVTHCGWNSTLESLVSGIPVVAFPQSSDQTTNAKLVEECWKTGVRVNV  411

Query  291   NE-EGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             NE EGVV++ E +RC+E VM      +E R NA KW++LA G+++  GSS  NLKA++D 
Sbjct  412   NEDEGVVESGEIRRCVEAVMAEETTADEFRRNAAKWRDLAAGSVRGGGSSCNNLKAFVDM  471

Query  114   MLSS  103
              + S
Sbjct  472   HMGS  475



>ref|XP_009604418.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=465

 Score =   386 bits (991),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/470 (43%), Positives = 287/470 (61%), Gaps = 20/470 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H L++  PAQGHINP+LQ AK L   GA+ T  T    + RM++ P  + L ++ F
Sbjct  1     MKKHHFLVISLPAQGHINPTLQMAKNLARAGARATFITTVYGLKRMNNLPTQERLFYSSF  60

Query  1308  SDGYDAG-LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDGYD   +   D  D+  ++K  GS  +  ++    +EG P T L+YT ++ W  VVAR
Sbjct  61    SDGYDDDWISNTDHNDYMNNLKHEGSKNLKNILRKFSDEGHPVTFLVYTILLPWVAVVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV------EVPGVPALGVRDFP  970
              +HVP   L  Q  T   IY H F     ++ +   +  V      E PG+P     D P
Sbjct  121   DIHVPSAFLVIQCGTAFAIYNHLFNSINGVYSSSVSDITVTPSFPIEFPGLPLFSCNDIP  180

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             + +   + + +      I  MR+ I+++  + N  VL+NTFD LE  ++R + K+R+  +
Sbjct  181   TIVLPNDPHSSV----MIPIMREHIQNLENDPNSCVLINTFDTLEEKSMRIVDKMRIFSV  236

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQN-SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPL+PSA+ DG DP D +FG +L +N   +Y  WLDS+PK SVVY++FGS A +     E
Sbjct  237   GPLVPSAFSDGNDPKDKSFGCELFENPEKNYRRWLDSKPKGSVVYVSFGSIAVLKKEQKE  296

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEE-----LEAQGKIVRWCAQVEVLQHP  448
             EI  GL++S+ PFLWV+R+    E+ E+    K E     L  +G I+ WCAQ+EVL H 
Sbjct  297   EILHGLLESERPFLWVMRKGK--EEVEKGNNYKNEYDDSLLNEKGLIIPWCAQMEVLFHK  354

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             SIGCF+THCGWNSTLESL +GVP+V CP ++DQ  NAK+ ++VW  GVR +A EE +V  
Sbjct  355   SIGCFVTHCGWNSTLESLVAGVPIVGCPQFSDQTTNAKMAEEVWGTGVRANAVEE-LVGR  413

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             +E KRC+E +MG GEKGEE++ N KKW +LA  A+K  GSS+ NLK +++
Sbjct  414   EELKRCLEILMGSGEKGEEIKRNVKKWSDLAVEAVKIGGSSHDNLKIFLE  463



>ref|XP_010023607.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW59918.1| hypothetical protein EUGRSUZ_H02642 [Eucalyptus grandis]
Length=461

 Score =   385 bits (989),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 208/463 (45%), Positives = 285/463 (62%), Gaps = 13/463 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI--QGLDFA  1315
             M   H L++ F  QGH+NP++Q AKRLV  GA+VT +      N  + +  I  +GL   
Sbjct  1     MNHQHFLIISFRGQGHLNPTIQLAKRLVWAGAQVTYANAVDGRNVRTIKTPISMEGLSHT  60

Query  1314  PFSDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
              FS   D   EP+  +D  + +K  GS  + +LI +  E+ RP T LIYT ++ WA  VA
Sbjct  61    SFSVTDDDAGEPSSYEDRISEIKRVGSRNLRELIVSLSEKDRPVTFLIYTVLLPWAADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFL  961
             R L VP   L  Q A V  IY+HYF      +++        + +PG+P L   D PSFL
Sbjct  121   RDLGVPSAFLSIQSAAVFAIYHHYFNSRSGFYQSSKNEPPTTISLPGLPPLTPEDLPSFL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRA-IKKVRMVGIGP  784
               T+ N        +   ++ I  +  E NP VL+NTFDALE D ++A ++ +++  IGP
Sbjct  181   LPTDPNFPI-----VPTFQEHILTLEKETNPCVLLNTFDALEEDLIKAGMENMKLFAIGP  235

Query  783   LIPSAYLDGED-PSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEI  607
             LIP AYLD +D P D +FG DL   S DY++WLDS+P SSV+Y++FGS A +    +EE+
Sbjct  236   LIPLAYLDNKDRPLDNSFGCDLFDCSTDYLQWLDSKPASSVIYVSFGSLAVLKKNQMEEL  295

Query  606   AQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEA-QGKIVRWCAQVEVLQHPSIGCFL  430
              QGL +S  PFLWV+R ++  E+ E     K  ++   G IV WC QVEVL H SIGC +
Sbjct  296   CQGLRESGQPFLWVIRPSNTSEQEEIDTMIKGRIDGDSGLIVPWCLQVEVLNHKSIGCHV  355

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLESL +GVP+VACP ++DQ  NAKLIQDVW +GV+  A+ EGVV  +E KRC
Sbjct  356   THCGWNSTLESLTAGVPMVACPQFSDQLTNAKLIQDVWGVGVKARADGEGVVGREEMKRC  415

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             ++ VMG   + E +R +A KWK LA+ A+K+ GSS  NL+ +M
Sbjct  416   LDLVMGPTHE-EGMRESASKWKALARRAVKESGSSDDNLRLFM  457



>ref|XP_010040347.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45290.1| hypothetical protein EUGRSUZ_L01046 [Eucalyptus grandis]
Length=411

 Score =   383 bits (984),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 201/415 (48%), Positives = 280/415 (67%), Gaps = 22/415 (5%)
 Frame = -3

Query  1329  GLDFAPFSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMS  1153
             G+ F  FSDGYD G  P D L+ + A M  RGS+A+  LI     +G  FT +++T I+ 
Sbjct  9     GVTFTTFSDGYDDGYVPGDDLERYRAEMNRRGSEALRDLIEHSSGQGLSFTCVLHT-IVP  67

Query  1152  WAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFR-----NCSGNQVVEVPGVPAL  988
             W   VAR L + + L+W QPATV DIYYHYF+ Y D+ +      C    ++ +P VP L
Sbjct  68    WVHDVARSLQIKLVLVWIQPATVFDIYYHYFSGYEDVIKGVTSQRCDTTSLIRLPSVPPL  127

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKV-LVNTFDALEFDALRAIK  811
               R+ PS L     ++     + +  ++  +E+I   ENPKV LVNTFDALE +ALR I 
Sbjct  128   TNRNIPSIL-----HIEDKYAFVLPEIQSLLENIKEGENPKVVLVNTFDALELEALRVIG  182

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADV  631
              + +VGIGPL+P ++LD    SD +  GD    S DYV+WL+++ ++SV+Y+AFGS A +
Sbjct  183   TLNLVGIGPLVPLSFLD----SDQSSRGDRFLGSEDYVKWLNAKEEASVIYVAFGSIAML  238

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                   E+A+GL+++  PFLWV+R   KG+  +++L  KEEL+ +G IV WC+Q+EVL H
Sbjct  239   SKAQKREMARGLLETGRPFLWVMR---KGDGDDDELIYKEELDKRGVIVPWCSQIEVLSH  295

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS-ANEEG-V  277
             PSIGCFLTHCGWNST+ESL  G+P+VA P W DQ  NAKL++DVWK+GVRVS  ++EG +
Sbjct  296   PSIGCFLTHCGWNSTIESLVCGIPMVAFPQWIDQMTNAKLVEDVWKVGVRVSEIDQEGII  355

Query  276   VKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             V+  E K+C+E VMGGGE+G+E+R NAKKWK+L   A K+ GSS  NLKA+++E+
Sbjct  356   VEGGEIKKCLELVMGGGERGDEIRRNAKKWKDLVMEASKEGGSSDKNLKAFVEEI  410



>gb|KFK36297.1| hypothetical protein AALP_AA4G104100 [Arabis alpina]
Length=456

 Score =   385 bits (988),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 291/458 (64%), Gaps = 22/458 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV FP QGHINP+LQ A RL++ GA VT ST  SA+ RM   P ++GL +A F+DG+
Sbjct  12    HYLLVTFPGQGHINPALQLANRLIHHGATVTYSTAVSALRRMGEPPSVKGLSYAWFTDGF  71

Query  1296  DAGLEP-ADLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGVVARGLH  1123
             D GL+   D K   + +K  GSDA++ +I    + G  P T +IY+ ++ W   VAR  H
Sbjct  72    DDGLKSFEDQKIHMSELKRHGSDALSNIIKTNLDGGTEPITGVIYSLLVPWVSTVARSFH  131

Query  1122  VPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTET  946
             +P TLLW +PATVL+IYY+YF T Y  LF        + +PG+P L   D PSF+  ++T
Sbjct  132   LPTTLLWIEPATVLNIYYYYFNTSYNHLF----DINPITLPGLPPLSTDDLPSFIQPSKT  187

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
                  +  A+  +++ IE +  E NPK+LVN+F  LE DAL + +K+ M+ IGPL+ S+ 
Sbjct  188   -----IPSAVVTLKEHIEALESESNPKILVNSFSKLEPDALTSTQKLTMIPIGPLVSSSS  242

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD-VPNTMLEEIAQGLVK  589
                +      F    R +  DY++WLDS+ + SV+Y++ G++AD +P   +E +A G++ 
Sbjct  243   NSDDSSKADLF----RSSEEDYMKWLDSKLEKSVIYISLGTHADDLPEKHMEALANGVLA  298

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             +  PFLW++RE  K  +  + +R  +    +G ++ WC+Q  VL H S+GCF+THCGWNS
Sbjct  299   TSKPFLWIVREKKKN-RFVDLIREDD----RGLVIDWCSQTTVLAHKSVGCFVTHCGWNS  353

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
             T+ESL SGVP+VA P + DQF  AKL++D+W++GVRV   E G V  +E + C+E VMG 
Sbjct  354   TVESLESGVPMVAFPQFADQFTTAKLVEDMWRIGVRVKEGEGGDVDGEEVRLCLEKVMGD  413

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             GE+ EE+R NA +WK+ A  A  + G S LNLK ++ E
Sbjct  414   GEEAEEMRGNAARWKKFAGDAAVEGGPSDLNLKRFVVE  451



>ref|XP_011043909.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=498

 Score =   385 bits (989),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/469 (42%), Positives = 297/469 (63%), Gaps = 12/469 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGA-KVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             ME  H LL+  P QGH+NP LQ AK L   GA +VT +T    + ++ + P + GL +A 
Sbjct  1     MENQHFLLITCPFQGHLNPMLQLAKNLRQAGAARVTFATTVHGLTQIKTFPSLDGLYYAS  60

Query  1311  FSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G++ A + +D  + +K  GS  + +LI    +   P + LIYT I+ WA  VA
Sbjct  61    FSDGFDDGIKHATNSQDMLSELKRAGSQTLTELIMTFSKNSHPVSFLIYTLILPWAADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLF--RNCSGNQ---VVEVPGVPALGVRDFP  970
             R + +P  LL+ Q AT L + +H+F  +G ++   N S N+    ++VPG+P L   D P
Sbjct  121   RYMSIPSALLYIQSATSLALCHHFFNRHGGVYDLYNSSENKPPSSIQVPGLPPLETEDIP  180

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             SFL     + + +        +  I+ +  E +P VL+NTF  LE + + AI  +  + I
Sbjct  181   SFLLPNGPHSSLN-----PVFQHHIQVLEQEPSPWVLLNTFACLEEEVIAAIGNISPIPI  235

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             GPLIP + LD    SDT+ G DL + S +Y++WL+S+PK SV+Y++FGS A +    +EE
Sbjct  236   GPLIPFSLLDKNHQSDTSCGCDLFEKSTEYIQWLNSKPKRSVIYISFGSIAVLQKDQMEE  295

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             I  GL+ +  PFLW++R +   +   +++  ++  E +G IV WC+Q+EVL H SIGC +
Sbjct  296   ILLGLIGTCRPFLWIIRSSDNKDTEFDEMVREKVNEEKGLIVPWCSQMEVLAHESIGCCM  355

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
              HCGWNST+ESL +G+P+V  P + DQ  NAK+I++VW+ GVR   NE G+V+A+E +RC
Sbjct  356   MHCGWNSTMESLVAGIPVVGLPQFADQTTNAKMIEEVWRNGVRARVNEVGIVEAEEIRRC  415

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             +E V+G G++G+E+R+NAKKW  LA  A+KD GSS+ NLKA+++ + +S
Sbjct  416   LEVVIGSGQRGQEIRSNAKKWSGLALDAVKDGGSSHNNLKAFLENVTTS  464



>gb|KDO43225.1| hypothetical protein CISIN_1g036740mg, partial [Citrus sinensis]
Length=424

 Score =   382 bits (982),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 214/423 (51%), Positives = 286/423 (68%), Gaps = 19/423 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQ-GLDFAPFSDG  1300
             H LL+ FP QGHINPSLQFA+RL  +G +VT +   SA  RM++ P  + GL FA FSDG
Sbjct  8     HFLLLTFPIQGHINPSLQFARRLTRIGTRVTFAIAISAYRRMANNPTPEDGLSFASFSDG  67

Query  1299  YDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGVVARG  1129
             YD G      D K + +  K R S+A+A+LITA + EG +PFT L+Y  ++ WA  VAR 
Sbjct  68    YDDGFNSKQNDRKHYMSEFKRRSSEALAELITASQNEGGQPFTCLVYPQLLPWAAEVARA  127

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTE  949
              H+P  LLW QPA V D+YY+YF  YGDL      N ++E+PG+P L  RD PSFL    
Sbjct  128   YHLPSALLWLQPALVFDVYYYYFYGYGDLIEG-KVNDLIELPGLPPLTGRDLPSFLDPRN  186

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
             +N  Y   + + + ++Q+E I  E +P++LVNTFDALE + L+AI K  M+ IGPL+ SA
Sbjct  187   SNDAYS--FVLPSFKEQMEAIVEETDPRILVNTFDALEAETLKAIDKFNMIAIGPLVASA  244

Query  768   YLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
              LDG++     +GGDL +NS+   Y+EWL S+PKSSV+Y+AFG+   +    +EEIA+GL
Sbjct  245   LLDGKE----QYGGDLCKNSSKEYYMEWLSSKPKSSVIYVAFGTICVLEKRQVEEIARGL  300

Query  594   VKSKMPFLWVLRETSKGEKPEEK------LRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             + S  PFLWV RE+   +K ++K      ++ KEEL  +G IV WC+QVEVL H ++GCF
Sbjct  301   LDSGHPFLWVSRESDNKDKDKDKGEDDVMMKYKEELNEKGMIVPWCSQVEVLSHEAVGCF  360

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGW+S+LESL  GVP+VA P W DQ  NAK+I D  K GVRV ANEEG+V++DE  R
Sbjct  361   VTHCGWSSSLESLVYGVPVVAFPQWTDQGTNAKIIVDFCKTGVRVKANEEGIVESDEINR  420

Query  252   CIE  244
             C+E
Sbjct  421   CLE  423



>emb|CBI39398.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   381 bits (979),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 274/459 (60%), Gaps = 62/459 (14%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV +PAQGHINP+L+ AKRL+  GA+VT  T   A  RM     + GL FAPFSDGY
Sbjct  5     HFLLVSYPAQGHINPTLRLAKRLIQTGAQVTFVTTVYAQRRMVKPLSVCGLSFAPFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G E  D L    + +K +G+  + +L+    ++GRP   ++YT I  WA  VAR + V
Sbjct  65    DDGCENKDNLHHVLSEIKRQGTLKLTELVLECADQGRPVACIVYTMIFDWAQEVARRVQV  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCS--GNQVVEVPGV-PALGVRDFPSFLFSTE  949
                  W Q  TV DIYY+YF  YGD  RN S   +  +E+PG+ P    RD PSFL S+ 
Sbjct  125   LSAYFWNQATTVFDIYYYYFNGYGDEVRNKSIDPSSSIELPGLEPLFTSRDLPSFLLSSN  184

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSA  769
                   L + +E+ +   E ++ +ENPKVL+NTFDALE  ALRA+ K++++GIGPLIPSA
Sbjct  185   K-----LTFVLESFQKNFEALSQDENPKVLLNTFDALEPKALRALDKLKLIGIGPLIPSA  239

Query  768   YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVK  589
             +LD +DP+D +FGGD  Q S DY+EWL+S+PKSSV+Y++FGS A +    +EEIA GL+ 
Sbjct  240   FLDAKDPTDISFGGDQFQGSTDYIEWLNSKPKSSVIYISFGSLAILSKPQMEEIACGLLN  299

Query  588   SKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNS  409
             S  PFLWV+RE  KGE  +E++                                      
Sbjct  300   SDRPFLWVIREPDKGEMKDEEM--------------------------------------  321

Query  408   TLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGG  229
                            L  DQ  NAKLI D+WK G+RV  NEEG+V+ DE K C+E VMG 
Sbjct  322   ---------------LGTDQATNAKLITDMWKTGIRVWVNEEGMVERDEIKMCLEIVMGD  366

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             GE+ E LR NA+KWKELA+ AMK+ G S  NLKA++DE+
Sbjct  367   GERAEGLRRNAEKWKELAREAMKNGGMSDNNLKAFVDEV  405



>emb|CBI39410.3| unnamed protein product [Vitis vinifera]
Length=410

 Score =   381 bits (979),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 197/458 (43%), Positives = 276/458 (60%), Gaps = 82/458 (18%)
 Frame = -3

Query  1479  CHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDG  1300
               +LLV +PAQGHINPSLQ AK L   GA VT  T  SA  RMS  P ++GL+F  FSDG
Sbjct  31    AQILLVTYPAQGHINPSLQLAKLLTRAGAHVTFVTSSSASTRMSKPPTLEGLEFVTFSDG  90

Query  1299  YDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             YD G +  D L++F + +   GS A+ +LI A+  EGRPFT L+Y  I+ W   VA+  H
Sbjct  91    YDHGFKHGDDLQNFMSELDRLGSQALTELIVARANEGRPFTCLLYGIIIPWVAEVAQSFH  150

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTETN  943
             +P  L+W+Q ATV DIYY+YF E                   P+  +             
Sbjct  151   LPSALVWSQAATVFDIYYYYFNE-------------------PSKAIA------------  179

Query  942   VNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYL  763
                  ++ +++++ Q+E +N E NP+VLVN+FDALE +ALRA+ K +++GIGPL+P A+L
Sbjct  180   ----FNFVLKSLQKQLEQLNRESNPRVLVNSFDALESEALRALNKFKLMGIGPLLPLAFL  235

Query  762   DGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSK  583
             DG+DPSDT+FGGDL ++S DY++WL+S+P+SSV+Y++FGS + +     EEIA+GL+ S 
Sbjct  236   DGKDPSDTSFGGDLFRDSKDYIQWLNSKPESSVIYVSFGSLSVLSKQQSEEIARGLLASG  295

Query  582   MPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTL  403
              PFLWV+R    GE+ +E  +                                       
Sbjct  296   RPFLWVIRAKENGEEEKEDDKL--------------------------------------  317

Query  402   ESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGGE  223
                     +VA P W DQ  NAKLI+DVWK G+RV  N+EG+V+  E K+C+E VMG GE
Sbjct  318   --------MVAFPQWTDQTTNAKLIEDVWKTGLRVMVNQEGIVEGGEIKKCLELVMGCGE  369

Query  222   KGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             KG+E+R NAKKWK+LA+ A+K+ GSS  NLK +++E++
Sbjct  370   KGQEVRRNAKKWKDLAREAVKEGGSSDKNLKNFVNEII  407



>gb|KFK42892.1| hypothetical protein AALP_AA1G052200 [Arabis alpina]
Length=464

 Score =   381 bits (978),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 209/470 (44%), Positives = 294/470 (63%), Gaps = 36/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMN--RMSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA+VT  T  S  N   + ++  ++ L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIRTTGARVTFVTCQSVFNCSMIPNQSNLKNLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++KT G   +   I A +    P T ++YT +++WA  VAR
Sbjct  65    DGFDDGGMSNVEDRQKRSLNLKTNGDKTLTDFIEANRYSDSPVTCVVYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
                +P  LLW QPA V DIYY++FTE          N   E P +P+L +RD PSFL  T
Sbjct  125   RFQLPSALLWIQPALVFDIYYNHFTE---------NNTSFEFPNLPSLAIRDLPSFL--T  173

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              +N N D   A  + ++ IE +  E NPK+LVNTFD+LE +AL A   ++MV IGPL+P+
Sbjct  174   PSNTNKD---AYGSFQEMIELLKEEANPKILVNTFDSLEPEALTAYPNIKMVAIGPLLPT  230

Query  771   A-YLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
               +L+      T    D+ +  + Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L
Sbjct  231   EIFLES-----TKSVKDVSREQSRYSLWLDSKTESSVIYVSFGTMVELSKKQIEELARAL  285

Query  594   VKSKMPFLWVLRETS------KGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSI  442
             +  K PFLWV+ + S      +GE   E  +    + ELE  G IV WC+QVEVL+H S+
Sbjct  286   IDGKRPFLWVITDKSNREAKTEGEDETEIEKIDGLRHELEEVGMIVSWCSQVEVLRHRSV  345

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL+++ WK GVRV  NE+G+V+  E
Sbjct  346   GCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEEQWKTGVRVRENEKGLVERGE  405

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +RC+E VM   EK  ELR NA+KWK LA  A+ + GSS  N++A+++E+
Sbjct  406   IRRCLEAVM--EEKAVELRENAEKWKRLAAEAVGEGGSSDKNMEAFVEEI  453



>ref|XP_009781303.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
sylvestris]
Length=455

 Score =   380 bits (976),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/464 (41%), Positives = 293/464 (63%), Gaps = 14/464 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H L++  PAQGHINP+LQ AK L   GA+ T  T      +M++ P I GL +A  
Sbjct  1     MKKHHFLIISLPAQGHINPTLQLAKNLARAGARCTFVTTVHGFRKMNNLPSIDGLFYASI  60

Query  1308  SDGYDAGLEPADL--KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDG+D G+ P ++   D+   +K  GS+ +  L+    ++G P T L+YT + +W   VA
Sbjct  61    SDGHDDGM-PKEMYFGDYLNDLKRVGSENLKNLLQQFTDDGYPVTCLVYTILFTWVAEVA  119

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPALGVRDFPSF  964
             R  H P+  L  Q AT   IYY+ FT    ++ + +  ++   +++P +P     D P+F
Sbjct  120   REYHAPLAFLAIQCATAFAIYYYLFTTNNGMYSSTTEVELSFPLKLPELPLFSRDDIPTF  179

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  +++  ++     I  +R+ I+ +  + NP+VL+NTFDALE  +L+ ++K+ +  IGP
Sbjct  180   LLQSDSASSF----MIPVVREHIKILENDPNPRVLINTFDALEEKSLKILEKIGVSSIGP  235

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+ DG D +D +FG +L   S +Y +WLD + + SVVY++FGS A +     EEI 
Sbjct  236   LIPSAFCDGNDVNDKSFGCELFDKSENYSQWLDLKAEGSVVYISFGSLAVLKEEQKEEIL  295

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             +GL++S+ PFLWV+R +++  K +        L  +G IV WC+Q+EVL H SIGCF++H
Sbjct  296   KGLLESERPFLWVIRLSNEDGKNK---NVNYGLNGKGMIVPWCSQMEVLFHKSIGCFVSH  352

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLES+ + VPL+  P ++DQ  N K++++VW  GVR  A EEG+VK +E KRC++
Sbjct  353   CGWNSTLESIVADVPLIGYPQFSDQVTNIKMVEEVWGTGVRARA-EEGIVKREELKRCLK  411

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +MG GEKG E+R N KK+K+LA  A+K  GSS+ NL  ++D +
Sbjct  412   ILMGDGEKGNEIRRNVKKYKDLAMEAVKGGGSSHYNLNKFLDSL  455



>ref|XP_008793440.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
 ref|XP_008793441.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=474

