BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g6_i1 len=447 path=[41336:0-142 41478:143-145 14406:146-349
41682:350-363 41696:364-446]

Length=447
                                                                      Score     E

ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     144   2e-37   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     142   7e-37   
emb|CDO98833.1|  unnamed protein product                                132   3e-33   
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     132   4e-33   
ref|XP_009761202.1|  PREDICTED: pectinesterase                          130   1e-32   
emb|CDO98832.1|  unnamed protein product                                129   3e-32   
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    129   4e-32   
ref|XP_003632058.1|  PREDICTED: probable pectinesterase/pectinest...    129   5e-32   
ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     128   6e-32   
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     128   7e-32   
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     128   7e-32   
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     128   8e-32   
emb|CDO99718.1|  unnamed protein product                                128   8e-32   
emb|CBI39447.3|  unnamed protein product                                126   2e-31   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     127   3e-31   
gb|ABZ89800.1|  pectin methylesterase-like protein                      125   1e-30   Taiwania cryptomerioides
emb|CAN77092.1|  hypothetical protein VITISV_026596                     124   2e-30   Vitis vinifera
ref|XP_006411580.1|  hypothetical protein EUTSA_v10016522mg             124   2e-30   
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     124   3e-30   
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     124   4e-30   Vitis vinifera
ref|XP_002880019.1|  pectinesterase family protein                      123   5e-30   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          123   6e-30   
gb|KFK37147.1|  hypothetical protein AALP_AA4G219300                    122   6e-30   
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    123   7e-30   
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                123   8e-30   
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    123   8e-30   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    122   8e-30   
ref|XP_003591484.1|  Pectinesterase                                     120   1e-29   
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          122   1e-29   
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    124   1e-29   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 122   1e-29   Ricinus communis
emb|CDY56347.1|  BnaCnng30140D                                          122   1e-29   
ref|XP_003591482.1|  Pectinesterase                                     122   1e-29   
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    122   2e-29   
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            123   2e-29   
ref|XP_009383093.1|  PREDICTED: pectinesterase-like                     122   2e-29   
gb|AAQ21125.1|  pectinesterase                                          117   2e-29   Fragaria x ananassa
ref|XP_006349951.1|  PREDICTED: pectinesterase-like                     115   2e-29   
emb|CDO98834.1|  unnamed protein product                                121   2e-29   
gb|KEH41800.1|  pectinesterase/pectinesterase inhibitor                 121   3e-29   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     121   3e-29   
dbj|BAK05307.1|  predicted protein                                      121   3e-29   
ref|XP_003564371.1|  PREDICTED: pectinesterase                          121   4e-29   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     121   4e-29   
gb|ABK24761.1|  unknown                                                 120   5e-29   Picea sitchensis
dbj|BAF95866.1|  pectin methylesterase isoform alpha                    117   5e-29   Vitis hybrid cultivar
ref|XP_002527752.1|  Pectinesterase-2 precursor, putative               120   5e-29   Ricinus communis
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         120   5e-29   
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     120   6e-29   
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    120   6e-29   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          120   7e-29   
dbj|BAO02509.1|  predicted pectin esterase ortholog                     120   7e-29   
gb|KFK37146.1|  hypothetical protein AALP_AA4G219200                    119   8e-29   
ref|XP_003591498.1|  Pectinesterase                                     118   8e-29   
ref|XP_010058840.1|  PREDICTED: pectinesterase-like                     120   8e-29   
ref|XP_010524121.1|  PREDICTED: probable pectinesterase/pectinest...    120   9e-29   
gb|ABK94644.1|  unknown                                                 118   1e-28   Populus trichocarpa [western balsam poplar]
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    118   1e-28   Petunia integrifolia [violet-flowered petunia]
ref|XP_009111182.1|  PREDICTED: probable pectinesterase/pectinest...    119   1e-28   
ref|XP_010103929.1|  putative pectinesterase/pectinesterase inhib...    119   2e-28   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         119   2e-28   
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    119   2e-28   
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    119   2e-28   
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     119   2e-28   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    119   2e-28   
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    119   2e-28   
ref|XP_010056842.1|  PREDICTED: pectinesterase-like                     119   2e-28   
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    119   2e-28   
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   115   2e-28   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    118   2e-28   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      118   2e-28   
gb|ACJ02103.1|  pectin methylesterase                                   118   3e-28   
gb|KFK30820.1|  pectinesterase family protein                           119   3e-28   
ref|XP_002317208.1|  pectin methylesterase family protein               118   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     118   3e-28   
ref|XP_010923950.1|  PREDICTED: pectinesterase-like                     118   3e-28   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             118   4e-28   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    118   4e-28   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    118   5e-28   
ref|XP_008389982.1|  PREDICTED: pectinesterase                          117   6e-28   
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                118   6e-28   
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                117   6e-28   
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                117   6e-28   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    117   7e-28   
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     117   8e-28   
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                117   8e-28   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    117   9e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        117   9e-28   
ref|NP_001044480.1|  Os01g0788400                                       117   9e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098738.1|  Pectinesterase 3                                   117   1e-27   
ref|XP_007031046.1|  Pectinesterase-2 precursor                         117   1e-27   
ref|XP_004513410.1|  PREDICTED: probable pectinesterase/pectinest...    117   1e-27   
ref|XP_002889876.1|  At1g11580/T23J18_33                                117   1e-27   
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     117   1e-27   
ref|XP_010069351.1|  PREDICTED: pectinesterase-like                     116   1e-27   
gb|AAN05419.1|  putative pectin methylesterase                          109   1e-27   Populus tremula x Populus alba [gray poplar]
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 117   1e-27   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    117   1e-27   
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     116   1e-27   
gb|EMS66304.1|  Pectinesterase 2.2                                      113   1e-27   
ref|XP_006294020.1|  hypothetical protein CARUB_v10023013mg             116   1e-27   
ref|XP_002314364.1|  putative pectinesterase family protein             117   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             116   1e-27   
emb|CDY53657.1|  BnaC04g52910D                                          116   1e-27   
gb|AFC98398.1|  pectin methylesterase                                   116   1e-27   
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    117   2e-27   
emb|CDY15440.1|  BnaA08g27240D                                          117   2e-27   
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         114   2e-27   
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 116   2e-27   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 115   2e-27   
emb|CDY55503.1|  BnaA05g34400D                                          115   2e-27   
ref|XP_009142905.1|  PREDICTED: probable pectinesterase/pectinest...    115   2e-27   
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     116   2e-27   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     116   2e-27   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    116   2e-27   
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   115   3e-27   
dbj|BAM05623.1|  pectin methylesterase 6                                108   3e-27   
ref|XP_010506161.1|  PREDICTED: probable pectinesterase/pectinest...    115   3e-27   
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     115   3e-27   
ref|XP_010276570.1|  PREDICTED: pectinesterase 2-like                   111   3e-27   
dbj|BAM05622.1|  pectin methylesterase 6                                108   3e-27   
emb|CDY65637.1|  BnaAnng20820D                                          115   3e-27   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         115   3e-27   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    115   4e-27   
gb|ACN40984.1|  unknown                                                 116   4e-27   Picea sitchensis
ref|XP_007222370.1|  hypothetical protein PRUPE_ppa003433mg             115   4e-27   
gb|EAY76103.1|  hypothetical protein OsI_04029                          115   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             115   4e-27   
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             115   4e-27   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    115   4e-27   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     115   4e-27   
ref|XP_010687599.1|  PREDICTED: pectinesterase/pectinesterase inh...    115   5e-27   
ref|NP_181833.1|  putative pectinesterase/ pectinerase inhibitor 16     115   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172624.1|  methylesterase PCR A                                  115   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917364.1|  PREDICTED: pectinesterase                          115   5e-27   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   115   5e-27   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    115   5e-27   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          115   5e-27   
gb|AAK59760.1|  At1g11580/T23J18_33                                     115   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ42392.1|  pectin methylesterase-like protein                      115   5e-27   Taiwania cryptomerioides
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    115   6e-27   Ficus pumila var. awkeotsang [jelly fig]
gb|AIZ46897.1|  pectin methylesterase                                   111   6e-27   
ref|XP_004252915.1|  PREDICTED: pectinesterase                          115   6e-27   
emb|CDY65861.1|  BnaCnng48920D                                          115   6e-27   
ref|XP_010508475.1|  PREDICTED: probable pectinesterase/pectinest...    114   6e-27   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    115   6e-27   
ref|XP_004494388.1|  PREDICTED: probable pectinesterase/pectinest...    115   6e-27   
ref|XP_004494387.1|  PREDICTED: probable pectinesterase/pectinest...    115   6e-27   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            115   7e-27   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    115   7e-27   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 114   8e-27   
gb|AAF16637.1|AC011661_15  T23J18.24                                    110   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             114   9e-27   
gb|AFW03475.1|  pectin methylesterase 1                                 115   9e-27   
ref|XP_008235120.1|  PREDICTED: probable pectinesterase/pectinest...    114   9e-27   
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    114   9e-27   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    114   9e-27   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     114   9e-27   
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     114   9e-27   
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          114   9e-27   Sorghum bicolor [broomcorn]
gb|AFB77929.1|  pectin methylesterase                                   114   9e-27   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     114   9e-27   
ref|XP_009409132.1|  PREDICTED: pectinesterase-like                     114   9e-27   
gb|AFW03480.1|  pectin methylesterase 1                                 114   1e-26   
gb|KHG08631.1|  Pectinesterase 3                                        114   1e-26   
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    114   1e-26   
ref|NP_001274785.1|  pectin methyl esterase                             114   1e-26   
gb|AAN84553.1|  methyl pectinesterase                                   110   1e-26   Lolium perenne [perennial ryegrass]
emb|CDY34642.1|  BnaC08g42010D                                          113   1e-26   
gb|KDP23441.1|  hypothetical protein JCGZ_23274                         114   1e-26   
ref|XP_008800482.1|  PREDICTED: pectinesterase-like isoform X1          114   1e-26   
ref|XP_006480113.1|  PREDICTED: probable pectinesterase/pectinest...    114   1e-26   
gb|KDO87167.1|  hypothetical protein CISIN_1g045495mg                   114   1e-26   
ref|XP_006444391.1|  hypothetical protein CICLE_v10024391mg             114   1e-26   
ref|XP_008390793.1|  PREDICTED: probable pectinesterase/pectinest...    110   1e-26   
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        114   1e-26   
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   113   1e-26   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    115   1e-26   
ref|XP_010556727.1|  PREDICTED: probable pectinesterase/pectinest...    114   1e-26   
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    114   1e-26   
gb|EMT05022.1|  Pectinesterase 3                                        113   1e-26   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    113   1e-26   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             114   1e-26   
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     114   1e-26   
ref|XP_007157171.1|  hypothetical protein PHAVU_002G048600g             114   1e-26   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     114   1e-26   
ref|XP_006479999.1|  PREDICTED: probable pectinesterase/pectinest...    114   1e-26   
ref|XP_007199770.1|  hypothetical protein PRUPE_ppa003639mg             114   1e-26   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   113   2e-26   
emb|CDY68840.1|  BnaCnng60750D                                          112   2e-26   
emb|CDO97717.1|  unnamed protein product                                110   2e-26   
emb|CAA96436.1|  pectin methylesterase                                  111   2e-26   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    113   2e-26   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     114   2e-26   
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         114   2e-26   
ref|NP_001170280.1|  uncharacterized protein LOC100384243               107   2e-26   Zea mays [maize]
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    113   2e-26   
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    113   2e-26   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          113   2e-26   Vitis vinifera
ref|XP_008391336.1|  PREDICTED: probable pectinesterase/pectinest...    112   2e-26   
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  110   2e-26   
gb|EAY73715.1|  hypothetical protein OsI_01593                          113   2e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_002512459.1|  Pectinesterase precursor, putative                 114   2e-26   Ricinus communis
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    113   2e-26   
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    113   2e-26   
ref|XP_006444392.1|  hypothetical protein CICLE_v10023588mg             113   2e-26   
ref|NP_001061941.1|  Os08g0450200                                       114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010058837.1|  PREDICTED: uncharacterized protein LOC104446716    115   2e-26   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    114   2e-26   
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     113   2e-26   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     113   2e-26   
ref|XP_006444399.1|  hypothetical protein CICLE_v100237231mg            113   2e-26   
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     113   3e-26   
ref|XP_006418303.1|  hypothetical protein EUTSA_v10007177mg             113   3e-26   
gb|ABD47732.1|  pectin methylesterase                                   106   3e-26   Eucalyptus globulus subsp. globulus
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             113   3e-26   
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     113   3e-26   
ref|XP_004972208.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    112   3e-26   
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     113   3e-26   
ref|XP_006480001.1|  PREDICTED: probable pectinesterase/pectinest...    113   3e-26   
ref|XP_002512460.1|  Pectinesterase-2 precursor, putative               113   3e-26   Ricinus communis
gb|AHB84678.1|  pectin methylesterase                                   113   3e-26   
emb|CAA96435.1|  pectin methylesterase                                  110   3e-26   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009611830.1|  PREDICTED: probable pectinesterase/pectinest...    112   3e-26   
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     112   3e-26   
emb|CAA96434.1|  pectin methylesterase                                  110   3e-26   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   111   4e-26   
ref|XP_010939846.1|  PREDICTED: pectinesterase-like                     113   4e-26   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          113   4e-26   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   112   4e-26   
ref|XP_006444394.1|  hypothetical protein CICLE_v10020108mg             111   4e-26   
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                112   4e-26   
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 112   4e-26   
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     109   4e-26   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    112   4e-26   
ref|XP_010522800.1|  PREDICTED: probable pectinesterase/pectinest...    112   4e-26   
ref|NP_001042865.1|  Os01g0311800                                       112   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    112   4e-26   
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          112   4e-26   Sorghum bicolor [broomcorn]
ref|XP_010261671.1|  PREDICTED: pectinesterase-like                     113   4e-26   
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     112   4e-26   
ref|XP_010556724.1|  PREDICTED: pectinesterase-like                     112   5e-26   
gb|EAZ07185.1|  hypothetical protein OsI_29431                          113   5e-26   Oryza sativa Indica Group [Indian rice]
dbj|BAJ96804.1|  predicted protein                                      112   5e-26   
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    113   5e-26   
ref|XP_002444448.1|  hypothetical protein SORBIDRAFT_07g022090          112   5e-26   Sorghum bicolor [broomcorn]
ref|XP_006659463.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    112   5e-26   
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             112   5e-26   
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     113   5e-26   
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                112   5e-26   
ref|XP_010058942.1|  PREDICTED: pectinesterase-like                     109   5e-26   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          112   5e-26   
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     112   5e-26   
ref|XP_006396440.1|  hypothetical protein EUTSA_v10028546mg             112   5e-26   
gb|AFI23411.1|  pectin methylesterase                                   112   5e-26   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    112   6e-26   
ref|XP_008803383.1|  PREDICTED: pectinesterase                          112   6e-26   
ref|XP_010543030.1|  PREDICTED: pectinesterase 2-like                   112   6e-26   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               112   6e-26   Ricinus communis
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    112   6e-26   
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         112   6e-26   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    112   6e-26   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          112   6e-26   
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     112   6e-26   
gb|AGG23325.1|  pectin methylesterase 1                                 112   6e-26   
sp|Q96575.1|PME22_SOLLC  RecName: Full=Pectinesterase 2.2; Short=...    112   6e-26   Solanum lycopersicum
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     112   6e-26   
emb|CBI26012.3|  unnamed protein product                                112   6e-26   
ref|XP_008371117.1|  PREDICTED: pectinesterase                          112   7e-26   
gb|ACQ85264.1|  pectin methylesterase                                   112   7e-26   Musa acuminata AAA Group [Cavendish banana]
gb|AFW03479.1|  pectin methylesterase 5                                 111   7e-26   
ref|XP_010107694.1|  putative pectinesterase/pectinesterase inhib...    112   7e-26   
ref|XP_007052106.1|  Pectinesterase 2                                   111   8e-26   
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      111   8e-26   
ref|XP_010507786.1|  PREDICTED: probable pectinesterase/pectinest...    108   8e-26   
gb|AAK69695.1|  putative pectin methylesterase LuPME1                   112   8e-26   Linum usitatissimum
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    112   9e-26   
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    112   9e-26   
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             112   9e-26   
gb|AAK84428.1|  papillar cell-specific pectin methylesterase-like...    112   9e-26   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     111   9e-26   
ref|XP_002516960.1|  Pectinesterase precursor, putative                 112   9e-26   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             111   9e-26   
emb|CDY63854.1|  BnaC04g51830D                                          112   9e-26   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      111   9e-26   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   111   9e-26   
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               111   9e-26   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             111   1e-25   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   111   1e-25   
gb|ABK28786.1|  pectinesterase family protein                           108   1e-25   
ref|XP_009384411.1|  PREDICTED: pectinesterase-like                     112   1e-25   
ref|XP_010260187.1|  PREDICTED: probable pectinesterase/pectinest...    110   1e-25   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     111   1e-25   
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    112   1e-25   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    112   1e-25   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          112   1e-25   
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    111   1e-25   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
gb|EEC70505.1|  hypothetical protein OsI_01594                          111   1e-25   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    112   1e-25   
ref|XP_006402733.1|  hypothetical protein EUTSA_v10005885mg             111   1e-25   
ref|XP_009335708.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             112   1e-25   
emb|CBI27741.3|  unnamed protein product                                110   1e-25   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             110   1e-25   
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   111   1e-25   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    112   1e-25   
ref|XP_009335714.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    111   1e-25   
ref|XP_008386683.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
ref|XP_010481250.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
gb|EPS70728.1|  pectinesterase                                          111   1e-25   
ref|XP_003591503.1|  Pectinesterase                                     110   1e-25   
ref|XP_003591169.1|  Pectinesterase                                     111   1e-25   
emb|CDP20872.1|  unnamed protein product                                110   1e-25   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     111   1e-25   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     111   1e-25   
ref|XP_008351186.1|  PREDICTED: probable pectinesterase/pectinest...    109   1e-25   
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     111   1e-25   
gb|KDO65445.1|  hypothetical protein CISIN_1g0366961mg                  107   1e-25   
gb|KEH15891.1|  pectinesterase/pectinesterase inhibitor                 110   1e-25   
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   108   1e-25   
ref|XP_009119610.1|  PREDICTED: probable pectinesterase/pectinest...    111   1e-25   
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     111   1e-25   
emb|CDP17208.1|  unnamed protein product                                110   1e-25   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      110   1e-25   
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   110   2e-25   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    110   2e-25   
ref|XP_004967522.1|  PREDICTED: probable pectinesterase/pectinest...    111   2e-25   
gb|KEH43216.1|  pectinesterase/pectinesterase inhibitor                 111   2e-25   
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    110   2e-25   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               111   2e-25   
ref|XP_010474855.1|  PREDICTED: probable pectinesterase/pectinest...    111   2e-25   
ref|XP_004303758.1|  PREDICTED: pectinesterase/pectinesterase inh...    111   2e-25   
ref|XP_004299718.1|  PREDICTED: probable pectinesterase/pectinest...    111   2e-25   
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     111   2e-25   
ref|XP_010534986.1|  PREDICTED: pectinesterase/pectinesterase inh...    111   2e-25   
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             110   2e-25   
ref|XP_010040919.1|  PREDICTED: probable pectinesterase/pectinest...    107   2e-25   
ref|XP_009142519.1|  PREDICTED: probable pectinesterase/pectinest...    111   2e-25   
gb|EEE54425.1|  hypothetical protein OsJ_01485                          111   2e-25   
ref|XP_008800483.1|  PREDICTED: pectinesterase 3-like isoform X2        108   2e-25   
ref|XP_010057972.1|  PREDICTED: pectinesterase-like                     110   2e-25   
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         111   2e-25   
gb|KHN47892.1|  Pectinesterase 2                                        110   2e-25   
ref|NP_172625.3|  probable pectinesterase/pectinesterase inhibito...    110   2e-25   
ref|XP_010937249.1|  PREDICTED: pectinesterase-like                     111   2e-25   
ref|XP_002318285.1|  putative pectin methylesterase family protein      110   2e-25   
emb|CDX80116.1|  BnaA05g00400D                                          110   2e-25   
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                     110   2e-25   
gb|KHN35616.1|  Pectinesterase 2                                        108   2e-25   
ref|XP_010457268.1|  PREDICTED: probable pectinesterase/pectinest...    110   2e-25   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    111   2e-25   
ref|XP_006293931.1|  hypothetical protein CARUB_v10022923mg             110   2e-25   
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         110   2e-25   
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   109   2e-25   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          110   2e-25   
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          110   2e-25   
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             111   2e-25   
ref|XP_006828613.1|  hypothetical protein AMTR_s00129p00074780          111   2e-25   
gb|AAF16638.1|AC011661_16  T23J18.25                                    110   2e-25   
gb|KDO36004.1|  hypothetical protein CISIN_1g029714mg                   104   2e-25   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             110   2e-25   
emb|CDY15265.1|  BnaC05g01440D                                          112   3e-25   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          110   3e-25   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    110   3e-25   
emb|CBI22967.3|  unnamed protein product                                112   3e-25   
gb|EAZ42934.1|  hypothetical protein OsJ_27524                          107   3e-25   
sp|P83218.1|PME_DAUCA  RecName: Full=Pectinesterase; Short=PE; Al...    108   3e-25   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   110   3e-25   
ref|XP_009343376.1|  PREDICTED: pectinesterase-like                     110   3e-25   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    110   3e-25   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   109   3e-25   
emb|CDX89942.1|  BnaA10g01400D                                          111   3e-25   
pdb|1GQ8|A  Chain A, Pectin Methylesterase From Carrot                  108   3e-25   
ref|XP_008222686.1|  PREDICTED: probable pectinesterase/pectinest...    110   3e-25   
emb|CDY52779.1|  BnaCnng23240D                                          110   3e-25   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          110   3e-25   
gb|AFG69043.1|  hypothetical protein 2_5100_02                          103   3e-25   
ref|XP_010047424.1|  PREDICTED: pectinesterase-like                     110   3e-25   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 110   3e-25   
gb|AHC69829.1|  pectin methylesterase PME2.1                            110   3e-25   
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             110   3e-25   
gb|AAL24207.1|  At2g47550/T30B22.15                                     108   3e-25   
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            110   3e-25   
gb|AAO11616.1|  At2g47550/T30B22.15                                     108   3e-25   
pdb|1XG2|A  Chain A, Crystal Structure Of The Complex Between Pec...    108   3e-25   
ref|XP_007157170.1|  hypothetical protein PHAVU_002G048500g             110   3e-25   
gb|KFK35142.1|  hypothetical protein AALP_AA5G243700                    110   3e-25   
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     107   3e-25   
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    110   3e-25   
gb|KDO87160.1|  hypothetical protein CISIN_1g015794mg                   108   3e-25   
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     110   3e-25   
ref|XP_010684347.1|  PREDICTED: pectinesterase                          110   3e-25   
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    110   4e-25   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          110   4e-25   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          110   4e-25   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             110   4e-25   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    109   4e-25   
emb|CDX76371.1|  BnaA08g10290D                                          108   4e-25   
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     109   4e-25   
emb|CDP15270.1|  unnamed protein product                                110   4e-25   
gb|KFK37519.1|  hypothetical protein AALP_AA4G267600                    110   4e-25   
ref|NP_191460.1|  pectinesterase 35                                     109   4e-25   
ref|XP_010069353.1|  PREDICTED: pectinesterase-like                     109   4e-25   
ref|XP_004299720.1|  PREDICTED: probable pectinesterase/pectinest...    110   4e-25   
ref|XP_003535331.2|  PREDICTED: probable pectinesterase/pectinest...    109   4e-25   
emb|CDY27478.1|  BnaC04g51190D                                          110   4e-25   
gb|KDP34079.1|  hypothetical protein JCGZ_07650                         110   4e-25   
emb|CDO97787.1|  unnamed protein product                                107   4e-25   
ref|NP_001275859.1|  pectinesterase 1 precursor                         110   5e-25   
ref|XP_006397950.1|  hypothetical protein EUTSA_v10001380mg             110   5e-25   
ref|XP_009118697.1|  PREDICTED: probable pectinesterase/pectinest...    110   5e-25   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    110   5e-25   
ref|XP_009111301.1|  PREDICTED: probable pectinesterase/pectinest...    109   5e-25   
gb|ABE67980.1|  pectin methylesterase                                   106   5e-25   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     109   5e-25   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   109   5e-25   
gb|KDO36003.1|  hypothetical protein CISIN_1g029714mg                   105   5e-25   
gb|EYU33104.1|  hypothetical protein MIMGU_mgv1a012115mg                107   5e-25   
ref|XP_006306147.1|  hypothetical protein CARUB_v10011654mg             110   5e-25   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          110   5e-25   
gb|KHN47891.1|  Pectinesterase 2                                        109   5e-25   
ref|XP_006490218.1|  PREDICTED: probable pectinesterase/pectinest...    109   5e-25   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   109   5e-25   
gb|AAQ21126.1|  pectinesterase                                          105   5e-25   
emb|CDY51430.1|  BnaA04g27070D                                          109   5e-25   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   109   5e-25   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     108   5e-25   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   108   5e-25   
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          109   6e-25   
emb|CDY51798.1|  BnaC06g41940D                                          110   6e-25   
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               109   6e-25   
ref|XP_007038413.1|  Pectinesterase                                     109   6e-25   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     108   6e-25   
ref|XP_010324324.1|  PREDICTED: pectinesterase 3                        109   6e-25   
ref|XP_003608135.1|  Pectinesterase                                     109   6e-25   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     109   6e-25   
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    109   6e-25   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     109   6e-25   
ref|XP_002304257.2|  pectinesterase family protein                      109   7e-25   
gb|AAB38794.1|  pectin methylesterase                                   108   7e-25   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   108   7e-25   
gb|AFG69049.1|  hypothetical protein 2_5100_02                          103   7e-25   
dbj|BAF00855.1|  hypothetical protein                                   109   7e-25   
ref|XP_006287360.1|  hypothetical protein CARUB_v10000558mg             109   7e-25   
ref|XP_007050982.1|  Plant invertase/pectin methylesterase inhibi...    109   7e-25   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    109   7e-25   
gb|ABK24883.1|  unknown                                                 109   7e-25   
emb|CAC01624.1|  putative pectin methylesterase                         109   7e-25   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     109   7e-25   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   108   7e-25   
gb|AAR03544.1|  pectin methylesterase isoform 1                         105   7e-25   
ref|NP_563662.1|  pectinesterase 7                                      109   7e-25   
ref|NP_001042866.1|  Os01g0312500                                       108   7e-25   
ref|XP_009417531.1|  PREDICTED: probable pectinesterase/pectinest...    110   7e-25   
gb|EYU29496.1|  hypothetical protein MIMGU_mgv1a003055mg                109   7e-25   
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    108   7e-25   
ref|XP_006421696.1|  hypothetical protein CICLE_v10004719mg             108   7e-25   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     109   7e-25   
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     109   8e-25   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   108   8e-25   
ref|XP_002894186.1|  predicted protein                                  108   8e-25   
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    109   8e-25   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    108   8e-25   
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    109   8e-25   
gb|KHN17768.1|  Pectinesterase/pectinesterase inhibitor PPE8B           108   8e-25   
ref|XP_003551027.1|  PREDICTED: pectinesterase/pectinesterase inh...    108   8e-25   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     109   8e-25   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    109   8e-25   
gb|KDP33984.1|  hypothetical protein JCGZ_07555                         109   8e-25   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   108   8e-25   
ref|XP_011017534.1|  PREDICTED: probable pectinesterase/pectinest...    107   9e-25   
ref|XP_006407094.1|  hypothetical protein EUTSA_v10020354mg             109   9e-25   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               108   9e-25   
ref|XP_011072691.1|  PREDICTED: pectinesterase-like                     108   9e-25   
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      108   9e-25   
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    109   9e-25   
ref|XP_010687790.1|  PREDICTED: probable pectinesterase/pectinest...    105   1e-24   
ref|XP_002301275.2|  hypothetical protein POPTR_0002s14660g             107   1e-24   
gb|KFK42633.1|  hypothetical protein AALP_AA1G020600                    109   1e-24   
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   107   1e-24   
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     108   1e-24   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             108   1e-24   
gb|AAB67740.1|  PME1.9                                                  107   1e-24   
ref|NP_189437.1|  plant invertase/pectin methylesterase inhibitor...    108   1e-24   
ref|XP_003609932.1|  Pectinesterase                                     109   1e-24   
gb|EPS72184.1|  pectinesterase family protein                           108   1e-24   
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     108   1e-24   
ref|XP_007138594.1|  hypothetical protein PHAVU_009G222100g             108   1e-24   
gb|AAL66865.1|  pectin methylesterase                                   103   1e-24   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    108   1e-24   
gb|KHN42841.1|  Pectinesterase/pectinesterase inhibitor PPE8B           108   1e-24   
ref|XP_003546532.1|  PREDICTED: pectinesterase/pectinesterase inh...    108   1e-24   
ref|XP_002322401.1|  putative pectin methylesterase family protein      108   1e-24   
ref|XP_011078160.1|  PREDICTED: pectinesterase-like isoform X2          108   1e-24   
ref|NP_567227.1|  Probable pectinesterase/pectinesterase inhibito...    108   1e-24   
ref|XP_010999998.1|  PREDICTED: probable pectinesterase/pectinest...    108   1e-24   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    108   1e-24   
ref|NP_001146685.1|  pectinesterase precursor                           108   1e-24   



