BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25780_g4_i9 len=3272 path=[31329:0-343 25007:344-369 25033:370-1432
26095:1433-1533 26196:1534-1593 15876:1594-1669 4649:1670-1693
49376:1694-1707 49390:1708-1711 49394:1712-1712 49395:1713-1717
26373:1718-1741 26397:1742-1767 26423:1768-1780 49435:1781-1783
49438:1784-1872 26525:1873-1903 14258:1904-1913 26565:1914-1946
26598:1947-1985 26637:1986-1997 26649:1998-2009 2887:2010-2033
49607:2034-2045 44719:2046-2054 2932:2055-2068 49666:2069-2092
49690:2093-2095 49693:2096-2112 2990:2113-2171 3049:2172-2362
3240:2363-2420 3298:2421-2458 17269:2459-2516 3394:2517-2595
3473:2596-2600 3478:2601-2683 3561:2684-2702 3580:2703-2705
3583:2706-2734 12756:2735-2802 16702:2803-2891 12913:2892-2938
16248:2939-2942 12964:2943-2975 48975:2976-2986 13008:2987-3106
47635:3107-3119 13156:3120-3193 44555:3194-3227 13264:3228-3271]

Length=3272
                                                                      Score     E

ref|XP_009615584.1|  PREDICTED: pectinesterase-like                     704   0.0      
ref|XP_009761202.1|  PREDICTED: pectinesterase                          700   0.0      
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     692   0.0      
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     688   0.0      
ref|XP_006342830.1|  PREDICTED: putative pectinesterase/pectinest...    684   0.0      
emb|CDO98832.1|  unnamed protein product                                682   0.0      
ref|XP_004229265.1|  PREDICTED: pectinesterase-like                     670   0.0      
emb|CDO98833.1|  unnamed protein product                                657   0.0      
emb|CDO98834.1|  unnamed protein product                                655   0.0      
ref|XP_004239802.1|  PREDICTED: pectinesterase-like                     649   0.0      
gb|EYU43977.1|  hypothetical protein MIMGU_mgv1a003434mg                629   0.0      
ref|XP_002512459.1|  Pectinesterase precursor, putative                 616   0.0      Ricinus communis
gb|EYU45536.1|  hypothetical protein MIMGU_mgv1a003444mg                613   0.0      
gb|EYU45538.1|  hypothetical protein MIMGU_mgv1a003726mg                611   0.0      
ref|XP_011071430.1|  PREDICTED: pectinesterase-like                     610   0.0      
ref|XP_009774523.1|  PREDICTED: pectinesterase-like                     600   0.0      
ref|XP_009596737.1|  PREDICTED: pectinesterase-like                     599   0.0      
ref|XP_008438906.1|  PREDICTED: pectinesterase-like                     598   0.0      
ref|XP_010258716.1|  PREDICTED: putative pectinesterase/pectinest...    598   0.0      
gb|EYU45535.1|  hypothetical protein MIMGU_mgv1a003776mg                597   0.0      
ref|XP_010105131.1|  Putative pectinesterase/pectinesterase inhib...    596   0.0      
gb|EYU45537.1|  hypothetical protein MIMGU_mgv1a003747mg                594   0.0      
ref|XP_007035646.1|  Plant invertase/pectin methylesterase inhibi...    596   0.0      
ref|XP_004162213.1|  PREDICTED: probable pectinesterase/pectinest...    592   0.0      
ref|XP_004134493.1|  PREDICTED: probable pectinesterase/pectinest...    591   0.0      
ref|XP_011091005.1|  PREDICTED: pectinesterase-like                     591   0.0      
ref|XP_002314364.1|  putative pectinesterase family protein             591   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011006446.1|  PREDICTED: putative pectinesterase/pectinest...    590   0.0      
ref|XP_011071432.1|  PREDICTED: pectinesterase-like                     591   0.0      
ref|XP_010039612.1|  PREDICTED: probable pectinesterase/pectinest...    590   0.0      
gb|KDP23449.1|  hypothetical protein JCGZ_23282                         588   0.0      
ref|XP_011071429.1|  PREDICTED: pectinesterase-like                     586   0.0      
ref|XP_009620126.1|  PREDICTED: pectinesterase-like                     587   0.0      
ref|XP_011071426.1|  PREDICTED: pectinesterase-like                     585   0.0      
gb|EPS72184.1|  pectinesterase family protein                           585   0.0      
ref|XP_009792453.1|  PREDICTED: pectinesterase-like                     584   0.0      
ref|XP_011071427.1|  PREDICTED: pectinesterase-like                     583   0.0      
ref|XP_011071421.1|  PREDICTED: pectinesterase-like                     583   0.0      
ref|XP_011091003.1|  PREDICTED: pectinesterase-like isoform X1          582   0.0      
ref|XP_011071425.1|  PREDICTED: pectinesterase-like                     581   0.0      
ref|XP_010046221.1|  PREDICTED: probable pectinesterase/pectinest...    582   0.0      
ref|XP_011071655.1|  PREDICTED: pectinesterase-like                     580   0.0      
gb|EYU45539.1|  hypothetical protein MIMGU_mgv1a004121mg                580   0.0      
dbj|BAO02509.1|  predicted pectin esterase ortholog                     578   0.0      
ref|XP_003631952.1|  PREDICTED: putative pectinesterase/pectinest...    579   0.0      
ref|XP_008458409.1|  PREDICTED: probable pectinesterase/pectinest...    577   0.0      
ref|XP_011071431.1|  PREDICTED: pectinesterase-like                     577   0.0      
gb|EPS70728.1|  pectinesterase                                          573   0.0      
ref|XP_004150503.1|  PREDICTED: putative pectinesterase/pectinest...    573   0.0      
ref|XP_008245483.1|  PREDICTED: putative pectinesterase/pectinest...    573   0.0      
ref|XP_007227113.1|  hypothetical protein PRUPE_ppa026560mg             571   0.0      
ref|XP_002872255.1|  pectinesterase family protein                      572   0.0      
ref|XP_010024084.1|  PREDICTED: putative pectinesterase/pectinest...    567   0.0      
ref|XP_010659656.1|  PREDICTED: putative pectinesterase/pectinest...    567   0.0      
ref|NP_198139.1|  putative pectinesterase/pectinesterase inhibito...    570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002516960.1|  Pectinesterase precursor, putative                 562   0.0      Ricinus communis
emb|CBI39537.3|  unnamed protein product                                569   0.0      
ref|XP_007224682.1|  hypothetical protein PRUPE_ppa025631mg             561   0.0      
ref|XP_004252915.1|  PREDICTED: pectinesterase                          560   0.0      
gb|KDP27834.1|  hypothetical protein JCGZ_18914                         559   0.0      
ref|XP_009352341.1|  PREDICTED: probable pectinesterase/pectinest...    560   0.0      
ref|XP_010546739.1|  PREDICTED: probable pectinesterase/pectinest...    561   0.0      
ref|XP_009111740.1|  PREDICTED: putative pectinesterase/pectinest...    562   0.0      
ref|XP_010268337.1|  PREDICTED: putative pectinesterase/pectinest...    558   0.0      
ref|XP_008223242.1|  PREDICTED: putative pectinesterase/pectinest...    556   0.0      
ref|XP_002318979.2|  hypothetical protein POPTR_0013s01500g             557   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP27833.1|  hypothetical protein JCGZ_18913                         556   0.0      
ref|XP_008390623.1|  PREDICTED: probable pectinesterase/pectinest...    555   0.0      
ref|XP_008245480.1|  PREDICTED: probable pectinesterase/pectinest...    555   0.0      
ref|XP_008223241.1|  PREDICTED: putative pectinesterase/pectinest...    554   0.0      
ref|XP_009385286.1|  PREDICTED: putative pectinesterase/pectinest...    554   0.0      
ref|XP_006290150.1|  hypothetical protein CARUB_v10003818mg             559   0.0      
ref|XP_007225707.1|  hypothetical protein PRUPE_ppa003569mg             552   0.0      
emb|CDP21547.1|  unnamed protein product                                556   0.0      
ref|XP_010551001.1|  PREDICTED: probable pectinesterase/pectinest...    555   2e-180   
ref|XP_006382447.1|  pectin methylesterase family protein               551   3e-180   
emb|CDX99968.1|  BnaC09g03330D                                          555   3e-180   
ref|XP_009147301.1|  PREDICTED: probable pectinesterase/pectinest...    553   3e-180   
gb|EYU42197.1|  hypothetical protein MIMGU_mgv1a000814mg                565   3e-180   
ref|XP_008223240.1|  PREDICTED: putative pectinesterase/pectinest...    550   5e-180   
ref|XP_009352343.1|  PREDICTED: putative pectinesterase/pectinest...    550   5e-180   
ref|NP_199729.1|  putative pectinesterase/pectinesterase inhibito...    550   7e-180   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884519.1|  pectinesterase family protein                      553   8e-180   
ref|XP_010455075.1|  PREDICTED: putative pectinesterase/pectinest...    560   9e-180   
ref|NP_187212.1|  probable pectinesterase/pectinesterase inhibito...    553   1e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006299753.1|  hypothetical protein CARUB_v10015948mg             554   1e-179   
ref|XP_006408050.1|  hypothetical protein EUTSA_v10020314mg             550   2e-179   
gb|KFK26505.1|  hypothetical protein AALP_AA8G257900                    553   6e-179   
ref|XP_007221831.1|  hypothetical protein PRUPE_ppa020185mg             546   1e-178   
ref|XP_004494574.1|  PREDICTED: probable pectinesterase/pectinest...    546   2e-178   