 Score =   381 bits (978),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 211/475 (44%), Positives = 289/475 (61%), Gaps = 27/475 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMS---SRPEIQGLD----  1321
             H LLV +PAQGH+NP+L  AKRL    G++VT ST  S   RM    ++P+ +  D    
Sbjct  7     HFLLVTYPAQGHVNPALHLAKRLARTTGSRVTFSTAISGHRRMFPSLAKPDEEVEDGLVS  66

Query  1320  FAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWA  1147
             + P+SDGYD G +    D+  F + +K  GS  V+ L+       RP + LIYT +M+WA
Sbjct  67    YIPYSDGYDDGYKATTDDVNTFMSKIKLAGSRTVSTLVQDLAARDRPVSCLIYTLLMAWA  126

Query  1146  GVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVPALGVRDF  973
               VAR   VP  L W Q ATV   YYHYF  Y +L  + S +    V +PG+  L +RD 
Sbjct  127   ADVARDHGVPSALYWIQTATVFATYYHYFHGYDELITSHSHDPAFTVNLPGLLPLQIRDL  186

Query  972   PSFLFSTETNVNYDLDWAIEAMRDQIEDINGEEN----PKVLVNTFDALEFDALRAIKKV  805
             PSF   T TN        +   R+  E ++ EE     P++L+NTFDALE DA++AI  +
Sbjct  187   PSFF--TNTNPEDPYYSVLAGFRELFEKLDREEKTSSKPRILMNTFDALETDAIKAIDTM  244

Query  804   RMVGIGPLIPSAYLDGEDPSDTAFG-GDLRQNSND-YVEWLDSQPKSSVVYLAFGSYADV  631
              ++ IGPL+P   LDG D + T    GDL +  N  Y+EWLDSQP+ SVVY++FGS + +
Sbjct  245   ELIAIGPLVPFLSLDGTDSNGTTISDGDLFEADNKGYMEWLDSQPERSVVYVSFGSISLI  304

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                 L EI+ GL +S  PFLWV+R+ ++GE  E       E    G +V WC+QV+VL H
Sbjct  305   KKQQLAEISWGLEESGRPFLWVVRKDNRGEGVEL------EDGENGMVVEWCSQVKVLSH  358

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF+THCGWNSTLESLA GVP V  P W DQ  NA+L +  W  GVR   ++EGV++
Sbjct  359   PSVGCFVTHCGWNSTLESLACGVPTVGVPQWTDQATNARLAE-AWGTGVRGELSKEGVLE  417

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
               E KRC+E VMG GE+G E+R  A+ W++ A+ A+++ GSS  NL+ ++D + S
Sbjct  418   GKELKRCVEVVMGEGERGMEIRRKAEIWRDRAREAVRERGSSEGNLRNFVDGIAS  472



>ref|XP_006365463.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
1-like [Solanum tuberosum]
Length=458

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 194/466 (42%), Positives = 287/466 (62%), Gaps = 15/466 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H +++  PAQ HINP+LQ AK L   G + T  T  +   ++++ P I GL +A  
Sbjct  1     MKQHHFVIISLPAQSHINPTLQLAKNLSRAGTRCTFVTTVNGFRKLNNLPSIDGLFYASI  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDG D G    D  D+   +K  GS+ + KLI     +G P T L+YT + +W   VAR 
Sbjct  61    SDGNDDGAAKMDFGDYLKQLKRVGSENLKKLIDELAGDGHPVTCLVYTFLWAWVAEVARE  120

Query  1128  LHVPVTLLWTQPATVLDIYYHYFT-EYGDLFRNCSGNQV---VEVPGVPALGVRDFPSFL  961
             +++P   L  Q AT   IY+H F+     ++ + S  ++   +++P +P     D PSFL
Sbjct  121   INLPSAFLAIQSATAFAIYHHLFSINNNGVYSSTSEIELSFPIKLPELPLFSRDDIPSFL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                +   ++     I  MR+ I+++  + NP+VL+NTFD LE  +L+ + K+ +  IGPL
Sbjct  181   LQNDPYSSF----MIPVMREHIQNLEHDPNPRVLINTFDKLEEKSLKILDKIGICSIGPL  236

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             IPSA+L+G +  D +FG DL + S  Y +WLDS+P+ SVVY+AFGS A V     EE+ Q
Sbjct  237   IPSAFLNGNELEDKSFGCDLFEKSETYCQWLDSKPEGSVVYVAFGSVAMVKEEQKEEVLQ  296

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKE--ELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
              L++S+MPFLWV+R +    K ++K +  E   L  +G IV WC+Q+EVL H SIGCF++
Sbjct  297   SLMESEMPFLWVIRSS----KEDDKKKNDEIYGLNGKGMIVPWCSQMEVLFHKSIGCFVS  352

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE-GVVKADEYKRC  250
             HCGWNSTLES  +GVPL+  P  +DQ  N K++++VW  GVR    EE G+VK +E KRC
Sbjct  353   HCGWNSTLESTVAGVPLIGVPQLSDQMTNIKMVEEVWGTGVRARVEEEGGIVKREELKRC  412

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +E +MG GEKG E+R N KK+++LA   +K  GSS+ NL  +++ +
Sbjct  413   LEVLMGDGEKGNEIRRNVKKYRDLAMEDVKVGGSSHNNLNEFLESL  458



>ref|XP_004239848.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=458

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 198/467 (42%), Positives = 287/467 (61%), Gaps = 17/467 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H +++    QGHINP+LQ AK L   G + T  T  +  +++++ P I GL +A  
Sbjct  1     MKHHHFIIISLTIQGHINPTLQLAKNLSRAGVRCTFVTTVNGFSKLNNLPSIDGLFYASI  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDG D G    D  D+   +K  GS+ + KLI     +G P T L+YT I  W   VAR 
Sbjct  61    SDGNDDGTAKMDFSDYMKQLKRVGSENLKKLIDRYAGDGHPVTCLVYTFIWPWVAEVARE  120

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV-----VEVPGVPALGVRDFPSF  964
             +++P   L  Q AT   IY+H F+   +   + S N++     +++P +P L   D PSF
Sbjct  121   INLPSAFLVIQSATAFAIYHHLFSINNNGVYS-STNEINLSFPIKLPELPLLFRDDIPSF  179

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L   +   ++     I  MR+ I+++  + NP+VL+NTF+ LE  +L+ I K+ +  IGP
Sbjct  180   LLQNDPYSSF----MIPVMREHIQNLEHDTNPRVLINTFNKLEEKSLKIIDKIGIYSIGP  235

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+LDG +  D +FG DL + S  Y +WLDS+ + SVVY+AFGS A V     EE+ 
Sbjct  236   LIPSAFLDGIELEDKSFGCDLFEKSETYCQWLDSKLEGSVVYVAFGSIATVKEEQKEEVL  295

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKE--ELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             QGL++S+MPFLWV+R +    K ++K +  E   L  +G IV WC+Q+EVL H SIGCF+
Sbjct  296   QGLLESEMPFLWVIRSS----KEDDKKKNDEIYGLNGKGMIVPWCSQMEVLFHKSIGCFV  351

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE-GVVKADEYKR  253
             +HCGWNSTLES  +GVPL+  P   DQF N K++++VW  GVR    EE G+VK +E KR
Sbjct  352   SHCGWNSTLESTIAGVPLIGVPQLADQFTNIKMVEEVWGTGVRARVEEEGGIVKREELKR  411

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             C+  +MG GEKG E+R N KK+++LA  A+K  GSS+ NL  +++ +
Sbjct  412   CLGVLMGDGEKGNEIRRNVKKYRDLAMEAVKVGGSSHNNLNKFLESL  458



>gb|KGN46579.1| hypothetical protein Csa_6G109740 [Cucumis sativus]
Length=464

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 298/477 (62%), Gaps = 40/477 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG---LDF  1318
             M   H L+V FP+QG+INPSLQ A +L +L  +VT +T  +A  RM    +I     L F
Sbjct  1     MRNHHFLIVCFPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  1317  APFSDGYD-AGLEPADLKDFWASMKTRGSDAVAKLITA-KKEEGRPFTRLIYTSIMSWAG  1144
             A FSDG+D    + +D   F++ +K  GS ++  LIT+ +    RPFT +IY+ +++WA 
Sbjct  61    ATFSDGFDDENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLNWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-----VVEVPGVPAL-GV  982
              VA   ++P  L   QPATVL +YY+YF  + D   N   N       +E+PG+P L   
Sbjct  121   DVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLLFKS  180

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENP-KVLVNTFDALEFDALRAIKKV  805
              + PSF FS      + + W    MR+Q+E +  ++ P KVLVNTF ALE +ALRAI ++
Sbjct  181   HEMPSF-FSPSGQHAFIIPW----MREQMEFLGQQKQPIKVLVNTFHALENEALRAIHEL  235

Query  804   RMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADV  631
              M+ IGPLI            + F GDL Q SN+  Y+EWL+S+   SVVYL+FGS   +
Sbjct  236   EMIAIGPLI------------SQFRGDLFQVSNEDYYMEWLNSKSNCSVVYLSFGSICVL  283

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                  EEI  GL +S  PFLWV+R  SK ++ EEK   KE +E +GKIV WC Q+EVL+H
Sbjct  284   SKEQEEEILYGLFESGYPFLWVMR--SKSDEDEEKW--KELVEGKGKIVSWCRQIEVLKH  339

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF++HCGWNSTLESL+ G+P+VA P   DQ  NAKL++DVWK+GVRV  N EG+V+
Sbjct  340   PSLGCFMSHCGWNSTLESLSFGLPMVAFPQQVDQPTNAKLVEDVWKMGVRVKGNLEGIVE  399

Query  270   ADEYKRCIECVMG----GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +E +RC++ VM      GE+ EE   N +KWK+LA  AM + GSS LNL  ++DE+
Sbjct  400   REEIRRCLDLVMNRKYINGER-EETEKNVEKWKKLAWEAMDEGGSSILNLANFVDEI  455



>ref|XP_004140604.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Cucumis sativus]
Length=464

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 217/477 (45%), Positives = 298/477 (62%), Gaps = 40/477 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG---LDF  1318
             M   H L+V FP+QG+INPSLQ A +L +L  +VT +T  +A  RM    +I     L F
Sbjct  1     MRNHHFLIVCFPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  1317  APFSDGYD-AGLEPADLKDFWASMKTRGSDAVAKLITA-KKEEGRPFTRLIYTSIMSWAG  1144
             A FSDG+D    + +D   F++ +K  GS ++  LIT+ +    RPFT +IY+ +++WA 
Sbjct  61    ATFSDGFDDENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLNWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-----VVEVPGVPAL-GV  982
              VA   ++P  L   QPATVL +YY+YF  + D   N   N       +E+PG+P L   
Sbjct  121   DVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLLFKS  180

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENP-KVLVNTFDALEFDALRAIKKV  805
              + PSF FS      + + W    MR+Q+E +  ++ P KVLVNTF ALE +ALRAI ++
Sbjct  181   HEMPSF-FSPSGQHAFIIPW----MREQMEFLGQQKQPIKVLVNTFHALENEALRAIHEL  235

Query  804   RMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADV  631
              M+ IGPLI            + F GDL Q SN+  Y+EWL+S+   SVVYL+FGS   +
Sbjct  236   EMIAIGPLI------------SQFRGDLFQVSNEDYYMEWLNSKSNCSVVYLSFGSICVL  283

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                  EEI  GL +S  PFLWV+R  SK ++ EEK   KE +E +GKIV WC Q+EVL+H
Sbjct  284   SKEQEEEILYGLFESGYPFLWVMR--SKSDEDEEKW--KELVEGKGKIVSWCRQIEVLKH  339

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF++HCGWNSTLESL+ G+P+VA P   DQ  NAKL++DVWK+GVRV  N EG+V+
Sbjct  340   PSLGCFMSHCGWNSTLESLSFGLPMVAFPQQVDQPTNAKLVEDVWKVGVRVKGNLEGIVE  399

Query  270   ADEYKRCIECVMG----GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +E +RC++ VM      GE+ EE   N +KWK+LA  AM + GSS LNL  ++DE+
Sbjct  400   REEIRRCLDLVMNRKYINGER-EETEKNVEKWKKLAWEAMDEGGSSILNLANFVDEI  455



>emb|CDP21497.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   377 bits (967),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 198/463 (43%), Positives = 284/463 (61%), Gaps = 14/463 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L+   PAQGHINP+LQ AK L   GA+VT +T    ++R+ +RP   GL FA FSDGY
Sbjct  7     HFLVTAIPAQGHINPTLQLAKNLARAGAQVTFATTVYGLSRIKNRPASNGLSFASFSDGY  66

Query  1296  D--AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLH  1123
             D    ++  D   F + +K  GS  + KLI A   EGRP T  IYT ++ W   +A  ++
Sbjct  67    DDEKSMKNRDFACFLSDVKCFGSKDLTKLIQASSNEGRPVTFAIYTILLPWVAELASEMN  126

Query  1122  VPVTLLWTQPATVLDIYYHYFTEYGDLF---RNCSGNQV-VEVPGVPALGVRDFPSFLFS  955
             VP   L  Q AT   +Y+ YF  +  ++   R    + + +++P +      D P+F F 
Sbjct  127   VPSAFLVIQCATSFALYHRYFNSHDGIYDGVREVDYSSISIKLPDLSLFQKEDLPTFFFP  186

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
              +          + +  + I+ +  E    VLVNTF+ LE  +++A+  + ++ IGPLIP
Sbjct  187   NDPL----FPSVVPSFHEHIKILEQESTACVLVNTFNELEEASIKAVDGMNLIPIGPLIP  242

Query  774   SAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             SA+ DG D SD + GG+L     NDY++WLDS+P+SSVVY +FGS   +      EI  G
Sbjct  243   SAFCDGYDSSDKSVGGNLFDIPENDYLQWLDSKPESSVVYASFGSLLSLKKEEKMEILHG  302

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQ-GKIVRWCAQVEVLQHPSIGCFLTHC  421
             L ++   +L VLR  +  E+ EE     E + ++ G IV WC+Q+EVL H SIGCFLTHC
Sbjct  303   LKEAGRSYLLVLR--ADNEQEEEVKAVVENISSEEGMIVPWCSQMEVLCHRSIGCFLTHC  360

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNSTLES+ +GVP+V CP ++DQ  NAKLI++VW +GVR  ANEEGVV+  E +RC++ 
Sbjct  361   GWNSTLESIVAGVPIVGCPHFSDQTTNAKLIEEVWGIGVRAKANEEGVVERAEIRRCLDI  420

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VMGGGEKGEE+R N+ KW  +A  A+K++GSS+ N + ++  +
Sbjct  421   VMGGGEKGEEIRRNSAKWSCMAIEAVKENGSSHNNFRNFLQNL  463



>emb|CAN73416.1| hypothetical protein VITISV_017052 [Vitis vinifera]
Length=453

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 203/463 (44%), Positives = 292/463 (63%), Gaps = 25/463 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+  P+QGHINP+L  AK L+ +G +VT +T  S + R+++ P I GL FA F
Sbjct  1     MDKHHFLLLSCPSQGHINPTLHLAKLLLRVGVRVTFATFVSGLRRIATLPTIPGLHFASF  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G    +       MK  GS +++ L+ +   E  P T LIY  ++SWA  VAR 
Sbjct  61    SDGYDDG---NNSNYSMEEMKRVGSQSLSSLLLSLSNERGPVTYLIYGFLLSWAATVARE  117

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPALGVRDFPSFLF  958
               +P   L TQ ATV+ +Y+ YF  +  LF    GN +   +E+PG+P L   D PS L 
Sbjct  118   HGIPSAFLSTQSATVIAVYHRYFKAHDGLFNTELGNSLNISLELPGLPPLKYEDLPSILL  177

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK-VRMVGIGPL  781
              T  + ++     + ++++ I+++  + NP VL+NTF+ALE D ++A+   + +V IGPL
Sbjct  178   PTSRHASF-----VPSLQEHIQNLEQDPNPCVLINTFNALEEDVIKALGDFMNVVAIGPL  232

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL + S DY+ WL+S+P+ SV+Y++FGS A +    +EEI  
Sbjct  233   VQL---------DSSISCDLFERSKDYLPWLNSKPEGSVIYVSFGSLATLQKKQMEEIFH  283

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV+R  S   + EEK+      E QG IV+WC QVEVL H ++GCFLTHC
Sbjct  284   GLMESHRPFLWVIR--SIESELEEKMNSSLS-EEQGLIVQWCFQVEVLCHQAVGCFLTHC  340

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST+ESL +GVP+VACP ++DQ  NAKL+ +VW  GV+  ANEEGVV+ +E K+C+E 
Sbjct  341   GWNSTMESLVAGVPVVACPQFSDQXTNAKLV-EVWGTGVKAXANEEGVVEREEIKKCLEM  399

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VM GGEKG+E+R NA KWK LA  +M+   S   NLK +++ +
Sbjct  400   VMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESL  442



>ref|XP_010435193.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score =   375 bits (964),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 210/467 (45%), Positives = 298/467 (64%), Gaps = 33/467 (7%)
 Frame = -3

Query  1482  GC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             GC    H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA
Sbjct  7     GCPRHPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFA  66

Query  1314  PFSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGV  1141
              F+DG+D G++ + D K + + +K  GS+ ++ +I A  +    P T +IY+ ++ WA  
Sbjct  67    WFTDGFDDGVKSSKDQKIYMSELKRFGSNGLSDIIRANLDASTEPITGVIYSVLVPWAAT  126

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
             VAR  H+P TLLW +PATVLDIYY+YF T Y  LF        +++P +P +   D PSF
Sbjct  127   VARKFHLPTTLLWVEPATVLDIYYYYFNTSYKHLF----DTDPIKLPKLPLITTGDLPSF  182

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  ++      L  A+  +++ IE +  E NPK+LVNTF ALE DAL +++K+RM+ IGP
Sbjct  183   LQPSKA-----LPSALVTLKEHIEALESEPNPKILVNTFSALEHDALTSVEKLRMIPIGP  237

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSN-DYVEWLDSQPKSSVVYLAFGSYA-DVPNTMLEE  610
             L+ S+  DG+         DL ++S+ DY +WLDS    SVVY++ G++A D+P   +E 
Sbjct  238   LVSSSS-DGKT--------DLFKSSDEDYTKWLDSNLDKSVVYVSLGTHAEDLPEKHMEA  288

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEA--QGKIVRWCAQVEVLQHPSIGC  436
             +  G++ +  PFLW++RE ++    EEK R  E +    +G +V WC+Q  VL H S+GC
Sbjct  289   LTHGVLATNRPFLWIVREKNQ----EEKNRFLEMIRGVERGLVVDWCSQTAVLAHRSVGC  344

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNSTLESL SGVP+VA P + DQ   +KL++D W++GV+V   E+G V  +E +
Sbjct  345   FVTHCGWNSTLESLGSGVPVVAFPQFADQCTTSKLVEDAWRIGVKVKVEEDGHVAGEEVR  404

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             RC+E VM  GE+ EE+R  A KW +LA  A  + G S LNLK +++E
Sbjct  405   RCLERVMSEGEEAEEMRECAAKWMKLAVDAAVEGGPSDLNLKGFVEE  451



>ref|XP_010485047.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X1 [Camelina 
sativa]
Length=465

 Score =   375 bits (964),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 291/469 (62%), Gaps = 35/469 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA VT  T  S  +R  + +  ++  L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKTTGAHVTFVTCLSFFHRSMIPNHNKVDNLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++   G  A+++ I A +  G P T LIYT +++WA  VAR
Sbjct  65    DGFDDGGISTSDDRQKRSVNLMVNGDKALSEFIEANRNGGSPVTCLIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
                +P  LLW QPA V DIYY++F  Y   F         E+P + +L +RD PSFL  +
Sbjct  125   RYQLPCALLWIQPALVFDIYYNHFMGYKSAF---------ELPNLSSLEIRDLPSFLTPS  175

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              TN       A    ++ +E +  E NPK+L+NTFD+LE +AL A   + MV +GPL+P+
Sbjct  176   NTN-----KAAYALFQEMMESLKEENNPKILINTFDSLEPEALTAYPNIAMVAVGPLLPT  230

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                 G   S T    D  Q+S+ Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L+
Sbjct  231   EVFSG---STTKSVKD--QSSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALI  285

Query  591   KSKMPFLWVL-----RET-SKGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSIG  439
             + K PFLWV+     RET ++GE   E  +    ++ELE  G +V WC+Q+EVL+H S+G
Sbjct  286   EGKRPFLWVITDKPNRETKAEGEDEIEVEKIAGFRDELEEVGMLVSWCSQIEVLRHRSVG  345

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL+++ W  GVRV  N EG+V+  E 
Sbjct  346   CFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRVRENSEGLVERGEI  405

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             KRC+E VM   EK  ELR NA+KWK LA  A  + GSS  N++A+++E+
Sbjct  406   KRCLEAVM--KEKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVEEI  452



>gb|KGN45711.1| hypothetical protein Csa_6G007450 [Cucumis sativus]
Length=465

 Score =   375 bits (964),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 274/471 (58%), Gaps = 18/471 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   HVL V     GH NP L FA  L + G  VT +T  S   R+   P    L FA F
Sbjct  1     MMAPHVLFVALATHGHFNPGLHFANILSHGGLHVTFATSSSVFRRVPKLPSSPRLSFAFF  60

Query  1308  SDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             SDG D G +P D +  F +  + + S A+  +I   K  G+P T ++Y+ +  W   VAR
Sbjct  61    SDGQDDGFKPGDDVVPFLSQFELQASRAIHDIILKSKASGKPITFVLYSLLTPWMANVAR  120

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEV--PGVPALGVRDFPSFLF  958
                +P  L W Q A V  IYYH+F  Y ++ +NC  +  + +  PG+ +L  +  PS   
Sbjct  121   SFDLPTALFWNQSAAVFAIYYHFFNGYREVIQNCFSHPCININLPGLTSLNSKQLPSLCN  180

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
                +N      + ++      + +  E + K+L+N+FD LE D  RA     ++ IGP++
Sbjct  181   PVNSN-----SFILKLFESHFQVLKQEPHLKILINSFDELEHDVFRANNMGNLIPIGPVL  235

Query  777   P---------SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPN  625
             P           +LD    +  +F     Q+ + Y  WL+S+P+SSVVYL+FGS A V  
Sbjct  236   PIKCIEQMNNEIFLDAFRVAPISFSLHNSQDESKYHSWLNSKPRSSVVYLSFGSIAAVSK  295

Query  624   TMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPS  445
               LEEI +GL+     FLWV+R+ S G +  + L C +ELEA+GK+V WC+Q+EVL +P+
Sbjct  296   AQLEEIGRGLLDYGGEFLWVMRKMSHGNE-RDMLSCLDELEAKGKVVAWCSQLEVLSNPA  354

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             IGCFLTHCGWNS++ESL  GVP+VA P W DQ  NAK+I+D+ K GV++  NE G+V+  
Sbjct  355   IGCFLTHCGWNSSMESLVCGVPVVAFPQWTDQGTNAKIIEDLSKSGVKLRVNENGIVERG  414

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E K+C+E VMG G++GE  R N KKWKELAK A+   GSS+LN++ ++D +
Sbjct  415   EIKKCLEMVMGKGDEGEGFRRNGKKWKELAKKAITKGGSSHLNIRNFIDHL  465



>ref|XP_010925318.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=474

 Score =   375 bits (963),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 210/476 (44%), Positives = 292/476 (61%), Gaps = 27/476 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMS---SRP--EIQG--LD  1321
             H L+V +PAQGH+NPSL+ AKRL    G  VT ST  SA   M    ++P  E++   L 
Sbjct  7     HFLVVTYPAQGHVNPSLRLAKRLAQTTGGHVTFSTAISAHRLMFPSLAKPDEEVEDGLLT  66

Query  1320  FAPFSDGYDAGLE---PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSW  1150
             + PFS+GYD G +     DL DF    K  G+  +  ++      GRP + +IYT  +SW
Sbjct  67    YIPFSNGYDDGFKVDTDGDLDDFLYQFKLVGTRTLDGIVHDLAARGRPVSCIIYTIFLSW  126

Query  1149  AGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ--VVEVPGVPALGVRD  976
             A  VAR   +P  L W QPATV   YYHYF  Y +L  +   +    V++ G+P L +RD
Sbjct  127   AADVARDHGIPSALYWIQPATVFTTYYHYFHGYEELITSHGHDPFFTVDLSGLPHLQIRD  186