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIMQS IDGFIAPEGWSPW G   LDTL+YAEYQNRG G+ T SRV W GY+
Sbjct  450  PWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQ  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+  +A QFT G+ + GDEW+K +G+ Y+ GM +V
Sbjct  510  KTIAPQVAAQFTPGVFIMGDEWVKLSGVPYEPGMIRV  546



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   142 bits (358),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIMQS IDGFIAPEGWSPW G   LDTL+YAEYQNRG G+ T SRV W GY+
Sbjct  450  PWKEFSRTIIMQSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQ  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+  +A QFT  + + GDEW+K +G+ Y+ GM +V
Sbjct  510  KTIAPQVAAQFTPAVFIMGDEWVKLSGVPYEPGMIRV  546



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 72/94 (77%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIMQ+ IDGFIAPEGWSPW G  G+DT +YAEY NRG GA T+ RV+W G K
Sbjct  451  PWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIK  510

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K I+  IA+ FT G  +QGD WI  +G++Y SGM
Sbjct  511  K-ITPQIAQSFTPGAYIQGDAWITASGVTYASGM  543



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 74/97 (76%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIMQS IDGFI P+GWS W G+  L TL+YAEY+NRG GA++ +RV W GYK
Sbjct  458  PWKEFSRTIIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIGANSNNRVNWRGYK  517

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            KNI  +IA  F  G+ +  DEW++ +G+ Y+SG+ KV
Sbjct  518  KNIGKEIAAGFAPGVFILADEWVRLSGVPYESGLMKV  554



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIMQSYID FI PEGW+PW+G   L+TL+YAEYQNRG GA+   RVKW GYK
Sbjct  467  PWKEYSRTIIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYK  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
            +NIS   A+++     +  D WIK+TGISY
Sbjct  527  RNISPQEAEKYAPAHFIDQDNWIKKTGISY  556



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIMQ+ IDGFIAPEGWSPW G  G+DT +YAEY NRG GA T+ RV+W G K
Sbjct  467  PWKEFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIK  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K I+  IA+ FT G  +QGD WI  +G+ Y  GM
Sbjct  527  K-ITPQIAQSFTPGAYIQGDAWITASGVPYAPGM  559



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIMQ+ ID FI PEGW+PW+G   L+TL+YAEYQNRG GA+T  RVKW GYK
Sbjct  463  PWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDKRVKWAGYK  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
            +NIS   A+++   + +  D WIK+TGISY
Sbjct  523  RNISPQEAEKYAPNIFIDQDSWIKKTGISY  552



>ref|XP_003632058.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Vitis vinifera]
Length=553

 Score =   129 bits (323),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IMQSY+DG I P GW PW G   L TL+Y EY N G GAST+ RVKW GY+
Sbjct  458  PWKKYSRTVIMQSYLDGSIPPSGWYPWSGSFALSTLFYGEYMNAGPGASTSGRVKWGGYQ  517

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ++A +A++FTVG  + G+ W+  TG+S+DSG+
Sbjct  518  GELTASVAQEFTVGEFISGNAWLPSTGVSFDSGL  551



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTII+QSYID FI PEGW+PW+G   L+TL+YAEYQNRG GA+   RVKW GYK
Sbjct  467  PWKEYSRTIIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANIDKRVKWGGYK  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
            +NIS   A+++     +  D WIK+TGISY
Sbjct  527  RNISPQEAEKYAPAHFIDQDNWIKKTGISY  556



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRTIIMQS IDGFI PEGW+PW G   LDTL++ EYQNRG GA+T  RV W  Y 
Sbjct  458  PWKLYSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYI  517

Query  267  KNISADIAKQFTVGMLLQG----DEWIKETGISYDSGMTKV  157
            KN + D+  +FT G++L+G    D W+ +TG+ Y+ GM KV
Sbjct  518  KNPTPDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMKV  558



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRTIIMQS IDGFI PEGW+PW G   LDTL++ EYQNRG GA+T  RV W  Y 
Sbjct  458  PWKLYSRTIIMQSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYI  517

Query  267  KNISADIAKQFTVGMLLQG----DEWIKETGISYDSGMTKV  157
            KN + D+  +FT G++L+G    D W+ +TG+ Y+ GM KV
Sbjct  518  KNPTPDVIAKFTPGVVLKGGDNTDTWVTKTGVPYEPGMMKV  558



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   128 bits (321),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIMQS ID FI PEGW+PW+G   L+TL+YAEYQNRG GA+T  RVKW GYK
Sbjct  459  PWKEYSRTIIMQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTDRRVKWAGYK  518

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
            K+IS   A+++   + +  D WIK+TGISY
Sbjct  519  KSISPQEAEKYAPNIFIDQDSWIKKTGISY  548



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   128 bits (321),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS ID  I PEGWS W G+  L TL+Y EYQNRG GA T+ RVKW GY 
Sbjct  455  PWKEYSRTVVMQSNIDNHIVPEGWSVWSGDFALKTLYYGEYQNRGPGAGTSGRVKWPGYH  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTV  L+QG EW+K TG++Y  G+
Sbjct  515  VITSAAEASKFTVAQLIQGGEWLKNTGVAYTEGL  548



>emb|CBI39447.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IMQSY+DG I P GW PW G   L TL+Y EY N G GAST+ RVKW GY+
Sbjct  337  PWKKYSRTVIMQSYLDGSIPPSGWYPWSGSFALSTLFYGEYMNAGPGASTSGRVKWGGYQ  396

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ++A +A++FTVG  + G+ W+  TG+S+DSG+
Sbjct  397  GELTASVAQEFTVGEFISGNAWLPSTGVSFDSGL  430



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   127 bits (318),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQSYID  I  +GW  WDGE  L TL+Y EYQNRG GA T  RVKW GY 
Sbjct  460  PWKAYSRTVVMQSYIDSHINSKGWLEWDGEFALKTLFYGEYQNRGPGAGTGGRVKWPGYH  519

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                A+ AK FTV  L+QG  W+KETG+++  G+
Sbjct  520  VITDANTAKAFTVASLIQGGSWLKETGVAFAEGL  553



>gb|ABZ89800.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=584

 Score =   125 bits (314),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+I+QS++D  I P GW  WDG   L TL+Y EY NRG GA+TA+RVKW G++
Sbjct  490  PWKQYSRTVILQSHLDDLIHPAGWHEWDGNFALSTLYYGEYMNRGPGAATANRVKWGGHR  549

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S+  A QFTV   LQGD W+  TG+ Y +G T
Sbjct  550  VITSSSEANQFTVNQFLQGDSWLPATGVQYTAGFT  584



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M++ +DG I PEGWSPW G+ GL TL+Y EY N G+GAST  RVKW GY 
Sbjct  414  PWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYH  473

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  L GD WI  TG+ Y SG+
Sbjct  474  VITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  507



>ref|XP_006411580.1| hypothetical protein EUTSA_v10016522mg [Eutrema salsugineum]
 gb|ESQ53033.1| hypothetical protein EUTSA_v10016522mg [Eutrema salsugineum]
Length=520

 Score =   124 bits (311),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GWSPW G  GL+TL+Y E++N G G+S + RVKW+GY 
Sbjct  425  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGSFGLNTLFYGEFENSGPGSSVSGRVKWSGYH  484