emb|CDY27751.1|  BnaA05g31600D                                          548   2e-178   
emb|CBI22967.3|  unnamed protein product                                568   3e-178   
dbj|BAC42986.1|  putative pectinesterase                                549   3e-178   Arabidopsis thaliana [mouse-ear cress]
gb|EPS59322.1|  pectinesterase                                          544   3e-178   
ref|XP_011023718.1|  PREDICTED: probable pectinesterase/pectinest...    546   3e-178   
emb|CDY05188.1|  BnaC05g46150D                                          547   4e-178   
ref|XP_008351177.1|  PREDICTED: putative pectinesterase/pectinest...    545   4e-178   
gb|KFK37969.1|  hypothetical protein AALP_AA3G053300                    548   5e-178   
ref|XP_009385223.1|  PREDICTED: putative pectinesterase/pectinest...    545   5e-178   
ref|XP_011036905.1|  PREDICTED: probable pectinesterase/pectinest...    545   6e-178   
ref|XP_002865716.1|  pectinesterase family protein                      545   6e-178   
ref|XP_006281463.1|  hypothetical protein CARUB_v10027546mg             545   7e-178   
ref|XP_006841651.1|  hypothetical protein AMTR_s00003p00239700          545   8e-178   
gb|EYU37278.1|  hypothetical protein MIMGU_mgv1a002232mg                549   8e-178   
emb|CDX80613.1|  BnaC07g28310D                                          547   2e-177   
ref|XP_008810219.1|  PREDICTED: putative pectinesterase/pectinest...    544   2e-177   
ref|XP_007222393.1|  hypothetical protein PRUPE_ppa003441mg             543   3e-177   
ref|XP_008246353.1|  PREDICTED: putative pectinesterase/pectinest...    545   3e-177   
ref|XP_009352342.1|  PREDICTED: probable pectinesterase/pectinest...    543   4e-177   
ref|XP_006395088.1|  hypothetical protein EUTSA_v10003919mg             541   9e-177   
ref|XP_003626199.1|  Pectinesterase                                     542   1e-176   
ref|XP_010094457.1|  Putative pectinesterase/pectinesterase inhib...    541   2e-176   
ref|XP_007226432.1|  hypothetical protein PRUPE_ppa024011mg             541   3e-176   
ref|XP_010464089.1|  PREDICTED: probable pectinesterase/pectinest...    545   4e-176   
ref|XP_009151177.1|  PREDICTED: putative pectinesterase/pectinest...    543   9e-176   
ref|XP_009421439.1|  PREDICTED: putative pectinesterase/pectinest...    538   9e-176   
ref|XP_007207839.1|  hypothetical protein PRUPE_ppa023319mg             540   1e-175   
ref|XP_010547008.1|  PREDICTED: probable pectinesterase/pectinest...    539   1e-175   
ref|XP_010440281.1|  PREDICTED: probable pectinesterase/pectinest...    538   2e-175   
emb|CDY68790.1|  BnaAnng28400D                                          543   3e-175   
ref|XP_008450602.1|  PREDICTED: probable pectinesterase/pectinest...    538   4e-175   
ref|XP_009124869.1|  PREDICTED: probable pectinesterase/pectinest...    539   4e-175   
ref|XP_010429701.1|  PREDICTED: probable pectinesterase/pectinest...    541   7e-175   
ref|XP_009402043.1|  PREDICTED: putative pectinesterase/pectinest...    536   8e-175   
ref|XP_004135775.1|  PREDICTED: putative pectinesterase/pectinest...    536   2e-174   
ref|XP_009134836.1|  PREDICTED: probable pectinesterase/pectinest...    541   2e-174   
ref|XP_010429777.1|  PREDICTED: probable pectinesterase/pectinest...    540   2e-174   
ref|XP_006394934.1|  hypothetical protein EUTSA_v10003734mg             540   3e-174   
emb|CDX74137.1|  BnaA03g29100D                                          540   3e-174   
ref|XP_009134835.1|  PREDICTED: probable pectinesterase/pectinest...    541   3e-174   
ref|XP_009762317.1|  PREDICTED: pectinesterase-like                     538   5e-174   
ref|XP_004298144.1|  PREDICTED: probable pectinesterase/pectinest...    534   1e-173   
ref|XP_003591166.1|  Pectinesterase                                     533   2e-173   
ref|XP_010932011.1|  PREDICTED: putative pectinesterase/pectinest...    533   5e-173   
ref|XP_007146999.1|  hypothetical protein PHAVU_006G088200g             531   2e-172   
ref|XP_003591168.1|  Pectinesterase                                     531   2e-172   
ref|XP_008370617.1|  PREDICTED: pectinesterase                          531   4e-172   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    531   5e-172   
ref|XP_003591164.1|  Pectinesterase                                     530   8e-172   
ref|XP_010547007.1|  PREDICTED: probable pectinesterase/pectinest...    529   1e-171   
ref|XP_003604119.1|  Pectinesterase                                     530   3e-171   
ref|XP_010667121.1|  PREDICTED: probable pectinesterase/pectinest...    528   3e-171   
ref|XP_003535332.1|  PREDICTED: probable pectinesterase/pectinest...    528   5e-171   
ref|XP_003529778.1|  PREDICTED: putative pectinesterase/pectinest...    527   5e-171   
gb|KHN01292.1|  Putative pectinesterase/pectinesterase inhibitor 28     527   7e-171   
ref|XP_004495690.1|  PREDICTED: probable pectinesterase/pectinest...    527   8e-171   
ref|XP_011092100.1|  PREDICTED: probable pectinesterase/pectinest...    534   1e-170   
ref|XP_010442377.1|  PREDICTED: probable pectinesterase/pectinest...    525   2e-170   
gb|KHN16095.1|  Putative pectinesterase/pectinesterase inhibitor 21     525   2e-170   
ref|XP_003529788.1|  PREDICTED: putative pectinesterase/pectinest...    525   3e-170   
gb|KHN26239.1|  Putative pectinesterase/pectinesterase inhibitor 21     525   3e-170   
ref|XP_010482197.1|  PREDICTED: probable pectinesterase/pectinest...    525   4e-170   
ref|XP_010315470.1|  PREDICTED: pectinesterase                          526   4e-170   
ref|XP_003555613.2|  PREDICTED: probable pectinesterase/pectinest...    525   5e-170   
gb|KHN04170.1|  Putative pectinesterase/pectinesterase inhibitor 21     524   6e-170   
ref|XP_003530310.1|  PREDICTED: putative pectinesterase/pectinest...    525   6e-170   
ref|XP_006344696.1|  PREDICTED: putative pectinesterase/pectinest...    528   7e-170   
ref|XP_004229262.1|  PREDICTED: pectinesterase-like                     523   1e-169   
ref|XP_003516937.1|  PREDICTED: probable pectinesterase/pectinest...    523   1e-169   
ref|XP_010667122.1|  PREDICTED: pectinesterase                          523   2e-169   
ref|XP_010558804.1|  PREDICTED: probable pectinesterase/pectinest...    523   2e-169   
ref|XP_004229264.1|  PREDICTED: pectinesterase-like                     521   5e-169   
ref|XP_003557035.1|  PREDICTED: putative pectinesterase/pectinest...    521   9e-169   
gb|KHN03958.1|  Putative pectinesterase/pectinesterase inhibitor 21     521   9e-169   
gb|AGT17860.1|  pollen-specific pectin methylesterase                   521   1e-168   
ref|XP_010495536.1|  PREDICTED: putative pectinesterase/pectinest...    522   2e-168   
ref|XP_010922274.1|  PREDICTED: pectinesterase-like                     520   4e-168   
ref|XP_004515520.1|  PREDICTED: probable pectinesterase/pectinest...    520   5e-168   
ref|XP_008795810.1|  PREDICTED: putative pectinesterase/pectinest...    519   6e-168   
gb|KHN43318.1|  Putative pectinesterase/pectinesterase inhibitor 21     518   1e-167   
ref|XP_003529774.1|  PREDICTED: putative pectinesterase/pectinest...    518   2e-167   
ref|XP_003553713.1|  PREDICTED: putative pectinesterase/pectinest...    518   2e-167   
ref|XP_004495691.1|  PREDICTED: probable pectinesterase/pectinest...    516   2e-166   
ref|XP_004515516.1|  PREDICTED: probable pectinesterase/pectinest...    515   3e-166   
ref|XP_009594458.1|  PREDICTED: pectinesterase                          519   3e-166   
ref|XP_007148795.1|  hypothetical protein PHAVU_005G015000g             515   3e-166   
ref|XP_006342829.1|  PREDICTED: pectinesterase-like                     513   4e-166   
gb|AES86317.2|  pectinesterase/pectinesterase inhibitor                 513   8e-166   
ref|XP_010524549.1|  PREDICTED: putative pectinesterase/pectinest...    513   1e-165   
ref|XP_003604120.1|  Pectinesterase                                     513   4e-165   
ref|XP_007031044.1|  Pectinesterase, putative                           512   1e-164   
gb|EPS69059.1|  hypothetical protein M569_05708                         531   2e-164   
ref|XP_009129764.1|  PREDICTED: probable pectinesterase/pectinest...    509   2e-164   
emb|CDY33925.1|  BnaA02g30620D                                          508   5e-164   
ref|XP_011091007.1|  PREDICTED: pectinesterase-like                     508   1e-163   
ref|XP_006342828.1|  PREDICTED: pectinesterase-like                     504   2e-162   
ref|XP_004984909.1|  PREDICTED: probable pectinesterase/pectinest...    501   4e-161   
ref|XP_003529556.1|  PREDICTED: pectinesterase/pectinesterase inh...    501   6e-161   
gb|KHN02946.1|  Pectinesterase/pectinesterase inhibitor                 499   2e-160   
gb|KFK38146.1|  hypothetical protein AALP_AA3G075300                    498   5e-160   
ref|XP_002465396.1|  hypothetical protein SORBIDRAFT_01g037900          496   3e-159   Sorghum bicolor [broomcorn]
gb|KHG19164.1|  putative pectinesterase/pectinesterase inhibitor ...    493   3e-158   