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEEN---PKVLVNTFDALEFDALRAIKKV  805
              PS + ST ++  Y     + A+++  + ++ +EN   PKVL+N+FDALE DA++A+  +
Sbjct  187   LPSLITSTNSDDPYRP--ILVALKETFDTLDQKENSSKPKVLINSFDALEADAIKAVGDM  244

Query  804   RMVGIGPLIPSAYLD-GEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADV  631
              ++ IGPL+PS  LD G+D  DTA GGDL + +   Y+EWLDS+   SVVY++FGS + +
Sbjct  245   DLITIGPLLPSLPLDIGKDSEDTASGGDLFEADKKRYMEWLDSKSGRSVVYVSFGSMSVI  304

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                 LEEI  GL +S  P+LWV+R+ ++GE  E       E    G +V WC+QV+VL H
Sbjct  305   KKRQLEEILLGLKESGRPYLWVVRKDNRGEGVEL------EDGENGMVVEWCSQVKVLSH  358

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF+THCGWNSTLESL  GVP +  P W DQ  NAKL + VW  GVR   N EG++ 
Sbjct  359   PSVGCFVTHCGWNSTLESLICGVPTIGVPQWTDQGTNAKLTE-VWGTGVRSEVNGEGLLD  417

Query  270   ADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
               E KRC+E VMG G +G E+R  A  WK+ A  A+++ GSS  NLK +++E+ S+
Sbjct  418   GSELKRCLEVVMGEGGRGVEIRTKAAIWKDKAWEAVREGGSSDRNLKTFVEEIASN  473



>ref|XP_009622557.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=454

 Score =   374 bits (960),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/462 (42%), Positives = 290/462 (63%), Gaps = 15/462 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H L++  PAQGHINP+LQ AK L   GA+ T  T      +M++ P I GL +A  
Sbjct  1     MKKHHFLIISLPAQGHINPTLQLAKILARAGARCTFVTSVHGFRKMNNLPSIDGLFYASI  60

Query  1308  SDGYDAGLEPADL--KDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDG+D G  P ++   D+    K  GS+ +  L+    ++G P T L+YT + +W   VA
Sbjct  61    SDGHDDG-RPKEMYFGDYLNDFKRVGSENLKNLLHKFTDDGYPVTCLVYTILFTWVAEVA  119

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPALGVRDFPSF  964
             R  H     L  Q AT   IYY+ FT    ++ + +  +    +++P +P +   D P+F
Sbjct  120   RECHAQSAFLAIQCATAFAIYYNLFTTNNGIYSSTTEIEPSFPIKLPELPLISRDDIPTF  179

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  +++  ++     I  MR+ I+ +  + NP+VL+NTFDALE  +L+ ++K+ +  IGP
Sbjct  180   LLQSDSASSF----MIPVMREHIKILESDSNPRVLINTFDALEEKSLKILEKIGVCSIGP  235

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             LIPSA+ DG D +D +FG +L   S +Y +WLD + + SVVY++FGS A +     EEI 
Sbjct  236   LIPSAFCDGNDVNDKSFGCELFDKSENYSQWLDLKAEGSVVYVSFGSLAVLKEEQKEEIL  295

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             +GL++S+ PFLWV+R +++ +K + +      L  +G IV WC+Q+E+L H SIGCF++H
Sbjct  296   KGLLESERPFLWVIRSSNEDDKIKNE---NYGLNGKGMIVPWCSQMEILFHKSIGCFVSH  352

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLES+A GVPL+  P ++DQ  N K++++VW  GVR  A EEG+VK +E KRC+E
Sbjct  353   CGWNSTLESIALGVPLIGYPQFSDQVTNIKMVEEVWGTGVRARA-EEGIVKREELKRCLE  411

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
              +MG GEKG E+R N KK+ +LA  A++  GSS+ NL  ++D
Sbjct  412   ILMGNGEKGNEIRRNVKKYGDLAMEAVR-GGSSHYNLNKFLD  452



>ref|XP_004162387.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Cucumis sativus]
Length=464

 Score =   374 bits (961),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 216/477 (45%), Positives = 297/477 (62%), Gaps = 40/477 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQG---LDF  1318
             M   H L+V  P+QG+INPSLQ A +L +L  +VT +T  +A  RM    +I     L F
Sbjct  1     MRNHHFLIVCLPSQGYINPSLQLANKLTSLNIEVTFATTVTASRRMKITQQISSPSTLSF  60

Query  1317  APFSDGYD-AGLEPADLKDFWASMKTRGSDAVAKLITA-KKEEGRPFTRLIYTSIMSWAG  1144
             A FSDG+D    + +D   F++ +K  GS ++  LIT+ +    RPFT +IY+ +++WA 
Sbjct  61    ATFSDGFDDENHKTSDFNHFFSELKRCGSQSLTDLITSFRDRHRRPFTFVIYSLLLNWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-----VVEVPGVPAL-GV  982
              VA   ++P  L   QPATVL +YY+YF  + D   N   N       +E+PG+P L   
Sbjct  121   DVATSFNIPSALFSAQPATVLALYYYYFHGFEDEITNKLQNDGPSSLSIELPGLPLLFKS  180

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENP-KVLVNTFDALEFDALRAIKKV  805
              + PSF FS      + + W    MR+Q+E +  ++ P KVLVNTF ALE +ALRAI ++
Sbjct  181   HEMPSF-FSPSGQHAFIIPW----MREQMEFLGQQKQPIKVLVNTFHALENEALRAIHEL  235

Query  804   RMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADV  631
              M+ IGPLI            + F GDL Q SN+  Y+EWL+S+   SVVYL+FGS   +
Sbjct  236   EMIAIGPLI------------SEFRGDLFQVSNEDYYMEWLNSKSNCSVVYLSFGSICVL  283

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQH  451
                  EEI  GL +S  P LWV+R  SK ++ EEK   KE +E +GKIV WC Q+EVL+H
Sbjct  284   SKEQEEEILYGLFESGYPLLWVMR--SKNDEDEEKW--KELVEGKGKIVSWCRQIEVLKH  339

Query  450   PSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVK  271
             PS+GCF++HCGWNSTLESL+ G+P+VA P   DQ  NAKL++DVWK+GVRV AN EG+V+
Sbjct  340   PSLGCFMSHCGWNSTLESLSFGLPMVAFPQQVDQPTNAKLVEDVWKMGVRVKANLEGIVE  399

Query  270   ADEYKRCIECVMG----GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +E +RC++ VM      GE+ EE   N +KWK+LA  AM + GSS LNL  ++DE+
Sbjct  400   REEIRRCLDLVMNRKYINGER-EETEKNVEKWKKLAWEAMDEGGSSILNLANFVDEI  455



>ref|XP_010457643.1| PREDICTED: UDP-glycosyltransferase 75B1-like [Camelina sativa]
Length=465

 Score =   374 bits (960),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 292/470 (62%), Gaps = 37/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA+VT  T FS  +R  + +  ++  L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFVTCFSFFHRSMIPNHKKVDNLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++   G  A++  I A +    P T LIYT +++WA  VAR
Sbjct  65    DGFDDGGISTSDDSQKRSVNLTVNGDKALSDFIEANRNGDSPVTCLIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFS  955
                +P  LLW QPA V DIYY++F           GN+   E+P + +L +RD PSFL  
Sbjct  125   RYQLPCALLWIQPALVFDIYYNHFM----------GNKSAFELPNLSSLEIRDLPSFLTP  174

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             + TN       A  + ++ +E +  E NPK+L+NTFD+LE +AL A   + MV +GPL+P
Sbjct  175   SNTN-----KAAYGSFQEMMESLKEETNPKILINTFDSLEPEALTAYPNIEMVAVGPLLP  229

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             +    G   S T    D  Q+S+ Y  WLDS+ +SSV+Y++FG+  ++     EE+A+ L
Sbjct  230   TEVFSG---STTKSVKD--QSSSSYTLWLDSKTESSVIYVSFGTMVELSKKQKEELARAL  284

Query  594   VKSKMPFLWVL-----RET-SKGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSI  442
             ++ K PFLWV+     RET ++GE   E  +    ++ELE  G IV WC+Q+EVL+H S+
Sbjct  285   IEGKRPFLWVITDKPNRETKAEGEDETEVEKIAAFRDELEEVGMIVSWCSQIEVLRHRSV  344

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL+++ W  GVRV  N EG+V+  E
Sbjct  345   GCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRVRENSEGLVERGE  404

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              KRC+E VM   EK  ELR NA+KWK LA  A  + GSS  N++A+++E+
Sbjct  405   IKRCLEAVM--KEKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVEEI  452



>ref|XP_010434952.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   373 bits (958),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 206/488 (42%), Positives = 297/488 (61%), Gaps = 54/488 (11%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNRMSSRPEI--QGLDFA  1315
             G H L V +PAQGHINPSL+ AKRL      A+VT +   SA NR     EI  + L FA
Sbjct  11    GPHFLFVTYPAQGHINPSLELAKRLAGTISNARVTFAAPISAYNRRMFSQEIVPETLTFA  70

Query  1314  PFSDGYDAGLE--------PAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G +        P D + ++ + M+ RG + + +LI   + + RPFT ++YT 
Sbjct  71    TYSDGHDDGFKSSTSFDKSPQDAVANYMSDMRRRGKETLTELIEDNRRQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPAL  988
             +++W   +AR +H+P  LLW QP TV  I+YHYF  Y D       N    +++P +P L
Sbjct  131   LLTWIAELAREIHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMGNNPSSSIKLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              +RD PSFL S+         + + A RDQ+E +  E NPK+L+N+F ALE +A+ ++  
Sbjct  191   TLRDLPSFLVSSNAYA-----FLLPAFRDQLESLEEEANPKILINSFQALEPEAMTSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSN---DYVEWLDSQPKSSVVYLAFGSY  640
               ++V IGPL+                  LR  S+   +Y+EWLD++  SSVVY++FG+ 
Sbjct  246   NYKIVPIGPLL-----------------TLRTGSSSHSEYIEWLDTKSDSSVVYVSFGTI  288

Query  639   ADVPNTMLEEIAQGLVKSKMPFLWVLRETS---KGEKPEEKLRC----KEELEAQGKIVR  481
             A +    L E+ + L++S+ PFLWV+ + S   + ++ E++  C    +EEL+  G +V 
Sbjct  289   AVLNKKQLVELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVS  348

Query  480   WCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVR  301
             WC Q  VL H SIGCF+THCGWNSTLESL +GVP+VA P W DQ  NAKL++D WK GVR
Sbjct  349   WCDQFRVLNHRSIGCFVTHCGWNSTLESLVAGVPVVAFPQWTDQMTNAKLLEDCWKTGVR  408

Query  300   V--SANEEGV--VKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNL  133
             V    ++EGV  V+++E +RCIE VM G  K EE R NA +WK+LA  A+++ GSS+ +L
Sbjct  409   VMEKKDDEGVVLVESEEIRRCIEEVMEG--KAEEFRGNAARWKDLAAEAVREGGSSFNHL  466

Query  132   KAYMDEML  109
             KA+ DE +
Sbjct  467   KAFADERM  474



>ref|XP_011021104.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Populus 
euphratica]
Length=461

 Score =   372 bits (955),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 292/465 (63%), Gaps = 11/465 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGA-KVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             ME  H LL+  PAQGH+NP  Q  K L++ GA +VT +T    + ++ + P ++ L +A 
Sbjct  1     MENKHFLLIALPAQGHLNPMFQLGKCLIHAGAGRVTFATTAHGLTQVEAFPSLENLHYAS  60

Query  1311  FSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G++P  D     A +K  GS  + +L+ +  +EG P + LIYT ++ WA  VA
Sbjct  61    FSDGFDDGIKPTNDPHRIRAELKRVGSQTLTELLLSLSKEGNPVSYLIYTLLLPWAADVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFL  961
             R + +P   L     T   + Y +F E   ++ +        +E+PG+P    +D PSFL
Sbjct  121   RDMSIPSAFLCILSTTAFALCYCFFKERDGVYDSNDNGPPSSIEMPGLPLFTSKDMPSFL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                + + +      I   +  I+ +  + NP VL+NT D LE +A+R I  +  + IGPL
Sbjct  181   LPNDPHASI----LIPLFQHHIQALEKDSNPCVLLNTSDCLEEEAIRRISNLNPIPIGPL  236

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +  A+LD  + +D++ G DL + S +Y +WL+S+PK SVVY++FGS A +    +E+I  
Sbjct  237   VSYAFLDENNSTDSSCGIDLFEKSTEYSQWLNSKPKGSVVYVSFGSLAVLQKNQMEKILL  296

Query  600   GLVKSKMPFLWVLRET--SKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLT  427
             GL  +  PFLWV+R +  S   + EEK+R K   E +G IV WC+Q+EVL H SIGCF+ 
Sbjct  297   GLTGTCRPFLWVVRPSAGSDDREFEEKIRDKVN-EEEGLIVPWCSQMEVLAHESIGCFMM  355

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             HCGWNSTLESLA+GVP+V  P ++DQ  NAK++++VW+ GVR   N++G ++A+E +RC+
Sbjct  356   HCGWNSTLESLATGVPVVGFPQFSDQTTNAKMVEEVWRTGVRARVNDDGTLEAEEIERCL  415

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             E VMGGG++GEE+R NAKKWK L   A+ + GSSY NL A+++++
Sbjct  416   EMVMGGGQRGEEIRRNAKKWKGLTLEAVMEGGSSYNNLNAFLEKI  460



>ref|NP_567471.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 sp|O23406.2|U75D1_ARATH RecName: Full=UDP-glycosyltransferase 75D1 [Arabidopsis thaliana]
 gb|AEE83624.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AHL38691.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=474

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 293/485 (60%), Gaps = 48/485 (10%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR--MSSRPEIQGLDFA  1315
             G H L V FPAQGHINPSL+ AKRL     GA+VT +   SA NR   S+    + L FA
Sbjct  11    GPHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSTENVPETLIFA  70

Query  1314  PFSDGYDAGLEPADLKD---------FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G + +   D         F + M+ RG + + +LI   +++ RPFT ++YT 
Sbjct  71    TYSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPAL  988
             +++W   +AR  H+P  LLW QP TV  I+YHYF  Y D     +   +  +++P +P L
Sbjct  131   LLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMANTPSSSIKLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              VRD PSF+ S+         + + A R+QI+ +  E NPK+L+NTF  LE +A+ ++  
Sbjct  191   TVRDIPSFIVSSNVYA-----FLLPAFREQIDSLKEEINPKILINTFQELEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADV  631
               ++V +GPL+                 D   +  +Y+EWLD++  SSV+Y++FG+ A +
Sbjct  246   NFKIVPVGPLL-------------TLRTDF-SSRGEYIEWLDTKADSSVLYVSFGTLAVL  291

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETS---KGEKPEEKLRC----KEELEAQGKIVRWCA  472
                 L E+ + L++S+ PFLWV+ + S   K ++ E++  C    +EEL+  G +V WC 
Sbjct  292   SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMVVSWCD  351

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--  298
             Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P WNDQ  NAKL++D WK GVRV  
Sbjct  352   QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVME  411

Query  297   SANEEGVVKAD--EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAY  124
                EEGVV  D  E +RCIE VM   +K EE R NA +WK+LA  A+++ GSS+ +LKA+
Sbjct  412   KKEEEGVVVVDSEEIRRCIEEVM--EDKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  469

Query  123   MDEML  109
             +DE +
Sbjct  470   VDEHM  474



>gb|AFJ52965.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=473

 Score =   371 bits (953),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 295/482 (61%), Gaps = 40/482 (8%)
 Frame = -3

Query  1467  LVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI--QGLDFAPFSDGYD  1294
             +  FPAQGH+NPS+ F+ +LV LG +V L T  S    ++    I   GL    FSDGYD
Sbjct  1     MATFPAQGHVNPSVHFSIQLVALGCRVILVTTVSGSYLITKSNNILPPGLSIVTFSDGYD  60

Query  1293  AG----LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
                       D    W  + +RGS  ++ LI     +G PF  L+Y+ +++WA  VAR  
Sbjct  61    MAGSSWKSKEDQNKQWEQLNSRGSQFLSDLIVTNANQGTPFACLVYSPLLTWAVDVARDH  120

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGV--RDFPSFLFS  955
             ++P TLLW QPATV+DIYY+ F  YGDLF  C      +++PG+ ++    +D PSF   
Sbjct  121   NLPTTLLWIQPATVMDIYYYLFNGYGDLFEKCKDPSFAMDLPGLHSVSFTSKDLPSFAIH  180

Query  954   TETNVNYDLDWAIEAMRDQIEDINGE-ENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
                   Y L   I  ++ Q++ +  +    KVLVNTFD LE +A++A  ++ M+G+GPLI
Sbjct  181   PN---QYPL--LINGVKQQMQVLTRDGTKSKVLVNTFDELEMEAMKANVELEMIGVGPLI  235

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PS + +    ++   GGD        V WLD Q +SSVVY++FG+ A +     EE+A+G
Sbjct  236   PSCFWEPRHDNNNTDGGD------SVVTWLDLQARSSVVYVSFGTMAVISKKQREELAKG  289

Query  597   LVKS-KMPFLWVLRETSKGEKPEEKL---RCKEELEAQ-----GKIVRWCAQVEVLQHPS  445
             LV S   PFLWV+R+    EK EE++   R +EE+E +     G+I+ WC+QVEVL H +
Sbjct  290   LVSSSNRPFLWVIRKDEAVEKEEERIEMVRWREEMETKAESVGGRIIEWCSQVEVLSHEA  349

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE------  283
             +GCF+THCGWNSTLES+  GVPLVA P ++DQ  NAKL++DVWK+GVRV    +      
Sbjct  350   VGCFVTHCGWNSTLESICLGVPLVAFPQFSDQTTNAKLVEDVWKIGVRVVVPNQKPETEE  409

Query  282   ----GVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
                  VV+ DE +RC++ VMG G+  E++  NA KWK+LA+ A+++ GSS+ N+KA++D+
Sbjct  410   EEAAVVVEGDEIRRCLDLVMGEGQVREQVTTNADKWKQLARDALREGGSSHSNIKAFVDQ  469

Query  114   ML  109
             ++
Sbjct  470   II  471



>ref|XP_002892295.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68554.1| UDP-glucosyl transferase 75B2 [Arabidopsis lyrata subsp. lyrata]
Length=459

 Score =   370 bits (950),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 283/472 (60%), Gaps = 39/472 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMSSRPEIQG----LDFAP  1312
             H LLV FPAQGH+NPSL+FA+RL+   G +VT +T  SA+NR S  P+       L F  
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKTTGTRVTFATCLSAINR-SMIPDHNNVNDLLSFLT  63

Query  1311  FSDGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             FSDG+D G+     D+++   + +  G  A++  I A      P T LIYT + +WA  V
Sbjct  64    FSDGFDDGVISNTDDVQNRLLNFERNGDKALSDFIEANLNGDSPVTCLIYTILPNWAPKV  123

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLF  958
             AR  H+P  LLW QPA V DIYY+Y T           N V E P +P+L +RD PSFL 
Sbjct  124   ARRFHIPSVLLWIQPAFVFDIYYNYST---------GNNSVFEFPNLPSLAIRDLPSFLS  174

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
              + TN       A     + +E +  E NPK+LVNTFD+LE D L AI  V MV +GPL+
Sbjct  175   PSNTN-----KAAQAVYLELMEFLKEESNPKILVNTFDSLEPDFLTAIPNVEMVAVGPLL  229

Query  777   PSAYLDGEDPSDTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             P+    G +      G DL R  S+ Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+
Sbjct  230   PAEIFTGSES-----GKDLSRDQSSSYKLWLDSKTESSVIYVSFGTMVELSKKQIEELAR  284

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRC---------KEELEAQGKIVRWCAQVEVLQHP  448
              L++ K PFLWV+      E   E             + ELE  G IV WC+Q+EVL+H 
Sbjct  285   ALIEGKRPFLWVITNKLNREAKIEGEEETEIEKIASFRHELEEVGMIVSWCSQIEVLRHR  344

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             ++ CF+THCGW+S+LESL  GVP+VA P+W+DQ  NAKL++ +WK GVRV  N EG+V+ 
Sbjct  345   AVSCFVTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEKIWKTGVRVRENSEGLVER  404

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              E KRC+E VM   EK EELR +A+KWK LA  A  + GSS  N++A++  +
Sbjct  405   GEIKRCLEAVM--EEKSEELRESAEKWKRLAIEAGGEGGSSDKNVEAFVKTL  454



>ref|XP_008458143.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   370 bits (951),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 209/478 (44%), Positives = 300/478 (63%), Gaps = 38/478 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEI---QGLDF  1318
             M   H L+V FP+QG INPSLQ A +L +L  +VT +T  +A  RM+   +I     L F
Sbjct  1     MRNHHFLIVCFPSQGCINPSLQLANKLTSLNIEVTFATTVTASRRMNITQQIPSPSTLSF  60

Query  1317  APFSDGYD-AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEG---RPFTRLIYTSIMSW  1150
             A FSDG+D    + +D   +++ +K  GS ++  LI + +++    RPFT LIY+ +++W
Sbjct  61    ATFSDGFDDENHKTSDFNHYFSELKRCGSQSLTDLIASLRDDRHRRRPFTFLIYSLLLNW  120

Query  1149  AGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ----VVEVPGVPAL-G  985
             A  VA   ++P  L  TQPATVL +YY+YF  + D   N   N      +E+PG+P L  
Sbjct  121   AADVATSFNIPSALFSTQPATVLALYYYYFHGFEDEITNKLQNDGPSLSIELPGLPLLFK  180

Query  984   VRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENP-KVLVNTFDALEFDALRAIKK  808
               + PSF   +  + +         MR+Q+E ++ ++ P KVLVNTFDALE +ALRAI +
Sbjct  181   SHEMPSFFSPSSQHASI----ITPLMREQMEFLSQQKKPTKVLVNTFDALENEALRAIHE  236

Query  807   VRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYAD  634
             + M+ +GPLI           +T F GDL Q SN   Y+EWL+S+   SVVY++FGS   
Sbjct  237   LEMIAVGPLI-----------NTEFRGDLFQVSNGDYYMEWLNSKSNFSVVYISFGSICV  285

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQ  454
             +     EEI  GL++S  PFLWV+R  +  ++ E   + KE +E +G+IV WC Q+EVL+
Sbjct  286   LSKEQEEEILYGLLESGYPFLWVIRSKNDEDREE---KWKELVEGKGRIVSWCRQIEVLK  342

Query  453   HPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVV  274
             HPS+GCF++HCGWNSTLESL+ G+P+VA P   DQ  NAKL++DVWK+GVRV AN EG+V
Sbjct  343   HPSLGCFVSHCGWNSTLESLSFGLPMVAFPQQIDQPTNAKLVEDVWKMGVRVKANLEGIV  402

Query  273   KADEYKRCIECVMG----GGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             + +E +RC++ VM      GE+ E +  N +KWKELA  A+ + GSS LNL  ++DE+
Sbjct  403   EREEIRRCLDLVMNRKDIDGER-EVIEKNVEKWKELAWEAINEGGSSILNLVNFVDEI  459



>gb|ADG45874.1| UDP-glucosyltransferase [Isatis tinctoria]
Length=476

 Score =   370 bits (951),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 199/485 (41%), Positives = 293/485 (60%), Gaps = 48/485 (10%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLDFA  1315
             G H L V +P QGHINPSL+ AKRL     GA+VT +   SA NR M S+  + + L FA
Sbjct  13    GPHFLFVTYPTQGHINPSLELAKRLAATITGARVTFAAPISAYNRRMFSKENVPETLIFA  72

Query  1314  PFSDGYDAGLEPADLKD---------FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G + +   D         + + M+ RG + + +LI   + + RPFT ++YT 
Sbjct  73    TYSDGHDDGYKASTSSDKSRQDTARQYMSEMRRRGRETLTELIEDNRRQNRPFTCVVYTI  132

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPA  991
             +++W   +AR  H+P  LLW QP TV  I+YHYF+ Y D     + N     +E+P +P 
Sbjct  133   LLTWVAELARDFHIPSALLWVQPVTVFSIFYHYFSGYADAISEMARNNPSGSIELPSLPP  192

Query  990   LGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-  814
             L +RD P+F+    T       + + A R+QIE +  EENPK+LVN+F  LE +AL ++ 
Sbjct  193   LRLRDLPTFIVPENTYA-----FLLSAFREQIESLKQEENPKILVNSFQELEQEALSSVL  247