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A++FTV   + G  W+  TG+S+DSG+ K
Sbjct  485  SSLTVKEAERFTVAGFIDGAMWLPSTGVSFDSGLVK  520



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 72/95 (76%), Gaps = 1/95 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK++SRTIIMQ+ IDGFIAPEGW+PW+G   LDTL+Y E++NRG G+  + RV+W G  
Sbjct  477  PWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNRGPGSDMSRRVRWKGI-  535

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
            + I+  IA+ FT G L  GDEW++++G+ Y +GM 
Sbjct  536  QTITPAIAESFTPGRLFAGDEWVRQSGVPYVAGMV  570



>ref|XP_002271665.2| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=561

 Score =   124 bits (310),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS I   I P GW  WDG+  L TL+Y EY+NRG G++T+ RV W GY+
Sbjct  465  PWKEYSRTVYMQSNIGNLIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYR  524

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
               S+ +A QFTVG  +QGDEW+  TGI Y S +T V
Sbjct  525  VINSSSVASQFTVGAFIQGDEWLPATGIPYYSNLTIV  561



>ref|XP_002880019.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56278.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=518

 Score =   123 bits (308),  Expect = 5e-30, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I G I P GWSPW G  GL +L+Y E++N G G+S + RVKW+GY 
Sbjct  423  PWKEYSRTVVMQSFIGGSIHPSGWSPWSGGFGLKSLFYGEFENSGPGSSVSGRVKWSGYH  482

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A++FTV + + G+ W+  TG+S+DSG+ K
Sbjct  483  SSLTLTEAEKFTVAVFIDGNMWLPSTGVSFDSGLVK  518



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   123 bits (308),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M++ +DG I PEGWSPW G+ GL TL+Y EY N G+GAST  RVKW GY 
Sbjct  441  PWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWRGYH  500

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  L GD WI  TG+ Y SG+
Sbjct  501  VITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  534



>gb|KFK37147.1| hypothetical protein AALP_AA4G219300 [Arabis alpina]
Length=489

 Score =   122 bits (307),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQSY+ G I P GWSPW G  GL+TL+Y E+ N G G+S + RVKW+GY 
Sbjct  394  PWKAYSRTVVMQSYLGGEIHPSGWSPWSGGFGLNTLFYGEFMNTGPGSSVSGRVKWSGYH  453

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              ++   A++FTV   + GD W+  TGIS+DSG+ K
Sbjct  454  SALTVTEAEKFTVAKFIDGDTWLPSTGISFDSGLMK  489



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIMQ+ ID  I P+GW PW G+  L T +YAEY NRG GA    RVKW G K
Sbjct  483  PWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGPGAVLTQRVKWRGIK  542

Query  267  KNI-SADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
             +I + + A+QFT G  ++GD WIK TG+ YDSG++ +
Sbjct  543  TSIMTPEKAQQFTAGRFIRGDSWIKPTGVPYDSGLSSM  580



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 71/97 (73%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI+MQS IDGFIAPEGWSPW G   L TL+Y EYQNRGAG+  + RV W G K
Sbjct  490  PWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAGSGLSGRVTWKGIK  549

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+  IA+ FT G++ + D W+  +GI Y SGM ++
Sbjct  550  K-ITPAIAQSFTPGVVYKNDTWVSTSGIPYVSGMLQL  585



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRTIIM+SYID  I P+GW PW G+ GL+T +YAEY+NRG GASTA RVKW G K
Sbjct  480  PWKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGASTARRVKWKGIK  539

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K I+   A +FT G  ++GD WI+  G+ Y +GM
Sbjct  540  K-ITPQHAVEFTAGRFMKGDRWIRTAGVPYVAGM  572



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   122 bits (307),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSYI   I P GWS W+G+  L TL+Y EY NRG GA T  RVKW GY+
Sbjct  450  PWKEYSRTVVMQSYIADHIDPSGWSIWNGDFALKTLYYGEYMNRGPGAGTCKRVKWPGYR  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                A+ AK FTV  L+QG  W+K TG++Y  G+
Sbjct  510  ILTKAEEAKPFTVAELIQGGSWLKSTGVAYTEGL  543



>ref|XP_003591484.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591505.1| Pectinesterase [Medicago truncatula]
 gb|AES61735.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|KEH15892.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=315

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D FI P GW  W+G+  L+TL+YAEY NRGAG+ST +RV W GY 
Sbjct  222  PWKEYSRTVFMQSFMDSFINPAGWHEWNGDFALNTLYYAEYSNRGAGSSTVNRVTWPGYH  281

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I A  A  FTV   L GD+WI +TG+ Y SG+
Sbjct  282  V-IGATDAANFTVSNFLSGDDWIPQTGVPYSSGL  314



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK++SRTIIMQ+ IDGFIAPEGW+PW G   LDTL+Y E++NRG G+  + RV+W G  
Sbjct  477  PWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGEFKNRGPGSDMSRRVRWKGI-  535

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
            + I+  IA  FT G L  GDEW++++G+ Y +GM 
Sbjct  536  QTITPAIADSFTPGRLFAGDEWVRQSGVPYVAGMV  570



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 71/96 (74%), Gaps = 1/96 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRT+IMQS ID  IAPEGW PW+G+  L+TLWYAE+ NRG GA    RV W G K
Sbjct  590  PWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPGAVQTHRVTWRGIK  649

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
            K I+A IA++FT G+ L+GD+WI + G+ Y  G+ +
Sbjct  650  K-INAAIARRFTPGVFLRGDDWIPKAGVPYTPGLIR  684



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS WDGE  L TL+Y EY N+GAGA T+ RVKW GY 
Sbjct  454  PWKEYSRTVVMQSNIGDHIDPAGWSIWDGEFALKTLYYGEYMNKGAGAGTSKRVKWPGYH  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  AK+FTV  L+QG  W+K TG+++  G+
Sbjct  514  VITSATEAKKFTVAELIQGGAWLKSTGVAFTEGL  547



>emb|CDY56347.1| BnaCnng30140D [Brassica napus]
Length=517

 Score =   122 bits (305),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GWSPW G  GL TL+YAE+ N G G+S + RVKW GY 
Sbjct  422  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGGFGLKTLFYAEFGNSGPGSSVSGRVKWAGYH  481

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A+ FTV   + G  W+  TG+S+DSG+ K
Sbjct  482  SSLTVKEAEGFTVANFIGGTMWLPSTGVSFDSGLVK  517



>ref|XP_003591482.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591507.1| Pectinesterase [Medicago truncatula]
 gb|AES61733.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=556

 Score =   122 bits (306),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D FI P GW  W+G+  L+TL+YAEY NRGAG+ST +RV W GY 
Sbjct  463  PWKEYSRTVFMQSFMDSFINPAGWHEWNGDFALNTLYYAEYSNRGAGSSTVNRVTWPGYH  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I A  A  FTV   L GD+WI +TG+ Y SG+
Sbjct  523  V-IGATDAANFTVSNFLSGDDWIPQTGVPYSSGL  555



>ref|XP_010552499.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Tarenaya hassleriana]
Length=536

 Score =   122 bits (305),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT++MQS+IDG I P GWSPW G   L+TL+Y EY N G G+S + RVKW+GY 
Sbjct  441  PWKQYSRTVVMQSFIDGSIHPSGWSPWSGSFALNTLFYGEYGNSGPGSSVSGRVKWSGYH  500

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A+ FTV   +QG+ W+  TG+S+DSG+ K
Sbjct  501  PSLTLAEAQGFTVSGFIQGNMWLPSTGVSFDSGLVK  536



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   123 bits (308),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSYI   I P GW  WDG+  L+TL+Y EY NRG GA T+ RVKW GY 
Sbjct  563  PWKEYSRTVVMQSYIGDLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWAGYH  622

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A++FTV  L+QG  W++ TG+ Y  G+
Sbjct  623  VITSPDEAQKFTVAELIQGGPWLESTGVDYTEGL  656



>ref|XP_009383093.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   122 bits (305),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IM+S++D  I P GW PW+G+  LDTL+YAEY N G G+ T +RV W GY 
Sbjct  475  PWKKYSRTVIMESFMDSLIDPAGWLPWNGKFALDTLYYAEYNNTGKGSDTDNRVTWPGYH  534

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              IS+D A  FTV   +QGD W+  TG++YDSG+
Sbjct  535  V-ISSDDAMNFTVRNFIQGDNWLPHTGVAYDSGL  567



>gb|AAQ21125.1| pectinesterase [Fragaria x ananassa]
Length=193

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSR +IM+S +DG IAP+GW PW G  GLDTL+Y EY N GAGA+T  RVKW G++
Sbjct  100  PWQKYSRVVIMKSNLDGLIAPQGWFPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFR  159

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  L GD W+  TG+ +++G+
Sbjct  160  VITSATEAGKFTVGNFLAGDAWLPGTGVPFEAGL  193



>ref|XP_006349951.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=149

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            P K YSRTI+MQS IDGFI PEGW+P+ G  GL+TL++ EYQNRG GA+T  RV W  Y 
Sbjct  49   PGKMYSRTIVMQSQIDGFIEPEGWTPFAGTFGLETLYFVEYQNRGPGANTDKRVTWKNYI  108

Query  267  KNISADIAKQFTVGMLLQG----DEWIKETGISYDSGMTKV  157
            KN   D+  +F  G++L+G    D W+K+TG+ Y+  M K+
Sbjct  109  KNPPQDVVAKFAPGVVLKGGDNTDGWVKKTGVQYEPEMMKM  149



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIMQS IDGFI P+GWSPW G  GL TL+YAEYQNRG GA+T  RV W G  
Sbjct  471  PWKEYSRTIIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGI-  529

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++I+  +A+ FT G    GD WI  +G  Y  GM KV
Sbjct  530  QHITPQVAESFTPGKYFIGDSWITASGFPYVPGMLKV  566



>gb|KEH41800.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=559

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D FI P GW  W+G+  L+TL+YAEY NRGAG+ST +RV W GY 
Sbjct  466  PWKEYSRTVYMQSFMDSFINPSGWREWNGDFALNTLYYAEYSNRGAGSSTVNRVTWPGYH  525

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I A  A  FTV   + GD+WI +TG+ Y SG+
Sbjct  526  V-IGATDAANFTVSNFVSGDDWIPQTGVPYSSGL  558



>ref|XP_008235121.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=562

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M+SYID  + P GW  W+G   L TL+Y EY NRG G++T++RVKW GY+
Sbjct  467  PWKEYSRTVYMKSYIDDLVQPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVKWPGYR  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S+D A QFTVG  +QG+EW+  T I Y  G+T
Sbjct  527  VINSSDEANQFTVGPFIQGNEWLNSTNIPYFIGLT  561



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   121 bits (303),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQSY+   + P GW  WDG+  L TL+Y EY N G GA TA RVKW GY+
Sbjct  455  PWKAYSRTVYMQSYLGAHVHPRGWLEWDGDFALRTLFYGEYANEGPGAGTAGRVKWPGYR  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                  +A QFTVG  +QG  WIK TG++YD G+
Sbjct  515  VITDRSVAVQFTVGRFIQGANWIKGTGVAYDDGL  548



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   121 bits (303),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS++   + P+GW  WDGE  L TL+Y EYQN G GA TA RV+W GY 
Sbjct  456  PWKAYSRTVYMQSFLGPHVDPKGWLEWDGEFALRTLFYGEYQNEGPGAGTAGRVRWPGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                  +A QFTVG  +QG  W+K+TG+ YD G+
Sbjct  516  VITDRAVALQFTVGKFIQGGRWLKDTGVDYDEGL  549



>ref|XP_010261668.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=576

 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQS+I   I PEGW  W+G   L+TL+Y EY+N GAGA+TA RVKW GYK
Sbjct  483  PWKEYSRTVIMQSFITDVIHPEGWHAWNGNFALNTLYYGEYRNTGAGAATAKRVKWKGYK  542

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA +A+QFTV   + GD W+  TG  + +G+
Sbjct  543  VITSATVAQQFTVKNFILGDHWLGSTGFPFSAGL  576



>gb|ABK24761.1| unknown [Picea sitchensis]
Length=557

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYIDGFI P GW  WDG+  L TL+Y EY N G G+ T +RVKW GY+
Sbjct  462  PWKEYSRTVFMQSYIDGFIQPAGWLEWDGDFALKTLYYGEYMNTGPGSGTGNRVKWPGYR  521

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S   A +FTVG  +QGD W++ TG+ Y  G+T
Sbjct  522  VIKSPQEASKFTVGEFIQGDSWLQSTGVHYVDGLT  556



>dbj|BAF95866.1| pectin methylesterase isoform alpha [Vitis hybrid cultivar]
Length=234

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS I   I P GW  WDG+  L TL+Y EY+NRG G++T+ RV W GY+
Sbjct  106  PWKEYSRTVYMQSNIGDLIDPAGWLEWDGDFALSTLYYGEYKNRGPGSNTSGRVTWPGYR  165

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
               S+ +A QFTVG  +QGDEW+  TGI Y S +T V
Sbjct  166  VINSSSVASQFTVGAFIQGDEWLPATGIPYYSNLTIV  202



>ref|XP_002527752.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF34613.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=583

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++Y+R +IMQS++DG I P GW PW G   L+TL+YAEY N G GAST+ RVKW GYK
Sbjct  488  PWQKYARVVIMQSFLDGSINPAGWFPWSGSFALNTLYYAEYMNSGPGASTSGRVKWPGYK  547

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +S+  A+ FTVG  ++G+ W+  TG+S+DSG+
Sbjct  548  GILSSAAAQTFTVGNFIEGNMWLPSTGVSFDSGL  581



>gb|KDP42887.1| hypothetical protein JCGZ_23829 [Jatropha curcas]
Length=580

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+++SRT+IMQS++D  I P GWSPW G   L+TL+YAEY N G GAST+ RVKW GY+
Sbjct  485  PWQKFSRTVIMQSFLDNSINPSGWSPWSGNFALNTLFYAEYMNSGPGASTSGRVKWAGYR  544

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ++A  A+ FTVG  + G+ W+  TG+S+DSG+
Sbjct  545  GILTAAAAQAFTVGGFIDGNMWLPSTGVSFDSGL  578



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRTIIMQ  ID  I PEGW PW G+  L TL+YAE  NRG GA+T  RVKW G K
Sbjct  475  PWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+   A  FTVG  ++GD WIK TG+ Y SGM  V
Sbjct  535  K-ITPQHALDFTVGRFIRGDPWIKPTGVPYSSGMMAV  570



>ref|XP_009142158.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Brassica rapa]
 emb|CDY30378.1| BnaA04g24790D [Brassica napus]
Length=516

 Score =   120 bits (300),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GWSPW G  GL TL+Y E+ N G G+S + RVKW GY 
Sbjct  421  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGGFGLKTLFYGEFGNSGPGSSVSGRVKWAGYH  480

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A+ FTV   + G  W+  TG+S+DSG+ K
Sbjct  481  SSLTVKEAEGFTVANFIGGTMWLPSTGVSFDSGLVK  516



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS WDGE  L TL+Y EY N+GAGA T+ RVKW GY 
Sbjct  464  PWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVKWPGYH  523

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA+ AK+FTV  L+QG  W+K TG+SY  G+
Sbjct  524  VITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  557



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 70/101 (69%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDG-EIGLDTLWYAEYQNRGAGASTASRV-KWNG  274
            PWKEYSRTIIMQS+IDGFI P GWSPW+  + GL T WYAEYQNRG GAS   RV  W G
Sbjct  455  PWKEYSRTIIMQSFIDGFIDPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRG  514

Query  273  YKKNISADIAKQFTVGMLLQ--GDEWIKETGISYDSGMTKV  157
            Y++ IS D+A  FT G  +   G  ++ +  I Y++GM KV
Sbjct  515  YQRGISGDVANSFTAGQFINPSGSSFLPKADIPYEAGMMKV  555



>gb|KFK37146.1| hypothetical protein AALP_AA4G219200 [Arabis alpina]
Length=491

 Score =   119 bits (299),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQSY+ G I P GW PW G  GL+TL+Y E+ N G G+S + RVKW+GY 
Sbjct  396  PWKAYSRTVVMQSYLGGEIHPSGWYPWSGGFGLNTLFYGEFMNTGPGSSVSGRVKWDGYH  455

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              ++   A++FTV   + GD W+  TG+S+DSG+ K
Sbjct  456  SALTVTEAEKFTVANFIDGDMWLPSTGVSFDSGLVK  491



>ref|XP_003591498.1| Pectinesterase [Medicago truncatula]
Length=335

 Score =   118 bits (295),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS+ D FI P GW  W+G+  L+TL+YAEY NRGAG+ST +RV W GY 
Sbjct  242  PWKEYSRTVFMQSFTDSFINPAGWHEWNGDFALNTLYYAEYGNRGAGSSTVNRVTWPGYH  301

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I A  A  FTV   L GD+WI +TG+ Y SG+
Sbjct  302  V-IGATDAANFTVSNFLSGDDWIPQTGVPYSSGL  334



>ref|XP_010058840.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=599

 Score =   120 bits (302),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRT+IM+SYI   + P GWS + G  GL TL+Y EYQNRG G++T+ RVKW GYK
Sbjct  505  PWKEFSRTVIMESYISDLVDPAGWSEFHGSAGLSTLFYGEYQNRGPGSNTSDRVKWPGYK  564

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+ +AKQFTV   +QG++W+ +TG  Y SG+
Sbjct  565  VITSSTVAKQFTVESFIQGNQWLNDTGFPYFSGL  598



>ref|XP_010524121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Tarenaya hassleriana]
Length=559

 Score =   120 bits (300),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 51/96 (53%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+IMQS++DG I P GWSPW G   L+TL+Y EY N G G+S + RVKW GY 
Sbjct  464  PWRQYSRTVIMQSFLDGSIHPAGWSPWSGNFALNTLFYGEYGNSGPGSSVSGRVKWPGYH  523

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             ++S   A+ FTV  L+ G+ W+  TG+S+DSG+ K
Sbjct  524  PSLSLAQAQGFTVSALIDGNMWLPSTGVSFDSGLVK  559



>gb|ABK94644.1| unknown [Populus trichocarpa]
Length=327

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS WDGE  L TL+Y EY N+GAGA T+ RV W GY 
Sbjct  234  PWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYH  293