ref|XP_003534836.1|  PREDICTED: pectinesterase/pectinesterase inh...    494   4e-158   
gb|KDO39972.1|  hypothetical protein CISIN_1g039111mg                   494   5e-158   
ref|XP_006649944.1|  PREDICTED: probable pectinesterase/pectinest...    492   1e-157   
gb|AEL79481.1|  pectin methylesterase-like protein                      491   2e-157   
dbj|BAC42959.2|  putative pectin methylesterase                         491   3e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006472135.1|  PREDICTED: probable pectinesterase/pectinest...    492   3e-157   
gb|KEH32301.1|  pectinesterase/pectinesterase inhibitor                 491   4e-157   
gb|KHG22352.1|  putative pectinesterase/pectinesterase inhibitor ...    490   4e-157   
ref|XP_003550542.1|  PREDICTED: pectinesterase/pectinesterase inh...    490   9e-157   
ref|NP_187339.2|  probable pectinesterase/pectinesterase inhibito...    489   1e-156   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA44942.1|  TPA: hypothetical protein ZEAMMB73_754551              489   2e-156   
gb|KHG02742.1|  putative pectinesterase/pectinesterase inhibitor ...    488   2e-156   
gb|AAF63815.1|  pectin methylesterase, putative                         487   6e-156   Arabidopsis thaliana [mouse-ear cress]
gb|KEH32300.1|  pectinesterase/pectinesterase inhibitor                 488   1e-155   
ref|XP_004487827.1|  PREDICTED: pectinesterase/pectinesterase inh...    488   2e-155   
ref|XP_004296866.1|  PREDICTED: probable pectinesterase/pectinest...    486   2e-155   
ref|XP_010674078.1|  PREDICTED: probable pectinesterase/pectinest...    499   4e-155   
ref|XP_007154304.1|  hypothetical protein PHAVU_003G107300g             485   7e-155   
ref|XP_010464272.1|  PREDICTED: probable pectinesterase/pectinest...    484   9e-155   
ref|XP_006407898.1|  hypothetical protein EUTSA_v10020401mg             484   1e-154   
ref|XP_003561714.1|  PREDICTED: probable pectinesterase/pectinest...    481   1e-153   
emb|CDY24663.1|  BnaA05g30620D                                          481   2e-153   
ref|XP_002882495.1|  pectinesterase family protein                      481   2e-153   
gb|EYU43978.1|  hypothetical protein MIMGU_mgv1a003697mg                481   3e-153   
ref|XP_009147125.1|  PREDICTED: probable pectinesterase/pectinest...    481   3e-153   
ref|XP_006433459.1|  hypothetical protein CICLE_v10000415mg             485   3e-153   
ref|XP_006433461.1|  hypothetical protein CICLE_v10000415mg             486   4e-153   
ref|XP_006433460.1|  hypothetical protein CICLE_v10000415mg             485   4e-153   
ref|XP_006433462.1|  hypothetical protein CICLE_v10000415mg             485   4e-153   
ref|NP_001049858.1|  Os03g0300500                                       479   1e-152   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007144961.1|  hypothetical protein PHAVU_007G198100g             479   1e-152   
ref|XP_004508195.1|  PREDICTED: pectinesterase/pectinesterase inh...    478   3e-152   
gb|EPS65387.1|  pectinesterase                                          476   1e-151   
ref|XP_010445248.1|  PREDICTED: probable pectinesterase/pectinest...    476   2e-151   
ref|XP_009124640.1|  PREDICTED: probable pectinesterase/pectinest...    474   6e-151   
emb|CAB65290.2|  pectin methyl-esterase PER                             475   1e-150   Medicago truncatula
gb|KEH37212.1|  pectinesterase/pectinesterase inhibitor                 475   2e-150   
emb|CDY05295.1|  BnaC05g45080D                                          473   3e-150   
ref|XP_010486213.1|  PREDICTED: probable pectinesterase/pectinest...    473   3e-150   
ref|XP_006299740.1|  hypothetical protein CARUB_v10015933mg             472   5e-150   
gb|KHN03341.1|  Pectinesterase/pectinesterase inhibitor                 471   7e-150   
dbj|BAK06954.1|  predicted protein                                      471   1e-149   
ref|XP_002528621.1|  Pectinesterase-4 precursor, putative               470   3e-149   Ricinus communis
gb|KHN20255.1|  Putative pectinesterase/pectinesterase inhibitor 21     466   5e-149   
gb|KHN04165.1|  Putative pectinesterase/pectinesterase inhibitor 28     460   6e-147   
ref|XP_007138937.1|  hypothetical protein PHAVU_009G250600g             463   1e-146   
emb|CDY34927.1|  BnaA01g32580D                                          462   1e-146   
ref|NP_001060715.1|  Os07g0691100                                       456   1e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007144962.1|  hypothetical protein PHAVU_007G198100g             455   1e-143   
gb|KEH37213.1|  pectinesterase/pectinesterase inhibitor                 454   4e-143   
emb|CAB65291.1|  pectin methyl-esterase PEF1                            454   5e-143   Medicago truncatula
ref|XP_009369703.1|  PREDICTED: pectinesterase-like                     453   6e-143   
ref|XP_004298254.1|  PREDICTED: putative pectinesterase/pectinest...    454   7e-143   
ref|XP_008390484.1|  PREDICTED: pectinesterase-like                     452   3e-142   
ref|XP_009359792.1|  PREDICTED: pectinesterase-like                     451   3e-142   
ref|XP_007222606.1|  hypothetical protein PRUPE_ppa003528mg             451   5e-142   
ref|XP_008223522.1|  PREDICTED: pectinesterase-like                     451   6e-142   
ref|XP_007149854.1|  hypothetical protein PHAVU_005G104100g             446   1e-141   
ref|XP_006828574.1|  hypothetical protein AMTR_s00129p00028250          450   2e-141   
gb|EAZ41174.1|  hypothetical protein OsJ_25671                          449   2e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027125.1|  PREDICTED: pectinesterase-like                     447   9e-141   
gb|KHN26532.1|  Pectinesterase/pectinesterase inhibitor                 450   1e-140   
gb|EAZ05229.1|  hypothetical protein OsI_27427                          447   2e-140   Oryza sativa Indica Group [Indian rice]
ref|XP_004958780.1|  PREDICTED: probable pectinesterase/pectinest...    445   7e-140   
gb|KDP43631.1|  hypothetical protein JCGZ_16918                         445   1e-139   
tpg|DAA64233.1|  TPA: pectinesterase                                    441   2e-138   
ref|XP_010694101.1|  PREDICTED: pectinesterase-like                     441   2e-138   
sp|Q42920.1|PME_MEDSA  RecName: Full=Pectinesterase/pectinesteras...    437   3e-138   Medicago sativa [alfalfa]
ref|XP_002461260.1|  hypothetical protein SORBIDRAFT_02g043780          440   9e-138   Sorghum bicolor [broomcorn]
sp|Q43043.1|PME_PETIN  RecName: Full=Pectinesterase; Short=PE; Al...    432   1e-137   Petunia integrifolia [violet-flowered petunia]
ref|XP_002445591.1|  hypothetical protein SORBIDRAFT_07g022100          441   2e-137   Sorghum bicolor [broomcorn]
ref|XP_006349952.1|  PREDICTED: probable pectinesterase/pectinest...    434   2e-137   
ref|XP_010271093.1|  PREDICTED: pectinesterase-like                     438   4e-137   
gb|EMS49616.1|  Putative pectinesterase/pectinesterase inhibitor 28     437   6e-137   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    438   7e-137   
gb|EMT00807.1|  Putative pectinesterase/pectinesterase inhibitor 28     437   8e-137   
ref|XP_006652375.1|  PREDICTED: probable pectinesterase/pectinest...    437   2e-136   
gb|KHN00313.1|  Putative pectinesterase/pectinesterase inhibitor 21     436   4e-136   
ref|XP_010656076.1|  PREDICTED: putative pectinesterase/pectinest...    436   4e-136   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    436   6e-136   
ref|XP_007051270.1|  Plant invertase/pectin methylesterase inhibi...    434   8e-136   
ref|XP_004975844.1|  PREDICTED: probable pectinesterase/pectinest...    434   8e-136   
ref|XP_003536855.1|  PREDICTED: probable pectinesterase/pectinest...    434   1e-135   
gb|EMT00224.1|  Putative pectinesterase/pectinesterase inhibitor 21     433   2e-135   
ref|XP_011078157.1|  PREDICTED: pectinesterase-like                     434   3e-135   
ref|XP_009405157.1|  PREDICTED: putative pectinesterase/pectinest...    436   3e-135   
gb|EYU28291.1|  hypothetical protein MIMGU_mgv1a003232mg                432   2e-134   
ref|XP_002275000.1|  PREDICTED: pectinesterase                          431   2e-134   
ref|XP_006658993.1|  PREDICTED: probable pectinesterase/pectinest...    431   2e-134   
ref|XP_003579894.1|  PREDICTED: pectinesterase-like                     431   2e-134   
ref|XP_002447958.1|  hypothetical protein SORBIDRAFT_06g018850          431   2e-134   
ref|XP_002528620.1|  Pectinesterase-4 precursor, putative               431   2e-134   
emb|CBI26012.3|  unnamed protein product                                431   2e-134   
ref|XP_009414337.1|  PREDICTED: pectinesterase-like                     431   3e-134   
ref|XP_010047427.1|  PREDICTED: putative pectinesterase/pectinest...    431   5e-134   
emb|CDY19737.1|  BnaA09g03900D                                          428   6e-134   
ref|XP_009134931.1|  PREDICTED: probable pectinesterase/pectinest...    430   6e-134   
ref|XP_008242146.1|  PREDICTED: pectinesterase-like                     431   7e-134   