Query  813   KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYAD  634
                +++ IGPLI S        +D+  G +       YVEWLD++  SSV+Y++FG+ A 
Sbjct  248   DNFKIIPIGPLITSR-------TDSGTGAE-------YVEWLDTKTDSSVLYISFGTLAV  293

Query  633   VPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEE------KLRC-KEELEAQGKIVRWC  475
             +    L E+   L++S+ PFLWV+ + +   K +        +R  +EEL+  G +V WC
Sbjct  294   LSTRQLVELCMALIQSRRPFLWVITDKTYRIKEDGEETEEESIRSFREELDEIGMVVSWC  353

Query  474   AQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV-  298
              Q  VL+H SIGC++THCGWNS+LESL +GVP+VA P W DQ  NAKL++D W+ GVRV 
Sbjct  354   DQFSVLKHRSIGCYMTHCGWNSSLESLVAGVPVVAFPQWTDQTTNAKLLEDCWRTGVRVM  413

Query  297   --SANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAY  124
                 +EE VV++ E +RCIE VM   +K EE R NA +W++LA   +++ GSS+ +LKA+
Sbjct  414   EKKEDEEVVVESGEIRRCIEEVM--DKKLEEFRENAARWRDLAAETVREGGSSFNHLKAF  471

Query  123   MDEML  109
             +DE +
Sbjct  472   VDEHM  476



>ref|XP_010485054.1| PREDICTED: UDP-glycosyltransferase 75B1 isoform X2 [Camelina 
sativa]
Length=465

 Score =   370 bits (950),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 206/470 (44%), Positives = 291/470 (62%), Gaps = 37/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA VT  T  S  +R  + +  ++  L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKTTGAHVTFVTCLSFFHRSMIPNHNKVDNLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++   G  A++  I A +    P T LIYT +++WA  VAR
Sbjct  65    DGFDDGGISTSDDSQKRSVNLTVNGDKALSDFIEANRNGDSPVTCLIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFS  955
                +P  LLW QPA V DIYY++F           GN+   E+P + +L +RD PSFL  
Sbjct  125   RYQLPCALLWIQPALVFDIYYNHFM----------GNKSAFELPNLSSLEIRDLPSFLTP  174

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             + TN       A  + ++ +E +  E NPK+L+NTFD+LE +AL A   + MV +GPL+P
Sbjct  175   SNTN-----KAAYGSFQEMMESLKEETNPKILINTFDSLEPEALTAYPNIEMVAVGPLLP  229

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             +    G   S T    D  Q+S+ Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L
Sbjct  230   TEVFSG---STTKSVKD--QSSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARAL  284

Query  594   VKSKMPFLWVL-----RET-SKGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSI  442
             ++ K PFLWV+     RET ++GE   E  +    ++ELE  G +V WC+Q+EVL+H S+
Sbjct  285   IEGKRPFLWVITDKPNRETKAEGEDEIEVEKIAGFRDELEEVGMLVSWCSQIEVLRHRSV  344

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLESL  GVP+VA P+W+DQ  NAKL+++ W  GVRV  N EG+V+  E
Sbjct  345   GCFVTHCGWNSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWMTGVRVRENSEGLVERGE  404

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              KRC+E VM   EK  ELR NA+KWK LA  A  + GSS  N++A+++E+
Sbjct  405   IKRCLEAVM--KEKSVELRENAEKWKRLATEAGGEGGSSDKNMEAFVEEI  452



>ref|XP_010450127.1| PREDICTED: UDP-glycosyltransferase 75C1-like [Camelina sativa]
Length=454

 Score =   369 bits (948),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 208/467 (45%), Positives = 297/467 (64%), Gaps = 33/467 (7%)
 Frame = -3

Query  1482  GC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             GC    H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA
Sbjct  7     GCPRYPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMREPPSTKGLSFA  66

Query  1314  PFSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGV  1141
              F+DG+D G++ + D K + + +K  GS+ ++ +I A  +    P T +IY+  + WA  
Sbjct  67    WFTDGFDDGVKSSKDQKIYMSELKRCGSNGLSDIIRANLDANLEPITGVIYSVFVPWAAT  126

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
             VAR  H+P TLLW +PATVLDIYY+YF T Y  LF        +++P +P +   D PSF
Sbjct  127   VAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLF----DTDPIKLPKLPLITTGDLPSF  182

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  ++      L  A+  +++ IE +  E NPK+LVNTF ALE DAL +++K+RM+ IGP
Sbjct  183   LQPSKA-----LPSALVTLKEHIEALESEPNPKILVNTFSALEHDALTSVEKLRMIPIGP  237

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSND-YVEWLDSQPKSSVVYLAFGSYA-DVPNTMLEE  610
             L+ S+  DG+         DL ++S+D Y +WLDS+   SVVY++ G++A D+P   +E 
Sbjct  238   LVSSSS-DGK--------ADLFKSSDDDYTKWLDSKLDKSVVYVSLGTHAEDLPEKHMEA  288

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEA--QGKIVRWCAQVEVLQHPSIGC  436
             +  G++ +  PFLW++RE ++    E K R  E +    +G +  WC+Q  VL H S+GC
Sbjct  289   LTHGVLATNRPFLWIVREKNQ----ENKNRFLEMIRGVERGLVGDWCSQTAVLAHRSVGC  344

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNSTLESL SGVP+VA P + DQ   +KL++D W++GV+V  +E+G V  +E +
Sbjct  345   FVTHCGWNSTLESLESGVPVVAFPQFADQCTASKLVEDAWRIGVKVKVDEDGHVAGEEVR  404

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             RC+E VM  GE+ EE+R  A KW +LA  A  + G S LNLK +++E
Sbjct  405   RCLERVMSEGEEAEEMRECAAKWMKLAVDAAVEGGPSDLNLKGFVEE  451



>ref|XP_004253165.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Solanum 
lycopersicum]
Length=465

 Score =   370 bits (949),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 196/469 (42%), Positives = 283/469 (60%), Gaps = 18/469 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M   H L++  PAQGHINP+LQ AK L   GA+ T  T    ++RM++ P   GL ++ F
Sbjct  1     MNKQHFLVISLPAQGHINPTLQLAKNLARAGARATFITTVYGLSRMNNLPTQDGLFYSSF  60

Query  1308  SDGYD--AGLEPADLKDFWAS-MKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             SDG D  + +      D++ + +K  GS  +  L+    +EG P T L+YT ++ W  VV
Sbjct  61    SDGCDDDSWMNSNSTVDYFMNDLKINGSKNLRDLVRKYSDEGHPVTFLVYTILLPWVAVV  120

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVV------EVPGVPALGVRD  976
             AR +HVP   L  Q  T   IYYH       ++ N S +  V      E+P +P     D
Sbjct  121   AREIHVPSAFLVIQCGTAFAIYYHLLNSTNGVYSNSSSDFTVMPSFPIEIPELPLFSCND  180

Query  975   FPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMV  796
              P+ +       N+     I  +R+ I+++  + N  VL+NTF+ALE  ++R I K R+ 
Sbjct  181   IPTIVLPN----NHLSSIMIPILREHIQNLENDPNSYVLINTFNALEEKSMRVIDKFRLF  236

Query  795   GIGPLIPSAYLDGEDPSDTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTM  619
              IGPL+PSA+ DG DP D +FG +L  +   +Y +WLDS+ + SVVY++FGS A +    
Sbjct  237   SIGPLVPSAFSDGNDPKDKSFGCELFDKPEKNYHQWLDSRHEGSVVYVSFGSLAVLKKEQ  296

Query  618   LEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL--EAQGKIVRWCAQVEVLQHPS  445
               EI +GL++S+ PFLW  R   + E  ++ L C + +  E  G IV WC+Q+EVL H S
Sbjct  297   EREILRGLLESERPFLWT-RRKGEDEGKKKNLECDDVITDEKLGLIVPWCSQMEVLCHKS  355

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             IGCF+THCGWNSTLESL SGVP+V  P ++DQ  NAK++++VW +GVRV    EG+VK +
Sbjct  356   IGCFVTHCGWNSTLESLVSGVPIVGYPQFSDQTTNAKMLEEVWGIGVRVKE-VEGLVKKE  414

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             E KRC+  +M  GEKGEE++ N KKW+ LA  A+K  GSS+ N+K +++
Sbjct  415   ELKRCLGILMENGEKGEEIKKNVKKWRNLALDALKIGGSSHDNIKKFIE  463



>ref|XP_010434517.1| PREDICTED: UDP-glycosyltransferase 75D1 [Camelina sativa]
Length=474

 Score =   369 bits (948),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 202/488 (41%), Positives = 298/488 (61%), Gaps = 54/488 (11%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLDFA  1315
             G H L V +PAQGHINPSLQ AKRL       +VT +   SA NR M S+  + + L F+
Sbjct  11    GPHFLFVTYPAQGHINPSLQLAKRLAGTISNGRVTFAAPISAYNRRMFSQENVPETLTFS  70

Query  1314  PFSDGYDAGLEPAD---------LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G + +          + ++ + M+ RG + + +LI   +++ RPFT ++YT 
Sbjct  71    TYSDGHDDGFKSSTSFDKSPQEAVANYMSDMRRRGKETLTELIEDNRKQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPAL  988
             +++W   +AR +H+P  LLW QP TV  I+YHYF  Y D       N    +++P +P L
Sbjct  131   LLTWVSELAREIHLPSALLWVQPVTVFSIFYHYFHGYEDAISEMGNNPSSSIQLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              VRD PSF+ S+         + + A RDQ+E +  E NPK+L+N+F  LE +A+ ++  
Sbjct  191   CVRDLPSFIVSSNAYA-----FLLPAFRDQLESLKEEANPKILINSFQELEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSN---DYVEWLDSQPKSSVVYLAFGSY  640
               ++V IGPL+                  LR +S+   +Y+EWLD++  SSV+Y++FG+ 
Sbjct  246   NYKIVPIGPLL-----------------TLRTDSSSRGEYIEWLDTKADSSVIYISFGTL  288

Query  639   ADVPNTMLEEIAQGLVKSKMPFLWVLRETS---KGEKPEEKLRC----KEELEAQGKIVR  481
             A +    L E+ + L++S+ PFLWV+ + S   + ++ E++  C    +EEL+  G +V 
Sbjct  289   AVLTKKQLGELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVS  348

Query  480   WCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVR  301
             WC Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P W DQ  NAKL++D WK GVR
Sbjct  349   WCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQMTNAKLLEDCWKTGVR  408

Query  300   V--SANEEGV--VKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNL  133
             V    +EEGV  V+++E +RCI+ VM   EK EE R NA +WK+LA  A+++ GSS+ +L
Sbjct  409   VMEKKDEEGVVLVESEEIRRCIDEVM--EEKAEEFRGNAARWKDLAAEAVREGGSSFNHL  466

Query  132   KAYMDEML  109
             KA+ DE +
Sbjct  467   KAFADEHM  474



>ref|XP_006373420.1| hypothetical protein POPTR_0017s13620g [Populus trichocarpa]
 gb|ERP51217.1| hypothetical protein POPTR_0017s13620g [Populus trichocarpa]
Length=460

 Score =   368 bits (945),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 189/464 (41%), Positives = 289/464 (62%), Gaps = 10/464 (2%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGA-KVTLSTGFSAMNRMSSRPEIQGLDFAP  1312
             ME  H LL+  P QGHINP  Q  K L++ GA +VT +T    + ++ + P ++ L +A 
Sbjct  1     MENKHFLLICMPGQGHINPMFQLGKCLIHAGAGRVTFATTAHGLTQVEAFPSLENLHYAS  60

Query  1311  FSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FSDG+D G++P  D     A +K  GS  + +L+ +  +EG P + LIYT ++ WA  +A
Sbjct  61    FSDGFDDGIKPTNDPHRIMAELKRVGSQTLTELLLSLSKEGNPVSYLIYTLLLPWAADIA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPALGVRDFPSFL  961
             R + +P   L     T   + Y +F E   ++ +        +E+PG+P    +D PSFL
Sbjct  121   RDMSIPSAFLCILSTTAFALCYCFFEERDGVYDSNDNRPPSSIEMPGLPLFTSKDMPSFL  180

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                + + +      I   +  I+ +  + NP VL+NT D +E +A+R I  +  + IGPL
Sbjct  181   LPNDPHAST----LIPIFQHHIQALEKDSNPCVLLNTSDCVEEEAIRLISNLNPIPIGPL  236

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +  A+LD  + +D++ G DL + S +Y +WL+S+P+ SVVY++FGS A +    +E+I  
Sbjct  237   VSYAFLDENNSTDSSCGIDLFEKSAEYSQWLNSKPEGSVVYVSFGSLAVLQRNQMEKILL  296

Query  600   GLVKSKMPFLWVLRETSKGEKP-EEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
             GL  +  PFLWV+R +   ++  EEK+R K   E  G IV WC+Q+EVL H SIGCF+ H
Sbjct  297   GLTSNCRPFLWVIRPSGSNDREFEEKIRDKVNEEV-GLIVPWCSQMEVLTHESIGCFMMH  355

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESLA+GVP+V  P ++DQ  NAK++++VW+ GVR   NE+G ++A+E  RC++
Sbjct  356   CGWNSTLESLATGVPVVGFPQFSDQTTNAKMVEEVWRTGVRARVNEDGTLEAEEIARCLD  415

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMGGG++GEE+R NAKKWK L   A+ + GSSY NL A+++++
Sbjct  416   MVMGGGQRGEEIRRNAKKWKGLTLEAVMEGGSSYNNLNAFLEKI  459



>emb|CDP21504.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   368 bits (944),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 277/467 (59%), Gaps = 15/467 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             ME  H L+   P+QGHINP+LQ AK L   GA+VT +T     +R+ + P    L FA F
Sbjct  1     MEHQHFLITALPSQGHINPTLQLAKNLARTGAQVTFATTVYGFSRIRNLPASGCLSFASF  60

Query  1308  SDGYD--AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDGYD     +  D   F +  K  G   + KLI    +EGRP T LIYT ++ W   VA
Sbjct  61    SDGYDDEKSQKNRDFTSFSSDTKRFGYKDLTKLIQTTSKEGRPVTFLIYTVMLPWVAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFR-----NCSGNQVVEVPGVPALGVRDFP  970
             R +H+P   L  Q AT   IY+ YF  +   +       CS   + ++P +P     D P
Sbjct  121   REMHIPSAFLAIQSATTFAIYHRYFNSHDGFYDGVREVECSSISI-KLPDLPLFEKEDLP  179

Query  969   SFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGI  790
             +FL   +    + + +      + I+ +  +  P VLVNTF+ LE  +++A+  + ++ I
Sbjct  180   TFLLPNDQFFAFTVPF----FHEHIKILEQDSKPCVLVNTFNELEESSIKAVDGMNLISI  235

Query  789   GPLIPSAYLDGEDPSDTAFGGDLRQN-SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPLIPSA+ D  D +D + GGDL    S  +++WLD +P+ SV+Y++FGS   +      
Sbjct  236   GPLIPSAFSDRNDLTDKSIGGDLFDTPSKGFLQWLDPKPERSVIYVSFGSLVALKKAEKI  295

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             EI  GL ++   +L VL+  S  E+ E K   +     +G IV WC+Q+EVL H SIGCF
Sbjct  296   EILHGLEEAGRAYLLVLQ--SDNEEEEVKAMIENASSEEGMIVPWCSQLEVLCHRSIGCF  353

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             +THCGWNSTLES+ +GVP+V CP  +DQ  NAKLI++VW +GVR  ANEEGVV+  E +R
Sbjct  354   ITHCGWNSTLESIVAGVPIVGCPHLSDQTTNAKLIEEVWGIGVRAKANEEGVVERAEIRR  413

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             C++ VMGG E GEE+R N+ KW+ +A  A+K++GSS+ N + ++ ++
Sbjct  414   CLDIVMGGDENGEEIRRNSAKWRCMAIEAVKENGSSHNNFRNFLQKL  460



>ref|XP_006285715.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
 gb|EOA18613.1| hypothetical protein CARUB_v10007186mg [Capsella rubella]
Length=475

 Score =   369 bits (946),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 292/489 (60%), Gaps = 51/489 (10%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLD  1321
             + G H L V FPAQGHINP L+ AKR      GA+VT +   SA NR M S+  + + L 
Sbjct  9     LAGPHFLFVTFPAQGHINPCLELAKRFAGTIPGARVTFAAPVSAYNRRMFSQENVPETLT  68

Query  1320  FAPFSDGYDAGLEPADLKD---------FWASMKTRGSDAVAKLITAKKEEGRPFTRLIY  1168
             FA +SDGYD G + +   D         + + M+ RG + +A+LI   + + RPFT L+Y
Sbjct  69    FATYSDGYDDGYKSSTSTDKSRQDAAANYMSDMRRRGKETLAELIEDNRRQNRPFTCLVY  128

Query  1167  TSIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVP  994
             T +++W   +AR +H+P  LLW QP TVL I+YHYF  Y D       N    +++P +P
Sbjct  129   TILLTWVAELAREIHLPSALLWVQPVTVLSIFYHYFNGYEDALSELGNNPSGSIQLPSLP  188

Query  993   ALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI  814
              L +RD PSF+ S+         + I A R+QIE +  E NPK+L+NTF  LE +A+ ++
Sbjct  189   LLCLRDLPSFILSSNVYA-----FLIPAFREQIESLKEEANPKILINTFQELEPEAMSSV  243

Query  813   -KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYA  637
                +++V IGPLI                 D   + ++Y+EWLD++P SSV+Y++FG+ A
Sbjct  244   PDNIKIVPIGPLI-------------TLRTDSSSHGHEYIEWLDTKPDSSVLYVSFGTLA  290

Query  636   DVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRC---------KEELEAQGKIV  484
              +    L E+ + L+KS+ PFLWV+  T K  + +E             +EEL+  G +V
Sbjct  291   VLIKKQLVELCKALIKSRRPFLWVI--TDKFYRSKEDELEKEEDLISSFREELDEIGMVV  348

Query  483   RWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGV  304
              WC Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P WNDQ  NAKL++D WK GV
Sbjct  349   SWCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQLTNAKLLEDSWKTGV  408

Query  303   RV--SANEEG--VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLN  136
             RV    +EEG  VV ++E  RCI       EK EE R NA++WK+LA  A+++ GSS+ N
Sbjct  409   RVMEKKDEEGAVVVDSEEIGRCI--EEVMEEKAEEFRRNAERWKDLAAEAVREGGSSFNN  466

Query  135   LKAYMDEML  109
             LKA+ +E +
Sbjct  467   LKAFANEHM  475



>ref|XP_010450109.1| PREDICTED: UDP-glycosyltransferase 75C1 [Camelina sativa]
Length=454

 Score =   367 bits (943),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 207/467 (44%), Positives = 298/467 (64%), Gaps = 33/467 (7%)
 Frame = -3

Query  1482  GC----HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFA  1315
             GC    H LLV FPAQGHINP+LQ A RL++ GA VT ST  SA  RM   P  +GL FA
Sbjct  7     GCPRYPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAISAHRRMGEPPSTKGLSFA  66

Query  1314  PFSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEG-RPFTRLIYTSIMSWAGV  1141
              F+DG+D G++ + D K + + +K  GS+ ++ +I    +    P T +IY+ ++ WA  
Sbjct  67    WFTDGFDDGVKSSKDQKIYMSELKRCGSNGLSDIIRVNLDANTEPITGVIYSVLVPWAAT  126

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYF-TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
             VAR  H+P TLLW +PATVLDIYY+YF T Y  LF        +++P +P +   D PSF
Sbjct  127   VARKFHLPTTLLWIEPATVLDIYYYYFNTSYKHLF----DTDPIKLPKLPLITTGDLPSF  182

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGP  784
             L  ++      L  A+  +++ IE +  E NPK+LVNTF ALE DAL +++K+RM+ IGP
Sbjct  183   LQPSKA-----LPSALVTLKEHIEALEPEPNPKILVNTFSALEHDALTSVEKLRMIPIGP  237

Query  783   LIPSAYLDGEDPSDTAFGGDLRQNSN-DYVEWLDSQPKSSVVYLAFGSYA-DVPNTMLEE  610
             L+ S+  DG+         DL ++S+ DY +WLDS+   SVVY++ G++A D+P   +E 
Sbjct  238   LVSSSS-DGK--------ADLFKSSDEDYTKWLDSKLDKSVVYVSLGTHAEDLPEKHMEA  288

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEA--QGKIVRWCAQVEVLQHPSIGC  436
             +  G++ +  PFLW++RE    + P++K R  E +    +G +V WC+Q  VL H S+GC
Sbjct  289   LTHGVLATNRPFLWIVRE----KNPQDKNRFLELIRGVERGLVVDWCSQTAVLAHRSMGC  344

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNSTLESL SGVP+VA P + DQ   +KL++D W++GV+V   E+G V  +E +
Sbjct  345   FVTHCGWNSTLESLESGVPVVAFPQFADQCTTSKLVEDAWRIGVKVKVGEDGHVDGEEVR  404

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             RC+E VM   E+ EE+R +A KW +LA  A  + G S LNLK +++E
Sbjct  405   RCLERVMSESEEAEEMRESAAKWMKLAVDAAVEGGPSDLNLKGFVEE  451



>ref|XP_010440288.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=473

 Score =   367 bits (943),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 202/487 (41%), Positives = 293/487 (60%), Gaps = 53/487 (11%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLDFA  1315
             G H L V +PAQGHINPSL+ AKRL       +VT +   SA +R M S+  + + L FA
Sbjct  11    GPHFLFVTYPAQGHINPSLELAKRLAGTISNGRVTFAAPISAYHRRMFSQENVPETLTFA  70

Query  1314  PFSDGYDAGLEPAD---------LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G + ++         + ++ + M+ RG + + +LI   + + RPFT ++YT 
Sbjct  71    TYSDGHDDGFKSSNSFDKSPQDAIANYMSDMRRRGKETLTELIEDNRRQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGN--QVVEVPGVPAL  988
             +++W   +AR +H+P  LLW QP TV  I+YHYF  Y D       N    +++P +P L
Sbjct  131   LLTWVAELAREIHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMGDNPSSSIKLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              +RD PSFL S+         + + A RDQ+E +  E NPK+L+N+F ALE +A+ ++  
Sbjct  191   TLRDLPSFLVSSNAYA-----FLLPAFRDQLESMEEEANPKILINSFQALEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSND---YVEWLDSQPKSSVVYLAFGSY  640
               ++V IGPL+                  LR  S+    Y+EWLD++  SSVVY++FG+ 
Sbjct  246   NYKIVPIGPLL-----------------TLRTGSSSHSKYIEWLDTKSDSSVVYVSFGTI  288

Query  639   ADVPNTMLEEIAQGLVKSKMPFLWVLRETS---KGEKPEEKLRC----KEELEAQGKIVR  481
             A +    L E+ + L++S+ PFLWV+ + S   + ++ E++  C    +EEL+  G +V 
Sbjct  289   AVLNKKQLVELCKALIQSRRPFLWVITDKSYRSREDEKEKEEDCIKSFREELDEIGMVVS  348

Query  480   WCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVR  301
             WC Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P W DQ  NAKL++D WK GVR
Sbjct  349   WCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWTDQMTNAKLLEDCWKTGVR  408

Query  300   V---SANEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLK  130
             V     +E  +V+ +E +RCIE VM G  K EE R NA +WK+LA  AM + GSS+ +LK
Sbjct  409   VMEKKDDEVVLVEGEEIRRCIEEVMEG--KAEEFRGNAARWKDLAAEAMSEGGSSFNHLK  466

Query  129   AYMDEML  109
             A+ DE +
Sbjct  467   AFADEHM  473



>gb|EYU31585.1| hypothetical protein MIMGU_mgv1a007491mg [Erythranthe guttata]
Length=405

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/398 (51%), Positives = 272/398 (68%), Gaps = 20/398 (5%)
 Frame = -3

Query  1275  DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHVPVTLLWTQ  1096
             D   +   +++RGS ++   I A  E+GRP T+L+YT ++ WA  VAR  HVP  LLW Q
Sbjct  16    DAGKYMTEIRSRGSQSLRDTILAAAEQGRPVTQLVYTLLLPWAPEVAREFHVPSALLWIQ  75

Query  1095  PATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGV--RDFPSFLFSTETNVNYDL  928
             PATVL+IYY+YF  YGD     S +     + PG+PAL    RD PSF+  + ++     
Sbjct  76    PATVLNIYYYYFNGYGDEITANSNDPTWHFQFPGIPALNFSKRDLPSFVLPSSSD---KY  132