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA+ AK+FTV  L+QG  W+K TG+SY  G+
Sbjct  294  VITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  327



>sp|Q43043.1|PME_PETIN RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Petunia integrifolia]
 gb|AAA33714.1| pectinesterase [Petunia integrifolia subsp. inflata]
Length=374

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWD-GEIGLDTLWYAEYQNRGAGASTASRVKWNGY  271
            PWKEYSRTIIMQSYID FI PEGW+PW+    G DT +YAEYQNRG GA+   R+ W G+
Sbjct  276  PWKEYSRTIIMQSYIDKFIEPEGWAPWNITNFGRDTSYYAEYQNRGPGAALDKRITWKGF  335

Query  270  KKNISADIAKQFTVGMLLQGDE-WIKETGISYDSGMTKV  157
            +K  + + A++FT G+ +  DE W+++  + Y++GM KV
Sbjct  336  QKGFTGEAAQKFTAGVYINNDENWLQKANVPYEAGMMKV  374



>ref|XP_009111182.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Brassica rapa]
Length=576

 Score =   119 bits (299),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQSYIDGF+ P GW  W+G+  L TL+YAEY N G G++T SRV WNGY 
Sbjct  482  PWKEYSRTVIMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTSRVTWNGYH  541

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV  L   D+WI +TG+ Y SG+
Sbjct  542  VANSTD-AANFTVTGLFLEDDWIWKTGVPYTSGL  574



>ref|XP_010103929.1| putative pectinesterase/pectinesterase inhibitor 35 [Morus notabilis]
 gb|EXB97446.1| putative pectinesterase/pectinesterase inhibitor 35 [Morus notabilis]
Length=567

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IM+SY+DG I+P GW PW G   L TL+YAEY+N G GAST  RV W GY 
Sbjct  472  PWKQYSRTVIMESYLDGSISPSGWYPWSGGFALKTLFYAEYRNTGPGASTGRRVNWAGYH  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +++A  A  FTV   + G+ W+  TG+S+DSG+
Sbjct  532  PSLTAPQANSFTVAGFISGNAWLPSTGVSFDSGL  565



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS W+G+  L TL+Y EY NRGAGA T+ RVKW GY+
Sbjct  451  PWKEYSRTVVMQSNIADHIDPAGWSIWEGDFALKTLYYGEYMNRGAGAGTSKRVKWAGYR  510

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A++FTV  L+QG  W+K TG+++  G+
Sbjct  511  VITSATEAQKFTVAELIQGGVWLKSTGVAFTEGL  544



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRTIIMQS ID  I PEGW PW G   L+TL+YAE  NRG GA+T  RVKW G K
Sbjct  475  PWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+ + A  FT    ++GD WIK TG+ Y SGM  V
Sbjct  535  K-ITMEHALDFTAARFIRGDPWIKPTGVPYTSGMMAV  570



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRTIIMQS ID  I PEGW PW G   L+TL+YAE  NRG GA+T  RVKW G K
Sbjct  478  PWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK  537

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+ + A  FT    ++GD WIK TG+ Y SGM  V
Sbjct  538  K-ITMEHALDFTAARFIRGDPWIKPTGVPYTSGMMAV  573



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 71/101 (70%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWD-GEIGLDTLWYAEYQNRGAGASTASRV-KWNG  274
            PWKEYSRTIIMQSYIDGFI P GW+PW+  E G+ T WYAEYQNRG GAS   R+  W G
Sbjct  455  PWKEYSRTIIMQSYIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRG  514

Query  273  YKKNISADIAKQFTVGMLLQGDE--WIKETGISYDSGMTKV  157
            Y+K IS D+A  FT G+ +   +  ++ +  I Y++GM KV
Sbjct  515  YQKGISGDVANSFTAGLFINPTDSSFLPKADIPYEAGMMKV  555



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDG+  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  463  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFK  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                +  A QFTV  L+QG  W+K TG+++  G+
Sbjct  523  VIRDSKEADQFTVAKLIQGGLWLKPTGVTFQEGL  556



>ref|XP_004513409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Cicer arietinum]
Length=554

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI MQS++D FI P GW  W+G   L TL+YAEY NRG+G+ST +RV W GY 
Sbjct  461  PWKEYSRTIFMQSFMDSFINPAGWHDWNGSFALSTLYYAEYNNRGSGSSTVNRVTWPGYH  520

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+WI  TG+ Y SG+
Sbjct  521  V-INATDASNFTVSNFLSGDDWIPPTGVPYLSGL  553



>ref|XP_010056842.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=538

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRT+IM+SYI   + P GWS + G  GL TL+Y EYQNRG G++ + RVKW GYK
Sbjct  444  PWKEFSRTVIMESYIGDLVDPAGWSEFHGSAGLRTLFYGEYQNRGPGSNMSDRVKWPGYK  503

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+ +AKQFTV   +QG++W+  TG  Y SG+
Sbjct  504  VITSSTVAKQFTVESFIQGNQWLNNTGFPYFSGL  537



>ref|XP_004513411.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Cicer arietinum]
Length=554

 Score =   119 bits (297),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI MQS++D FI P GW  W+G   L TL+YAEY NRG+G+ST +RV W GY 
Sbjct  461  PWKEYSRTIFMQSFMDSFINPAGWHDWNGSFALSTLYYAEYNNRGSGSSTVNRVTWPGYH  520

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+WI  TG+ Y SG+
Sbjct  521  V-INATDAANFTVSNFLSGDDWIPPTGVPYLSGL  553



>ref|XP_004155863.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=227

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT++M+S I GFI+P GW PW G   L+TL+YAEY N G GASTA+RV W GY 
Sbjct  134  PWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGPGASTANRVNWKGYH  193

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  + G  W+  TG+ + SG+
Sbjct  194  VITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  227



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT++M+S +DG I P GWSPW G  GL +L+YAEY N GAGASTA RVKW G++
Sbjct  429  PWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFR  488

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              IS+  A +FTVG  L G  WI  +G+ +D+G+
Sbjct  489  L-ISSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   118 bits (296),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT++M+S +DG I P GWSPW G  GL +L+YAEY N GAGASTA RVKW G++
Sbjct  429  PWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWPGFR  488

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              IS+  A +FTVG  L G  WI  +G+ +D+G+
Sbjct  489  L-ISSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>gb|ACJ02103.1| pectin methylesterase [Oncidium hybrid cultivar]
Length=529

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT++MQSYID  + P+GW  WDG+  L TL+Y EY N G GA TA RV W GY 
Sbjct  436  PWKQYSRTVVMQSYIDSHVNPKGWLEWDGDFALKTLFYGEYSNSGPGAGTAGRVNWAGYH  495

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 ++A  FTV  L+QG +W++ TG+++  G+
Sbjct  496  VITDPNVANDFTVAKLIQGGQWLRATGVAFTEGL  529



>gb|KFK30820.1| pectinesterase family protein [Arabis alpina]
Length=572

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYIDGF+ P GW  W+G+  L TL+YAEY N G+G++T  RV W GY 
Sbjct  478  PWKEYSRTVFMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGSGSNTTDRVVWPGYH  537

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV + L GDEW+ ++G+ Y SG+
Sbjct  538  VMNSTD-ASNFTVSIFLFGDEWMVQSGVPYTSGL  570



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS WDGE  L TL+Y EY N+GAGA T+ RV W GY 
Sbjct  456  PWKEYSRTVVMQSNIGDLIDPAGWSAWDGEFALKTLYYGEYLNQGAGAGTSKRVNWAGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA+ AK+FTV  L+QG  W+K TG+SY  G+
Sbjct  516  VITSANEAKKFTVAELIQGGVWLKSTGVSYTEGL  549



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 72/101 (71%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWD-GEIGLDTLWYAEYQNRGAGASTASRV-KWNG  274
            PWKEYSRTIIMQS+IDGFI P GW+PW+  + G+ T WYAEYQNRGAGAS   RV  W G
Sbjct  455  PWKEYSRTIIMQSFIDGFIDPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRG  514

Query  273  YKKNISADIAKQFTVGMLLQ--GDEWIKETGISYDSGMTKV  157
            Y++ IS D+A  FT G+ +    + ++ +  I Y++GM KV
Sbjct  515  YQRGISGDVANSFTAGVFINPTDNSFLPKADIPYEAGMMKV  555



>ref|XP_010923950.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=547

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYID  + P+GW  W G+  LDTL+Y EY N G GA T+ RV W GY 
Sbjct  454  PWKEYSRTVFMQSYIDDHVDPKGWEEWSGDFALDTLFYGEYANVGPGAGTSGRVNWTGYH  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 ++AK FTV  L+QG  W++ TG+++  G+
Sbjct  514  VITDPNVAKDFTVAELIQGGTWLQSTGVAFTEGL  547



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   118 bits (295),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RV W G+K
Sbjct  454  PWKLYSRTVIMQSFIDNHINPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVTWKGFK  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                A  A+QFTV  L+QG  W+K TG++Y
Sbjct  514  VIRDAKEAEQFTVAKLIQGGLWLKPTGVTY  543



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   118 bits (295),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQ++ID  I P GW PWDGE  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  454  PWKLYSRTVIMQTFIDNHIDPAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFK  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG++Y
Sbjct  514  VIRDSKEAEQFTVAKLIQGGLWLKPTGVTY  543



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQ++ID  I P GW PWDGE  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  457  PWKLYSRTVIMQTFIDNHIDPAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFK  516

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG++Y
Sbjct  517  VIRDSKEAEQFTVAKLIQGGLWLKPTGVTY  546



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   117 bits (294),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IM+S +DG I P GW PW G   L TL+Y EY N GAGA T  RV W GY+
Sbjct  444  PWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGAGTGGRVNWPGYR  503

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG LL GD WI  TG+ + +G+
Sbjct  504  VIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTGL  537



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE SRTIIMQ+ I GFIAPEGWSPW G   LDT +Y EYQNRGAG+  A RV W G K
Sbjct  489  PWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIK  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYD  175
            K I+ +IA  +T G+  +GD+WIK +G+ Y+
Sbjct  549  K-ITPEIALSWTAGLAFKGDDWIKSSGVPYN  578



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE SRTIIMQS IDGFI+P+GWSPW G   LDT +Y EYQNRGAG+  A+RV W G K
Sbjct  469  PWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIK  528

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+ +IA+ +T G+  +GDEWIK   + Y   + K+
Sbjct  529  K-ITPEIAQSWTGGVAFKGDEWIKAARVPYVPTLMKI  564



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE SRTIIMQS IDGFI+P+GWSPW G   LDT +Y EYQNRGAG+  A+RV W G K
Sbjct  471  PWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTWKGIK  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K I+ +IA+ +T G+  +GDEWIK   + Y   + K+
Sbjct  531  K-ITPEIAQSWTGGVAFKGDEWIKAARVPYVPTLMKI  566



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   117 bits (293),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQ++ID  + P GW PWDGE  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  454  PWKLYSRTVIMQTFIDNHVDPAGWFPWDGEFALSTLYYGEYANSGPGADTSKRVKWKGFK  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
               ++  A+QFTV  L+QG  W+K TG++Y
Sbjct  514  VIRNSKEAEQFTVAKLIQGGLWLKPTGVTY  543



>ref|XP_008809854.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=550

 Score =   117 bits (293),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYID  + P+GW  W G+  LDTL+Y EY N G GA T+ RV W GY 
Sbjct  457  PWKEYSRTVFMQSYIDDHVDPKGWMEWSGDFALDTLYYGEYANIGPGAGTSGRVNWTGYH  516

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 ++AK FTV  L+QG  W++ TG+++  G+
Sbjct  517  VITDPNVAKDFTVAGLIQGGTWLQPTGVAFTEGL  550



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE SRTIIMQ+ I GFIAPEGWSPW G   LDT +Y EYQNRGAG+  A RV W G K
Sbjct  472  PWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKGIK  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYD  175
            K I+ +IA  +T G+  +GD+WIK  G+ Y+
Sbjct  532  K-ITPEIALSWTAGLAFKGDDWIKTAGVPYN  561



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ M++++D  I P GWSPW+G   LDTL+Y EY N G G+STA+RV W GY+
Sbjct  421  PWKQYSRTVFMKTFLDSLINPAGWSPWNGNFALDTLYYGEYMNTGPGSSTANRVNWKGYR  480

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+ +A QFTVG  + G+ W+  T + + +G+
Sbjct  481  VITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M++Y+D  I P GW PW+G   LDTL+Y EY N G G+STA+RV W GY+
Sbjct  421  PWKEYSRTVFMKTYLDSLINPAGWLPWNGNFALDTLYYGEYMNTGPGSSTANRVNWKGYR  480

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+ +A QFTVG  + G+ W+  T + + +G+
Sbjct  481  VITSSTVASQFTVGSFISGNNWLPATNVPFTAGL  514



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDG-EIGLDTLWYAEYQNRGAGASTASRVKWNGY  271
            PWKEYSRT+ M SY+D  + P GW  W+G +  L TL+Y EYQN+G GASTA RV W GY
Sbjct  452  PWKEYSRTVYMLSYLDSHVDPRGWLEWNGADFALKTLFYGEYQNQGPGASTAGRVNWPGY  511

Query  270  KKNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   +A QFTVG  +QG  W+K TG++Y+ G+
Sbjct  512  HVITDQSVAMQFTVGQFIQGGNWLKATGVNYNEGL  546



>ref|XP_010098738.1| Pectinesterase 3 [Morus notabilis]
 gb|EXB75641.1| Pectinesterase 3 [Morus notabilis]
Length=612

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IM+S ID  I P GW  WDGE  LDTL+YAEY NRGAGA+T  RVKW GYK
Sbjct  515  PWKQYSRTVIMESTIDDLIKPVGWLEWDGEFALDTLYYAEYANRGAGAATEQRVKWKGYK  574

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
                 + A QFT    +QGD W+K TG  Y  G   V
Sbjct  575  VIRDRNEALQFTAANFIQGDVWLKNTGAPYFLGFKHV  611



>ref|XP_007031046.1| Pectinesterase-2 precursor [Theobroma cacao]
 gb|EOY11548.1| Pectinesterase-2 precursor [Theobroma cacao]
Length=560

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ MQS++D  I P GWS W G   LDTL+YAEY+N+G G++T SRV+W GY 
Sbjct  465  PWKQYSRTVYMQSFMDKLIEPSGWSEWSGNFALDTLYYAEYKNKGPGSNTDSRVRWPGYH  524

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             NI+   A   TV   +QG+ W+  TG+ ++ G+
Sbjct  525  GNINDIDAANLTVSKFIQGESWLPATGVPFEGGL  558



>ref|XP_004513410.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20-like 
[Cicer arietinum]
Length=554

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI MQS++D FI P GW  W+G   L TL+YAEY NRG+ +ST++RV W GY 
Sbjct  461  PWKEYSRTIFMQSFMDSFINPAGWHDWNGSFALSTLYYAEYNNRGSSSSTSNRVTWPGYH  520

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+WI  TG+ Y SG+
Sbjct  521  V-INATDAANFTVSNFLSGDDWIPPTGVPYLSGL  553



>ref|XP_002889876.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66135.1| At1g11580/T23J18_33 [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/90 (57%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  463  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVKWKGFK  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG+++
Sbjct  523  VIKDSKEAEQFTVAKLIQGGLWLKPTGVTF  552



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ ++S++D  I P GW  W G+  L TL+Y EY NRG GA+T+SRV W GY+
Sbjct  467  PWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANTSSRVSWPGYR  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+  A QFTV   +QG+EW+  TG+ Y SG+
Sbjct  527  VINSSTEASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_010069351.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=537

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRTI+MQS +DG I P GWSPW G+  L TL+Y EY+N G GA  A RV+W  Y 
Sbjct  442  PWKQYSRTIVMQSLLDGSIHPLGWSPWSGDFALKTLFYGEYRNSGPGARIAGRVQWASYH  501

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             ++++  A++FTV   + G+ W+  TG+S+DSG+
Sbjct  502  GSLTSAQAQRFTVAQFISGNLWLPSTGVSFDSGL  535



>gb|AAN05419.1| putative pectin methylesterase [Populus tremula x Populus alba]
Length=99

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS +DG I PEGW PW G     +++Y EY N G G+ST+ RV W GY 
Sbjct  3    PWKEYSRTVVMQSLLDGSIDPEGWFPWAGGSSPKSIYYGEYSNSGPGSSTSGRVTWPGYH  62

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +++++ A++FTVG  + G+ W+  TG+++DSG+
Sbjct  63   SSLTSEEAQRFTVGSFISGNVWLPPTGVAFDSGL  96



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSYI   I P GWS W G+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  457  PWKEYSRTVVMQSYIGDHIDPVGWSEWSGDFALKTLYYGEYMNKGPGAGTSKRVKWAGYH  516

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               +A  A +FTV  L+QG EW+  TG++Y  G+
Sbjct  517  VITNAAEAAKFTVKELIQGVEWLGSTGVAYTEGL  550



>ref|XP_004296684.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35-like 
[Fragaria vesca subsp. vesca]
Length=579

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRTI+MQS++D  I   GWSPW G   L+TL+Y EY N G+GAST+ RVKW GY 
Sbjct  484  PWKQYSRTIVMQSFLDDSINRAGWSPWSGGFALNTLYYGEYMNSGSGASTSGRVKWGGYH  543

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             ++++  A+ FTVG  + G+ W+  TG+S+ SG+
Sbjct  544  ASLTSTQAQAFTVGGFISGNLWLPSTGVSFSSGL  577



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I P GWS WDG+  L TL+Y EY N+GAGA  + RV W GY 
Sbjct  453  PWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVNWPGYH  512

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K ++   A +FTVG L+QG  W+K TG++Y  G+
Sbjct  513  KALTTSEATKFTVGQLIQGAAWLKSTGVAYTDGL  546



>gb|EMS66304.1| Pectinesterase 2.2 [Triticum urartu]
Length=236

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQSY+   + P GW  WDG+  L TL+Y EY N G GA TA RVKW GY+
Sbjct  143  PWKAYSRTVYMQSYLGAHVHPRGWLEWDGDFALSTLFYGEYANEGPGAGTAGRVKWPGYR  202

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                  +A QFTVG  +QG  W+K TG++YD G+
Sbjct  203  VITDRSVAVQFTVGQFIQGGYWLKGTGVAYDDGL  236