ref|XP_009800039.1|  PREDICTED: pectinesterase-like                     430   7e-134   
ref|XP_009623162.1|  PREDICTED: pectinesterase-like                     430   9e-134   
gb|KHN00235.1|  Putative pectinesterase/pectinesterase inhibitor 21     429   1e-133   
ref|XP_003519736.1|  PREDICTED: probable pectinesterase/pectinest...    429   1e-133   
ref|XP_010932334.1|  PREDICTED: pectinesterase-like                     430   1e-133   
ref|NP_001052981.1|  Os04g0458900                                       428   2e-133   
gb|ACF79975.1|  unknown                                                 428   2e-133   
ref|XP_007203102.1|  hypothetical protein PRUPE_ppa023802mg             429   3e-133   
gb|EAY94388.1|  hypothetical protein OsI_16156                          428   3e-133   
emb|CAH67075.1|  OSIGBa0097P08.5                                        427   4e-133   
ref|XP_010687597.1|  PREDICTED: pectinesterase                          429   4e-133   
gb|EAY94391.1|  hypothetical protein OsI_16158                          427   5e-133   
emb|CDX74078.1|  BnaA03g29690D                                          427   7e-133   
ref|XP_003559753.1|  PREDICTED: pectinesterase-like                     427   7e-133   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    427   9e-133   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    427   1e-132   
ref|XP_007035986.1|  Plant invertase/pectin methylesterase inhibi...    427   1e-132   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          427   2e-132   
gb|EYU26212.1|  hypothetical protein MIMGU_mgv1a003546mg                426   2e-132   
ref|XP_002324181.2|  pectinesterase family protein                      425   1e-131   
ref|NP_001151322.1|  pectinesterase-1 precursor                         424   1e-131   
tpg|DAA37472.1|  TPA: hypothetical protein ZEAMMB73_350063              424   1e-131   
ref|XP_010091418.1|  putative pectinesterase/pectinesterase inhib...    424   1e-131   
gb|EPS66234.1|  hypothetical protein M569_08543                         423   5e-131   
ref|XP_009417804.1|  PREDICTED: pectinesterase-like                     422   1e-130   
ref|XP_008812392.1|  PREDICTED: pectinesterase-like                     422   2e-130   
emb|CDP19930.1|  unnamed protein product                                421   2e-130   
ref|XP_004298145.1|  PREDICTED: putative pectinesterase/pectinest...    420   4e-130   
ref|XP_008466382.1|  PREDICTED: pectinesterase-like isoform X2          419   4e-130   
ref|XP_009419138.1|  PREDICTED: pectinesterase-like                     419   5e-130   
ref|XP_008390620.1|  PREDICTED: probable pectinesterase/pectinest...    413   5e-130   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    420   6e-130   
ref|XP_004149498.1|  PREDICTED: probable pectinesterase/pectinest...    419   8e-130   
gb|ABZ89800.1|  pectin methylesterase-like protein                      419   9e-130   
gb|KGN49779.1|  hypothetical protein Csa_5G119700                       419   1e-129   
ref|XP_004229041.1|  PREDICTED: pectinesterase-like                     419   1e-129   
ref|XP_010107091.1|  putative pectinesterase/pectinesterase inhib...    420   1e-129   
ref|XP_008391931.1|  PREDICTED: putative pectinesterase/pectinest...    419   1e-129   
ref|XP_004508050.1|  PREDICTED: putative pectinesterase/pectinest...    419   2e-129   
ref|XP_009407600.1|  PREDICTED: pectinesterase-like                     417   3e-129   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               418   3e-129   
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                417   6e-129   
ref|XP_004495869.1|  PREDICTED: probable pectinesterase/pectinest...    417   8e-129   
ref|XP_010273801.1|  PREDICTED: pectinesterase                          417   9e-129   
ref|XP_010273980.1|  PREDICTED: putative pectinesterase/pectinest...    417   1e-128   
ref|XP_008337792.1|  PREDICTED: probable pectinesterase/pectinest...    417   1e-128   
ref|XP_002303172.1|  hypothetical protein POPTR_0003s01580g             415   2e-128   
ref|XP_010247575.1|  PREDICTED: probable pectinesterase/pectinest...    426   2e-128   
ref|XP_003550590.1|  PREDICTED: putative pectinesterase/pectinest...    416   2e-128   
ref|XP_008466391.1|  PREDICTED: pectinesterase-like isoform X3          415   2e-128   
ref|XP_007145107.1|  hypothetical protein PHAVU_007G210400g             415   2e-128   
ref|XP_003534837.2|  PREDICTED: pectinesterase/pectinesterase inh...    410   1e-127   
ref|XP_002519324.1|  Pectinesterase-3 precursor, putative               413   2e-127   
ref|XP_009359677.1|  PREDICTED: putative pectinesterase/pectinest...    414   2e-127   
ref|XP_010939847.1|  PREDICTED: pectinesterase-like                     412   2e-127   
gb|AFB77929.1|  pectin methylesterase                                   412   3e-127   
ref|XP_011005056.1|  PREDICTED: putative pectinesterase/pectinest...    413   3e-127   
gb|KHG08631.1|  Pectinesterase 3                                        412   3e-127   
gb|AFW03480.1|  pectin methylesterase 1                                 412   5e-127   
ref|XP_006338009.1|  PREDICTED: putative pectinesterase/pectinest...    412   7e-127   
dbj|BAA89480.1|  pectin methylesterase                                  412   1e-126   
gb|AFW03475.1|  pectin methylesterase 1                                 411   1e-126   
ref|XP_007012506.1|  Pectinesterase                                     410   3e-126   
ref|XP_006381543.1|  hypothetical protein POPTR_0006s13690g             410   5e-126   
ref|XP_011093900.1|  PREDICTED: pectinesterase-like                     409   7e-126   
ref|XP_008783344.1|  PREDICTED: pectinesterase-like                     408   8e-126   
ref|XP_008466374.1|  PREDICTED: pectinesterase-like isoform X1          408   9e-126   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     409   2e-125   
ref|XP_004956918.1|  PREDICTED: putative pectinesterase/pectinest...    408   7e-125   
ref|XP_003627458.1|  Pectinesterase                                     406   8e-125   
gb|ABQ42392.1|  pectin methylesterase-like protein                      406   1e-124   
ref|XP_010038523.1|  PREDICTED: pectinesterase-like                     404   2e-124   
ref|XP_003632385.1|  PREDICTED: pectinesterase-like                     404   3e-124   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    404   5e-124   
emb|CAB95025.1|  pectin methylesterase                                  404   5e-124   
ref|XP_008800480.1|  PREDICTED: probable pectinesterase/pectinest...    403   6e-124   
ref|NP_001063246.1|  Os09g0433700                                       405   7e-124   
ref|XP_002275819.3|  PREDICTED: pectinesterase-like                     403   9e-124   
ref|XP_010915944.1|  PREDICTED: probable pectinesterase/pectinest...    404   9e-124   
ref|XP_007219746.1|  hypothetical protein PRUPE_ppa024156mg             403   1e-123   
ref|XP_008231878.1|  PREDICTED: probable pectinesterase/pectinest...    402   1e-123   
ref|XP_011008693.1|  PREDICTED: pectinesterase-like                     402   1e-123   
dbj|BAK05856.1|  predicted protein                                      403   2e-123   
gb|EYU25006.1|  hypothetical protein MIMGU_mgv1a022121mg                402   2e-123   
ref|XP_002298186.1|  hypothetical protein POPTR_0001s21630g             402   2e-123   
gb|KHG23523.1|  putative pectinesterase/pectinesterase inhibitor ...    401   2e-123   
ref|XP_004151535.1|  PREDICTED: putative pectinesterase/pectinest...    402   2e-123   
ref|XP_004156120.1|  PREDICTED: putative pectinesterase/pectinest...    402   4e-123   
gb|EAZ44838.1|  hypothetical protein OsJ_29475                          405   4e-123   
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          401   4e-123   
gb|ACN40984.1|  unknown                                                 402   5e-123   
ref|XP_006578909.1|  PREDICTED: probable pectinesterase/pectinest...    401   5e-123   
ref|XP_009762395.1|  PREDICTED: pectinesterase/pectinesterase inh...    402   5e-123   
ref|XP_006661265.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    402   6e-123   
ref|XP_009606552.1|  PREDICTED: pectinesterase/pectinesterase inh...    401   6e-123   
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    401   7e-123   
gb|EPS69324.1|  hypothetical protein M569_05439                         400   8e-123   
ref|XP_008466403.1|  PREDICTED: pectinesterase-like                     400   8e-123   
ref|XP_008348472.1|  PREDICTED: pectinesterase-like                     401   8e-123   
ref|XP_010656074.1|  PREDICTED: pectinesterase-like                     400   8e-123   
ref|XP_007024770.1|  Pectin methylesterase 3 isoform 1                  400   1e-122   
gb|AFQ23194.1|  pectin methylesterase                                   400   1e-122   
ref|XP_011046142.1|  PREDICTED: pectinesterase-like                     399   1e-122   
ref|XP_002265171.1|  PREDICTED: pectinesterase                          401   1e-122   