Query  927   DWAIEAMRDQIEDINGE-ENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYLDGED  751
              +A+ + ++Q+E ++ E   PKVLVNTFDALE  AL++I K  + G+GPLIPSA      
Sbjct  133   SFALPSFKEQLETLDAEILKPKVLVNTFDALEPHALKSIDKYELFGVGPLIPSA------  186

Query  750   PSDTAFGGDLRQNSND-YVE-WLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSKMP  577
             PS+ +F GDL + S+D  VE WL+S+P+SSVVY++FGS   +P   +E++A+GL++S  P
Sbjct  187   PSEKSFRGDLFEKSDDNSVELWLNSKPESSVVYVSFGSILKLPKAQMEKVAKGLLESDRP  246

Query  576   FLWVLR---ETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
             FLWV+R   +    E+ EEKL C +ELE  GKIV WC+Q+EVL HPSIGCF++HCGWNST
Sbjct  247   FLWVIRTNEDKKNEEEEEEKLSCLDELEKIGKIVPWCSQLEVLTHPSIGCFVSHCGWNST  306

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWK-LGVRVSANEEGVVKADEYKRCIECVMGG  229
             LESL+SGVP+VA P W DQ  NAKLI+DVWK          +GVV++ E KRCIE VM G
Sbjct  307   LESLSSGVPVVAFPQWTDQGTNAKLIEDVWKSGVRVRGVGGDGVVESGEIKRCIEEVMDG  366

Query  228   GEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDE  115
             G++  ELR NA++WK LA+GAM ++GSS  NLK ++DE
Sbjct  367   GKRSRELRANAREWKSLARGAMDENGSSCKNLKDFLDE  404



>gb|AAB58497.1| UDP-glucose:indole-3-acetate beta-D-glucosyltransferase [Arabidopsis 
thaliana]
Length=474

 Score =   367 bits (942),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/485 (41%), Positives = 288/485 (59%), Gaps = 48/485 (10%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR--MSSRPEIQGLDFA  1315
             G H L V FPAQGHINPSL+ AKRL     GA+VT +   SA NR   S+    + L FA
Sbjct  11    GPHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRRMFSTENVPETLIFA  70

Query  1314  PFSDGYDAGLEPADLKD---------FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDG+D G + +   D         F + M+ RG + + +LI   +++ RPFT ++YT 
Sbjct  71    TYSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG--NQVVEVPGVPAL  988
             +++W   +AR  H+P  LLW QP TV  I+YHYF  Y D     +   +  +++P +P L
Sbjct  131   LLTWVAELAREFHLPSALLWVQPVTVFSIFYHYFNGYEDAISEMANTPSSSIKLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              VRD PSF+ S+         + + A R+QI+ +  E NPK+L+NTF  LE +A+ ++  
Sbjct  191   TVRDIPSFIVSSNVYA-----FLLPAFREQIDSLKEEINPKILINTFQELEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADV  631
               ++V +GPL+                 D   +  +Y+EWLD++  SSV+Y++FG+ A +
Sbjct  246   NFKIVPVGPLL-------------TLRTDF-SSRGEYIEWLDTKADSSVLYVSFGTLAVL  291

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKL-------RCKEELEAQGKIVRWCA  472
                 L E+ + L++S+ PFLWV+ + S   K +E+          ++  +  G +V WC 
Sbjct  292   SKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSSEKSFDEIGMVVSWCD  351

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--  298
             Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P WNDQ  NAKL++D WK GVRV  
Sbjct  352   QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMTNAKLLEDCWKTGVRVME  411

Query  297   SANEEGVVKAD--EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAY  124
                EEGVV  D  E +RCIE VM   +K EE R NA +WK+LA  A+++ GSS+ +LKA+
Sbjct  412   KKEEEGVVVVDSEEIRRCIEEVM--EDKAEEFRGNATRWKDLAAEAVREGGSSFNHLKAF  469

Query  123   MDEML  109
             +DE +
Sbjct  470   VDEHM  474



>ref|XP_006415092.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
 gb|ESQ33445.1| hypothetical protein EUTSA_v10007589mg [Eutrema salsugineum]
Length=458

 Score =   367 bits (941),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 203/470 (43%), Positives = 284/470 (60%), Gaps = 39/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMN--RMSSRPEIQGLDFAPFS  1306
             H LLV  PAQGH+NPSL+FA+RL+   GA+VT  T  S  +  R+ +   I  L F  FS
Sbjct  5     HFLLVTLPAQGHVNPSLRFARRLIRTTGARVTFVTCISIFHCSRIPNHHNIDNLSFLTFS  64

Query  1305  DGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G+     D+++   ++K  G   +++ I A +    P T LIYT + SW   +AR
Sbjct  65    DGFDDGVISTTDDVQNRLLNLKRNGDKTLSEFIEANRNGDSPVTCLIYTILPSWVPKLAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
               H+P  LLW QPA V  +YY++ +       N SG    E P +P L +RD PSF+  +
Sbjct  125   RFHLPSVLLWIQPALVFHVYYNHLS------VNSSG---FEFPNLPILKIRDLPSFISPS  175

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              TN N     A     + +E +  E N +VL NTFD+LE +AL AI+ + MV +GPL+P 
Sbjct  176   NTNKN-----AQAVYVELMEFLKEESNLRVLFNTFDSLEPEALTAIQNIEMVAVGPLLPE  230

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                      D   G    ++ + Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L+
Sbjct  231   ---------DIFKGSKSVKDQSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALI  281

Query  591   KSKMPFLWVLRETSKGE---------KPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIG  439
               K PFLWV+ E S  E         + E+    K ELE  G IV WC+QVEVL+H +IG
Sbjct  282   DGKRPFLWVITEKSNREAKIEGEDETEIEKIAEFKHELEEVGMIVSWCSQVEVLRHQAIG  341

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+ HCGW+STLESL  GVP+VA P+W+DQ  NAKL+++ WK GV+V  NEEG+V+  E 
Sbjct  342   CFVNHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEEKWKTGVKVRENEEGLVERGEI  401

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +RC+E VM   EK EEL+ NA+KWK LA  A K++GSS  NL A++D +L
Sbjct  402   RRCLEAVM--VEKAEELKVNAEKWKRLAVEAGKEEGSSDKNLVAFVDSVL  449



>ref|XP_009119145.1| PREDICTED: UDP-glycosyltransferase 75B1 [Brassica rapa]
Length=472

 Score =   367 bits (941),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/472 (43%), Positives = 294/472 (62%), Gaps = 34/472 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA+VT  T  S  +R  +S   ++  L F  FS
Sbjct  6     HFLLVTFPAQGHVNPSLRFARRLIRTTGARVTFVTCASVFHRSMISKHSDLDNLSFLTFS  65

Query  1305  DGYD-AGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D  GL  A DLK   A++K  G  A+++ I   K+   P T L+YT +++WA  VA 
Sbjct  66    DGFDQGGLTTAEDLKSRSANLKNNGEKALSEFIEGNKKGDSPVTCLVYTILLNWAPKVAS  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
                +P  LLW QPA V +IYY++    GD     + N  +E   + ++  RD PSFL   
Sbjct  126   RFQLPSALLWIQPALVFNIYYNHIN--GD-----NNNSCLEFKNLSSIATRDLPSFLTPA  178

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              TN       A ++ ++ +E +  E NPK+LVNTFD+LE +AL+A+  V MV +GPL+PS
Sbjct  179   NTN-----QGAYKSFQELMELLKEETNPKILVNTFDSLEQEALKALPSVGMVAVGPLLPS  233

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                  E   D +        S+ Y  WLDS+ +SSV+Y++FG+  ++    + E+A+ L+
Sbjct  234   EMFT-ESVKDLS-----NDQSSSYSRWLDSKTESSVIYVSFGTMVELSKKQIGELARALI  287

Query  591   KSKMPFLWVLRETS------KGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSIG  439
             + K PFLWV+ + S      +GE   E  +    + ELE  G IV WC+QVEVL+H ++G
Sbjct  288   EGKRPFLWVITDKSNREAKLEGEDETEIEKIAGFRHELEEVGMIVSWCSQVEVLRHRAVG  347

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+THCGW+STLESL  GVP+VA P+W+DQ  NAKL++++W  GVRV  NEEG+V+  E 
Sbjct  348   CFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWGTGVRVRENEEGLVERGEI  407

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             +RC+E VM   EK  +LR NA++W+ LA  A ++ GS   N++A++DE+L S
Sbjct  408   RRCLEAVM--DEKLVKLRGNAEEWRRLAVEAGREGGSCDKNIEAFVDEILLS  457



>ref|XP_010434494.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   366 bits (940),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 205/485 (42%), Positives = 296/485 (61%), Gaps = 48/485 (10%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLDFA  1315
             G H L V FP QGHINPSL+ AKRL     GA+VT +   SA NR M S+  + + L FA
Sbjct  11    GPHFLFVTFPTQGHINPSLELAKRLAGTISGARVTYAAPISAYNRRMFSQENVPETLTFA  70

Query  1314  PFSDGYDAGLEPAD-----LKD----FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDGYD G + +      L+D    F + M+  G + + +LI   + + RPFT ++YT 
Sbjct  71    TYSDGYDDGYKSSTSSKKSLQDATANFMSDMRRHGKETLTELIEDNRRQNRPFTCVVYTI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPAL  988
             +++W   +AR +H+P  LLW QP TV  I YHYF  Y D       N    +++P +P L
Sbjct  131   LLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGYEDAISEMGNNPSGSIQLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              +RD PSFL S+         + +  +R+Q+E +  E NPK+L+NTF  LE +A+ ++  
Sbjct  191   TLRDLPSFLVSSNAYA-----FLLPVLREQLESLKEEANPKILINTFKELEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADV  631
               +++ IGPL+            T   G   Q+  +Y+EWLD++  SSV+Y++FG+ A +
Sbjct  246   NYKVIPIGPLL------------TLRTGSSSQS--EYIEWLDTKADSSVLYVSFGTVAVL  291

Query  630   PNTMLEEIAQGLVKSKMPFLWVLRETS---KGEKPEEKLRC----KEELEAQGKIVRWCA  472
                 L E+ + L++S+ PFLWV+ + S   KG++ E++  C    +EEL+  G +V WC 
Sbjct  292   TKKQLVELCKALIQSRRPFLWVITDKSYKSKGDEQEKEEDCISSFREELDEIGMVVSWCD  351

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRV--  298
             Q  VL H SIGCF+THCGWNSTLESL SGVP+VA P   DQ  NAKL++D WK GVRV  
Sbjct  352   QFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQCTDQMTNAKLLEDCWKTGVRVME  411

Query  297   SANEEG--VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAY  124
               +EEG  VV+++E +RCI+ V+   EK EE R NA +WK+LA  A+++ GSS+ +LKA+
Sbjct  412   KKHEEGAVVVESEEIRRCIKEVI--EEKAEEFRGNAARWKDLAAEAVREGGSSFNHLKAF  469

Query  123   MDEML  109
              DE +
Sbjct  470   ADEHM  474



>gb|KCW57754.1| hypothetical protein EUGRSUZ_H00503, partial [Eucalyptus grandis]
Length=404

 Score =   363 bits (933),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 273/428 (64%), Gaps = 37/428 (9%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV    +  +NP+LQ A+RL  +G++VT  +   A   M      +G+ F  FSDGY
Sbjct  5     HFLLVALSTRSAMNPALQLAERLARVGSRVTFLSTVCAHRCMIDPVCPEGVTFTTFSDGY  64

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G  P D L+ + A MK RGS+A+  LI                  M W   VAR L +
Sbjct  65    DDGYVPGDDLERYRAEMKRRGSEALRDLIEH----------------MPWVHDVARSLQI  108

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRN-----CSGNQVVEVPGVPALGVRDFPSFLFS  955
                L+W QPATV DIYYHYF+ Y D+ ++     C    ++ +PGVP L  R+ PSFL  
Sbjct  109   KSVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNRNIPSFL--  166

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKV-LVNTFDALEFDALRAIKKVRMVGIGPLI  778
                +V     +A+  ++  +E++   ENPKV LVNTFDALE +ALRAI  + +VGIGPL+
Sbjct  167   ---HVENKYAFALPEIQSLLENLKEGENPKVVLVNTFDALELEALRAIGTLNLVGIGPLV  223

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             P ++LD    SD +  GD    S DYV+WL+++ ++SV+Y+AFGS A +      E+A+G
Sbjct  224   PLSFLD----SDQSSRGDRFLGSEDYVKWLNAKEEASVIYVAFGSIAMLSKAQKREMARG  279

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             L+++  PFLWV+    KG+  +++L  KEE++ +G IV WC+Q+EVL HPSIGCFLTHCG
Sbjct  280   LLETGRPFLWVM---GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVLSHPSIGCFLTHCG  336

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVS-ANEEG-VVKADEYKRCIE  244
             WNST+ESL  G+P+VA P W DQ  NAKL++DVWK+GVRVS  ++EG +V+A E K+C+E
Sbjct  337   WNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSEIDQEGIIVEAGEIKKCLE  396

Query  243   CVMGGGEK  220
              VMGGGE+
Sbjct  397   LVMGGGER  404



>ref|NP_172044.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 sp|Q9ZVY5.1|U75B2_ARATH RecName: Full=UDP-glycosyltransferase 75B2; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 2; AltName: Full=IAA-Glu synthase 2; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AAF79732.1|AC005106_13 T25N20.18 [Arabidopsis thaliana]
 gb|AEE27849.1| UDP-glucosyl transferase 75B2 [Arabidopsis thaliana]
 gb|AHL38969.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score =   365 bits (938),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 201/477 (42%), Positives = 286/477 (60%), Gaps = 39/477 (8%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDF  1318
             M   H LLV FPAQGH+NPSL+FA+RL+   GA+VT +T  S ++R  + +   ++ L F
Sbjct  1     MAQPHFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVIHRSMIPNHNNVENLSF  60

Query  1317  APFSDGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
               FSDG+D G+     D+++     +  G  A++  I A +    P + LIYT + +W  
Sbjct  61    LTFSDGFDDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVP  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR  H+P   LW QPA   DIYY+Y T           N V E P +P+L +RD PSF
Sbjct  121   KVARRFHLPSVHLWIQPAFAFDIYYNYST---------GNNSVFEFPNLPSLEIRDLPSF  171

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEE-NPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             L  + TN       A +A+  ++ D   EE NPK+LVNTFD+LE + L AI  + MV +G
Sbjct  172   LSPSNTNK------AAQAVYQELMDFLKEESNPKILVNTFDSLEPEFLTAIPNIEMVAVG  225

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQN--SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             PL+P+    G +      G DL ++  S+ Y  WLDS+ +SSV+Y++FG+  ++    +E
Sbjct  226   PLLPAEIFTGSES-----GKDLSRDHQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIE  280

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRC---------KEELEAQGKIVRWCAQVEV  460
             E+A+ L++   PFLWV+ +    E   E             + ELE  G IV WC+Q+EV
Sbjct  281   ELARALIEGGRPFLWVITDKLNREAKIEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEV  340

Query  459   LQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEG  280
             L+H +IGCFLTHCGW+S+LESL  GVP+VA P+W+DQ  NAKL++++WK GVRV  N EG
Sbjct  341   LRHRAIGCFLTHCGWSSSLESLVLGVPVVAFPMWSDQPANAKLLEEIWKTGVRVRENSEG  400

Query  279   VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +V+  E  RC+E VM    K  ELR NA+KWK LA  A ++ GSS  N++A++  + 
Sbjct  401   LVERGEIMRCLEAVMEA--KSVELRENAEKWKRLATEAGREGGSSDKNVEAFVKSLF  455



>dbj|BAC54093.1| anthocyanin 5-glucosyltransferase [Torenia hybrid cultivar]
Length=478

 Score =   366 bits (939),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 212/481 (44%), Positives = 297/481 (62%), Gaps = 36/481 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGA--KVTLSTGFSAMNRMSSRPEIQG-LDFAPFS  1306
             H+LL  FPAQGHINPSL+FAKRL+N G   +VT  T   A+ RM    +    +DF    
Sbjct  6     HILLATFPAQGHINPSLEFAKRLLNTGYVDQVTFFTSVYALRRMRFETDPSSRIDFVAXX  65

Query  1305  DGYDAGLEPADL-KDFWASMKTRGS----DAVAKLITAK--KEEGRPFTRLIYTSIMSWA  1147
             D YD GL+  D  K++ + M+ RG+    D + KL  A    E     + ++Y+ + SWA
Sbjct  66    DSYDDGLKKGDDGKNYMSEMRKRGTKALKDTLIKLNDAAMGSECYNRVSFVVYSHLFSWA  125

Query  1146  GVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPS  967
               VAR + VP  LLW +PATV D+YY YF  Y D     +G+  +++P +P L  +D PS
Sbjct  126   AEVAREVDVPSALLWIEPATVFDVYYFYFNGYADDID--AGSDQIQLPNLPQLSKQDLPS  183

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL  +       L      M+++ + ++ E   KVL+NTFDALE + L+AI +  ++ IG
Sbjct  184   FLLPSSPARFRTL------MKEKFDTLDKEPKAKVLINTFDALETEQLKAIDRYELISIG  237

Query  786   PLIPSA-YLDGEDPSDT--AFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTM  619
             PLIPS+ + DG DPS +  ++GGDL R+    Y++WL+S+P+SSVVY++FGS   +P   
Sbjct  238   PLIPSSIFSDGNDPSSSNKSYGGDLFRKADETYMDWLNSKPESSVVYVSFGSLLRLPKPQ  297

Query  618   LEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL--------EAQGKIVRWCAQVE  463
             +EEIA GL  +K P LWV+R   +G++ E+    ++ L        E  GKIV WC+Q++
Sbjct  298   MEEIAIGLSDTKSPVLWVIRRNEEGDEQEQAEEEEKLLSFFDRHGTERLGKIVTWCSQLD  357

Query  462   VLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEE  283
             VL H S+GCF+THCGWNS +ESLA GVP+V  P W DQ  NAK+I+DVW+ GVRV  NEE
Sbjct  358   VLTHKSVGCFVTHCGWNSAIESLACGVPVVCFPQWFDQGTNAKMIEDVWRSGVRVRVNEE  417

Query  282   -GVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDD-GSSYLNLKAYMDEML  109
              GVV   E KRC+  V+    K  ELR +A  WK LAK AM ++ GSS  NLK ++  ++
Sbjct  418   GGVVDRREIKRCVSEVI----KSRELRESAMMWKGLAKEAMDEERGSSMNNLKNFITRII  473

Query  108   S  106
             +
Sbjct  474   N  474



>ref|XP_008458151.1| PREDICTED: anthocyanidin 3-O-glucoside 5-O-glucosyltransferase 
2-like [Cucumis melo]
Length=465

 Score =   365 bits (937),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 186/467 (40%), Positives = 273/467 (58%), Gaps = 18/467 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             HVLLV     GH NP L  A  L + G  VT +T  S + R+   P    L FA FSDG 
Sbjct  5     HVLLVALATHGHFNPGLHLANILSHGGLHVTFATSSSVLCRLPKLPSSPRLSFAFFSDGQ  64

Query  1296  DAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             + G +P  D+  F +  + + S A+  +I   K  G+P + ++Y+ +  W   VAR   +
Sbjct  65    EDGFKPGNDVVPFLSQFELQASRAIHDIILKSKASGKPISFVLYSLLTPWMANVARSFDL  124

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEV--PGVPALGVRDFPSFLFSTET  946
             P  L W Q A V  IYYH+F  Y ++ +NC  +  + +  PG+P+L  +  PS      +
Sbjct  125   PAALFWNQSAAVFAIYYHFFNGYREVIQNCFSHPCININLPGLPSLNSKQLPSLCNPANS  184

Query  945   NVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAY  766
             N      + ++      + +  E + K+L+N+F+ LE D  RA     ++ IGP++P+  
Sbjct  185   N-----SFVLKLFESHFQVLKQEPHLKILINSFEELEHDVFRANNMANLIPIGPVLPTKT  239

Query  765   LDGEDPSDTAFGGDLRQ------NSND---YVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             ++  +         +        NS D   Y  WL+S+PKSSVVY++FGS A V    LE
Sbjct  240   IEQLNNEKNLGAFKVTPISCSPPNSRDESKYYTWLNSKPKSSVVYVSFGSIAAVSKAQLE  299

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCF  433
             EI + L+     FLWV+R+ + G + ++ L C +ELEA+GK+V WC+Q+EVL +P+IGCF
Sbjct  300   EIGRALLDYGGEFLWVMRKMAHGNE-KDMLSCLDELEAKGKVVAWCSQLEVLSNPAIGCF  358

Query  432   LTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKR  253
             LTHCGWNS++ESL  GVP+VA P W DQ  NAK+I+D+ K GV++  NE G+V+  E K+
Sbjct  359   LTHCGWNSSMESLVCGVPVVAFPQWTDQGTNAKIIEDLSKSGVKLRVNENGIVERGEIKK  418

Query  252   CIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             C+E VMG G+KGE  R NAKKWKELA  A    GSSY+N++ ++D +
Sbjct  419   CLEMVMGEGDKGEGFRRNAKKWKELANKATTKGGSSYVNIRNFIDHL  465



>ref|NP_563742.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 sp|Q9LR44.1|U75B1_ARATH RecName: Full=UDP-glycosyltransferase 75B1; AltName: Full=(Uridine 
5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl 
transferase 1; AltName: Full=IAA-Glu synthase 1; AltName: 
Full=Indole-3-acetate beta-glucosyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAF79730.1|AC005106_11 T25N20.21 [Arabidopsis thaliana]
 gb|AAK32944.1|AF367358_1 At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AAK37839.1|AF196777_1 UDP-glucosyltransferase [Arabidopsis thaliana]
 gb|AAL77752.1| At1g05560/T25N20_20 [Arabidopsis thaliana]
 gb|AEE27854.1| UDP-glucosyltransferase 75B1 [Arabidopsis thaliana]
 gb|AHL38968.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=469

 Score =   365 bits (936),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 198/470 (42%), Positives = 288/470 (61%), Gaps = 38/470 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVN-LGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA+VT  T  S  +   +++  +++ L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +    ++K  G  A++  I A K    P T LIYT +++WA  VAR
Sbjct  65    DGFDDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ-VVEVPGVPALGVRDFPSFLFS  955
                +P  LLW QPA V +IYY +F           GN+ V E+P + +L +RD PSFL  
Sbjct  125   RFQLPSALLWIQPALVFNIYYTHFM----------GNKSVFELPNLSSLEIRDLPSFLTP  174

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIP  775
             + TN       A +A ++ +E +  E  PK+L+NTFD+LE +AL A   + MV +GPL+P
Sbjct  175   SNTNKG-----AYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNIDMVAVGPLLP  229

Query  774   SAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGL  595
             +    G      +    ++  S+ Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L
Sbjct  230   TEIFSG------STNKSVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARAL  283

Query  594   VKSKMPFLWVLRETSKGEKPEEKLRC---------KEELEAQGKIVRWCAQVEVLQHPSI  442
             ++ K PFLWV+ + S  E   E             + ELE  G IV WC+Q+EVL H ++
Sbjct  284   IEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAV  343

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGW+STLESL  GVP+VA P+W+DQ  NAKL+++ WK GVRV  N++G+V+  E
Sbjct  344   GCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGE  403

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              +RC+E VM   EK  ELR NAKKWK LA  A ++ GSS  N++A+++++
Sbjct  404   IRRCLEAVM--EEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDI  451



>ref|XP_008787452.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=493

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 210/498 (42%), Positives = 294/498 (59%), Gaps = 48/498 (10%)
 Frame = -3

Query  1488  MEGC--HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNRMS---SRP--EI  1333
             ME C  H L+  +PAQGHINPSL  AKRL    G +VT ST  SA  RM    ++P  E+
Sbjct  1     MEQCQQHFLVATYPAQGHINPSLHLAKRLAQTTGGRVTFSTSISAHRRMFPSLAKPDEEV  60

Query  1332  QG--LDFAPFSDGYDAGLEP---ADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIY  1168
             +   L + PFSDGYD G E     DL DF    K  G+  ++ ++       RP + +IY
Sbjct  61    EDGLLSYIPFSDGYDTGFEADTDGDLDDFMTQFKLVGTRTLSGIVHDLAARDRPVSCVIY  120