>ref|XP_006294020.1| hypothetical protein CARUB_v10023013mg [Capsella rubella]
 gb|EOA26918.1| hypothetical protein CARUB_v10023013mg [Capsella rubella]
Length=519

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQS++ G I P GWSPW G  GL +L+Y EY N G G+S + RVKW GY 
Sbjct  424  PWKAYSRTVVMQSFLGGSIDPSGWSPWSGGFGLKSLYYGEYGNTGPGSSVSGRVKWTGYH  483

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              ++   A++FTV   + G+ W+  TG+S+DSG+ K
Sbjct  484  SALTVTEAEKFTVAGFIGGNMWLPSTGVSFDSGLIK  519



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+E SRTI+MQS+ID  IAPEGW PW G  GL+TL+Y+EY N+G GA   +RVKW G K
Sbjct  476  PWRELSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIK  535

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K ++ + A  +T    +QGDEWI +TG+ Y +GM
Sbjct  536  K-LTPEAADGYTAAKFIQGDEWIPQTGVPYTAGM  568



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I G I P GWS W G+  L TL+Y EY NRG GA T+ RVKW GY 
Sbjct  463  PWKEYSRTVVMQSHIGGHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   AK+FTV  L+ G  W+K TG++Y  G+
Sbjct  523  VITDPGEAKKFTVAELIGGGSWLKSTGVAYTEGL  556



>emb|CDY53657.1| BnaC04g52910D [Brassica napus]
Length=524

 Score =   116 bits (290),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGE--IGLDTLWYAEYQNRGAGASTASRVKWNG  274
            PWKEYSRT++MQS++DG I P GWSPW G    GL TL+Y E++N G G+S + RVKW G
Sbjct  427  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGSGSFGLKTLFYGEFENTGPGSSVSGRVKWAG  486

Query  273  YKKNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
            Y  +++   A+ FTV   + G  W+  TG+S+DSG+ K
Sbjct  487  YHPSLTVKEAEGFTVAGFIGGTMWLPSTGVSFDSGLVK  524



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   116 bits (291),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RV W GY+
Sbjct  463  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANNGPGAGTSKRVTWKGYR  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                +  A +FTV  L+QG  W+K TG+++  G+
Sbjct  523  VIKDSKEAAKFTVANLIQGGLWLKPTGVAFQEGL  556



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+E SRTI+MQS+ID  IAPEGW PW G  GL+TL+Y+EY N+G GA   +RVKW G K
Sbjct  476  PWRELSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIK  535

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K ++ + A  +T    +QGDEWI +TG+ Y +GM
Sbjct  536  K-LTPEAADGYTAAKFIQGDEWIPQTGVPYTAGM  568



>emb|CDY15440.1| BnaA08g27240D [Brassica napus]
Length=576

 Score =   117 bits (292),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQSYIDGF+ P GW  W+G+  L TL+YAEY N G G++T SRV W GY 
Sbjct  482  PWKEYSRTVIMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTSRVTWPGYH  541

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV  L   D+WI +TG+ Y SG+
Sbjct  542  VANSTD-AANFTVTGLFLEDDWIWKTGVPYTSGL  574



>gb|KDP23442.1| hypothetical protein JCGZ_23275 [Jatropha curcas]
Length=315

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI+MQS+ID  I P GW+PW G+  L TL+YAEY N G G++T+SRV W GY 
Sbjct  222  PWKEYSRTIVMQSFIDSLIDPTGWAPWSGDFALATLYYAEYDNNGPGSNTSSRVTWPGYH  281

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV    QGD W+  TG+ Y SG+
Sbjct  282  V-INATDAANFTVTNFTQGDFWLNTTGVPYFSGL  314



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M++ +DGFI P GW PWDG   LDTL+YAEY N G+G+ST++RV W GY 
Sbjct  416  PWQKYSRTVFMKTVLDGFINPAGWLPWDGNFALDTLYYAEYANTGSGSSTSNRVTWKGYH  475

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A  FTVG  + G+ WI  TG+ + SG+
Sbjct  476  VLTSASQASPFTVGNFIAGNSWIGNTGVPFTSGL  509



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I   I P GWS W G+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  384  PWKEYSRTVVMQSHIGDHIDPSGWSVWTGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  443

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SAD AK+FTV  L+QG  W+K TG+++  G+
Sbjct  444  VITSADEAKKFTVAGLIQGGSWLKPTGVTFTEGL  477



>emb|CDY55503.1| BnaA05g34400D [Brassica napus]
Length=525

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGE--IGLDTLWYAEYQNRGAGASTASRVKWNG  274
            PWKEYSRT++MQS++DG I P GWSPW G    GL TL+Y E++N G G+S + RVKW G
Sbjct  428  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGSGSFGLKTLFYGEFENTGPGSSVSGRVKWAG  487

Query  273  YKKNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
            Y  +++   A+ FTV   + G  W+  TG+S+DSG+ K
Sbjct  488  YHPSLTVKEAEGFTVAGFIGGTMWLPSTGVSFDSGLVK  525



>ref|XP_009142905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Brassica rapa]
Length=524

 Score =   115 bits (289),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/98 (51%), Positives = 68/98 (69%), Gaps = 2/98 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGE--IGLDTLWYAEYQNRGAGASTASRVKWNG  274
            PWKEYSRT++MQS++DG I P GWSPW G    GL TL+Y E++N G G+S + RVKW G
Sbjct  427  PWKEYSRTVVMQSFLDGSIHPSGWSPWSGSGSFGLKTLFYGEFENTGPGSSVSGRVKWAG  486

Query  273  YKKNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
            Y  +++   A+ FTV   + G  W+  TG+S+DSG+ K
Sbjct  487  YHPSLTVKEAEGFTVAGFIGGTMWLPSTGVSFDSGLVK  524



>ref|XP_009783075.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=567

 Score =   116 bits (290),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+++QSYI   I P GW  W+G+  L TL+Y EY NRG G+ST++RVKW GY+
Sbjct  471  PWKEYSRTVVLQSYIGSLIEPAGWLEWNGDFALKTLYYGEYMNRGPGSSTSARVKWPGYR  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S+  A QFTVG  +QG EW+  TG  +   +T
Sbjct  531  VINSSIEASQFTVGNFIQGGEWLPPTGFPFYLNLT  565



>gb|KHN00313.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=574

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+++RT++M+S I  FI PEGW+PW G + LDTL+YAEY N G G++   RVKW GY 
Sbjct  472  PWKDFARTVVMESNIGDFIQPEGWTPWSGNLFLDTLYYAEYANVGPGSNVQGRVKWKGYH  531

Query  267  KNISADIAKQFTVGMLLQG------DEWIKETGISYDSGMTK  160
             NI+ + A+QFT G  L+G      D+W+K TG+ Y  G TK
Sbjct  532  PNINKNEAEQFTAGQFLRGGPSGNADDWLKATGVPYTIGFTK  573



>ref|XP_003536855.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=574

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 70/102 (69%), Gaps = 6/102 (6%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+++RT++M+S I  FI PEGW+PW G + LDTL+YAEY N G G++   RVKW GY 
Sbjct  472  PWKDFARTVVMESNIGDFIQPEGWTPWSGNLFLDTLYYAEYANVGPGSNVQGRVKWKGYH  531

Query  267  KNISADIAKQFTVGMLLQG------DEWIKETGISYDSGMTK  160
             NI+ + A+QFT G  L+G      D+W+K TG+ Y  G TK
Sbjct  532  PNINKNEAEQFTAGQFLRGGPSGNADDWLKATGVPYTIGFTK  573



>ref|XP_004133929.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN56617.1| hypothetical protein Csa_3G126810 [Cucumis sativus]
Length=509

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT++M+S I GFI+P GW PW G   L+TL+YAEY N G GASTA+RV W GY 
Sbjct  416  PWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGPGASTANRVNWKGYH  475

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  + G  W+  TG+ + SG+
Sbjct  476  VITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  509



>dbj|BAM05623.1| pectin methylesterase 6, partial [Eucalyptus pyrocarpa]
Length=96

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS W G+  L TL+Y EY N+G GA T+ RV W GY 
Sbjct  3    PWKEYSRTVVMQSNIGDHIDPTGWSVWSGDFALKTLYYGEYMNKGPGAGTSKRVNWPGYH  62

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  AK+FTV  L+QG  W+K +G+SY  G+
Sbjct  63   VITSATEAKKFTVAELIQGGTWLKSSGVSYTEGL  96



>ref|XP_010506161.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Camelina sativa]
Length=523

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQSY+ G I P GWSPW G  GL +L+Y E+ N G G+S + RV+W+GY 
Sbjct  428  PWKAYSRTVVMQSYLGGSIDPAGWSPWSGGFGLKSLYYGEFGNSGPGSSVSGRVQWSGYH  487

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              ++   A++FTV   + G+ W+  TG+S+DSG+ K
Sbjct  488  SALTMTEAEKFTVAGFINGNMWLPSTGVSFDSGLIK  523



>ref|XP_009351519.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   115 bits (289),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IM+S +DG I P GW PW G + L TL+Y EY N GAGA T  RV W GY+
Sbjct  444  PWKQYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGTGGRVNWPGYR  503

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                A  A +FTVG  L GD WI+ TG+ + +G+
Sbjct  504  VITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>ref|XP_010276570.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=211

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+Y+ TIIM+S I  FI PEGW PW G   LDTL+YAEY NRG GA+TA RVKW G+K
Sbjct  116  PWKKYATTIIMESAIGDFIRPEGWMPWSGNFALDTLFYAEYNNRGPGANTAQRVKWKGFK  175

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               + + A +FT G  + G+EW+K TG  +  G+
Sbjct  176  VITNRNEALRFTAGPFILGNEWLKNTGAPFVLGL  209



>dbj|BAM05622.1| pectin methylesterase 6, partial [Eucalyptus pilularis]
Length=98

 Score =   108 bits (270),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GWS W G+  L TL+Y EY N+G GA T+ RV W GY 
Sbjct  5    PWKEYSRTVVMQSNIGDHIDPTGWSVWSGDFALKTLYYGEYMNKGPGAGTSKRVNWPGYH  64

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  AK+FTV  L+QG  W+K +G+SY  G+
Sbjct  65   VITSATEAKKFTVAELIQGGTWLKSSGVSYTEGL  98



>emb|CDY65637.1| BnaAnng20820D [Brassica napus]
Length=533

 Score =   115 bits (288),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSY+DGFI P GW  W+G+  L TL+YAEY N G G+ST +RV W GY 
Sbjct  439  PWKEYSRTVFMQSYLDGFIEPVGWREWNGDFALSTLYYAEYNNTGPGSSTTNRVVWPGYH  498

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GDEW+ ++G+ Y +G+
Sbjct  499  VINSTD-ANNFTVSNFLFGDEWMVQSGVPYMAGL  531



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+EYSRT+I++S +DG I P GW PW G   L TL+YAEY N G+GAST  RVKW GY 
Sbjct  450  PWQEYSRTVILKSNLDGLIDPAGWLPWSGNFALSTLYYAEYMNSGSGASTGDRVKWPGYH  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   A +FTVG  L GD WI  TG+ +DSG+
Sbjct  510  VITKVTDAGKFTVGNFLAGDSWIPATGVPFDSGL  543



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSR +IM+S +DG I P+GW PW G  GLDTL+Y EY N GAGA+T  RVKW G++
Sbjct  455  PWQKYSRVVIMKSNLDGLIEPQGWFPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWPGFR  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  L GD W+  TG+ +++G+
Sbjct  515  VITSATEAGKFTVGNFLAGDAWLPGTGVPFEAGL  548



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   116 bits (290),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ MQSY+   I P GW  W+G   L+TL+Y E+ NRG GA  A+RV+W GY+
Sbjct  507  PWRQYSRTVFMQSYLGDLIQPAGWLEWNGNFALNTLYYGEFMNRGPGAGVANRVRWPGYR  566

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S++ AKQFTV   ++GD W+  TG+ Y SG T
Sbjct  567  AIRSSNEAKQFTVSQFIKGDSWLPSTGVKYVSGFT  601



>ref|XP_007222370.1| hypothetical protein PRUPE_ppa003433mg [Prunus persica]
 gb|EMJ23569.1| hypothetical protein PRUPE_ppa003433mg [Prunus persica]
Length=575

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT++MQSY+D  I   GWSPW G  GL TL+Y EY N G GAST+ RV+W GY 
Sbjct  480  PWKQYSRTVVMQSYLDESINRAGWSPWAGGFGLTTLYYGEYLNFGPGASTSGRVQWPGYH  539

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +I+  +A+ FTVG  + G+ W+  TG+S+DSG+
Sbjct  540  ASITTTVAQGFTVGGFISGNLWLPSTGVSFDSGL  573



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   115 bits (288),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 49/95 (52%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDG-EIGLDTLWYAEYQNRGAGASTASRVKWNGY  271
            PWKEYSRT+ M SY+D  + P GW  W+G +  L TL+Y EYQN+G GA TA RV W GY
Sbjct  452  PWKEYSRTVYMLSYLDSHVDPRGWLEWNGADFALKTLFYGEYQNQGPGAGTAGRVNWPGY  511

Query  270  KKNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   +A QFTVG  +QG  W+K TG++Y+ G+
Sbjct  512  HVITDQSVAMQFTVGQFIQGGNWLKATGVNYNEGL  546



>ref|XP_006448208.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
 gb|ESR61448.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
Length=525

 Score =   115 bits (287),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ M+  IDG I P GW PW G   L TL+YAEY N G GAST+ RVKW+GY 
Sbjct  432  PWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYAEYMNIGTGASTSGRVKWSGYH  491

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A +FTVG  L G+ WI  TG+ +DSG+
Sbjct  492  VIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>ref|XP_007201179.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
 gb|EMJ02378.1| hypothetical protein PRUPE_ppa003400mg [Prunus persica]
Length=578

 Score =   115 bits (289),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M+SYID  + P GW  W+G   L TL+Y EY NRG G++T++RV W GY+
Sbjct  483  PWKEYSRTVYMKSYIDDLVEPAGWLEWNGTFALSTLYYGEYLNRGPGSNTSARVTWPGYR  542

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S+  A QFTVG  +QG+EW+  T I Y  G+T
Sbjct  543  VINSSAEANQFTVGPFIQGNEWLNATNIPYFIGLT  577



>ref|XP_003519736.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=573

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE++RT++M+S I  FI PEGW+PWDG + LDTL+YAEY N G G++   RVKW GY 
Sbjct  472  PWKEFARTVVMESNIGDFIQPEGWTPWDGNLYLDTLYYAEYANVGPGSNVQGRVKWRGYH  531

Query  267  KNISADIAKQFTVGMLLQG------DEWIKETGISYDSGMTK  160
             NI+ + A QFT    L+G      D W+K TG+ Y  G TK
Sbjct  532  PNINKNEAAQFTAAQFLRGGPAGDADGWLKATGVPYTIGFTK  573



>gb|KHN00235.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=573

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 68/102 (67%), Gaps = 6/102 (6%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE++RT++M+S I  FI PEGW+PWDG + LDTL+YAEY N G G++   RVKW GY 
Sbjct  472  PWKEFARTVVMESNIGDFIQPEGWTPWDGNLYLDTLYYAEYANVGPGSNVQGRVKWRGYH  531

Query  267  KNISADIAKQFTVGMLLQG------DEWIKETGISYDSGMTK  160
             NI+ + A QFT    L+G      D W+K TG+ Y  G TK
Sbjct  532  PNINKNEAAQFTAAQFLRGGPAGDADGWLKATGVPYTIGFTK  573



>ref|XP_010687599.1| PREDICTED: pectinesterase/pectinesterase inhibitor PPE8B-like 
[Beta vulgaris subsp. vulgaris]
Length=544

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 0/97 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRTIIM+SYI G + PEGW  W G + LDTL+YAEY N G GAS ASRVKW GY 
Sbjct  448  PWKAYSRTIIMESYISGVVRPEGWLEWSGNVSLDTLYYAEYMNYGPGASLASRVKWPGYH  507

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
               S+  A  +TV   L GD W+  TGI + SG++ V
Sbjct  508  IFNSSAQALNYTVAQFLDGDLWLPTTGIRFASGLSTV  544



>ref|NP_181833.1| putative pectinesterase/ pectinerase inhibitor 16 [Arabidopsis 
thaliana]
 sp|Q9SKX2.1|PME16_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
16; Includes: RecName: Full=Pectinesterase inhibitor 16; AltName: 
Full=Pectin methylesterase inhibitor 16; Includes: RecName: 
Full=Pectinesterase 16; Short=PE 16; AltName: Full=AtPMEpcrD; 
AltName: Full=Pectin methylesterase 16; Short=AtPME16; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD22126.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAY56424.1| At2g43050 [Arabidopsis thaliana]
 gb|AEC10203.1| putative pectinesterase/ pectinerase inhibitor 16 [Arabidopsis 
thaliana]
Length=518

 Score =   115 bits (287),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I G I P GWSPW G  GL +L+Y EY N G G+S + RVKW+G  
Sbjct  423  PWKEYSRTVVMQSFIGGSIHPSGWSPWSGGFGLKSLFYGEYGNSGPGSSVSGRVKWSGCH  482

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +++   A++FTV   + G+ W+  TG+S+D G+
Sbjct  483  PSLTVTEAEKFTVASFIDGNIWLPSTGVSFDPGL  516



>ref|NP_172624.1| methylesterase PCR A [Arabidopsis thaliana]
 sp|Q1JPL7.3|PME18_ARATH RecName: Full=Pectinesterase/pectinesterase inhibitor 18; AltName: 
Full=AtPMEpcrA; Contains: RecName: Full=Pectinesterase 
inhibitor 18; AltName: Full=Pectin methylesterase inhibitor 
18; Contains: RecName: Full=Bifunctional pectinesterase 18/rRNA 
N-glycosylase; Short=PE 18; AltName: Full=Pectin methylesterase 
18; AltName: Full=Pectin methylesterase 4; Short=AtPME4; 
AltName: Full=Ribosome-inactivating protein; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABF57292.1| At1g11580 [Arabidopsis thaliana]
 gb|AEE28755.1| methylesterase PCR A [Arabidopsis thaliana]
Length=557

 Score =   115 bits (288),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RV W G+K
Sbjct  464  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFK  523