ref|XP_007011069.1|  Root hair specific 12                              401   2e-122   
ref|XP_003609936.1|  Pectinesterase                                     400   2e-122   
ref|XP_004149499.1|  PREDICTED: putative pectinesterase/pectinest...    399   2e-122   
ref|NP_001132793.1|  pectinesterase                                     401   2e-122   
ref|NP_001274969.1|  pectin methyl esterase                             399   3e-122   
ref|XP_010543643.1|  PREDICTED: probable pectinesterase/pectinest...    399   3e-122   
gb|AAO85706.1|  pectin methyl-esterase                                  399   6e-122   
ref|XP_007136533.1|  hypothetical protein PHAVU_009G053000g             398   7e-122   
ref|XP_007148762.1|  hypothetical protein PHAVU_005G012000g             398   8e-122   
ref|XP_009386320.1|  PREDICTED: pectinesterase-like                     399   8e-122   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     399   1e-121   
ref|XP_009601611.1|  PREDICTED: pectinesterase-like                     398   1e-121   
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    398   1e-121   
ref|NP_001169525.1|  pectinesterase                                     399   1e-121   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         397   2e-121   
ref|XP_011031815.1|  PREDICTED: pectinesterase-like                     397   2e-121   
ref|XP_003526711.1|  PREDICTED: probable pectinesterase/pectinest...    397   2e-121   
gb|AFI23411.1|  pectin methylesterase                                   397   2e-121   
gb|KHN14164.1|  Putative pectinesterase/pectinesterase inhibitor 28     396   3e-121   
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    397   3e-121   
ref|XP_010937248.1|  PREDICTED: pectinesterase-like                     396   3e-121   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     397   4e-121   
ref|XP_003521616.1|  PREDICTED: pectinesterase 4-like                   395   5e-121   
ref|XP_007163235.1|  hypothetical protein PHAVU_001G217300g             396   5e-121   
ref|XP_006388348.1|  hypothetical protein POPTR_0214s00200g             395   7e-121   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    395   9e-121   
ref|XP_002304257.2|  pectinesterase family protein                      395   1e-120   
ref|XP_010261668.1|  PREDICTED: pectinesterase-like                     394   2e-120   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     394   2e-120   
ref|XP_008228105.1|  PREDICTED: pectinesterase                          395   2e-120   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    394   2e-120   
ref|XP_006307088.1|  hypothetical protein CARUB_v10008673mg             394   2e-120   
ref|XP_003528739.1|  PREDICTED: pectinesterase/pectinesterase inh...    395   3e-120   
emb|CAC01624.1|  putative pectin methylesterase                         394   3e-120   
ref|XP_003598363.1|  Pectinesterase                                     394   3e-120   
gb|EYU25005.1|  hypothetical protein MIMGU_mgv1a003670mg                393   3e-120   
ref|XP_002304074.1|  hypothetical protein POPTR_0003s01550g             393   4e-120   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             393   5e-120   
ref|XP_007154534.1|  hypothetical protein PHAVU_003G126700g             394   5e-120   
ref|XP_003591319.1|  Pectinesterase                                     393   5e-120   
ref|NP_001233857.1|  pectinesterase/pectinesterase inhibitor U1 p...    393   6e-120   
ref|XP_006289946.1|  hypothetical protein CARUB_v10003572mg             393   6e-120   
ref|XP_009355064.1|  PREDICTED: putative pectinesterase/pectinest...    393   6e-120   
ref|XP_008375414.1|  PREDICTED: putative pectinesterase/pectinest...    392   8e-120   
ref|XP_011084508.1|  PREDICTED: probable pectinesterase/pectinest...    393   8e-120   
ref|XP_007163236.1|  hypothetical protein PHAVU_001G217400g             392   9e-120   
ref|XP_008356804.1|  PREDICTED: putative pectinesterase/pectinest...    392   1e-119   
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    392   1e-119   
ref|XP_009339254.1|  PREDICTED: putative pectinesterase/pectinest...    392   2e-119   
ref|XP_010434900.1|  PREDICTED: putative pectinesterase/pectinest...    395   2e-119   
gb|KHN04166.1|  Putative pectinesterase/pectinesterase inhibitor 21     385   3e-119   
ref|XP_008783207.1|  PREDICTED: probable pectinesterase/pectinest...    392   3e-119   
ref|XP_002871126.1|  hypothetical protein ARALYDRAFT_487283             390   4e-119   
ref|NP_196115.1|  putative pectinesterase/pectinesterase inhibito...    390   4e-119   
gb|KDP40627.1|  hypothetical protein JCGZ_24626                         391   4e-119   
ref|XP_009767827.1|  PREDICTED: pectinesterase-like                     391   6e-119   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    390   6e-119   
ref|XP_002462429.1|  hypothetical protein SORBIDRAFT_02g025460          392   6e-119   
gb|ABJ99595.1|  pectinesterase inhibitor                                390   7e-119   
dbj|BAF42038.1|  pectin methylesterase 1                                391   7e-119   
ref|XP_004146219.1|  PREDICTED: probable pectinesterase/pectinest...    391   8e-119   
ref|XP_011076457.1|  PREDICTED: probable pectinesterase/pectinest...    390   8e-119   
ref|XP_009357300.1|  PREDICTED: probable pectinesterase/pectinest...    391   9e-119   
ref|XP_011101135.1|  PREDICTED: probable pectinesterase/pectinest...    389   9e-119   
ref|XP_006828609.1|  hypothetical protein AMTR_s00129p00068690          390   1e-118   
ref|XP_009768722.1|  PREDICTED: probable pectinesterase/pectinest...    390   1e-118   
ref|XP_007217169.1|  hypothetical protein PRUPE_ppa003285mg             390   1e-118   
ref|XP_010423512.1|  PREDICTED: probable pectinesterase/pectinest...    389   1e-118   
ref|XP_011076284.1|  PREDICTED: probable pectinesterase/pectinest...    388   3e-118   
gb|AAO42295.1|  unknown protein                                         388   4e-118   
ref|XP_010558236.1|  PREDICTED: probable pectinesterase/pectinest...    387   5e-118   
ref|XP_010449868.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    391   6e-118   
ref|XP_006599763.1|  PREDICTED: pectinesterase/pectinesterase inh...    385   6e-118   
ref|XP_009604014.1|  PREDICTED: probable pectinesterase/pectinest...    387   6e-118   
ref|XP_010685210.1|  PREDICTED: pectinesterase-like                     388   7e-118   
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    388   8e-118   
ref|XP_009122673.1|  PREDICTED: putative pectinesterase/pectinest...    387   8e-118   
ref|XP_008376726.1|  PREDICTED: probable pectinesterase/pectinest...    389   8e-118   
ref|XP_008806757.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    387   8e-118   
ref|XP_007139063.1|  hypothetical protein PHAVU_009G261700g             387   9e-118   
ref|NP_001275859.1|  pectinesterase 1 precursor                         387   1e-117   
ref|XP_010491027.1|  PREDICTED: probable pectinesterase/pectinest...    387   1e-117   
ref|XP_007141001.1|  hypothetical protein PHAVU_008G158900g             388   1e-117   
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             387   1e-117   
ref|XP_011007987.1|  PREDICTED: pectinesterase-like                     386   1e-117   
ref|XP_009773400.1|  PREDICTED: pectinesterase 1                        386   2e-117   
gb|AAC50023.1|  ATPME2 precursor                                        386   2e-117   
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    387   2e-117   
ref|NP_001289259.1|  probable pectinesterase/pectinesterase inhib...    387   2e-117   
ref|XP_010440226.1|  PREDICTED: putative pectinesterase/pectinest...    390   3e-117   
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    387   3e-117   
ref|XP_010462289.1|  PREDICTED: pectinesterase 2                        386   3e-117   
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                        386   3e-117   
sp|O04886.1|PME1_CITSI  RecName: Full=Pectinesterase 1; Short=PE ...    386   4e-117   
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     385   4e-117   
ref|XP_004141734.1|  PREDICTED: pectinesterase 3-like                   386   4e-117   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    385   6e-117   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               385   6e-117   
ref|XP_010049073.1|  PREDICTED: probable pectinesterase/pectinest...    385   7e-117   
emb|CDX80932.1|  BnaC03g01860D                                          385   7e-117   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     384   7e-117   
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    385   7e-117   
gb|ABJ99594.1|  pectinesterase inhibitor                                385   7e-117   
ref|XP_010925933.1|  PREDICTED: probable pectinesterase/pectinest...    385   8e-117   
ref|XP_004308181.1|  PREDICTED: probable pectinesterase/pectinest...    384   8e-117   
ref|XP_004172115.1|  PREDICTED: pectinesterase 3-like                   385   8e-117   