Query  1167  TSIMSWAGVVAR------GLH-------------VPVTLLWTQPATVLDIYYHYFTEYGD  1045
             +  +SWA  VAR       L+             +P  L W QPATV   YYHYF  Y +
Sbjct  121   SVWLSWAADVARDHGIPSALYWIIWAADVARDHGIPSVLYWIQPATVFTTYYHYFHGYEE  180

Query  1044  LFRNCSGNQV--VEVPGVPALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEEN  871
             L  +   + +  V++PG+P L  RD PSFL  T ++  Y   +    +R+  + ++ EE 
Sbjct  181   LITSHGHDPLFTVDLPGLPPLQNRDLPSFLTVTSSDDPYRPIFV--GVRETFDTLDREEK  238

Query  870   ---PKVLVNTFDALEFDALRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQ-NSND  703
                P+V +NTF+ LE DA++AI  + ++ IGPL+PS   DG++   T  GGDL + +   
Sbjct  239   TSKPRVFLNTFNKLEADAIKAIGNLDLIPIGPLLPSLSSDGQNSKGTVSGGDLFEADEKG  298

Query  702   YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKL  523
             Y+EWLDS+P+ SVVY+AFGS + +    LEEI  GL +S  P+LWV+R+ ++GE  E   
Sbjct  299   YMEWLDSKPEKSVVYVAFGSMSVIKKRQLEEILWGLKESGRPYLWVVRKDNRGEGVEL--  356

Query  522   RCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFP  343
                 E    G +V WC+QV+VL HPS+GCF+THCGWNSTLESL  GVP +  P W DQ  
Sbjct  357   ----EDGENGMVVEWCSQVKVLSHPSVGCFVTHCGWNSTLESLICGVPTIGVPQWTDQGT  412

Query  342   NAKLIQDVWKLGVRVSANE-EGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGA  166
             NA+LI+ VW  GVR   +  +G+++  E KRC+E VMG GE+G E+R  A  W++ A+ A
Sbjct  413   NARLIE-VWGTGVRSEVDRSQGLLEGSELKRCLEVVMGEGERGVEIRRKATMWRDKAREA  471

Query  165   MKDDGSSYLNLKAYMDEM  112
             +++ GSS  NLK +++E 
Sbjct  472   IREGGSSDRNLKTFVEEF  489



>dbj|BAP90370.1| UDP-glycose: glycosyltransferase UGT75R1 [Fagopyrum esculentum]
Length=471

 Score =   362 bits (929),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 197/468 (42%), Positives = 284/468 (61%), Gaps = 32/468 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRM--SSRPEIQGLDFAPFSD  1303
             H+LLV +P Q H+NP+LQFA   +N GA VTL T  S + RM  S      GL FA  SD
Sbjct  8     HILLVAYPLQSHMNPALQFANYFLNSGAHVTLVTTVSGVKRMKKSGGAAPTGLSFATISD  67

Query  1302  GYDAGLEPA-----DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVV  1138
             GYD G   A      L  +  + K RGS+ ++ LI A      P+T ++YT ++ W   V
Sbjct  68    GYDDGFTSAISDESALDGYMLNFKRRGSETLSDLIAAGTAVP-PYTCVVYTILLPWVANV  126

Query  1137  ARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVPALGVRDFPS  967
             AR  ++P  LLW Q A +L IYYHYF  YGD+   C  N     + +P +P L  RD PS
Sbjct  127   ARRHNLPSALLWLQNAALLSIYYHYFNGYGDIIHQCDENDPQWCLNLPSLPPLHARDLPS  186

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK-KVRMVGI  790
             FL  + T       +A  ++++Q E +   +NP +LVNTFD+LE + + +++ + +++ +
Sbjct  187   FLTPSNT-----YTFAEVSLKEQFEVLGESQNPIILVNTFDSLEHEIIESLQTRFKVLAV  241

Query  789   GPLIPSAYLDGEDPSDTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPL+P     G       F  DL  +   DYV W+D+QP +SVVY++FGS +       E
Sbjct  242   GPLLPREKSSG-------FAVDLFSRPEEDYVAWMDAQPNNSVVYVSFGSISAFSREQKE  294

Query  612   EIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCK-EELEAQGKIVRWCAQVEVLQHPSIGC  436
             EIA  L++ + PFLWV+R+ S   K +E +  +  ELE  G IV WC+Q+EVL H + GC
Sbjct  295   EIAAALLECRRPFLWVMRKDSDENKDDETVTSRWVELEKLGMIVSWCSQLEVLSHRATGC  354

Query  435   FLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYK  256
             F+THCGWNSTLESL++GVP+VA P W DQ  NAK+++ +W  GVRV+  ++ VV  +E  
Sbjct  355   FVTHCGWNSTLESLSTGVPVVAVPQWTDQPTNAKMLESMWGTGVRVA--DKKVVSRNELT  412

Query  255   RCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             RC+E VM    + E++R +A +W+ELA  A+KD GSS  N++ ++DE+
Sbjct  413   RCVETVM----ESEKVRADAMRWRELAIEAIKDGGSSDSNIRVFVDEV  456



>emb|CDP20005.1| unnamed protein product [Coffea canephora]
Length=463

 Score =   360 bits (925),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 277/464 (60%), Gaps = 16/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLST---GFSAMNRMSSRPEIQGLDFAPFS  1306
             H L+   PAQGHINP+LQ AK L   GA+VT +T   GFS +N+  + P   GL +A FS
Sbjct  6     HFLITALPAQGHINPTLQLAKSLARNGARVTFATTVHGFSCINK--ALPRYNGLSYATFS  63

Query  1305  DGYD--AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG D     +  D   F+A +K  G+  V +LI    EEGRP T LIYT ++ W   VA 
Sbjct  64    DGCDDEESSKRRDRGRFFADLKHFGTQTVRELIKTLSEEGRPVTCLIYTILLPWVAEVAF  123

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLF---RNCSGNQVVEVPGVPALGVRDFPSFL  961
              + +P      Q AT   IY  YF     ++   R    +  +++P +P     D P+ +
Sbjct  124   EMEIPSVFFVIQCATAFAIYLRYFNSQDGVYDGVREIDPSISIQLPNLPLFLSTDLPTII  183

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               +    N      +    + I+ +  +    VLVNTF+ LE  +LRAI  + ++ IGPL
Sbjct  184   MPS----NPYFASTVPVFHEHIKILEQDTKACVLVNTFNDLEQASLRAITNMNVIPIGPL  239

Query  780   IPSAYLDGEDPSDTAFGGDLRQN-SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             IPSA+ DG D +D + GGDL  +   DY+ WLD +P+ SVVY++FGS A +      EI 
Sbjct  240   IPSAFSDGTDLTDKSVGGDLFDSPKQDYIRWLDLKPERSVVYVSFGSLATLNKEQKIEIF  299

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
              GL ++   +L V+R+ S  E  E K   +  L  +G IV WC+Q+EVL H SIGCFLTH
Sbjct  300   HGLEEAGWDYLMVIRK-SDNEDQEVKEMMENGLSGKGIIVPWCSQMEVLCHKSIGCFLTH  358

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL +G+P++ CP ++DQ  NAKLI++VW  GVR  ANE  +V+ +E KRC+ 
Sbjct  359   CGWNSTLESLTAGIPMIGCPQFSDQTTNAKLIEEVWGNGVRAKANEASLVEREEIKRCLG  418

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMG GEKGE++R NA KW+ LA  A+K++GSS+ NL+ +++ +
Sbjct  419   IVMGCGEKGEKIRRNAAKWRSLAVDAVKENGSSHNNLELFLESL  462



>emb|CDY47274.1| BnaA10g03720D [Brassica napus]
Length=472

 Score =   360 bits (925),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 205/472 (43%), Positives = 293/472 (62%), Gaps = 34/472 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   GA+VTL T  S  +R  +S   ++  L F  FS
Sbjct  6     HFLLVTFPAQGHVNPSLRFARRLIRTTGARVTLVTCASVFHRSMISKHSDLDNLSFLTFS  65

Query  1305  DGYD-AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D  GL  A+ LK   A++K  G  A+++ I   K+   P T L+YT +++WA  VA 
Sbjct  66    DGFDQGGLTTAEELKTRSANLKNNGDKALSEFIEGNKKGDSPVTCLVYTILLNWAPKVAS  125

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
                +P  LLW QPA V +IYY++  E        + N  +E   + ++  RD PSFL   
Sbjct  126   RFQLPSALLWIQPALVFNIYYNHINEN-------NNNSCLEFKNLSSIATRDLPSFLTPA  178

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              TN       A  + ++ +E +  E NPK+LVNTFD+LE +AL+AI  V MV +GPL+PS
Sbjct  179   NTNQG-----AYNSFQELMELLKEETNPKILVNTFDSLEQEALKAIPSVGMVAVGPLLPS  233

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                  E   D +        S+ Y  WLDS+ +SSV+Y++FG+  ++    + E+A+ L+
Sbjct  234   EMFT-ESVKDLS-----NDQSSSYSRWLDSKTESSVIYVSFGTMVELSKKQIGELARALI  287

Query  591   KSKMPFLWVLRETS------KGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSIG  439
             + K PFLWV+ + S      +GE   E  +    + ELE  G IV WC+QVEVL+H ++G
Sbjct  288   EGKRPFLWVITDKSNREAKLEGEDETEIEKIAGFRHELEEVGMIVSWCSQVEVLRHRAVG  347

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+THCGW+STLESL  GVP+VA P+W+DQ  NAKL++++W  GVRV  NEEG+V+  E 
Sbjct  348   CFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWGTGVRVRENEEGLVERGEI  407

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             +RC+E VM   EK  ELR NA++W+ LA  A ++ GS   N++A++DE+L S
Sbjct  408   RRCLEAVM--DEKLVELRGNAEEWRRLAVEAGREGGSCDKNIEAFVDEILLS  457



>dbj|BAK55743.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=463

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 199/464 (43%), Positives = 279/464 (60%), Gaps = 16/464 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLST---GFSAMNRMSSRPEIQGLDFAPFS  1306
             H L+    AQGHINP+LQ AK L   GA+VT +T   G S +N  S+ P   GL +A FS
Sbjct  6     HFLITSLAAQGHINPTLQLAKSLARNGAQVTFATTVYGLSCIN--STLPRHNGLSYASFS  63

Query  1305  DGYD--AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG D    ++  D    +  +K  GS  V +LI     EGRP T +IYT ++ W   VA 
Sbjct  64    DGNDDKESIKKRDRGRVFHDLKQFGSQNVRELIKTLSAEGRPVTCVIYTILLPWVAEVAF  123

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLF---RNCSGNQVVEVPGVPALGVRDFPSFL  961
              + +P   L  Q ATV  IY+ YF     ++   R    +  V+ P +P    RD P+ +
Sbjct  124   EMQIPSVFLVIQCATVFAIYHRYFNSQDGVYDGVREIDPSISVQFPDLPLFSSRDLPTII  183

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
               ++    Y    +   + + I+ +  +    VLVNTFD LE  ++RAI  + ++ IGPL
Sbjct  184   VPSDPYFAY----SAPVIHEHIKVLEKDTTAFVLVNTFDELEQASVRAITNMNVIPIGPL  239

Query  780   IPSAYLDGEDPSDTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             +PSA+ DG D +D + GGDL   +S DY++WLDS+P+ SVVY++FGS A +      EI 
Sbjct  240   VPSAFSDGTDLTDKSVGGDLFDSSSRDYLQWLDSKPECSVVYVSFGSLATLKKEQKIEIF  299

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTH  424
              GL ++   +L V+R+ S  E  E K   +  L  +G IV WC+Q+EVL H SIGCF+TH
Sbjct  300   HGLEEAGWDYLMVIRK-SDNEDQEVKEMMENGLNGKGMIVPWCSQMEVLCHKSIGCFITH  358

Query  423   CGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIE  244
             CGWNSTLESL +GVP+V C  ++DQ  N KLI++VW  GVR  ANE GVV+ +E KRC+ 
Sbjct  359   CGWNSTLESLIAGVPIVGCAQFSDQMTNIKLIEEVWGNGVRAKANEAGVVEREEIKRCLG  418

Query  243   CVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              VMG GEK E++R NA KW+ LA  A+K++GSS+ NLK +++ +
Sbjct  419   IVMGCGEKEEKIRRNAAKWRGLAVDAVKENGSSHNNLKLFLESL  462



>emb|CDY10124.1| BnaC05g03670D [Brassica napus]
Length=466

 Score =   360 bits (924),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 203/474 (43%), Positives = 293/474 (62%), Gaps = 44/474 (9%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEI-QGLDFAPF  1309
             H LLV FPAQGH+NPSL FA+RL+   GA+VT  T  S  +R  +S   ++   L F  F
Sbjct  6     HFLLVTFPAQGHVNPSLHFARRLIRTTGARVTFVTCVSVFHRSMISKHSDLDNNLSFLAF  65

Query  1308  SDGYD-AGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDG+D  GL  A+ +K    ++K  G  A+++ I   K    P T L+YT +++WA  VA
Sbjct  66    SDGFDQGGLTTAEEIKSRSLNLKNNGEKALSEFIEGNKNGDSPVTCLVYTMLLNWAPKVA  125

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFS  955
                 +P  LLW QPA V +IYY++F  + +       +  +E   + ++ VRD PSFL  
Sbjct  126   SRFQLPSALLWIQPALVFNIYYNHFNGHNN-------SSCLEFKNLSSIAVRDLPSFLTP  178

Query  954   TETNVN-YDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLI  778
               TN   Y+L       ++ +E +  E NPK+LVNTFD+LE +AL+A+ +V MV +GPL+
Sbjct  179   ANTNQGVYNL------FQELMELLIEETNPKILVNTFDSLEQEALKALPRVGMVAVGPLL  232

Query  777   PSAYLDGEDPSDTAFGGDLRQNSND----YVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             PS            F   +R  SND    Y  WLDS+ +SSV+Y++FG+  ++    + E
Sbjct  233   PSEM----------FKESVRDLSNDQSSSYSRWLDSKTESSVIYVSFGTMVELSRKQIGE  282

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQ-----GKIVRWCAQVEVLQHPS  445
             +A  L++ K PFLWV+ + S  E    KL  ++E E +     G IV WC+QVEVL+H +
Sbjct  283   LAGALIEGKRPFLWVITDKSNREA---KLEGEDESEIEKIAEVGMIVSWCSQVEVLRHRA  339

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             +GCF+THCGW+STLESL  GVP+VA P+W+DQ  NAKL++++W+ GVRV  NEEG+V+  
Sbjct  340   VGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEELWRTGVRVRENEEGLVERG  399

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
             E +RC+E VM   EK  ELR NA++W+ LA  A ++ GS   N++A++DE+L S
Sbjct  400   EIRRCLEAVM--DEKLVELRENAEEWRRLAVEAGREGGSCDKNIEAFVDEILLS  451



>ref|XP_006853436.1| hypothetical protein AMTR_s00032p00176750 [Amborella trichopoda]
 gb|ERN14903.1| hypothetical protein AMTR_s00032p00176750 [Amborella trichopoda]
Length=450

 Score =   358 bits (919),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/460 (42%), Positives = 282/460 (61%), Gaps = 16/460 (3%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             HVL+V  PAQGHINP+L+ AKRLV    +VT +T    ++R+    +I  + FA +SDG+
Sbjct  4     HVLMVCSPAQGHINPALELAKRLVKKDLRVTFATTAHGLSRIHQAIDI--VSFASYSDGF  61

Query  1296  DAGLEPA-DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G + +    D+ +  K  GS+ +A LI     +G P T +IY S++ W+  VA  L +
Sbjct  62    DQGFDNSIAFADYVSQFKRLGSETLAALIRNLASQGCPVTFIIYNSVVPWSADVADELGI  121

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTETNV  940
             P  L W Q ATV  IY+++F          S   V  V G+P L + D PSFL  + TN 
Sbjct  122   PSALHWIQSATVFVIYWNHFRGSKSSSYLISTTNV-RVTGMPLLNIEDLPSFLQPSNTN-  179

Query  939   NYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRM--VGIGPLIPSAY  766
                 + A+E++ +  E ++      V+ +TFDALE D + A++K  M  + IGPL+PSA+
Sbjct  180   ----NIAVESLVELFEMLDSRRIDWVIASTFDALEKDLISAMEKENMTLLSIGPLVPSAF  235

Query  765   LDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLVKS  586
             +DG++P DT FGGD+ + S DY+EWL S+P  SVVY++FGS   +       IA+ L +S
Sbjct  236   IDGKNPEDTTFGGDMWEKSKDYMEWLGSKPVGSVVYVSFGSLRVLSPMQARNIARALSES  295

Query  585   KMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCGWNST  406
             +  +LWV+  + K  +  E      E   +G +V WC QVE+L HPSIGCF+ H GWNST
Sbjct  296   RHSYLWVVGSSEKALQNIEI-----EDSERGLVVGWCNQVELLAHPSIGCFVMHGGWNST  350

Query  405   LESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIECVMGGG  226
             +ESL +GVP+V  P W+DQ  NA L++ VWK GVR    E+GV++  E KRCIE VMGGG
Sbjct  351   IESLVAGVPMVVLPEWSDQTTNAWLVERVWKCGVRAKVREDGVLEEAELKRCIELVMGGG  410

Query  225   EKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             E+G E++  A++   LAK A K+ GSS +NL   ++++++
Sbjct  411   EEGAEMKKKARELSWLAKDAWKEGGSSEINLDRLLEKIVA  450



>gb|ABQ02257.1| O-glucosyltransferase 2 [Vitis labrusca]
Length=447

 Score =   357 bits (917),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 287/463 (62%), Gaps = 25/463 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+  PAQGHINP+L  AK L+ LG +VT +T  S + R+++ P I GL FA F
Sbjct  1     MDKHHFLLLSCPAQGHINPTLHLAKLLLRLGVRVTFATFVSGLRRIATLPTIPGLHFASF  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G    +       MK  GS +++ L+ +   E  P T LIY  ++ WA  VAR 
Sbjct  61    SDGYDDG---NNSNYSMEEMKRVGSQSLSNLLLSLSNERGPVTYLIYGFLLPWAATVARE  117

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPALGVRDFPSFLF  958
               +P   L TQ AT + +Y+ YF  +  LF    GN +   +E+PG+P L   D PS L 
Sbjct  118   HGIPSAFLSTQSATAIAVYHRYFKAHDGLFNTELGNSLNISLELPGLPPLKYEDLPSILL  177

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK-VRMVGIGPL  781
              T  +      W + + ++ I+++  + NP VL+NTF+ALE D ++A+   + +V IGPL
Sbjct  178   PTSPHA-----WVVPSFQELIQNLEQDPNPCVLINTFNALEEDVIKALGDFMNVVAIGPL  232

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL   S DY  WL+S+P+ SV+Y++FGS A +    +EEI  
Sbjct  233   MQL---------DSSISCDLFGRSKDYHPWLNSKPEGSVIYVSFGSLATLQKKQMEEIFH  283

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV+R  S   + EEK+      E QG IV+WC+QVEVL H ++GCFLTHC
Sbjct  284   GLMESHRPFLWVIR--SMESELEEKMNSSLS-EEQGLIVQWCSQVEVLCHQAVGCFLTHC  340

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST+ESL +GVP+VACP ++DQ  NAKL+ +VW  GV+  ANEEGVV+ +E K+C+E 
Sbjct  341   GWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVVEREEIKKCLEM  399

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VM GGEKG+E+R NA KWK LA  +M+   S   NLK +++ +
Sbjct  400   VMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESL  442



>ref|XP_008791887.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=470

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 195/481 (41%), Positives = 289/481 (60%), Gaps = 29/481 (6%)
 Frame = -3

Query  1500  HHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMS---SRP--  1339
             H P+    H L+V +PAQGHINP+L  A+RL +  GA VT ST  SA  RM    S+P  
Sbjct  3     HRPQ----HFLIVAYPAQGHINPALHLARRLASTTGAHVTFSTAISAHRRMFPALSKPDE  58

Query  1338  EIQG--LDFAPFSDGYDAGLEPA----DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTR  1177
             E++   L + PFS+GYD G +      + +DF +  K  GS  ++ +I       RP T 
Sbjct  59    EVEDGLLSYIPFSNGYDNGFKAGTGTENAQDFVSKFKLVGSRTLSTIIANLAARDRPVTC  118

Query  1176  LIYTSI-MSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEV  1006
             +I+T + MSWA  VA    VP  + W QPA V  IYYHYF  + +L  + S + +  V  
Sbjct  119   MIHTMLFMSWAADVAYDHGVPPVVYWIQPAAVFAIYYHYFHGFEELITSHSQDPLFTVNF  178

Query  1005  PGVPALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDA  826
             PG+P   +RD P+F  +   +  Y +        D ++       P++++NTF+ALE DA
Sbjct  179   PGLPPFRIRDLPTFTITNSDDPYYVILLDFRETFDMLDRKQRSSKPRIMMNTFEALEADA  238

Query  825   LRAIKKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFG  646
             ++A+  V ++ +GPL+PS  L G D  D       + +   Y+EWLDS+P+ SVVY++FG
Sbjct  239   IKAVGNVELITLGPLVPSLPLLGMDSKDKDL---FKPDDKGYMEWLDSKPERSVVYVSFG  295

Query  645   SYADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQV  466
             S A +    LEE+ +GL +S   +LWV+R+  +      +   + E E  G +V WC+QV
Sbjct  296   SIAVMKKQQLEEVLRGLRESGRAYLWVVRKDGR------EEGVELEDEENGMVVEWCSQV  349

Query  465   EVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANE  286
             +VL HPS+GCF+THCGWNSTLESL  GVP V  P W+DQ  NAKL++  W  GVR   ++
Sbjct  350   KVLSHPSVGCFVTHCGWNSTLESLVCGVPTVGVPQWSDQGTNAKLVE-TWGTGVRTEVDK  408

Query  285   EGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             EG+++  E +RC+E VMG GE+G E+R  A+ WK  A+ A+++ GSS +NL+A+++++ S
Sbjct  409   EGMLEGRELRRCLEVVMGEGERGVEIRKRAEIWKNKAQEAIREGGSSDVNLRAFLEQIAS  468

Query  105   S  103
             +
Sbjct  469   N  469



>ref|XP_008793436.1| PREDICTED: cyanidin 3-O-rutinoside 5-O-glucosyltransferase-like 
[Phoenix dactylifera]
Length=467

 Score =   358 bits (919),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 203/472 (43%), Positives = 279/472 (59%), Gaps = 33/472 (7%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNRM----SSRPEIQG--LD  1321
             H LL  +  QGHINP+L+ A +L     GA+VT ST  S   RM    +S  EI    L 
Sbjct  8     HFLLATYAGQGHINPALRLATQLARTIPGARVTFSTSVSGHRRMFPSAASDGEISDGRLS  67

Query  1320  FAPFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWA  1147
             + PFSDG D G +       DF A  K  GS  ++ L+      GRP T LIYT ++ WA
Sbjct  68    YLPFSDGCDDGFKGGIPGFSDFMAQSKLHGSRNLSNLLGDLTARGRPVTCLIYTILLPWA  127

Query  1146  GVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGVRDF  973
               VAR   +   L W QPA V  IYYHYF  Y DL  +  G+ +  VE PG+P L +RD 
Sbjct  128   ADVAREHGIRSFLHWIQPAFVFAIYYHYFHGYEDLVASNRGDPLFQVEFPGLPPLRIRDL  187

Query  972   PSFLFSTETNVNYDLDWAIEAMRDQIEDINGEEN----PKVLVNTFDALEFDALRAIKKV  805
             PSFL  +  +  Y +      +R+  E ++ E+     P++LVNTFDALE DAL A+  +
Sbjct  188   PSFLTISADDPFYHV---FLILREVFETVDREKTESHKPRILVNTFDALESDALSAVDAM  244

Query  804   RMVGIGPLIPSAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVP  628
              ++ IGPL+PS       P +T   GD+ Q +   Y+ WLDS+P+ SVVY++FGS + + 
Sbjct  245   HLLPIGPLLPS-------PEETPSHGDIFQLDGRRYMAWLDSKPEKSVVYVSFGSLSVMR  297

Query  627   NTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
                LEE+  GL +   P+LWV+R+ ++ E  E       E   +G +V WC+QV+VL HP
Sbjct  298   KQQLEEMLNGLEECGRPYLWVVRKDNREEGVEL------EKGEKGMVVEWCSQVKVLSHP  351