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG+++
Sbjct  524  VIKDSKEAEQFTVAKLIQGGLWLKPTGVTF  553



>ref|XP_010917364.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=520

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSY+ G + PEGW  WDG   LDTL+YAEY N G G+  A RVKW GY 
Sbjct  425  PWKEYSRTVFMQSYLGGLLRPEGWLEWDGNFALDTLYYAEYMNSGPGSGLAGRVKWTGYH  484

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               ++  A  FTVG  + G+ W+  TG+ Y SG+T
Sbjct  485  VMTNSAEAVNFTVGQFIDGNLWLPSTGVKYTSGLT  519



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   115 bits (288),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I   I P GWS W G+  L TL+Y EY NRG GA T+ RVKW GY 
Sbjct  463  PWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 + AK+FTV  L+ G  W+K TG++Y  G+
Sbjct  523  VITDPEEAKKFTVAELIGGGSWLKSTGVAYTEGL  556



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   115 bits (287),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+I   I P GWS W G+  L TL+Y EY NRG GA T+ RVKW GY 
Sbjct  463  PWKEYSRTVVMQSHIGDHIDPAGWSEWSGDFALKTLYYGEYLNRGPGAGTSKRVKWPGYH  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 + AK+FTV  L+ G  W+K TG++Y  G+
Sbjct  523  VITDPEEAKKFTVAELIGGGSWLKSTGVAYTEGL  556



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   115 bits (288),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 66/95 (69%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+I+ S I   I P GW  W G+  L+TL+Y EY NRG G++T++RVKW GY+
Sbjct  468  PWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWPGYR  527

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S+  A QFTVG  +QG EWI  TG+ + SG+T
Sbjct  528  VINSSSEASQFTVGNFIQGSEWIPATGVPFYSGLT  562



>gb|AAK59760.1| At1g11580/T23J18_33 [Arabidopsis thaliana]
Length=557

 Score =   115 bits (287),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RV W G+K
Sbjct  464  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFK  523

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG+++
Sbjct  524  VIKDSKEAEQFTVAKLIQGGLWLKPTGVTF  553



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   115 bits (288),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ +QSY+D  I P GW  W+    L TL+Y EY N G GA TA+RV W GY+
Sbjct  501  PWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGAGTANRVNWPGYR  560

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A QFTV   ++GD W+  TG+ Y SG+
Sbjct  561  VITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   115 bits (287),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++M+SYI   I P GW  WD +  L TL+Y EY+N G G+ T+ RVKW GY 
Sbjct  450  PWKEYSRTVVMESYISDVIDPAGWLEWDRDFALKTLFYGEYRNGGPGSGTSERVKWPGYH  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S ++A+QFTV  L+QG  W+  TG+ Y +G+
Sbjct  510  VITSPEVAEQFTVAELIQGGSWLGSTGVDYTAGL  543



>gb|AIZ46897.1| pectin methylesterase, partial [Dendrobium hybrid cultivar]
Length=217

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS ID  + P+GW  WDG   L TL++ EYQN G GA TA RV W GY 
Sbjct  124  PWKEYSRTVVMQSSIDNHVNPKGWLEWDGNFALQTLFHGEYQNYGPGAGTAGRVNWAGYH  183

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                A++A  FTV  L+QG +W++ TG+ +  G+
Sbjct  184  VITDANVANDFTVAKLIQGGQWLQGTGVDFTEGL  217



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   115 bits (287),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 69/101 (68%), Gaps = 4/101 (4%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            P K YSRTI+MQS IDGFI PEGW+P+ G  GL+TL++ EYQNRG GA+T  RV W  Y 
Sbjct  459  PAKMYSRTIVMQSQIDGFIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYM  518

Query  267  KNISADIAKQFTVGMLLQG----DEWIKETGISYDSGMTKV  157
            KN   D+  +F  G++L+G    D W+ +TG+ Y+  M K+
Sbjct  519  KNPPQDVIAKFAPGVVLKGGDNTDGWVTKTGVPYEPAMMKM  559



>emb|CDY65861.1| BnaCnng48920D [Brassica napus]
Length=559

 Score =   115 bits (287),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQSYIDGF+ P GW  W+G+  L TL+YAEY N G G++T +RV W GY 
Sbjct  465  PWKEYSRTVIMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTTRVTWPGYH  524

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV  L   D+WI +TG+ Y SG+
Sbjct  525  VANSTD-AANFTVTGLFLEDDWIWKTGVPYTSGL  557



>ref|XP_010508475.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Camelina sativa]
Length=523

 Score =   114 bits (286),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQSY+ G I P GWSPW G  GL +L+Y E+ N G G+S + RVKW+ Y 
Sbjct  428  PWKAYSRTVVMQSYLGGSIDPSGWSPWSGGFGLKSLYYGEFGNSGPGSSVSGRVKWSRYH  487

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              ++   A++FTV   + G+ W+  TG+S+DSG+ K
Sbjct  488  SALTMTEAEKFTVAGFINGNMWLPSTGVSFDSGLIK  523



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   115 bits (287),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTV  L+QG  W+K TG++Y  G+
Sbjct  516  V-LSASEATKFTVSQLIQGGAWLKSTGVAYTEGL  548



>ref|XP_004494388.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
isoform X2 [Cicer arietinum]
Length=562

 Score =   115 bits (287),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ +Q ++D FI+P GW  W G+  L TL+YAEY N G G+ T+ RV W GY 
Sbjct  468  PWKEYSRTVYLQCFMDSFISPSGWREWSGDFALSTLYYAEYNNTGVGSDTSMRVNWVGYH  527

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y SG+
Sbjct  528  VIINATDAANFTVSNFLDGDSWLPQTGVPYFSGL  561



>ref|XP_004494387.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
isoform X1 [Cicer arietinum]
Length=564

 Score =   115 bits (287),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ +Q ++D FI+P GW  W G+  L TL+YAEY N G G+ T+ RV W GY 
Sbjct  470  PWKEYSRTVYLQCFMDSFISPSGWREWSGDFALSTLYYAEYNNTGVGSDTSMRVNWVGYH  529

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y SG+
Sbjct  530  VIINATDAANFTVSNFLDGDSWLPQTGVPYFSGL  563



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSYI   I P GW  WDG+  L+TL+Y EY NRG GA T+ RVKW GY 
Sbjct  461  PWKEYSRTVVMQSYIGDLIDPAGWFEWDGDFALNTLYYGEYANRGPGAGTSKRVKWVGYH  520

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A++FTV  L+QG  W++ TG+ Y  G+
Sbjct  521  VITSPDEAQKFTVVELIQGGPWLESTGVDYTEGL  554



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   115 bits (287),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRTIIMQS ID FI PEGW PW G++GL T +YAE  N G GA+   RV W GYK
Sbjct  488  PWKPYSRTIIMQSQIDEFIHPEGWLPWLGDVGLHTCFYAEVDNHGLGANVTKRVTWRGYK  547

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K I +  A+QFTV   +QG+ W++ TG+ Y  G+
Sbjct  548  K-IDSSHAQQFTVQRFIQGNSWLRPTGVPYIPGL  580



>ref|XP_006360083.1| PREDICTED: pectinesterase 2.1-like [Solanum tuberosum]
Length=550

 Score =   114 bits (286),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSY+ G I P GW+ WDG+  L TL+Y E+ N G GA T+ RVKW GY 
Sbjct  455  PWKEYSRTVVMQSYLGGLIDPAGWAEWDGDFALKTLYYGEFMNNGPGAGTSKRVKWPGYH  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   A  FTV  L+QG  W+  TG++Y  G+
Sbjct  515  VITDPAEAMPFTVAELIQGGSWLSSTGVAYVDGL  548



>gb|AAF16637.1|AC011661_15 T23J18.24 [Arabidopsis thaliana]
Length=223

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDGE  L TL+Y EY N G GA T+ RV W G+K
Sbjct  130  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFALSTLYYGEYANTGPGADTSKRVNWKGFK  189

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG+++
Sbjct  190  VIKDSKEAEQFTVAKLIQGGLWLKPTGVTF  219



>ref|XP_007222797.1| hypothetical protein PRUPE_ppa003578mg [Prunus persica]
 gb|EMJ23996.1| hypothetical protein PRUPE_ppa003578mg [Prunus persica]
Length=564

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQ+++D FI P GW  W G+  L TL+YAEY N G G+STA+RV W+GY 
Sbjct  471  PWKEYSRTVYMQTFMDSFIDPAGWHDWSGDFALSTLYYAEYNNTGPGSSTANRVTWSGYH  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GD W+ +TG+ Y  G+
Sbjct  531  VINSTD-AANFTVSNFLLGDNWLPQTGVPYTGGL  563



>gb|AFW03475.1| pectin methylesterase 1 [Gossypium barbadense]
Length=582

 Score =   115 bits (287),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GW  W G   L TL+YAEYQN GAGAST++RVKW GYK
Sbjct  489  PWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYK  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A+ FT G  + G  W+  TG  +  G+
Sbjct  549  VITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_008235120.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Prunus mume]
Length=560

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYID  + P GW  WDGE  L TL+YAEY N G G++T SRV W GY 
Sbjct  467  PWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFALSTLYYAEYNNTGPGSNTTSRVTWTGYH  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+W+ +TG+ Y  G+
Sbjct  527  V-INATDAANFTVTNFLLGDDWLPQTGVPYTGGL  559



>ref|XP_006604725.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Glycine max]
 gb|KHN43497.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=562

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D FI P GW  W G+  L TL+YAEY N G G++T +RV W GY 
Sbjct  469  PWKEYSRTVYMQSFMDSFINPSGWREWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPGYH  528

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y SG+
Sbjct  529  V-INATDAANFTVSNFLDGDNWLPQTGVPYISGL  561



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   114 bits (285),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M+S +DG I  EGW PW G   L TL+YAE+ N GAGA T+ RVKW GY 
Sbjct  428  PWQKYSRTVFMKSVLDGVITAEGWLPWSGSFALSTLYYAEHMNTGAGADTSGRVKWGGYH  487

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ISA  A +FTVG  L GD WI  TG+ +D+G+
Sbjct  488  V-ISAAEAGKFTVGNFLAGDAWIPGTGVPFDAGL  520



>ref|XP_010271093.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=563

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IM+S I   I PEGW PW G+  LDTL+YAEY NRG GA+T  RV W G+K
Sbjct  467  PWKEYSRTVIMESTIGDLIQPEGWMPWSGDFALDTLFYAEYGNRGPGAATGKRVNWKGFK  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
               +   A QFT G  L+GD+W+  T   +D G+T+
Sbjct  527  VITNKREALQFTAGPFLEGDKWLPGTTTPFDLGLTQ  562



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   114 bits (286),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+ SRTIIMQS I GF+ PEGWS WDG   L+TL+YAEYQNRG G+ T +RV+W G  
Sbjct  451  PWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++ S  +A+ +T  ++ QGDEWI+ +G+ Y   M KV
Sbjct  510  QHFSPQMAESWTENVMYQGDEWIRNSGVPYVPTMMKV  546



>ref|XP_002455538.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
 gb|EES00658.1| hypothetical protein SORBIDRAFT_03g012830 [Sorghum bicolor]
Length=576

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ +QS +D  IAP GW  WDG   LDTL+Y EY N G GA T+ RVKW GY+
Sbjct  483  PWKQYSRTVFLQSELDSLIAPAGWLEWDGNFALDTLYYGEYMNTGPGAGTSGRVKWKGYR  542

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A  FTVG  + GD W+  T I + +G+
Sbjct  543  VITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  576



>gb|AFB77929.1| pectin methylesterase [Gossypium hirsutum]
Length=582

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GW  W G   L TL+YAEYQN GAGAST++RVKW GYK
Sbjct  489  PWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYK  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A+ FT G  + G  W+  TG  +  G+
Sbjct  549  VITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   114 bits (285),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA  + RVKW GY 
Sbjct  455  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGISKRVKWPGYH  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTVG L+QG  W+K TG++Y  G+
Sbjct  515  I-LSASEATKFTVGQLIQGGVWLKSTGVAYTEGL  547



>ref|XP_009409132.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=568

 Score =   114 bits (286),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 50/95 (53%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEY+RT+IM+S I   I PEGW  W G   LDTL+Y EY+N GAGA T SRV+W GYK
Sbjct  473  PWKEYARTVIMESEISDVIEPEGWHEWSGTFALDTLYYGEYRNTGAGAGTGSRVQWKGYK  532

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               SA  A +FT G  + G  W++ TG  Y  G++
Sbjct  533  VITSAAEAAEFTPGSFIAGSSWLEATGFPYSLGLS  567



>gb|AFW03480.1| pectin methylesterase 1 [Gossypium hirsutum]
Length=582

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GW  W G   L TL+YAEYQN GAGAST++RVKW GYK
Sbjct  489  PWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYK  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A+ FT G  + G  W+  TG  +  G+
Sbjct  549  VITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>gb|KHG08631.1| Pectinesterase 3 [Gossypium arboreum]
Length=582

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I   I P GW  W G   L TL+YAEYQN GAGAST++RVKW GYK
Sbjct  489  PWKEYSRTVVMQSTISDVIQPAGWHEWSGSFALKTLFYAEYQNTGAGASTSARVKWGGYK  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A+ FT G  + G  W+  TG  +  G+
Sbjct  549  VITSASEAQAFTPGRFIAGGSWLSSTGFPFALGL  582



>ref|XP_009111298.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41 
[Brassica rapa]
Length=572

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSY+DGF+ P GW  W+G+  L TL+YAEY N G G+ST +RV W GY 
Sbjct  478  PWKEYSRTVFMQSYLDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSSTTNRVVWPGYH  537

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GDEW+ ++G+ Y +G+
Sbjct  538  VINSTD-ANNFTVSNFLFGDEWMVQSGVPYMAGL  570



>ref|NP_001274785.1| pectin methyl esterase [Solanum tuberosum]
 emb|CBY44654.1| pectin methyl esterase [Solanum tuberosum]
Length=545

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQSY+ G I P GW+ W GE  L TL+Y EY N G GA T+ RVKW GY 
Sbjct  450  PWKEYSRTVVMQSYLGGLIDPAGWAEWSGEFALKTLYYGEYMNNGPGAGTSKRVKWPGYH  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                   A  FTV  L+QG  W+  TG++Y  G+
Sbjct  510  VITDPAEAMPFTVAELIQGGSWLSSTGVAYVDGL  543



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ +QS +D  + P+GW  WDG   LDTL+Y EYQN GAGAST++RVKW GY+
Sbjct  133  PWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWKGYR  192

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+  A  FTVG  + GD W+  T I + +G+
Sbjct  193  VISSSSEASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+ID  I P GW PWDG+  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  358  PWKLYSRTVIMQSFIDNHIDPAGWFPWDGDFALSTLYYGEYANNGPGADTSKRVKWKGFK  417

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                +  A +FTV  L+QG  W+K TG+++  G+
Sbjct  418  VIRDSKEADKFTVAKLIQGGLWLKPTGVTFQEGL  451



>gb|KDP23441.1| hypothetical protein JCGZ_23274 [Jatropha curcas]
Length=585

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTI M+SYI   I P GW+PW G+  L TL+YAE+ N G G+ TA+RV W+GY 
Sbjct  488  PWKEYSRTIFMESYIASLIDPTGWAPWSGDFALSTLYYAEFNNSGVGSKTANRVTWSGYH  547

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV    QGD W+  TGIS+  G+
Sbjct  548  L-INATEAANFTVSNFTQGDVWLPATGISFTGGL  580



>ref|XP_008800482.1| PREDICTED: pectinesterase-like isoform X1 [Phoenix dactylifera]
Length=585

 Score =   114 bits (286),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSR +IM+S I   I P GW  W+G  GLDTL+Y EY+N GAGA TA RVKW GY+
Sbjct  490  PWKEYSRAVIMESEISDVIDPAGWHEWNGPFGLDTLYYGEYKNTGAGAGTADRVKWKGYR  549

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
                   AKQF  G LL G  W+  TG  Y  G++
Sbjct  550  VLTDVQEAKQFAPGNLLGGSNWLDSTGFPYSLGLS  584



>ref|XP_006480113.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Citrus sinensis]
Length=566

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GW  W G+  L TL+YAEY NRG G++TA+RV W GY 
Sbjct  472  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+W+  TG+ Y  G+
Sbjct  532  A-INATDAANFTVSNFLLGDQWLPRTGVPYTGGL  564



>gb|KDO87167.1| hypothetical protein CISIN_1g045495mg [Citrus sinensis]
Length=549

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GW  W G+  L TL+YAEY NRG G++TA+RV W GY 
Sbjct  455  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  514

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+W+  TG+ Y  G+
Sbjct  515  A-INATDAANFTVSNFLLGDQWLPRTGVPYTGGL  547



>ref|XP_006444391.1| hypothetical protein CICLE_v10024391mg [Citrus clementina]
 gb|ESR57631.1| hypothetical protein CICLE_v10024391mg [Citrus clementina]
Length=566

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS++DG I P GW  W G+  L TL+YAEY NRG G++TA+RV W GY 
Sbjct  472  PWKEYSRTVVMQSFLDGLINPAGWQIWTGDFALSTLYYAEYDNRGPGSNTANRVTWPGYH  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+W+  TG+ Y  G+
Sbjct  532  A-INATDAANFTVSNFLLGDQWLPRTGVPYTGGL  564



>ref|XP_008390793.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 16 
[Malus domestica]
Length=244

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW +YSRT+IMQSY+D  I+  GWSPW G   L+TL+Y EY N G GAST+ RV+W GY 
Sbjct  149  PWMQYSRTVIMQSYLDDSISKAGWSPWSGGFALNTLYYGEYSNYGPGASTSGRVQWPGYH  208

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A+ FTV   + G+ W+  TG+S+D G+ K
Sbjct  209  ASLTPVAAQAFTVSGFISGNLWLPSTGVSFDPGLIK  244



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT++M+S I GFI+P GW PW G   L+TL+Y EY N G GASTA+RV W GY+
Sbjct  418  PWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYGEYMNTGPGASTANRVNWKGYR  477

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  + G  W+  TG+ + SG+
Sbjct  478  VITSAAEASKFTVGNFIAGGSWLPSTGVPFTSGL  511



>gb|KDO64577.1| hypothetical protein CISIN_1g047288mg [Citrus sinensis]
Length=508