>ref|XP_009615584.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=557

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/522 (63%), Positives = 416/522 (80%), Gaps = 11/522 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +IST++KSVK +C PTDYKE CE+SLA AK+T DPKELIKVAF+ T+ +I +A+  + L+
Sbjct  47    QISTSTKSVKAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLI  106

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +EA KDPRT DAL TC+ LL  SIDDL RSF+KV  FD+ ++K+YT+DLK W+S +IT Q
Sbjct  107   QEAAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQ  166

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             ETC+DAFENTTG+TGEKMK LLKTA EL+SNGLAM+T F E+L +L +PG++  RRLLT 
Sbjct  167   ETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVTSFGEMLTNLHVPGIS--RRLLTT  224

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             +++          FV+A +RRLL    A  K + VVA+DGSGQYK++ EAL+AVP KN++
Sbjct  225   DSE------YTSAFVEAGSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQ  276

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
             T VI IKAG Y E V++PR +  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDG
Sbjct  277   TYVILIKAGEYKEMVDIPRSITNVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDG  336

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F+AR+IGFEN+AGA KHQAVALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DCTI+GT
Sbjct  337   FVARDIGFENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGT  396

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG+A VVFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  +A
Sbjct  397   IDFIFGDASVVFQNCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTSA  456

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
              PP K +LGRPWKE+SRT+I+ ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ 
Sbjct  457   QPPIKAYLGRPWKEYSRTIIIQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANI  516

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             DKRVKW GYKRNISP+ A+++ P  F+  D  W+ +  I ++
Sbjct  517   DKRVKWGGYKRNISPQEAEKYAPAHFIDQD-NWIKKTGISYA  557



>ref|XP_009761202.1| PREDICTED: pectinesterase [Nicotiana sylvestris]
Length=556

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/521 (63%), Positives = 413/521 (79%), Gaps = 11/521 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +IST++KSV+ +C PTDYKE CE+SLA AK+T DPKELIKVAF+ T+ +I +A+  + L+
Sbjct  47    QISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAMKNTSLI  106

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +EA KDPRT DAL TC+ LL  SIDDL RSF+KV  FD+ ++K+YT+DLK W+S +IT Q
Sbjct  107   QEAAKDPRTKDALQTCESLLNVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQ  166

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             ETC+DAFENTTG+TGEKMK LLKTA EL+SNGLAM++ F E+L +L IPG++  RRLLT 
Sbjct  167   ETCLDAFENTTGETGEKMKKLLKTAGELTSNGLAMVSSFGEMLTNLHIPGIS--RRLLTT  224

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             +++          FV+A +RRLL    A  K + VVA+DGSGQYK++ EAL+AVP KN++
Sbjct  225   DSE------YTSAFVEAGSRRLLQVSGA--KPNAVVAQDGSGQYKTIKEALKAVPPKNNQ  276

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
             T VI IKAG Y E V++PR M  +VF+GEGPTKT+ITG+++  DG GTYHTATVA+ GDG
Sbjct  277   TYVILIKAGEYKEMVDIPRSMINVVFIGEGPTKTKITGNKNFADGTGTYHTATVAVNGDG  336

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F+AR+IGFEN+AGA KHQAVALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DCTI+GT
Sbjct  337   FVARDIGFENTAGAKKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCTITGT  396

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG+A  VFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVLQ+C+I AEPA  + 
Sbjct  397   IDFIFGDASAVFQNCKMIVRKPGDNQACMVTAQGRKDHRGVGAIVLQNCDIRAEPAFTST  456

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
              PP K +LGRPWKE+SRT+IM ++ID  + PEGW+ W G   L+T +YAEYQNRGPGA+ 
Sbjct  457   QPPIKAYLGRPWKEYSRTIIMQSYIDAFIDPEGWAPWNGNFALNTLFYAEYQNRGPGANI  516

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             DKRVKW GYKRNISP+ A+++ P  F+  D  W+ +  I +
Sbjct  517   DKRVKWGGYKRNISPQEAEKYAPAHFIDQD-NWIKKTGISY  556



>ref|XP_009775925.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=546

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/566 (61%), Positives = 421/566 (74%), Gaps = 33/566 (6%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvs--------vgssggGEISTASKSVKEICAPTDYKETC  3042
             KK+A+  VASI LVACVVAA +S          +S    +ST++KSV+ IC PTDYKETC
Sbjct  4     KKLAIASVASILLVACVVAAAISFTKKNEDKSSNSTDSRLSTSTKSVQAICQPTDYKETC  63

Query  3041  ERSLAGAKDTDDPKELIKVAFKVTVENITDAISKS-ELLKEADKDPRTSDALDTCKELLK  2865
             E+SLA AK+ +DPKELIKVAF  T+ +++D I  S  L+ EA KDPRT DAL TC+ L+ 
Sbjct  64    EKSLANAKNINDPKELIKVAFNATINDLSDVIKNSASLIDEAKKDPRTKDALQTCQGLVD  123

Query  2864  NSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +IDDL RSF+K + F++ ++K+YT+DLK WLS AIT QETC+DAFENTTGDTGEKMK L
Sbjct  124   VAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKMKKL  183

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LK A EL+SNGLAM++ F E++ +L IPGVN  RRLL A                    R
Sbjct  184   LKNAGELTSNGLAMVSSFGEVVANLNIPGVN--RRLLDAH------------------ER  223

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             +L+    S+K ++VVA DGSGQYKS+ EAL AVP  N +  VIFIKAGVYNE VE+PRKM
Sbjct  224   MLSD---SLKPNVVVAIDGSGQYKSINEALNAVPKMNTQRYVIFIKAGVYNEHVEIPRKM  280

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             N IVF+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG  KHQAVA
Sbjct  281   NNIVFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVA  340

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRVS DM IFHNC ID YQDTLY HSYRQF+RDCTI+GT+DFIFG+A  VFQNCKMIVRK
Sbjct  341   LRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCKMIVRK  400

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LGRPWKEFSRT+IM
Sbjct  401   PMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEQGFLAAQPPIKAYLGRPWKEFSRTIIM  460

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY++ I+P+VA QF
Sbjct  461   QSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQF  520

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             TPG F+M DE W+  + +P+ PG ++
Sbjct  521   TPGVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_009599026.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=546

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/566 (61%), Positives = 421/566 (74%), Gaps = 33/566 (6%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvs--------vgssggGEISTASKSVKEICAPTDYKETC  3042
             KK+A+  VASI LVACVVAA +S          +S    +ST++KSV+ IC PTDYKETC
Sbjct  4     KKLAIASVASILLVACVVAAAISFTKRNEDHSSNSTDSHLSTSTKSVQAICQPTDYKETC  63