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             S+GCF+THCGW+S LESLA GVP+V  P  +DQ  NAKL ++ W  GVR  AN+EGV + 
Sbjct  352   SVGCFVTHCGWSSMLESLACGVPIVGAPQMSDQGMNAKLAEEAWGTGVRAEANDEGVFEG  411

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
              E +RC+E VMG GEKG E+R  A KW++  + A+   G S  NL+A+++E+
Sbjct  412   AELRRCLEVVMGQGEKGAEMRRKATKWRDRVQEAVASGGPSDRNLRAFVEEI  463



>ref|XP_002263497.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=448

 Score =   357 bits (915),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 282/464 (61%), Gaps = 26/464 (6%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+ +PAQGHINP+    K L+ LG +VT +T  S   R+++ P + GL FA  
Sbjct  1     MDKHHFLLLSWPAQGHINPTFHLVKLLLRLGVRVTFTTFASGFRRIATLPTLPGLHFASV  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G       D    MK  GS +++ L+ +   E  P T LIY  ++ WA  VAR 
Sbjct  61    SDGYDDGNHSNFSMD---EMKRVGSQSLSNLLLSLSNERGPVTFLIYGLVLPWAATVARE  117

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG---NQVVEVPGVPALGVRDFPSFLF  958
               +P   L TQ ATV+ +Y+ YF  +  LF+   G   N  +E+PG+P L   D PS L 
Sbjct  118   HGIPSAFLSTQSATVIAVYHRYFKAHDGLFKTELGIPLNISLELPGLPPLKYEDLPSILL  177

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK-VRMVGIGPL  781
                   +      +   ++ I+++  + NP VLVNTFDALE D ++A+   + +V IGPL
Sbjct  178   PGNPYAS-----VLPCFQEHIQNLEQDPNPCVLVNTFDALEEDVIKALGHYMNVVAIGPL  232

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL + S DY+ WL+S+P  SV+Y++FGS A +    +EEI  
Sbjct  233   MQL---------DSSISCDLFERSKDYLPWLNSKPDGSVIYVSFGSLAVLQKKQMEEIFH  283

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV+R T   E   E++      E QG IV+WC+QVEVL H ++GCFLTHC
Sbjct  284   GLMESHRPFLWVIRST---ESEVEEMTNNSMSEEQGLIVQWCSQVEVLCHQAVGCFLTHC  340

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNS +ESL +GVP+VACP ++DQ  NAKL+ +VW  GV+  ANEEGVV+ +E K+C+E 
Sbjct  341   GWNSIMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVVEREEIKKCLEM  399

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSS-YLNLKAYMDEM  112
              M  G KGEE+R NA+KWK LA   M++ GSS  +NLK +++ +
Sbjct  400   AMEDGGKGEEMRRNAEKWKGLAVECMRECGSSGNINLKHFVESL  443



>ref|XP_010917296.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Elaeis 
guineensis]
Length=470

 Score =   357 bits (916),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 201/473 (42%), Positives = 288/473 (61%), Gaps = 25/473 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRMS---SRP--EIQG--LD  1321
             H L+V  P QGHINPSL  A+RL +  GA VT ST  SA  RM    S+P  E++   L 
Sbjct  7     HFLIVAHPFQGHINPSLHLARRLTSTTGAHVTFSTAISAHRRMFPALSKPDEEVEDGLLS  66

Query  1320  FAPFSDGYDAGLEPAD----LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSI-M  1156
             + P+S+GYD G + A      +DF +++K  GS  ++ +I       RP T  IYT I M
Sbjct  67    YIPYSNGYDNGFKAATGTKTPEDFMSNLKLVGSKTLSTIIHNLAARDRPVTCTIYTMILM  126

Query  1155  SWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPALGV  982
             SWA  VA    +P  + W QPATV  IYYHYF  Y +L R+ S + +  V+ PG+P L +
Sbjct  127   SWAADVAHDHGIPTAIYWIQPATVFGIYYHYFHGYDELIRSHSQDPLFTVDFPGLPPLRI  186

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVR  802
             RD P+F  +   +  Y +    +   + ++       P++++NTFDALE DA++A   ++
Sbjct  187   RDLPTFTITKSDDPYYLIFLDFKETFEMLDRKQRISKPRIIMNTFDALEADAIKAFGNMQ  246

Query  801   MVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNT  622
              +  GPL+P   L G D  D       + ++  ++EWLDS+P+ SVVY++FGS + +   
Sbjct  247   FITAGPLLPPLSLPGMDSKDNDL---FKPDNKGFMEWLDSKPERSVVYVSFGSISVIKKQ  303

Query  621   MLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSI  442
              LEEI +GL +S  P+LWV+R+ ++ E  E       E    G +V WC+QV+VL HPSI
Sbjct  304   QLEEILRGLRESGRPYLWVVRKDNREEGVEL------EDGENGMVVEWCSQVKVLSHPSI  357

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLESL  GVP V  P W+DQ  NAKL++ +W  GVR   N+EGV +  E
Sbjct  358   GCFVTHCGWNSTLESLVCGVPTVGVPQWSDQGTNAKLVE-MWGTGVRSEVNKEGVFEGKE  416

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
              +RC+E VMG GE+G E+R  A  W++ A  A+++ GSS +NLKA+M+++ S+
Sbjct  417   LRRCLEVVMGEGERGLEIRRRAGIWRDRAWEAVREGGSSDVNLKAFMEKIASN  469



>ref|XP_009403481.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=469

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 197/473 (42%), Positives = 288/473 (61%), Gaps = 25/473 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNL-GAKVTLSTGFSAMNRM---SSRPEIQG--LDFA  1315
             H L+V +P QGHINP+L  A+RL  + GA++T S   S   RM   S+  E+    + + 
Sbjct  4     HFLVVTYPLQGHINPALHLARRLARVAGARITFSIALSGHRRMFPSSADGEVDDGLISYV  63

Query  1314  PFSDGYDAGLEPA--DLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGV  1141
             P SDGYD G  P   D+K +    ++  S  ++ +I + +E GRP T +IYT ++SWA  
Sbjct  64    PHSDGYDDGFNPDVDDVKAYPLRTRSVSSKTLSAIIRSLEERGRPVTCVIYTLLLSWAAD  123

Query  1140  VARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEV--PGVPALGVRDFPS  967
             VA    +P  L W QPATV  +YYHYF  Y  L  +   + + +V  PG+P   + D PS
Sbjct  124   VAHEHGLPSVLYWIQPATVFALYYHYFHGYDGLIASHRQDPLFQVNLPGLPPFRICDLPS  183

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEE---NPKVLVNTFDALEFDALRAIKKVRMV  796
             FL  T  +  Y +   IE  ++  + ++ E+     +VL NTFD LE DAL A +K++++
Sbjct  184   FLRITSPDDPYFI--VIEMFKESFDVLDSEKARSTARVLANTFDELESDALVATEKMKLI  241

Query  795   GIGPLIPSAYLDGEDPS--DTAFGGDL-RQNSNDYVEWLDSQPKSSVVYLAFGSYADVPN  625
              IGP +PSA L+G + +    + G DL + +   Y+EWLDS+P+ SVVY++FGS A +  
Sbjct  242   PIGPTVPSALLEGTEAARGTGSTGADLFKLDEKQYMEWLDSKPEKSVVYVSFGSLAVIKK  301

Query  624   TMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPS  445
                EEI +GL +S  P+LWVL+      K   +    E  E  G +V WC+QV VL HP+
Sbjct  302   RQAEEIVRGLKESGRPYLWVLK------KENRRELEGEVEEEGGIMVEWCSQVRVLSHPA  355

Query  444   IGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKAD  265
             +GCF+THCGWNST+ES+  GVP V+ P W+DQ  NA+L++ +W  GVR   + EGV++  
Sbjct  356   VGCFVTHCGWNSTVESIVCGVPTVSAPQWSDQSTNARLVE-LWGTGVRGELDGEGVLEGA  414

Query  264   EYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             E  RC+E VMG GE G+E+R  A+ WKE A+ A+ + GSS  NL+A+++E+ S
Sbjct  415   ELSRCVETVMGEGETGKEIRRRAEMWKEKAREAVGEGGSSDRNLRAFVEEIAS  467



>emb|CBI39412.3| unnamed protein product [Vitis vinifera]
Length=646

 Score =   362 bits (929),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 282/463 (61%), Gaps = 25/463 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+ +PAQGHINP+    K L+ LG +VT +T  S   R+++ P + GL FA  
Sbjct  200   MDKHHFLLLSWPAQGHINPTFHLVKLLLRLGVRVTFTTFASGFRRIATLPTLPGLHFASV  259

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G       D    MK  GS +++ L+ +   E  P T LIY  ++ WA  VAR 
Sbjct  260   SDGYDDGNHSNFSMD---EMKRVGSQSLSNLLLSLSNERGPVTFLIYGLVLPWAATVARE  316

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG---NQVVEVPGVPALGVRDFPSFLF  958
               +P   L TQ ATV+ +Y+ YF  +  LF+   G   N  +E+PG+P L   D PS L 
Sbjct  317   HGIPSAFLSTQSATVIAVYHRYFKAHDGLFKTELGIPLNISLELPGLPPLKYEDLPSILL  376

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-KKVRMVGIGPL  781
                   +      +   ++ I+++  + NP VLVNTFDALE D ++A+   + +V IGPL
Sbjct  377   PGNPYAS-----VLPCFQEHIQNLEQDPNPCVLVNTFDALEEDVIKALGHYMNVVAIGPL  431

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL + S DY+ WL+S+P  SV+Y++FGS A +    +EEI  
Sbjct  432   MQL---------DSSISCDLFERSKDYLPWLNSKPDGSVIYVSFGSLAVLQKKQMEEIFH  482

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV+R T   E   E++      E QG IV+WC+QVEVL H ++GCFLTHC
Sbjct  483   GLMESHRPFLWVIRST---ESEVEEMTNNSMSEEQGLIVQWCSQVEVLCHQAVGCFLTHC  539

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST+ESL +GVP+VACP ++DQ  NAKL+ +VW  GV+  ANEEGVV+ +E K+C+E 
Sbjct  540   GWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVVEREEIKKCLEM  598

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VM GGEKG+E+R NA KWK LA  +M+   S   NLK +++ +
Sbjct  599   VMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESL  641



>ref|XP_009105515.1| PREDICTED: UDP-glycosyltransferase 75B2 [Brassica rapa]
Length=470

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 196/471 (42%), Positives = 282/471 (60%), Gaps = 38/471 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMN--RMSSRPEIQGLDFAPFS  1306
             H LLV  PAQGH+NPSL+FA RL+   GA+VTL+T  S  +   + S   +  L    FS
Sbjct  5     HFLLVTLPAQGHVNPSLRFAHRLIRTTGARVTLATCHSVFHCSNIQSHDNVYNLSLLTFS  64

Query  1305  DGYDAGL--EPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G+     D+++   +++  G   +++ I A K    P   +IYT + SW   +AR
Sbjct  65    DGFDDGVISNTEDVQNRLLNLERNGDKTLSEFIEANKNGYSPVACVIYTILPSWVPRLAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
               H+P  LLW QPA   ++YY++ T +   F         E P +P L  RD PSFL  +
Sbjct  125   RFHLPSVLLWIQPALAFNVYYNHSTGHNSGF---------EFPNLPTLETRDLPSFLSPS  175

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              T+ N   +  +E M    E +  E N KVLVNTFD+LE +AL A++ + MV +GPL+P 
Sbjct  176   NTSNNIAQEVYLELM----EFLKEEPNVKVLVNTFDSLEAEALTAVRDIEMVAVGPLLPP  231

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                   +P          ++ + Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L+
Sbjct  232   DMFTRSEPV---------KDQSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALI  282

Query  591   KSKMPFLWVL-----RETS-KGEKPEEKLRC---KEELEAQGKIVRWCAQVEVLQHPSIG  439
             + K PFLWV+     RE   KGE   E  +    + ELE  G IV WC+QVEVL+H ++G
Sbjct  283   ECKRPFLWVITDKVNREAKIKGENETEIEKIAGLRHELEEVGMIVSWCSQVEVLRHRAVG  342

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CFLTHCGW+STLESL  GVP+VA P+W+DQ  NAKL++D+W+ GVRV  NE+G+V   E 
Sbjct  343   CFLTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEDLWRTGVRVRENEDGLVVRGEI  402

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLS  106
             +RC+E VM   EK  ELR N + WK LA  A ++ GSS  N++A+++ + S
Sbjct  403   RRCLEAVM--EEKSVELRENGEAWKRLAVEAGREKGSSDKNMEAFVETLFS  451



>ref|XP_007041389.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOX97220.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=459

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 279/467 (60%), Gaps = 26/467 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LL   P Q H+NP+ + A+RL+  GA+VT +T  +   ++ S P ++GL +A  S+G+
Sbjct  7     HFLLATLPFQSHLNPTFRLARRLIQAGARVTFATTINGQRKIKSFPSLEGLAYASVSNGF  66

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G  P+D  +D  +  +  GS  +  L+ +   +G P + LIY   +SW   VAR + +
Sbjct  67    DDGTSPSDEQEDVMSRCEHVGSQTLTNLLLSLSNDGHPVSFLIYGPSLSWVADVARAMSI  126

Query  1119  PVTLLWTQPATVLDIYYHYF---TEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFSTE  949
             P   L  Q A +L IY+HY    T   D   NC  + V++  G+P  G +D P FL    
Sbjct  127   PSAFLCIQAAALLAIYHHYLNSQTGAYDSKVNCPPS-VIKFEGLPPFGWKDLPCFLLP--  183

Query  948   TNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI---KKVRMVGIGPLI  778
                N  L +A  A +  I+ +  + NP VL+NTFDALE  A++A+     + ++ IGPL+
Sbjct  184   ---NSPLSFATTAFQKHIQILEEDPNPCVLINTFDALEEYAIKALAHNSNINLITIGPLV  240

Query  777   PSAYLDGEDPSDTAFGGDLRQNSND--YVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             PS         D   G +L +NS+   Y+ WL+S+P  SVVY++FGS A +P   +EEI 
Sbjct  241   PS---------DKFNGCELFENSSHDCYINWLNSKPDCSVVYISFGSVAVLPRNQMEEIF  291

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEEL-EAQGKIVRWCAQVEVLQHPSIGCFLT  427
              G+V+S   FLWV+R +  G++   K   K ++ E QG IV WC+QVEVL H ++GCF+T
Sbjct  292   DGMVESGYTFLWVIRPSEDGKEEGFKNVIKNKMKEEQGLIVPWCSQVEVLNHRAVGCFVT  351

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANE-EGVVKADEYKRC  250
             HCGWNSTLE L +GVP++A P + DQ  NAKL+ +VW+ GVRV ANE   V + +E +RC
Sbjct  352   HCGWNSTLEGLVAGVPMIALPQFADQMTNAKLVDEVWETGVRVKANEGAAVAEKEEIRRC  411

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEML  109
             +E VMG G+ GEELR NAKKW+ LA  A    GSS  N K +M+  +
Sbjct  412   LEMVMGNGQIGEELRRNAKKWRGLALEATSQGGSSANNFKVFMESFV  458



>gb|KFK39474.1| hypothetical protein AALP_AA3G248900 [Arabis alpina]
Length=475

 Score =   355 bits (911),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 202/486 (42%), Positives = 294/486 (60%), Gaps = 47/486 (10%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR--MSSRPEIQGLD  1321
             + G H L V FPAQGHINPSL+ AKRL     GA+VT +   SA NR   S+    + L 
Sbjct  11    LTGPHFLFVTFPAQGHINPSLELAKRLAGTIAGARVTFAASISAYNRRMFSTENVPETLI  70

Query  1320  FAPFSDGYDAGLEPAD----LKD----FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYT  1165
             FA +SDG+D G + +     LKD    F + M+ RG + + +LI   + + RP T ++YT
Sbjct  71    FATYSDGHDDGFKKSSSDKTLKDDSGKFMSEMRRRGRETLTELIEDNRRQNRPITCVVYT  130

Query  1164  SIMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQ---VVEVPGVP  994
              +++W   +AR  H+P  LLW QP TV  I+YHYF  Y ++    + N     +++P +P
Sbjct  131   ILLTWVAELAREFHLPSALLWVQPITVFSIFYHYFNGYEEVITEMANNNPSGSIKLPSLP  190

Query  993   ALGVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI  814
              L +R+ PSF+       N    + + A ++Q+E +  EENPK+L+N+F  LE + L ++
Sbjct  191   LLRLRELPSFIVP-----NNHYAFLLPAFQEQMESLKQEENPKILINSFQELEPEGLTSV  245

Query  813   -KKVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYA  637
                V++V +GPLI S    G                ++YVEWLDS+  SSVVY++FG+ A
Sbjct  246   LDYVKIVPVGPLITSRTDSG--------------TCSEYVEWLDSKSDSSVVYISFGTLA  291

Query  636   DVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLRC----KEELEAQGKIVRWCAQ  469
              +    L E+ + L++S+ PFLWV+ + S   K +E++      +EEL+  G +V WC Q
Sbjct  292   VLSKKQLVELCKALIESRRPFLWVITDKSHRTKDDEEVDSIASFREELDEIGMVVSWCDQ  351

Query  468   VEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN  289
               VL+H SIGCF+THCGWNSTLESL SGVP+VA P WNDQ  NAKL+ + WK GVRV   
Sbjct  352   FRVLKHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMTNAKLLDESWKTGVRVIVK  411

Query  288   EEG------VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKA  127
             +E       VV+++E +RCI+ VM   EK E+ R NA +W++LA   +++ GSS+ NLKA
Sbjct  412   KEEKEEEGCVVESEEIRRCIDEVM--EEKAEDFRRNAARWRDLAAETIREGGSSFNNLKA  469

Query  126   YMDEML  109
             ++DE +
Sbjct  470   FVDEHM  475



>ref|XP_010025793.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Eucalyptus 
grandis]
Length=413

 Score =   353 bits (905),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 262/403 (65%), Gaps = 20/403 (5%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H LLV       +NP+LQ A+RL  +G++VT  +   A+  M       G+ F  FSDGY
Sbjct  24    HFLLVALSTCSAMNPALQLAERLARVGSRVTFLSTVYALRCMIDPVCPGGVTFTTFSDGY  83

Query  1296  DAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGLHV  1120
             D G  P D L+ + A M  RGS+A+  LI     +G  FT +++T I+ W   VAR L +
Sbjct  84    DDGYVPGDDLERYRAEMNRRGSEALRDLIEHSSGQGLSFTCVLHT-IVPWVHDVARSLQI  142

Query  1119  PVTLLWTQPATVLDIYYHYFTEYGDLFRN-----CSGNQVVEVPGVPALGVRDFPSFLFS  955
              + L+W QPATV DIYYHYF+ Y D+ ++     C    ++ +PGVP L  R+ PSFL  
Sbjct  143   KLVLVWIQPATVFDIYYHYFSGYEDVIKSVTSQRCDTTSLIRLPGVPPLTNRNIPSFL--  200

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKV-LVNTFDALEFDALRAIKKVRMVGIGPLI  778
                +V     +A+  ++  +E++  EENPKV LVNTFDALE +ALRAI  + +VGIGPL+
Sbjct  201   ---HVENKYAFALPEIQSLLENLKEEENPKVVLVNTFDALELEALRAIGTLNLVGIGPLV  257

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             P ++LD    SD +  GD    S D+V+WL+++ ++SV+Y+AFGS A +      E+A+G
Sbjct  258   PLSFLD----SDQSSRGDRFLGSEDFVKWLNAKEEASVIYVAFGSIAMLSKLQKREMARG  313

Query  597   LVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHCG  418
             L+++  PFLWV+    KG+  +++L  KEE++ +G IV WC+Q+EVL HPSIGCFLTHCG
Sbjct  314   LLETGRPFLWVM---GKGDGDDDELIYKEEIDKRGVIVPWCSQIEVLSHPSIGCFLTHCG  370

Query  417   WNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSAN  289
             WNST+ESL  G+P+VA P W DQ  NAKL++DVWK+GVRVS +
Sbjct  371   WNSTIESLVCGIPMVAFPQWADQMTNAKLVEDVWKVGVRVSED  413



>ref|XP_010673325.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=535

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 196/480 (41%), Positives = 282/480 (59%), Gaps = 28/480 (6%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKV-----TLSTGFSAMNRMSSRPEIQGLDFAP  1312
             H+LL+   AQGH+NP+LQ AK L    + +     T++   + +N  SS P +  L FA 
Sbjct  8     HLLLIAASAQGHLNPTLQLAKHLTRASSTIHVTFATMANAVARVNLPSSTPTLDRLSFAT  67

Query  1311  FSDGYDAGLEPAD-LKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             FS G+D G++P+D  K      K   S ++ +L+ +   EGRP   L+YT ++ WA  VA
Sbjct  68    FSTGFDDGVKPSDDPKTVAEKAKRVVSTSLHELMVSLSNEGRPVDLLVYTLMLPWAADVA  127

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFS  955
             R LHVP  LL+ Q AT   IY  +F     +  N S    +E+PG+P     D P+FL  
Sbjct  128   RELHVPSALLFIQSATTFAIYNRFFNGNNGI-DNKSPQSCIELPGLPLFESCDLPTFLLP  186

Query  954   TETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALR-AIKKVRMVGIGPLI  778
             +  +      +A   + D I  +  + NP VL+N+FD LE   +  A+  V+++ IGPLI
Sbjct  187   SSPHY-----FAAPTIEDHIRALERDFNPTVLINSFDFLEKPVITMAVDHVKIITIGPLI  241

Query  777   PSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQG  598
             PSA+ D  DPSDT++G DL + S DY+ WL+ + + SV+Y++FGS A +     EEI  G
Sbjct  242   PSAFSDMIDPSDTSYGCDLFEGSKDYLVWLEKKAEKSVIYVSFGSMAVIKKKQFEEILHG  301

Query  597   LVKSKMPFLWVLRETSK----GEKPEEKLR---CKEEL-------EAQGKIVRWCAQVEV  460
             L     P+LWV+R  +     G+  +E +     K  L         +G I+ WC+QVEV
Sbjct  302   LELMGRPYLWVVRAMTHNKIVGDHEDEVVIEDIIKNRLGPVSGGPHEKGLIIPWCSQVEV  361

Query  459   LQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEG  280
             L HP+IGCF+THCGWNS LESL  GVP+V  P  +DQ  NAKL+++VW +G+R   NEEG
Sbjct  362   LSHPTIGCFVTHCGWNSILESLVMGVPMVGVPQMSDQPTNAKLVEEVWGVGIRAKRNEEG  421

Query  279   V-VKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEMLSS  103
               V  +E +RC+E VMG  E G+E+R N KKW ELA  AM ++GSS  NL+ +++ + +S
Sbjct  422   TFVDREEIRRCVEIVMGDCEVGQEIRKNTKKWMELALEAMMEEGSSNNNLECFLEGIQNS  481



>gb|EYU31602.1| hypothetical protein MIMGU_mgv1a021119mg [Erythranthe guttata]
Length=461

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 278/470 (59%), Gaps = 22/470 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAP  1312
             M+  H L++ FP QGHINP LQ AK L  LGAKVT +T    ++R+  S P +  L +A 
Sbjct  1     MKSHHFLIISFPIQGHINPILQLAKNLARLGAKVTFATTDRILHRLQDSLPTLHRLSYAS  60

Query  1311  FSDGYDAGLE----PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
             FSDG     E          + A MK  GS+ + +++    +   P T L+Y+ ++ WA 
Sbjct  61    FSDGQHHEEEQEKSTKSTAGYMAEMKRAGSENLIRILQESLDGPEPVTCLVYSLLLPWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR + +P   L+ Q AT   IY+ +   + ++      + V  +  +P     D P+F
Sbjct  121   AVARDMQIPSAFLFIQCATAFAIYHRFSKPHNEIV-----DPVDIIQDLPLFSSSDLPTF  175

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK--KVRMVGI  790
             L       ++     IE M    +++  +  P VL+NTF+ LE DA+ ++K   + ++ I
Sbjct  176   LLPDNPMYSFMKPMMIEHM----QELEKDPKPLVLLNTFEELEQDAIESLKTKNINVITI  231

Query  789   GPLIPSAYLDGEDPSDTAFGGDLR-QNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPLIPSA+ DG D +D +FGGDL      DY +WLD++P++SVVY+AFGS   +      
Sbjct  232   GPLIPSAFSDGNDSTDKSFGGDLFISKKEDYFKWLDTKPENSVVYVAFGSLVVMNKDQKI  291