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ M+  IDG I P GW PW G   L TL+Y EY N G GAST+ RVKW+GY 
Sbjct  415  PWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGASTSGRVKWSGYH  474

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A +FTVG  L G+ WI  TG+ +DSG+
Sbjct  475  VIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  508



>ref|XP_010247575.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 13 
[Nelumbo nucifera]
Length=922

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEY+ T+IM+S I   I PEGW PW G+  LDTL+YAEY NRG GA+T  RVKW G+K
Sbjct  476  PWKEYAVTVIMESTIGDVIRPEGWMPWAGDFALDTLFYAEYNNRGPGANTDHRVKWKGFK  535

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
                 D A ++TVG  +QGDEW+K+TG  +  G++
Sbjct  536  VITKKDEALRYTVGPFIQGDEWLKDTGSPFTLGLS  570



>ref|XP_010556727.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Tarenaya hassleriana]
Length=566

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYIDGF+ P GW  W+G+  L TL+YAEY N G G++T +RV W GY 
Sbjct  472  PWKEYSRTVYMQSYIDGFVEPVGWREWNGDFALSTLYYAEYNNTGPGSNTTNRVNWPGYH  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GD+WI ++G+ Y  G+
Sbjct  532  VINSTD-AANFTVSSFLLGDDWILQSGVPYFGGL  564



>ref|XP_009339900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Pyrus x bretschneideri]
Length=590

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK++SRT+IMQSY+D  I+  GWSPW G   L+TL+Y EY N G GAST  RV+W GY 
Sbjct  495  PWKQHSRTVIMQSYLDDSISGAGWSPWSGGFALNTLYYGEYSNYGPGASTLGRVRWPGYH  554

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
             +++   A+ FTVG  + G+ W+  TG+S+DSG+ K
Sbjct  555  ASLTPVAAQAFTVGGFISGNLWLPSTGVSFDSGLIK  590



>gb|EMT05022.1| Pectinesterase 3 [Aegilops tauschii]
Length=472

 Score =   113 bits (282),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ +QS +D  + P GW  WDG   LDTL+YAEYQN G GA T+ RV W GY+
Sbjct  379  PWKQYSRTVFIQSELDSVVDPAGWLAWDGTFALDTLYYAEYQNTGPGAGTSGRVSWMGYR  438

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ISA  A  FTVG  + GD W+  T I +  G+
Sbjct  439  GVISASEASTFTVGSFIDGDVWLAGTSIPFSGGL  472



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   113 bits (283),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+IM+S +DG I P+GW PW G   L TL+YAE+ N GAGA+T  RV W GY 
Sbjct  421  PWQKYSRTVIMKSSLDGLIDPKGWLPWSGNFALSTLYYAEFMNSGAGAATGGRVSWPGYH  480

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  L GD WI  TG+ + +G+
Sbjct  481  VLTSAAEAGKFTVGNFLGGDSWIPATGVPFAAGL  514



>ref|XP_006417343.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
 gb|ESQ35696.1| hypothetical protein EUTSA_v10007263mg [Eutrema salsugineum]
Length=557

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS+I   I P GW PWDGE  L TL+Y EY N G G+ T+ RVKW G++
Sbjct  464  PWKLYSRTVIMQSFIGDHIDPAGWFPWDGEFALSTLYYGEYANNGPGSDTSKRVKWKGFR  523

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
               ++  A+QFTV  L+QG  W+K TG++Y
Sbjct  524  VIRNSKEAEQFTVAKLIQGGLWLKPTGVTY  553



>ref|XP_010230835.1| PREDICTED: pectinesterase-like [Brachypodium distachyon]
Length=561

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M+S +D  + P GW  W+G   LDTL+Y EYQN GAGA+T++RVKW GY+
Sbjct  468  PWQQYSRTVFMESQMDSVVNPAGWLEWNGNFALDTLYYGEYQNTGAGAATSNRVKWKGYR  527

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A  FTVG  + GD W+  T + + +G+
Sbjct  528  VITSASEASAFTVGSFIDGDVWLPRTSVPFSTGL  561



>ref|XP_007157171.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
 gb|ESW29165.1| hypothetical protein PHAVU_002G048600g [Phaseolus vulgaris]
Length=553

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 68/96 (71%), Gaps = 2/96 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIG--LDTLWYAEYQNRGAGASTASRVKWNG  274
            PWK+YSRT++MQS I+  I P GW+ WD +    L TL+YAEY N GAGA ++ RV W G
Sbjct  458  PWKKYSRTVVMQSTIENHIYPTGWAEWDEKSKDFLQTLYYAEYNNSGAGAGSSKRVNWPG  517

Query  273  YKKNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            Y K+I+A  A +FTV  L+QG+ W+K TG++Y  G+
Sbjct  518  YHKSITATEASKFTVTQLIQGNVWLKNTGVNYTEGL  553



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTV  L+QG  W+K TG++Y  G+
Sbjct  516  V-LSASEATKFTVSQLIQGGVWLKSTGVAYTEGL  548



>ref|XP_006479999.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Citrus sinensis]
 gb|KDO87163.1| hypothetical protein CISIN_1g008485mg [Citrus sinensis]
Length=564

 Score =   114 bits (285),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D  I P GW  W G+  L TL+YAEY N G G++TA+RV W GY 
Sbjct  470  PWKEYSRTVYMQSFMDSSINPAGWQIWSGDFALSTLYYAEYNNTGPGSNTANRVTWPGYH  529

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+WI +TG+SY   +
Sbjct  530  VTINATDAANFTVSNFLLGDDWIPQTGVSYTGAL  563



>ref|XP_007199770.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
 gb|EMJ00969.1| hypothetical protein PRUPE_ppa003639mg [Prunus persica]
Length=560

 Score =   114 bits (284),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYID  + P GW  WDGE  L TL+YAEY N G G++T SRV W GY 
Sbjct  467  PWKEYSRTVYMQSYIDSVVDPAGWRAWDGEFALSTLYYAEYNNTGPGSNTTSRVTWPGYH  526

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+W+ +TG+ Y  G+
Sbjct  527  V-INATDAANFTVTNFLLGDDWLPQTGVPYTGGL  559



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M++Y+D  I P GW  W+G   L TL+Y EY N G G+ST +RVKW GY+
Sbjct  422  PWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWGGYR  481

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG L+ G+ W+  TG+ + SG+
Sbjct  482  VITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  515



>emb|CDY68840.1| BnaCnng60750D, partial [Brassica napus]
Length=435

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSY+DGFI P GW  W+G+  L TL+YAEY N G G+ST +RV W GY 
Sbjct  341  PWKEYSRTVFMQSYMDGFIEPVGWREWNGDFALSTLYYAEYNNTGPGSSTTNRVVWPGYH  400

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GDEW+ ++G+ Y +G+
Sbjct  401  VINSTD-ANNFTVSNFLFGDEWMVQSGVPYMAGL  433



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M++++DG I P GW PW G   L+TL+Y EY N G G+STA RV W GY 
Sbjct  166  PWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWKGYH  225

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG  + G  W+  T + + SG+
Sbjct  226  VITSATEASKFTVGNFIAGSSWLPATNVPFTSGL  259



>emb|CAA96436.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=274

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  182  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  241

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTVG L+QG  W+K TG++Y  G+
Sbjct  242  I-LSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  274



>ref|XP_006469215.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Citrus sinensis]
Length=525

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ M+  IDG I P GW PW G   L TL+Y EY N G GAST+ RVKW+GY 
Sbjct  432  PWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGASTSGRVKWSGYH  491

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A +FTVG  L G+ WI  TG+ +DSG+
Sbjct  492  VIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>ref|XP_010656074.1| PREDICTED: pectinesterase-like [Vitis vinifera]
Length=578

 Score =   114 bits (284),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQ+ I   I P GW PW+G   LDTL+YAEYQN GAGA T+ RV W G+K
Sbjct  485  PWKEYSRTVVMQTSISDVINPAGWYPWNGNFALDTLFYAEYQNTGAGADTSKRVNWKGFK  544

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A+ FT G  + G  W+  TG  +  G+
Sbjct  545  VITSASEAQAFTAGSFIGGSSWLPSTGFPFSLGL  578



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQ  ID  I P+GW PW G   LDTL Y+EY+NRG G+ T  RV W G K
Sbjct  474  PWKEYSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIK  533

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K +SA  A  FTV   + GD WI +TGISY SGM  V
Sbjct  534  K-LSAQDADAFTVAKFIGGDLWIPDTGISYASGMMNV  569



>ref|NP_001170280.1| uncharacterized protein LOC100384243 [Zea mays]
 gb|ACN36463.1| unknown [Zea mays]
Length=145

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+E+SRT+IM+S I  FI   G+ PW+G+ GL TLWYAEY NRG GA TA RV W GYK
Sbjct  50   PWREFSRTLIMESDIPAFIDKAGYLPWNGDFGLKTLWYAEYANRGPGADTAGRVTWPGYK  109

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K IS + A++FTV   L  + W+K TG     G 
Sbjct  110  KVISKEEAEKFTVQNFLHAEPWLKPTGTPVKYGF  143



>gb|KFK43434.1| hypothetical protein AALP_AA1G125000 [Arabis alpina]
Length=556

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/90 (57%), Positives = 61/90 (68%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS I   I P GW PWDGE  L TL+Y EY N G GA T+ RVKW G+K
Sbjct  463  PWKLYSRTVIMQSSIGDHIDPAGWFPWDGEFALSTLYYGEYANNGPGADTSKRVKWKGFK  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                +  A+QFTV  L+QG  W+K TG++Y
Sbjct  523  VIRDSKEAEQFTVAKLIQGGLWLKPTGVTY  552



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M SY+D  + P GW  W+G+  L TL+Y EYQN+G GA TA+RV W G +
Sbjct  428  PWKEYSRTVYMLSYLDAHVDPAGWLAWNGDFALKTLFYGEYQNQGPGAGTAARVGWPGDR  487

Query  267  KNISAD--IAKQFTVGMLLQGDEWIKETGISYDSGM  166
               + D  +A QFTVG  +QG +W+  TG++Y+ G+
Sbjct  488  GITTGDRSVAMQFTVGQFIQGGDWLNATGVTYNDGL  523



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSR +++QSYI   I P GWS WDGE  L TL+Y EY NRG GA T+ RVKW GY+
Sbjct  435  PWKEYSRAVVLQSYIGDHIDPAGWSVWDGEFALKTLYYGEYVNRGPGAGTSKRVKWPGYR  494

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A+ FTV  L+QG  W++ TG++Y  G+
Sbjct  495  VITSPAEARNFTVAELIQGGTWLESTGVAYTEGL  528



>ref|XP_008391336.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Malus domestica]
Length=440

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+IMQSY+D  I+  GWSPW G   L+TL+Y EY N G GAST+ RV+W GY 
Sbjct  346  PWKQYSRTVIMQSYLDDSISXAGWSPWSGGFALNTLYYGEYSNYGPGASTSGRVRWPGYH  405

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +++   A+ FTV   + G+ W+  TG+S+DSG+
Sbjct  406  ASLTPVAAQGFTVSGFISGNLWLPSTGVSFDSGL  439



>gb|KDO87166.1| hypothetical protein CISIN_1g0440421mg, partial [Citrus sinensis]
Length=230

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQS++D  I P GW  W G+  L TL+YAEY NRG G+++A+RV W GY 
Sbjct  136  PWKEYSRTVIMQSFMDSLINPSGWQIWTGDFALSTLYYAEYDNRGPGSNSANRVTWPGYH  195

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y  G+
Sbjct  196  V-INATDAANFTVSNFLLGDVWLPQTGVPYTGGL  228



>gb|EAY73715.1| hypothetical protein OsI_01593 [Oryza sativa Indica Group]
Length=519

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS + G I P GW PWDG+  L TL+YAEY N GAGA T+ RV W GY 
Sbjct  425  PWKLYSRTVIMQSVVGGLIDPAGWMPWDGDYALSTLYYAEYNNSGAGADTSRRVTWPGYH  484

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A  FTVG ++ GD W+ +TG+ + SG+
Sbjct  485  VLNSTADAGNFTVGNMVLGDFWLPQTGVPFTSGL  518



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRTIIM+++ID  I PEGWSPW G  GL T WY EY N G G+   +RVKWNG K
Sbjct  487  PWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGPGSDMKNRVKWNGIK  546

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
              +S   A  FT G  L+GD WIK TG+ Y   +T+
Sbjct  547  P-VSRQHAIDFTPGRFLRGDSWIKPTGVPYAPYLTR  581



>ref|XP_008219290.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Prunus mume]
Length=564

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQ+++D FI P GW  W G+  L TL+YAEY N G G+STA+RV W GY 
Sbjct  471  PWKEYSRTVYMQTFMDSFIDPAGWHDWSGDFALSTLYYAEYNNTGPGSSTANRVTWPGYH  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GD W+ +TG+ Y  G+
Sbjct  531  VINSTD-AANFTVSNFLLGDNWLPQTGVPYTGGL  563



>ref|XP_006577155.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20-like 
[Glycine max]
 gb|KHN20387.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=562

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS+++ FI P GW  W G+  L TL+YAEY N G G++TA+RV W GY 
Sbjct  469  PWKEYSRTVYMQSFMNSFINPSGWHEWSGDFALSTLYYAEYNNTGPGSNTANRVTWPGYH  528

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y +G+
Sbjct  529  V-INATDAANFTVSNFLDGDSWLPQTGVPYVTGL  561



>ref|XP_006444392.1| hypothetical protein CICLE_v10023588mg [Citrus clementina]
 gb|ESR57632.1| hypothetical protein CICLE_v10023588mg [Citrus clementina]
Length=550

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQS++D  I P GW  W G+  L TL+YAEY NRG G+++A+RV W GY 
Sbjct  456  PWKEYSRTVIMQSFMDSLINPSGWQIWTGDFALSTLYYAEYDNRGPGSNSANRVTWPGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD W+ +TG+ Y  G+
Sbjct  516  V-INATDAANFTVSNFLLGDVWLPQTGVPYTGGL  548



>ref|NP_001061941.1| Os08g0450200 [Oryza sativa Japonica Group]
 dbj|BAD08732.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF23855.1| Os08g0450200 [Oryza sativa Japonica Group]
 dbj|BAG93144.1| unnamed protein product [Oryza sativa Japonica Group]
Length=664

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/94 (56%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+EYSRT+IM S I  F+   G+ PW G+ GL TLWYAEY N+GAGA+TA RV W GYK
Sbjct  569  PWREYSRTLIMNSDIPAFVDKAGYLPWSGDFGLKTLWYAEYGNKGAGAATAGRVSWPGYK  628

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K IS   A +FTV   L  + WIK TG     GM
Sbjct  629  KVISKKEATKFTVQNFLHAEPWIKPTGTPVKYGM  662



>ref|XP_010058837.1| PREDICTED: uncharacterized protein LOC104446716 [Eucalyptus grandis]
Length=1688

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -1

Query  447   PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
             PWKE+SRT+IM+SYI   + P GWS + G  GL TL+Y EYQNRG G++T  RVKW GYK
Sbjct  1594  PWKEFSRTVIMESYIGDLVDPVGWSEYRGSAGLSTLFYGEYQNRGPGSNTNDRVKWPGYK  1653

Query  267   KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                S+ +A QFTV   +QG++W+  TG  Y SG+
Sbjct  1654  VITSSTVANQFTVESFIQGNQWLDSTGFPYYSGL  1687



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIM+SYI   I PEGW PW G+ GL T +Y EY N G G+  + RVKW G  
Sbjct  480  PWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGSDKSKRVKWRGI-  538

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTK  160
            KNI+   A  FT G  L+GD WIK TG+ Y SG+T+
Sbjct  539  KNITPQHAVDFTPGRFLKGDRWIKPTGVPYVSGLTR  574



>ref|XP_009351517.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+IM+S +DG I P GW PW G + L TL+Y EY N GAGA T  RV W GY+
Sbjct  444  PWEKYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGTGGRVNWPGYR  503

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                A  A +FTVG  L GD WI+ TG+ + +G+
Sbjct  504  VITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   113 bits (283),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS W G+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  456  PWKAYSRTVFMQSNIGDHIDPEGWSVWQGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  515

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              ++A  A++FTVG L+QG  W+K TG++Y  G+
Sbjct  516  I-LNAAEARKFTVGQLIQGGAWLKSTGVAYTEGL  548



>ref|XP_006444399.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
 gb|ESR57639.1| hypothetical protein CICLE_v100237231mg, partial [Citrus clementina]
Length=548

 Score =   113 bits (282),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M SY+   IAP GW  W+G   L TL+Y EY+NRG G++T++RV W GY+
Sbjct  453  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  512

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               ++ +A QFT G  LQG EW+  TGI +   +T
Sbjct  513  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  547



>ref|XP_008242331.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=554

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+ YSRTI+M+SY+   I P+GWS WD    ++T+ Y EY N G G+ T  RVKW GYK
Sbjct  460  PWRNYSRTIVMKSYLGDMINPQGWSKWDDYSTVETVEYIEYLNFGPGSDTRHRVKWGGYK  519

Query  267  KNISADIAKQFTVGMLLQG-DEWIKETGISYDSG  169
            KN S +IA+QFTVG+ L G   W+K TGI    G
Sbjct  520  KNCSEEIARQFTVGLFLHGAGHWLKTTGIPLSYG  553



>ref|XP_006418303.1| hypothetical protein EUTSA_v10007177mg [Eutrema salsugineum]
 gb|ESQ36656.1| hypothetical protein EUTSA_v10007177mg [Eutrema salsugineum]
Length=582

 Score =   113 bits (283),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQSYIDGF+ P GW  W+G+  L TL+YAE+ N G G++T +RV W GY+
Sbjct  488  PWKEYSRTVIMQSYIDGFLEPVGWREWNGDFALSTLYYAEFNNTGPGSNTTNRVTWPGYQ  547

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV  L   D+WI +TG+ Y SG+
Sbjct  548  VINSTD-AANFTVTGLFLEDDWIWKTGVPYSSGL  580



>gb|ABD47732.1| pectin methylesterase [Eucalyptus globulus subsp. globulus]
Length=98

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++MQS I   I P GWS W G+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  5    PWKLYSRTVVMQSNIGDHIDPTGWSVWSGDHALKTLYYGEYMNKGPGAGTSKRVKWPGYH  64