Query  3041  ERSLAGAKDTDDPKELIKVAFKVTVENITDAISKS-ELLKEADKDPRTSDALDTCKELLK  2865
             E+SLA AK+ +DPKELIKVAF  T+ ++++ I  S  L+ EA KDPRT DAL TC+ LL 
Sbjct  64    EKSLANAKNINDPKELIKVAFNATINDLSNVIKNSASLIDEAKKDPRTKDALQTCQGLLD  123

Query  2864  NSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              +IDDL RSF+K + F++ ++K+YT+DLK WLS AIT QETC+DAFENTTGDTGEKMK L
Sbjct  124   VAIDDLTRSFDKFDKFEVSKIKDYTDDLKTWLSSAITYQETCLDAFENTTGDTGEKMKKL  183

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRR  2505
             LK A EL+SNGLAM++ F E++ +L IPGVN  RRLL A                    R
Sbjct  184   LKNAGELTSNGLAMVSSFGEVVANLNIPGVN--RRLLDAH------------------ER  223

Query  2504  LLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKM  2325
             +L+    S+K +++VA DGSGQYKS+ EAL AVP KN +  VIFIKAGVYNE VE+PRKM
Sbjct  224   MLSD---SLKPNVIVAIDGSGQYKSINEALNAVPKKNTQKYVIFIKAGVYNEHVEIPRKM  280

Query  2324  NKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVA  2145
             N I+F+GEGPTKT+ITGS +  DG GT+ TAT A+ GD F+A++IGFEN+AG  KHQAVA
Sbjct  281   NNIIFIGEGPTKTKITGSLNYADGTGTFKTATFAVNGDYFMAKDIGFENTAGPVKHQAVA  340

Query  2144  LRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRK  1965
             LRVS DM IFHNC ID YQDTLY HSYRQF+RDCTI+GT+DFIFG+A  VFQNC+MIVRK
Sbjct  341   LRVSGDMAIFHNCQIDGYQDTLYVHSYRQFFRDCTITGTIDFIFGDAAAVFQNCQMIVRK  400

Query  1964  PMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIM  1785
             PM NQ CMVTAQGRKD RG   IV+Q+C+I AE    AA PP K +LGRPWKEFSRT+IM
Sbjct  401   PMDNQACMVTAQGRKDHRGVGGIVMQNCQIKAEHDFLAAQPPIKAYLGRPWKEFSRTIIM  460

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGWS W G   LDT +YAEYQNRGPG+ T  RV WKGY++ I+P+VA QF
Sbjct  461   QSEIDGFIAPEGWSPWVGNFALDTLFYAEYQNRGPGSITYSRVNWKGYQKTIAPQVAAQF  520

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             TP  F+M DE W+  + +P+ PG ++
Sbjct  521   TPAVFIMGDE-WVKLSGVPYEPGMIR  545



>ref|XP_006342830.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=552

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/520 (62%), Positives = 406/520 (78%), Gaps = 14/520 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +ST++KSVK IC PTDYKETCE+SLA AK+T DPKELIKVAF+ T+ +I +AI  ++L+K
Sbjct  47    VSTSTKSVKAICQPTDYKETCEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIK  106

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A KDPRT +AL TC+ LL  SIDDL RSF+KV  FD+ ++K+YT+DLK W+S +IT QE
Sbjct  107   DAAKDPRTKEALHTCEGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQE  166

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+DAF+NT+GDTGEKMK LLKTA EL+SNGLAMIT F ++L S+ IPG++  RRLL  +
Sbjct  167   TCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTSMNIPGIS--RRLLAND  224

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                      +  FV+  +RRLL    +S K + VVA DGSGQ+K++ EAL+ VP KN + 
Sbjct  225   ---------YTSFVEDGSRRLLQV--SSTKPNAVVALDGSGQFKTIKEALKGVPPKNIQP  273

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI IKAG Y E V+VPR +  +VF+GEGPTKT+ITG+++  DG  T+HTATVA+ GDGF
Sbjct  274   YVILIKAGEYKEIVDVPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTATVAVNGDGF  333

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +AR+IGFEN+AGA KHQAVALRVSAD  +F+NC+ID YQDTLYTHSYRQFY+DC+ISGT+
Sbjct  334   VARDIGFENTAGAMKHQAVALRVSADKAVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTI  393

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG+A  VFQNCKMIVRKP  NQ CMVTAQGRKD RG  AIVL++CEI AEPA  +  
Sbjct  394   DFIFGDASAVFQNCKMIVRKPGNNQACMVTAQGRKDHRGVGAIVLRNCEIRAEPAFTSTQ  453

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP K +LGRPWKE+SRT+IM T ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TD
Sbjct  454   PPIKAYLGRPWKEYSRTIIMQTQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTD  513

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             KRVKW GYKRNISP+ A+++ P  F+  D  W+ +  I +
Sbjct  514   KRVKWAGYKRNISPQEAEKYAPNIFIDQDS-WIKKTGISY  552



>emb|CDO98832.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/572 (58%), Positives = 420/572 (73%), Gaps = 23/572 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGE----------ISTASKSVKEIC  3069
             MGS E  KK A+ GV+SI LVA VV          G E          +ST+SKSV+ +C
Sbjct  1     MGS-EGKKKAAILGVSSILLVAAVVGTVTYSVGRHGTETATSGGGSDQVSTSSKSVESVC  59

Query  3068  APTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDAL  2889
                DYK+TCE+SL+GAK+T DP+ELIK+AF   V+NI   I  S LL+ A KDPRT  AL
Sbjct  60    KHVDYKQTCEQSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQAL  119

Query  2888  DTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
             +TCK  L  SI+DL+RSFE V  FD+ ++ +Y  DLK WLS A T QETC+DAFENTTGD
Sbjct  120   ETCKYALNTSIEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTGD  179

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPG  2529
             TGE+MK LLKTA EL+SNGLAM+T  +E+L +  I G  FKRRL+++  +        P 
Sbjct  180   TGEQMKKLLKTAGELTSNGLAMVTDISEVLTNFNIQG--FKRRLMSSSVE--------PD  229

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             FVDA  R+L+    AS+K + VVA+DGSGQ+KS++ A+  VP KN++T VIFIKAG+Y E
Sbjct  230   FVDATARKLMAASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKE  289

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              V +P+ +N IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAG
Sbjct  290   YVTLPKHVNGIVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAG  349

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRVS D TI +NC IDAYQDTLYTH+YRQ+YR+CTISGT+DFIFG+A  VFQ
Sbjct  350   AVKHQAVALRVSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDASAVFQ  409

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             +CKM+VRKPM NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K +LGRPWK
Sbjct  410   DCKMVVRKPMENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWK  469

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             EFSRT+IM T ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+WKG K+ I
Sbjct  470   EFSRTIIMQTSIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-I  528

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +P++A+ FTPG ++  D  W+  + +P++PG 
Sbjct  529   TPQIAQSFTPGAYIQGDA-WITASGVPYAPGM  559



>ref|XP_004229265.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/520 (60%), Positives = 405/520 (78%), Gaps = 14/520 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             IST++KSV+ +C PTDYKE CE+SLA AK+T DPKELIKVAF+ T+ +I +AI  ++L+K
Sbjct  43    ISTSTKSVQAMCQPTDYKEACEKSLASAKNTSDPKELIKVAFESTITDIKNAIKNTDLIK  102

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A  DPRT +AL+TC  LL  SIDDL RSF+KV  FD+ ++K+YT+DLK W+S +IT QE
Sbjct  103   DAANDPRTKEALNTCDGLLDVSIDDLRRSFDKVGTFDINKIKDYTDDLKTWISASITYQE  162

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+DAF+NT+GDTGEKMK LLKTA EL+SNGLAMIT F ++L ++ IPG++  RRLL  +
Sbjct  163   TCLDAFQNTSGDTGEKMKKLLKTAGELTSNGLAMITSFGDMLTNMNIPGIS--RRLLADD  220

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                      +  FV+  +RRLL    ++ K + VVA DGSGQ+K++ EAL+ VP KN + 
Sbjct  221   ---------YTSFVEDGSRRLLQV--SNTKPNAVVALDGSGQFKTIKEALKGVPPKNIQP  269

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI IKAG Y E V++PR +  +VF+GEGPTKT+ITG+++  DG  T+HT+TVA+ GDGF
Sbjct  270   YVILIKAGEYKEMVDIPRGVTNVVFIGEGPTKTKITGNKNYADGTATFHTSTVAVNGDGF  329

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +A++IGFEN+AGA KHQAVALRVSAD T+F+NC+ID YQDTLYTHSYRQFY+DC+ISGT+
Sbjct  330   VAKDIGFENTAGAMKHQAVALRVSADKTVFYNCNIDGYQDTLYTHSYRQFYKDCSISGTI  389

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG+A  VFQNCKMIVRKP ANQ CMVTAQGRKD RG  AI+L++CEI AEPA     
Sbjct  390   DFIFGDASAVFQNCKMIVRKPGANQACMVTAQGRKDHRGVGAIILRNCEISAEPAFINTQ  449