Query  612   EIAQGLVKSKMPFLWVLRETSK-----GEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHP  448
             E   GLV+SK PFLWV+R +S       E   +K+    ++   G IV WCAQ+ VL H 
Sbjct  292   EFLHGLVESKRPFLWVIRSSSSSSDSVDENETKKMIDNSDIGENGMIVEWCAQMGVLSHK  351

Query  447   SIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKA  268
             SIGCF+THCGWNSTLE L  GVP + CP + DQ  NAKL+++VW  GVR  AN E +++ 
Sbjct  352   SIGCFVTHCGWNSTLEGLICGVPFICCPHFADQPTNAKLVEEVWGTGVRARANGEVLIER  411

Query  267   DEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMD  118
             +E+K+C++ VMG G++G+E+R NA KW+ LA  A+K+ GSSY+NLK  ++
Sbjct  412   EEFKKCLDVVMGEGDRGKEMRRNALKWRGLALEAVKEKGSSYINLKRVLE  461



>emb|CDP20001.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   354 bits (908),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 279/465 (60%), Gaps = 18/465 (4%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPFSDGY  1297
             H L+   PAQGHINP+LQ AK L   GA+VT +T    +  + + P   GL FA FSDGY
Sbjct  7     HFLITALPAQGHINPTLQLAKNLARAGAQVTFATTVYGLRCIKNPPASIGLSFASFSDGY  66

Query  1296  DAGLEPADLKD---FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARGL  1126
             D   EP   ++   + + +K  GS  + KLI     EGRP T LIYT ++ W   VA  +
Sbjct  67    DDE-EPMKNRNPGRYLSDVKCYGSKDLTKLIQCSSNEGRPVTFLIYTVLLPWVAEVASEM  125

Query  1125  HVPVTLLWTQPATVLDIYYHYFTEYGDLFR-----NCSGNQVVEVPGVPALGVRDFPSFL  961
             ++   LL  Q AT   IY+ YF  +  ++      +CS   + ++P +P L   D P+FL
Sbjct  126   NIHSALLAIQCATSFAIYHRYFNSHDGIYDGVREVDCSSISI-KLPDLPLLQKEDLPTFL  184

Query  960   FSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPL  781
                +          +  + + I+ +  +    VLVNTF+ LE  +++A+  + ++ IGPL
Sbjct  185   LPNDP----LFASIVPFVHENIKILEQDSEACVLVNTFNELEEASIKAVHGMNLIPIGPL  240

Query  780   IPSAYLDGEDPSDTAFGGDLRQ-NSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIA  604
             IPSA+ DG D SD + GG+L     ND ++WLDS+P+ SVVY +FGS   +      EI 
Sbjct  241   IPSAFCDGYDSSDKSVGGNLFDIPENDCLQWLDSKPERSVVYASFGSLLSLKKEEKMEIL  300

Query  603   QGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQ-GKIVRWCAQVEVLQHPSIGCFLT  427
              GL ++   +L VLR  +  E+ EE     E + ++ G IV WC+Q+EVL H SIGCFLT
Sbjct  301   HGLKEAGRSYLLVLR--ADNEQEEEVKAVVENISSEEGMIVPWCSQMEVLCHRSIGCFLT  358

Query  426   HCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCI  247
             H GWNSTLES+ +GVP+V CP  +DQ  NAKLI++VW +GVR  ANEEGVV+  E +RC+
Sbjct  359   HSGWNSTLESIVAGVPIVGCPHLSDQTTNAKLIEEVWGIGVRAKANEEGVVERAEIRRCL  418

Query  246   ECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             + VMGG E+GEE+R N+ KW  +A  A+K++GSS+ N + ++  +
Sbjct  419   DIVMGGDERGEEIRRNSAKWSCMAIEAVKENGSSHNNFRNFLQNL  463



>ref|XP_002892298.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68557.1| UDP-glucosyl transferase 75B1 [Arabidopsis lyrata subsp. lyrata]
Length=474

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 192/469 (41%), Positives = 281/469 (60%), Gaps = 37/469 (8%)
 Frame = -3

Query  1476  HVLLVIFPAQGHINPSLQFAKRLV-NLGAKVTLSTGFSAMNR--MSSRPEIQGLDFAPFS  1306
             H LLV FPAQGH+NPSL+FA+RL+   G +VT     S  +   + +   +  L F  FS
Sbjct  5     HFLLVTFPAQGHVNPSLRFARRLIKTTGTRVTFVACVSVFHNSMIPNHNNVDNLSFLTFS  64

Query  1305  DGYDAG--LEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVAR  1132
             DG+D G      D +   A++K  G  A+++ I A +    P T +IYT +++WA  VAR
Sbjct  65    DGFDDGGISTYEDRQKRTANLKVNGDKALSEFIEASRNGDSPVTCVIYTILLNWAPKVAR  124

Query  1131  GLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSFLFST  952
                +P  LLW QPA V DIYY++F            N V ++  + +L +RD PSFL  +
Sbjct  125   RFQLPSALLWIQPALVFDIYYNHFM---------GNNSVFKLTNLSSLEIRDLPSFLTPS  175

Query  951   ETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIGPLIPS  772
              TN       A ++ ++ +E +  E NPK+L+NTFD+LE +AL A   + MV +GPL+P+
Sbjct  176   NTN-----KAAYDSFQEMMEFLIEETNPKILINTFDSLEPEALTAFPNIDMVAVGPLLPT  230

Query  771   AYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQGLV  592
                 G   S       +   S+ Y  WLDS+ +SSV+Y++FG+  ++    +EE+A+ L+
Sbjct  231   EIFSGSAKS-------VEDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALI  283

Query  591   KSKMPFLWVLRETSKGEKPEEKLRC---------KEELEAQGKIVRWCAQVEVLQHPSIG  439
             + K PFLWV+ + S  E   E             + ELE  G +V WC+Q++VL H ++G
Sbjct  284   EGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMMVSWCSQIDVLSHRAVG  343

Query  438   CFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEY  259
             CF+THCGW+STLESL  GVP+VA P+W+DQ  NAKL+++ WK GVRV  NEEG+V+  E 
Sbjct  344   CFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENEEGLVERGEI  403

Query  258   KRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             +RC+E VM   +K  ELR +AKKWK LA  A  + GS   N++A+++E+
Sbjct  404   RRCLEAVM--EDKSVELRESAKKWKRLAIEAGGEGGSLDKNMEAFVEEI  450



>ref|XP_007226459.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
 gb|EMJ27658.1| hypothetical protein PRUPE_ppa024612mg [Prunus persica]
Length=471

 Score =   352 bits (904),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 196/477 (41%), Positives = 287/477 (60%), Gaps = 31/477 (6%)
 Frame = -3

Query  1503  HHHPRMEGCHVLLVIFPAQGHINPSLQFAKRLVNLGA-KVTLSTGFSAMNRMSSRPEIQG  1327
             HHH      H LL+  PAQGHINP+LQ AKRL+ +G   VT +T    + ++ S P ++G
Sbjct  6     HHH------HFLLISCPAQGHINPTLQLAKRLIGIGGTHVTYATTIRGLTKIKSFPSLEG  59

Query  1326  LDFAPFSDGYDAGLEPA-DLKDFWASMKTRGSDAVAKLI---TAKKEEGRPFTRLIYTSI  1159
             L +A FSDG+D G++P  D   F +  K  GS  +  LI   +  ++   P T LIY+ +
Sbjct  60    LSYASFSDGFDDGIKPTNDPNLFMSEFKLVGSKTLKALIEKISTSQDHSGPVTFLIYSVL  119

Query  1158  MSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSG-NQVVEVPGVPALGV  982
             + WA  VA    +P   L  Q  T   + +HYF      F NC      + + G+P    
Sbjct  120   LPWAAEVASDCGIPSAFLCIQSTTSFALCHHYFNH----FHNCPPFPNSMTIEGLPPFAP  175

Query  981   RDFPSFLFSTETNVNYDLDWAIEAMRDQIEDI-NGEENPK-VLVNTFDALEFDALRAIKK  808
              + PSFL  T  +V+      I   ++ I+ +  G+ N   VL+NTFDALE  A++A++ 
Sbjct  176   TELPSFLLPTSPHVS-----VIPTFQEHIQVLEQGKPNSSLVLLNTFDALEGAAIKALRS  230

Query  807   VRM--VGIGPLIPSAYLDGED--PSDTAFGGDLRQNS-NDYVEWLDSQPKSSVVYLAFGS  643
               M  + IGPL+ + + +  +   SD  F  DL   S +DY++WLDS+P  SVVY++FGS
Sbjct  231   SSMNVIPIGPLVITGFWEENENQSSDDGFRCDLFDKSEDDYLQWLDSKPDCSVVYVSFGS  290

Query  642   YADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEE---KLRCKEELEAQGKIVRWCA  472
                +    +EE+  GLV+S +P LWV+R   KG   E    K++ + +++ QG +V WC+
Sbjct  291   MVVLKRDQIEEMLNGLVESGLPVLWVIRCAEKGGDQEAQIMKIKNRLKIKEQGLVVPWCS  350

Query  471   QVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSA  292
             Q+EVL H S+GCF+ HCGWNST+ESL +GVP+V    ++DQ  NAKL+++VW +GVR   
Sbjct  351   QMEVLGHKSVGCFVMHCGWNSTVESLVAGVPMVGFAQFSDQNTNAKLVEEVWGVGVRAKE  410

Query  291   NEEGVVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYM  121
             NE+GV++  E KRC+E VMG GE+GEE+R N +KWK LAK A+K+ GSS  NL+ ++
Sbjct  411   NEKGVIEGAEIKRCLEIVMGDGERGEEIRRNCEKWKGLAKEAVKEGGSSDYNLRHFI  467



>ref|XP_010434953.1| PREDICTED: UDP-glycosyltransferase 75D1-like [Camelina sativa]
Length=474

 Score =   352 bits (904),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 205/490 (42%), Positives = 290/490 (59%), Gaps = 58/490 (12%)
 Frame = -3

Query  1482  GCHVLLVIFPAQGHINPSLQFAKRLVNL--GAKVTLSTGFSAMNR-MSSRPEI-QGLDFA  1315
             G H L V FP QGHINPSL+ AKRL     GA+VT +   SA NR M S+  + + L FA
Sbjct  11    GPHFLFVTFPTQGHINPSLELAKRLAGTISGARVTYAAPISAYNRRMFSQENVPETLTFA  70

Query  1314  PFSDGYDAGLEPAD-----LKD----FWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTS  1162
              +SDGYD G + +      L+D    F   M+  G + + +LI     + RPFT ++Y  
Sbjct  71    TYSDGYDDGYKSSASSKKSLQDATANFMFDMRRHGKETLTELIEDNLRQNRPFTCVVYRI  130

Query  1161  IMSWAGVVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV--VEVPGVPAL  988
             +++W   +AR +H+P  LLW QP TV  I YHYF  Y D       N    +++P +P L
Sbjct  131   LLTWVAELAREIHLPSALLWVQPVTVFSISYHYFNGYEDAISEMGNNPSGSIQLPSLPLL  190

Query  987   GVRDFPSFLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAI-K  811
              VRD PSFL S+         + +  +R+Q+E +  E NPK+L+NTF  LE +A+ ++  
Sbjct  191   TVRDLPSFLVSSNAYA-----FLLPVLREQLESLKEEANPKILINTFQELEPEAMSSVPD  245

Query  810   KVRMVGIGPLIPSAYLDGEDPSDTAFGGDLRQNSN---DYVEWLDSQPKSSVVYLAFGSY  640
               ++V IGPL+                  LR +S+   +Y+EWLD++  SSV+Y++FG+ 
Sbjct  246   SYKIVPIGPLL-----------------TLRTDSSSHSEYIEWLDTKADSSVLYVSFGTV  288

Query  639   ADVPNTMLEEIAQGLVKSKMPFLWVLRETSKGEKPEEKLR-----C----KEELEAQGKI  487
             A +    L E+ + L++ + PFLWV+  T+K  K +E  +     C    +EEL+  G +
Sbjct  289   AVLTKKQLVELCKALIQCRKPFLWVI--TNKSYKSKEDEQEKEEDCISSFREELDEIGMV  346

Query  486   VRWCAQVEVLQHPSIGCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLG  307
             V WC Q  V  H SIGCF+THCGWNSTLESL SGVP+VA P   DQ  NAKL++D WK G
Sbjct  347   VSWCDQFRVFNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQCTDQMTNAKLLEDCWKTG  406

Query  306   VRV--SANEEG--VVKADEYKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYL  139
             VRV    +EEG  VV+++E +RCI+ VM   EK EE R NA +WK+LA  A+++ GSS+ 
Sbjct  407   VRVIEKKDEEGAMVVESEEIRRCIKEVM--EEKAEEFRGNAARWKDLAAEAVREGGSSFN  464

Query  138   NLKAYMDEML  109
             +LKA+ DE +
Sbjct  465   HLKAFADEHM  474



>gb|EYU36923.1| hypothetical protein MIMGU_mgv1a026563mg [Erythranthe guttata]
Length=459

 Score =   352 bits (902),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 187/463 (40%), Positives = 275/463 (59%), Gaps = 20/463 (4%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMS-SRPEIQGLDFAP  1312
             M+  H L++ FP QGHINP LQ AK L  LGAKVT +T    ++ +  S P +  L +A 
Sbjct  1     MKSHHFLIISFPIQGHINPILQLAKNLARLGAKVTFATTEHILHLLQDSLPILHRLSYAS  60

Query  1311  FSDGYDAGLE----PADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAG  1144
             FSDG+    E         ++ A +K  GS+ + +++    +   P T L+Y+ ++ WA 
Sbjct  61    FSDGHHHEEEKEKSTKSTAEYMAELKRVGSENLTRILQESMDGPEPVTCLVYSLLLPWAA  120

Query  1143  VVARGLHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQVVEVPGVPALGVRDFPSF  964
              VAR + +P   L  Q AT L IY+ +   + ++      + V  +  +P     D P+F
Sbjct  121   AVARDMQIPSAFLSIQCATALAIYHRFSKHHNEII-----DPVDIIQDLPLFSSSDLPTF  175

Query  963   LFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIK--KVRMVGI  790
             L       ++     IE M    +++  +  P VL+NTF+ LE +A+ ++K   + ++ I
Sbjct  176   LLPDNPMYSFMKPMMIEHM----QELEKDPKPLVLLNTFEELEQEAIESLKAKNINVITI  231

Query  789   GPLIPSAYLDGEDPSDTAFGGDLR-QNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLE  613
             GPLIPSA+ +G D +D +FGGDL      DY +WLDS+P+ SVVY+AFGS   +      
Sbjct  232   GPLIPSAFSNGNDSTDKSFGGDLFISKKEDYFKWLDSKPEHSVVYVAFGSLVVMNKDQKV  291

Query  612   EIAQGLVKSKMPFLWVLRETSKG---EKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSI  442
             E   GLV+SK PFLWV+R +S     E   +K+     +   G IV WCAQ+EVL H SI
Sbjct  292   EFLHGLVESKRPFLWVIRSSSSDSVDENETKKMIDDNNIGENGMIVEWCAQMEVLSHKSI  351

Query  441   GCFLTHCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADE  262
             GCF+THCGWNSTLE L  GVP + CP + DQ  NAKL+++VW  GVR  AN E +++ +E
Sbjct  352   GCFVTHCGWNSTLEGLICGVPFICCPHFADQPTNAKLVEEVWGTGVRARANGEVLIEREE  411

Query  261   YKRCIECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNL  133
             +K+C++ VMG G++G+E+R NA KW+ LA  A+K++GS+Y NL
Sbjct  412   FKKCLDVVMGEGDRGKEMRRNALKWRGLALEAVKENGSTYNNL  454



>gb|ABQ02256.1| O-glucosyltransferase 1 [Vitis labrusca]
 gb|ADA72017.1| O-glucosyltransferase [Vitis amurensis]
Length=448

 Score =   351 bits (900),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 280/464 (60%), Gaps = 26/464 (6%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+ +PAQGHI+P+    K L+ LG +VT +T  S   ++++ P + GL FA  
Sbjct  1     MDKHHFLLLSWPAQGHISPTFHLVKLLLRLGVRVTFTTFASGFRQIATLPTLPGLHFASV  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G       D    MK  GS +++ L+ +   E  P T LIY  ++ WA  VAR 
Sbjct  61    SDGYDDGNRSNFSMD---EMKRVGSQSLSNLLLSLSNERGPVTFLIYGLVLPWAATVARE  117

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRNCSGNQV---VEVPGVPALGVRDFPSFLF  958
               +P   L TQ ATV+ +Y+ YF  +  LF    GN +   +E+PG+P L   D PS L 
Sbjct  118   HGIPSAFLSTQSATVIAVYHRYFKAHDGLFNTELGNPLNISLELPGLPPLKYEDLPSILL  177

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK-VRMVGIGPL  781
                   +      +   ++ I+++  + NP VLVNTFDALE D ++A+   + +V IGPL
Sbjct  178   PGNPYAS-----VLPCFQEHIQNLEQDPNPCVLVNTFDALEEDVIKALGHYMNVVAIGPL  232

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL + S DY+ WL+S+P  SV+Y++FGS A +    +EEI  
Sbjct  233   MQL---------DSSISCDLFERSEDYLPWLNSKPDGSVIYVSFGSLAVLQKKQMEEIFH  283

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV R T   E   E++      E QG IV+WC+QVEVL H ++GCFLTHC
Sbjct  284   GLMESHRPFLWVTRST---ESEVEEMTNNSLSEEQGLIVQWCSQVEVLCHQAVGCFLTHC  340

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNS +ESL +GVP+VACP ++DQ  NA L+ +VW  GV+   NEEGVV+ +E K+C+E 
Sbjct  341   GWNSIMESLVAGVPVVACPQFSDQTTNAMLV-EVWGTGVKARTNEEGVVEREEIKKCLEM  399

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSY-LNLKAYMDEM  112
              M GG KGEE+R NA+KWK LA   M++ GSS  +NLK +++ +
Sbjct  400   AMEGGGKGEEMRRNAEKWKGLAVECMRECGSSANINLKHFVESL  443



>ref|XP_002263532.1| PREDICTED: crocetin glucosyltransferase, chloroplastic-like [Vitis 
vinifera]
Length=447

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 286/463 (62%), Gaps = 25/463 (5%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             M+  H LL+  PAQGHINP+L  A  L+ LG +VT +T  S + R+++ P I GL FA F
Sbjct  1     MDKHHFLLLSCPAQGHINPTLHLAMLLLRLGVRVTFATFVSGLRRIATLPTIPGLHFASF  60

Query  1308  SDGYDAGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVARG  1129
             SDGYD G    +       MK  GS +++ L+ +   E  P T LIY  ++ WA  VAR 
Sbjct  61    SDGYDDG---NNSNYSMEEMKRVGSQSLSNLLLSLSNERGPVTYLIYGFLLPWAATVARE  117

Query  1128  LHVPVTLLWTQPATVLDIYYHYFTEYGDLFRN---CSGNQVVEVPGVPALGVRDFPSFLF  958
               +P   L TQ ATV+ +Y+ Y   +  LF      S N  +E+PG+P L   D PS L 
Sbjct  118   HGIPSAFLSTQSATVIAVYHRYLKAHDGLFNTELGSSLNISLELPGLPPLKYEDLPSILL  177

Query  957   STETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKK-VRMVGIGPL  781
              T  + +      + + ++ ++++  + N  +L+NTF+ALE D ++A+   + +V IGPL
Sbjct  178   PTSPHAS-----VVPSFQEHVQNLEQDPNTCLLINTFNALEEDVIKALGDFMNVVAIGPL  232

Query  780   IPSAYLDGEDPSDTAFGGDLRQNSNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEEIAQ  601
             +           D++   DL + S DY+ WL+S+P+ SV+Y++FGS A +    +EEI  
Sbjct  233   MQL---------DSSISCDLFERSKDYLPWLNSKPEGSVIYVSFGSLATLQKNQMEEIFH  283

Query  600   GLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFLTHC  421
             GL++S  PFLWV+R  S   + EEK+      E QG IV+WC+QVEVL H ++GCFLTHC
Sbjct  284   GLMESHRPFLWVIR--SIESELEEKMNSSLS-EEQGLIVQWCSQVEVLCHQAVGCFLTHC  340

Query  420   GWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRCIEC  241
             GWNST+ESL +GVP+VACP ++DQ  NAKL+ +VW  GV+  ANEEGVV+ +E K+C+E 
Sbjct  341   GWNSTMESLVAGVPVVACPQFSDQTTNAKLV-EVWGTGVKARANEEGVVEREEIKKCLEM  399

Query  240   VMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             VM GGEKG+E+R NA KWK LA  +M+   S   NLK +++ +
Sbjct  400   VMEGGEKGDEMRRNANKWKGLAVESMEYGSSGETNLKHFVESL  442



>emb|CDP20003.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   351 bits (901),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 191/466 (41%), Positives = 279/466 (60%), Gaps = 13/466 (3%)
 Frame = -3

Query  1488  MEGCHVLLVIFPAQGHINPSLQFAKRLVNLGAKVTLSTGFSAMNRMSSRPEIQGLDFAPF  1309
             ME  H L+   P+QGHINP+LQ AK L   GA+VT +T     +R+ + P    L FA F
Sbjct  1     MEHQHFLITALPSQGHINPTLQLAKNLARTGAQVTFATTVYGFSRIRNLPASGCLSFASF  60

Query  1308  SDGYD--AGLEPADLKDFWASMKTRGSDAVAKLITAKKEEGRPFTRLIYTSIMSWAGVVA  1135
             SDGYD     +  D   F +  K  G   + KLI    +EGRP T LIYT ++ W   VA
Sbjct  61    SDGYDDEKSQKNRDFTSFSSDTKRFGYKDLTKLIQTTSKEGRPVTFLIYTVMLPWVAEVA  120

Query  1134  RGLHVPVTLLWTQPATVLDIYYHYFTEYGDLF---RNCSGNQV-VEVPGVPALGVRDFPS  967
             R +H+P   L  Q AT   IY+ YF  +   +   R    + + +++P +P     D P+
Sbjct  121   REMHIPSAFLAIQSATTFAIYHRYFNSHDGFYDGVREVECSSISIKLPDLPLFEKEDLPT  180

Query  966   FLFSTETNVNYDLDWAIEAMRDQIEDINGEENPKVLVNTFDALEFDALRAIKKVRMVGIG  787
             FL   +    + + +      + I+ +  +  P VLVNTF+ LE  +++A+  + ++ IG
Sbjct  181   FLLPNDQFFAFTVPF----FHEHIKILEQDSKPCVLVNTFNELEESSIKAVDGMNLISIG  236

Query  786   PLIPSAYLDGEDPSDTAFGGDLRQN-SNDYVEWLDSQPKSSVVYLAFGSYADVPNTMLEE  610
             PLIPSA+ D  D +D + GGDL    S  +++WLD +P+ SV+Y++FGS   +      E
Sbjct  237   PLIPSAFSDRNDLTDKSIGGDLFDTPSKGFLQWLDPKPERSVIYVSFGSLVALKKAEKIE  296

Query  609   IAQGLVKSKMPFLWVLRETSKGEKPEEKLRCKEELEAQGKIVRWCAQVEVLQHPSIGCFL  430
             I  GL ++   +L VL+  S  E+ E K   +     +G IV WC+Q+EVL H SIGCF+
Sbjct  297   ILHGLEEAGRAYLLVLQ--SDNEEEEVKAMIENASSEEGMIVPWCSQMEVLCHRSIGCFI  354

Query  429   THCGWNSTLESLASGVPLVACPLWNDQFPNAKLIQDVWKLGVRVSANEEGVVKADEYKRC  250
             THCGWNSTLES+ +GVP+V CP  +DQ  NAKLI++VW +GVR  ANEEGVV+  E  RC
Sbjct  355   THCGWNSTLESIVAGVPIVGCPHLSDQTTNAKLIEEVWGIGVRAKANEEGVVERAEIGRC  414

Query  249   IECVMGGGEKGEELRNNAKKWKELAKGAMKDDGSSYLNLKAYMDEM  112
             ++ VMGGGE+GEE+R N+ KW+ +A  A+K++GSS+ N + ++ ++
Sbjct  415   LDTVMGGGEEGEEIRRNSAKWRCMAIEAVKENGSSHNNFRNFLQKL  460



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4318295211160