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   AK+FTV  L+QG  W+K TG+SY  G+
Sbjct  65   VITSPAEAKKFTVAELIQGGTWLKSTGVSYTEGL  98



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 61/94 (65%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS I G I P GW+ WD E  L TL+Y EY NRG GA  + RV W GY 
Sbjct  457  PWKEYSRTVVMQSNIGGHIDPTGWAEWDKEFALTTLYYGEYANRGLGAGVSKRVNWPGYH  516

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 + AKQFTV  L+QG  W+  TG+S+  G+
Sbjct  517  VITDPNEAKQFTVAELIQGGAWLGSTGVSFTEGL  550



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+ SRTIIMQS I GF+ PEGWS WDG   L+TL+YAEYQNRG G+ T +RV+W G  
Sbjct  451  PWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++ S  +A+ +T   + QGDEWI+ +G+ Y   M KV
Sbjct  510  QHFSPQMAESWTGAKMYQGDEWIRNSGVPYVPTMMKV  546



>ref|XP_004972208.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.1-like, partial 
[Setaria italica]
Length=525

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ M+SY+   + P GW  W+G   L TL+Y EY+N G GA TA+RV+W GY 
Sbjct  432  PWKAYSRTVYMRSYVGAHVDPRGWLEWNGNFALKTLFYGEYENEGPGAGTAARVRWPGYH  491

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                  +A QFTVG  +QG  W+K TG++Y +G+
Sbjct  492  VITDRSVAVQFTVGQFIQGGSWLKSTGVAYINGL  525



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+ SRTIIMQS I GF+ PEGWS WDG   L+TL+YAEYQNRG G+ T +RV+W G  
Sbjct  451  PWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++ S  +A+ +T   + QGDEWI+ +G+ Y   M KV
Sbjct  510  QHFSPQMAESWTGAKMYQGDEWIRNSGVPYVPTMMKV  546



>ref|XP_006480001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Citrus sinensis]
Length=569

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M SY+   IAP GW  W+G   L TL+Y EY+NRG G++T++RV W GY+
Sbjct  474  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  533

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               ++ +A QFT G  LQG EW+  TGI +   +T
Sbjct  534  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  568



>ref|XP_002512460.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF49912.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=548

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT++MQS+ID  I P GW+PW G+  L TL YAE+ N G G+  ++RV W GY 
Sbjct  454  PWKEYSRTVVMQSFIDSLIGPAGWAPWSGDFALATLHYAEFDNHGPGSDISNRVIWPGYD  513

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            ++ +A  A  FTV   +QGD W+  +G+ Y  G+
Sbjct  514  RDFNATDADSFTVSKFIQGDAWLPTSGVPYFGGL  547



>gb|AHB84678.1| pectin methylesterase [Citrus reticulata]
Length=569

 Score =   113 bits (282),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 64/95 (67%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M SY+   IAP GW  W+G   L TL+Y EY+NRG G++T++RV W GY+
Sbjct  474  PWKEYSRTVFMLSYLGDLIAPAGWLEWNGTFALSTLFYGEYKNRGPGSNTSARVTWPGYR  533

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               ++ +A QFT G  LQG EW+  TGI +   +T
Sbjct  534  VINNSAVAAQFTAGPFLQGSEWLNSTGIPFYLNLT  568



>emb|CAA96435.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  223  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  282

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTVG L+QG  W+K TG++Y  G+
Sbjct  283  I-LSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  315



>ref|XP_009611830.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Nicotiana tomentosiformis]
Length=523

 Score =   112 bits (281),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ +QS++D  I P GWSPW G+  L+TL+YAEY N G G+ T +RV W GY 
Sbjct  430  PWKEYSRTVYIQSFMDSLIDPSGWSPWSGDFALNTLYYAEYANTGPGSVTTNRVTWQGYH  489

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                 D A  FTV  L+QGD W+  TG+ + SG+
Sbjct  490  VINDTD-AVNFTVSSLIQGDVWLPATGVPFTSGL  522



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+ SRTIIMQS I GF+ PEGWS WDG   L+TL+YAEYQNRG G+ T +RV+W G  
Sbjct  451  PWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRVQWPGI-  509

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++ S  +A+ +T   + QGDEWI+ +G+ Y   M KV
Sbjct  510  QHFSPQMAESWTGAKMYQGDEWIRNSGVPYVPTMMKV  546



>emb|CAA96434.1| pectin methylesterase [Nicotiana plumbaginifolia]
Length=315

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I PEGWS WDG+  L TL+Y EY N+G GA T+ RVKW GY 
Sbjct  223  PWKAYSRTVFMQSNIGDHIDPEGWSVWDGDFALKTLYYGEYMNKGPGAGTSKRVKWPGYH  282

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              +SA  A +FTVG L+QG  W+K TG++Y  G+
Sbjct  283  I-LSAAEATKFTVGQLIQGGVWLKSTGVAYTEGL  315



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ M++Y+D  I P GW  W+G   L TL+Y EY N G G+ST +RVKW GY+
Sbjct  345  PWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWGGYR  404

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A +FTVG L+ G+ W+  TG+ + SG+
Sbjct  405  VITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  438



>ref|XP_010939846.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=591

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/95 (54%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRT+IM+S I   I P GW  W+G   LDTL+Y EY+N GAGA TA RVKWNGY+
Sbjct  496  PWKEHSRTVIMESDIGDVIDPAGWHEWNGPFALDTLYYGEYKNTGAGAGTAGRVKWNGYR  555

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
                   A+QFT G LL G  W+  TG  Y  G++
Sbjct  556  VLTDVREAEQFTPGNLLGGSNWLGSTGFPYSLGLS  590



>ref|XP_006828586.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
 gb|ERM96002.1| hypothetical protein AMTR_s00129p00044320 [Amborella trichopoda]
Length=564

 Score =   113 bits (282),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+IMQS I   I P GW  W+G   L+TL+Y EYQN GAGA T+ RVKW GYK
Sbjct  471  PWKEYSRTVIMQSTISDVINPAGWHEWNGNFALNTLYYGEYQNTGAGAGTSGRVKWKGYK  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  AKQFTVG  + G  W+  TG  + +G 
Sbjct  531  VITSASEAKQFTVGDFINGGSWLGSTGFPFTAGF  564



>ref|XP_004514850.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=511

 Score =   112 bits (280),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW++YSRT+ M + +D FI P GW  WDG   LDTL+YAEY N G+G+ST++RVKW GY 
Sbjct  418  PWQKYSRTVFMDTVLDSFINPAGWLEWDGNFALDTLYYAEYANTGSGSSTSNRVKWKGYH  477

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A  FTVG  + G+ W+ +TG+ + SG+
Sbjct  478  VLTSASQASPFTVGNFIAGNSWLPKTGVPFTSGL  511



>ref|XP_006444394.1| hypothetical protein CICLE_v10020108mg [Citrus clementina]
 gb|ESR57634.1| hypothetical protein CICLE_v10020108mg [Citrus clementina]
Length=452

 Score =   111 bits (278),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQS++D  I P GW  W G+  L TL+YAEY N G G++TA+RV W GY 
Sbjct  358  PWKEYSRTVYMQSFMDSSINPAGWQIWSGDFALSTLYYAEYNNTGPGSNTANRVTWPGYH  417

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
              I+A  A  FTV   L GD+WI +TG+SY   +
Sbjct  418  VTINATDAANFTVSNFLLGDDWIPQTGVSYTGAL  451



>gb|EYU43523.1| hypothetical protein MIMGU_mgv1a026199mg [Erythranthe guttata]
Length=484

 Score =   112 bits (279),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPW-DGEIGLDTLWYAEYQNRGAGASTASRVKWNGY  271
            PW++YSRT+IM+S+IDGF+ PEGWS W D +  L TL+Y EY+N G G S+ +RVKW GY
Sbjct  390  PWQQYSRTVIMKSFIDGFVVPEGWSRWEDSDFALSTLYYGEYKNFGPGGSSRNRVKWPGY  449

Query  270  KKNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                S ++A +FTVG L+ G  W+  TG+ + +G+
Sbjct  450  HIITSPNVANRFTVGSLIAGRAWLPSTGVPFIAGL  484



>gb|KEH24404.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=557

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/90 (51%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ + S+ID  I P GW  W+G   LDTL+Y EY+NRG G++T++RV W GYK
Sbjct  463  PWKKYSRTVYLNSFIDNLIDPAGWLEWNGTFALDTLFYGEYKNRGPGSNTSARVTWPGYK  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
               +A  A QFTV   +QG+EW+  TG+ +
Sbjct  523  VITNATEASQFTVRQFIQGNEWLNSTGVPF  552



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE+SRT+ MQSY+D  I P GW  W+G+  L+TL+Y EY NRG G++T  RVKW GY+
Sbjct  145  PWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWPGYR  204

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A  FTV   +QGD+W+  T + + SG+
Sbjct  205  VINSTAEASNFTVTSFIQGDQWLGSTSVPFTSGL  238



>ref|XP_010553426.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Tarenaya 
hassleriana]
Length=555

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQSYI+  I P GW PWDG+  L TL+Y EY N G G+ T+ RV W GY+
Sbjct  462  PWKMYSRTVFMQSYIEDHIDPSGWFPWDGDFALSTLYYGEYANTGPGSDTSKRVNWKGYR  521

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISY  178
                   A+QFTV  L+QG  W+K TG++Y
Sbjct  522  VIKDPKEAEQFTVAKLIQGGSWLKPTGVAY  551



>ref|XP_010522800.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7 
[Tarenaya hassleriana]
Length=565

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRT+ MQSYIDG + P GW  W+G+  L TL+YAEY N G G++T +RV W GY 
Sbjct  471  PWKEYSRTVYMQSYIDGVVEPIGWREWNGDFALSTLYYAEYNNTGPGSNTINRVNWTGYH  530

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S D A  FTV   L GD+WI ++G+ Y  G+
Sbjct  531  VINSTD-AANFTVSSFLLGDDWILQSGVPYSGGL  563



>ref|NP_001042865.1| Os01g0311800 [Oryza sativa Japonica Group]
 dbj|BAB92764.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04779.1| Os01g0311800 [Oryza sativa Japonica Group]
 dbj|BAG97911.1| unnamed protein product [Oryza sativa Japonica Group]
Length=557

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+IMQS + G I P GW PWDG+  L TL+YAEY N GAGA T+ RV W GY 
Sbjct  463  PWKLYSRTVIMQSVVGGLIDPAGWMPWDGDYALSTLYYAEYNNSGAGADTSRRVTWPGYH  522

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S   A  FTVG ++ GD W+ +TG+ + SG+
Sbjct  523  VLNSTADAGNFTVGNMVLGDFWLPQTGVPFTSGL  556



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   112 bits (279),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ MQS I   I P GWS WDG+  L TL+Y EY N+GAGA  + RV W GY 
Sbjct  393  PWKAYSRTVYMQSNIGDHIDPAGWSEWDGDFALKTLYYGEYMNKGAGAGISKRVNWAGYH  452

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K ++   A +FTVG L+QG  W+K TG++Y  G+
Sbjct  453  KALTTSEAAKFTVGQLIQGAAWLKSTGVAYTEGL  486



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 59/94 (63%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT++M SY+D  +   GW  WDG+  L TL+Y EYQN G GA+TA RV W GY 
Sbjct  459  PWKAYSRTVVMLSYLDAHVDARGWLEWDGDFALKTLFYGEYQNEGPGAATAGRVNWPGYH  518

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
                  +A QFTVG  +QG  W+  TG+ Y  G+
Sbjct  519  VITDRSVAVQFTVGQFIQGGNWLNGTGVPYIEGL  552



>ref|XP_010261671.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   113 bits (282),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 46/94 (49%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+ YSRT+IMQSY+D  I P GW PW G   L TL+Y EY N G G+ST+ RV W+GY 
Sbjct  488  PWQRYSRTVIMQSYLDDCIHPAGWFPWSGSFALSTLYYGEYMNSGPGSSTSGRVSWSGYH  547

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
             +++   A +FTV   + G+ W+  TG+++DSG+
Sbjct  548  PSLATAEATKFTVTNFIAGNLWLPSTGVAFDSGL  581



>ref|XP_008392665.1| PREDICTED: pectinesterase-like [Malus domestica]
 ref|XP_008344188.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=545

 Score =   112 bits (281),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 64/94 (68%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+ YSRT++M+SY+  FI P+GWS WD    +DT+ Y EY N G G+ T  RV W GYK
Sbjct  451  PWRNYSRTVVMRSYLGDFIHPQGWSKWDEFTTVDTVEYIEYFNFGPGSDTKQRVNWGGYK  510

Query  267  KNISADIAKQFTVGMLLQGD-EWIKETGISYDSG  169
            +N S +I +QFTVG+ L G+ +WI+ TGI    G
Sbjct  511  RNCSEEIVRQFTVGLFLHGESDWIQTTGIPLSYG  544



>ref|XP_010556724.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=547

 Score =   112 bits (280),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 47/94 (50%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK YSRT+ ++SYID  + P GW  W+G+  LDTL+Y EY NRG G++T +RVKW GY+
Sbjct  453  PWKAYSRTVFIKSYIDDAVDPAGWLEWNGDFALDTLYYGEYMNRGPGSNTTNRVKWAGYR  512

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               S+  A +FTVG  +QGD W+  T I +  G+
Sbjct  513  VINSSTEASKFTVGPFVQGDAWLNSTKIPFSLGL  546



>gb|EAZ07185.1| hypothetical protein OsI_29431 [Oryza sativa Indica Group]
Length=663

 Score =   113 bits (283),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+EYSRT+IM S I  F+   G+ PW G+ GL TLWYAEY N+GAGA+TA RV W GYK
Sbjct  568  PWREYSRTLIMNSDIPAFVDKAGYLPWSGDFGLKTLWYAEYGNKGAGAATAGRVSWPGYK  627

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K IS   A +FT+   L  + WIK TG     GM
Sbjct  628  KVISKKEATKFTLQNFLHAEPWIKPTGTPVKYGM  661



>dbj|BAJ96804.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   112 bits (281),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 0/94 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSRT+ MQS +D  + P GW  WDG   LDTL+Y EYQN G GA T+ RV W GY+
Sbjct  473  PWKQYSRTVFMQSELDSVVNPAGWLAWDGTFALDTLYYGEYQNTGPGAGTSGRVTWKGYR  532

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
               SA  A  FTVG  + GD W+  T I + +G+
Sbjct  533  VITSASEASTFTVGSFIDGDVWLAGTSIPFSAGL  566



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKEYSRTIIM ++I  F+ P+GW PW+ + GL TL+Y+E QN G G+  ASRV W G K
Sbjct  472  PWKEYSRTIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGSDLASRVTWAGIK  531

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGM  166
            K  S DI  QFT    +QGD WI  TG+ Y  G+
Sbjct  532  KLTSKDI-DQFTPAKFIQGDSWIPATGVPYTPGL  564



>ref|XP_002444448.1| hypothetical protein SORBIDRAFT_07g022090 [Sorghum bicolor]
 gb|EES13943.1| hypothetical protein SORBIDRAFT_07g022090 [Sorghum bicolor]
Length=584

 Score =   112 bits (281),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSR + MQSYI   + PEGW  WDG+  LDTL+Y EY N G GA  A+RVKW G+ 
Sbjct  489  PWKQYSRVVFMQSYIGDLVRPEGWLAWDGDFALDTLYYGEYSNTGPGAGVAARVKWPGFH  548

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               SA  A  FTV   ++G+ W+  TG+ Y +G+T
Sbjct  549  VMTSAAEAGNFTVAQFIEGNMWLPPTGVKYTAGLT  583



>ref|XP_006659463.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase/pectinesterase 
inhibitor PPE8B-like [Oryza brachyantha]
Length=532

 Score =   112 bits (280),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 48/95 (51%), Positives = 60/95 (63%), Gaps = 0/95 (0%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK+YSR + MQSYI   + PEGW  WDGE  LDTL+Y EY N G GA    RVKW G+ 
Sbjct  437  PWKQYSRVVFMQSYIGAVVRPEGWLAWDGEFALDTLYYGEYMNTGPGAGVGGRVKWPGFH  496

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMT  163
               S D A  FTV   ++G+ W+  TG+ Y +G+T
Sbjct  497  VMTSPDQAGNFTVAQFIEGNMWLPPTGVKYTAGLT  531



>ref|XP_007204488.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
 gb|EMJ05687.1| hypothetical protein PRUPE_ppa019698mg [Prunus persica]
Length=530

 Score =   112 bits (280),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PW+ YSRTI+M+SY+   I P+GWS WD    ++T+ Y EY N G G+ T  RVKW GYK
Sbjct  436  PWRNYSRTIVMKSYLGDMINPQGWSKWDDYSTVETVEYIEYLNFGPGSDTRHRVKWGGYK  495

Query  267  KNISADIAKQFTVGMLLQG-DEWIKETGISYDSG  169
            KN S +IA+QFTVG+ L G   W+K TGI    G
Sbjct  496  KNCSEEIARQFTVGLFLHGAGHWLKTTGIPLSYG  529



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   113 bits (282),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWK  SRTIIMQS I GFIAPEGW+PW G   LDTL+YAEYQNRG G+   +RV W G +
Sbjct  526  PWKLLSRTIIMQSNIGGFIAPEGWAPWAGTFALDTLYYAEYQNRGPGSDLKARVTWKGIQ  585

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            K +S  +A+ +T G L  GDEWI+ +G+ Y   M +V
Sbjct  586  K-LSPQMAESWTGGKLFGGDEWIRGSGVPYVPTMMQV  621



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = -1

Query  447  PWKEYSRTIIMQSYIDGFIAPEGWSPWDGEIGLDTLWYAEYQNRGAGASTASRVKWNGYK  268
            PWKE SRTIIMQS IDGFI+P+GWSPW G   LDTL+Y EYQNRGAG+  A+RV W G  
Sbjct  448  PWKELSRTIIMQSEIDGFISPKGWSPWMGNFALDTLYYGEYQNRGAGSDLANRVTWKGI-  506

Query  267  KNISADIAKQFTVGMLLQGDEWIKETGISYDSGMTKV  157
            ++++   A+++T G   +GDEWI  +G+ Y   + +V
Sbjct  507  QHMTQQKAEEWTGGAAFRGDEWITSSGVPYVPTLMQV  543



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 511302198024