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP K +LGRPWKE+SRT+IM + ID  + PEGW+ W G   L+T +YAEYQNRGPGA+TD
Sbjct  450   PPIKAYLGRPWKEYSRTIIMQSQIDAFIDPEGWAPWNGNFALNTLYYAEYQNRGPGANTD  509

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +RVKW GYK++ISP+ A+++ P  F+  D  W+ +  I +
Sbjct  510   RRVKWAGYKKSISPQEAEKYAPNIFIDQDS-WIKKTGISY  548



>emb|CDO98833.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/562 (58%), Positives = 414/562 (74%), Gaps = 19/562 (3%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCE  3039
             MGS E  KK A+ GV+SI LVA VV             +ST+SKSV+ +C   DYK+TCE
Sbjct  1     MGS-EGKKKAAILGVSSILLVAAVVGTVTYS------VVSTSSKSVESVCKHVDYKQTCE  53

Query  3038  RSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNS  2859
             +SL+GAK+T DP+ELIK+AF   V+NI   I  S LL+ A KDPRT  AL+TCK  L  S
Sbjct  54    QSLSGAKNTSDPRELIKLAFTAAVDNIASVIQNSTLLQNAAKDPRTHQALETCKYALNTS  113

Query  2858  IDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             I+DL+RSFE V  FD+ ++ +Y  DLK WLS A T QETC+DAFENTTGDTGE+MK LLK
Sbjct  114   IEDLQRSFETVGTFDINKIDDYVADLKTWLSAAGTFQETCLDAFENTTGDTGEQMKKLLK  173

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             TA EL+SNGLAM+T  +E+L +  I G  FKRRL+++  +        P FVDA  R+L+
Sbjct  174   TAGELTSNGLAMVTDISEVLTNFNIQG--FKRRLMSSSVE--------PDFVDATARKLM  223

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 AS+K + VVA+DGSGQ+KS++ A+  VP KN++T VIFIKAG+Y E V +P+ +N 
Sbjct  224   AASTASLKPNAVVAQDGSGQFKSIMAAVNTVPKKNNQTFVIFIKAGIYKEYVTLPKHVNG  283

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             IV VGEGPTKT+ITG+++  DG+GT+ T T+++ GD  I +++G ENSAGA KHQAVALR
Sbjct  284   IVLVGEGPTKTKITGNKNFVDGVGTFQTPTLSVNGDATILKDLGIENSAGAVKHQAVALR  343

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             VS D TI +NC IDAYQDTLYTH+YRQ+YR+CTISGT+DFIFG+   VFQ CKM+VRKPM
Sbjct  344   VSGDRTIVYNCQIDAYQDTLYTHTYRQYYRNCTISGTIDFIFGDGSAVFQGCKMVVRKPM  403

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ CMVTAQGRK+RRG  AIVLQ+C+I+A+PA  A  PP K +LGRPWKEFSRT+IM T
Sbjct  404   ENQGCMVTAQGRKERRGIGAIVLQNCQIVADPAFLAVQPPIKAYLGRPWKEFSRTIIMQT  463

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              ID  + PEGWS W G   +DTC+YAEY NRGPGA T KRV+WKG K+ I+P++A+ FTP
Sbjct  464   SIDGFIAPEGWSPWMGNFGMDTCYYAEYNNRGPGADTSKRVQWKGIKK-ITPQIAQSFTP  522

Query  1598  GPFLMADEQWLGRAQIPFSPGF  1533
             G ++  D  W+  + + ++ G 
Sbjct  523   GAYIQGDA-WITASGVTYASGM  543



>emb|CDO98834.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/569 (56%), Positives = 424/569 (75%), Gaps = 21/569 (4%)
 Frame = -1

Query  3203  QNKKVAVTGVASIFLvacvvaatvsvgssggGE----------ISTASKSVKEICAPTDY  3054
             +NKK+A+  V+SI LVA VV       S    E          ++++SK+++ +C  TDY
Sbjct  8     RNKKLAILSVSSILLVAAVVGVVTYGSSHKNVESPSAGADATPVTSSSKAIQSLCQHTDY  67

Query  3053  KETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             KETCE SL+ AK+T DP+EL+KVAF+ TV+N+ + I  S LL+ A KDPRTSDALD CKE
Sbjct  68    KETCEDSLSKAKNTSDPRELVKVAFQTTVDNLGEVIKNSSLLQNAAKDPRTSDALDICKE  127

Query  2873  LLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L  +IDD +RSF+KV++FD+ ++ +Y  DLK WLSGAIT Q+TC+DAFENTTGDTGEKM
Sbjct  128   VLNTAIDDFKRSFDKVQDFDISKLDDYAADLKTWLSGAITLQQTCLDAFENTTGDTGEKM  187

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K L++TA +LSSNGLA++T F+E+L +L IPG++  RRLL+AE +  ++E     FV+  
Sbjct  188   KQLMRTAVQLSSNGLAIVTDFSEILGTLAIPGLS--RRLLSAEKRKLDEE----NFVE--  239

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              RRLL  DP+SIK + ++A+DGSG +K++ +A+  VP  N    VI IKAGVY E + +P
Sbjct  240   -RRLLQVDPSSIKPNAIIAQDGSGTFKTIRDAINTVPKNNTTPFVILIKAGVYKEVILIP  298

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             R++N +V +GEGP  T+IT +++  DGIGT+HTATVAI GDG I R+IG ENSAG  KHQ
Sbjct  299   RRINNVVIMGEGPNVTKITANKNYVDGIGTFHTATVAINGDGCILRDIGIENSAGPEKHQ  358

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRVS D TI +NC ID YQDTLY+H+YRQFYRD TISGT+DFIFG+A  VFQNCK+I
Sbjct  359   AVALRVSGDRTIVYNCQIDGYQDTLYSHTYRQFYRDTTISGTIDFIFGDAAAVFQNCKLI  418

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR P+ NQ CMVTAQGR + R   AIVLQ+C I+A+PAL +A+PP + +LGRPWKE+SRT
Sbjct  419   VRMPLVNQACMVTAQGRNNSRSTGAIVLQNCSIVADPALLSADPPVRAYLGRPWKEYSRT  478

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + ID  + P+GWS W GT  L T +YAEYQNRGPGA+TD+RV W G + +I+P+VA
Sbjct  479   IIMQSNIDGFIDPQGWSPWMGTFGLKTLYYAEYQNRGPGANTDQRVDWPGIQ-HITPQVA  537

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + FTPG + + D  W+  +  P+ PG L+
Sbjct  538   ESFTPGKYFIGDS-WITASGFPYVPGMLK  565



>ref|XP_004239802.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=554

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/530 (58%), Positives = 393/530 (74%), Gaps = 23/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +IST++KSV  IC  TDYKETC +SLA A +T+DPK+L+KVAF  T+ ++ D I  S LL
Sbjct  44    QISTSAKSVNVICQQTDYKETCVKSLAKANNTNDPKDLLKVAFGATINDLFDVIKNSALL  103

Query  2927  -KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
               EA KDPRT DAL TC +LL  +IDD+ RSF+++  FD  + K+Y +DLK WLS +IT 
Sbjct  104   INEASKDPRTKDALKTCGDLLDVAIDDVRRSFDEIGVFDATKFKDYADDLKTWLSASITY  163

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQ--SLEIPGVNFKRRL  2577
             QETC+DAFENTTG+TGEKM+ LLK A EL+SN LAM++ F ++L   +L+IPGVN  RRL
Sbjct  164   QETCLDAFENTTGETGEKMRKLLKNAGELTSNSLAMVSSFGQVLTDLNLKIPGVN--RRL  221

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             L A                   R L   +   +K ++VVA DGSGQYKS+ EALRAVP K
Sbjct  222   LNAHE-----------------RMLNEVNSNGLKPNVVVAIDGSGQYKSINEALRAVPKK  264

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             N +  VIFIKAG+Y E +++P+KMN IVF+GEGPTKT+ITG+++  DGIGT+ TATVAI 
Sbjct  265   NTQKFVIFIKAGIYKEYIDIPKKMNHIVFIGEGPTKTKITGNKNFADGIGTFQTATVAIN  324

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F+A++IG EN+AGA KHQAVALRVS D  IFHNC  D YQDTLY H+YRQF+RDCTI
Sbjct  325   GDNFMAKDIGIENTAGAIKHQAVALRVSGDKAIFHNCQFDGYQDTLYVHAYRQFFRDCTI  384

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFG+A  VFQ+CKMIVRKPMANQ CMVTAQGRKDRRG  AIV+Q+CEI AE   
Sbjct  385   TGTIDFIFGDASSVFQSCKMIVRKPMANQACMVTAQGRKDRRGVGAIVMQNCEIRAEHEF  444

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              +  P  K +LGRPWKEFSRT+IM + ID  + P+GWS+W G   L T +YAEY+NRG G
Sbjct  445   ISTQPTIKAYLGRPWKEFSRTIIMQSLIDGFIDPQGWSVWAGDFALHTLFYAEYENRGIG  504

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             A+++ RV W+GYK+NI  E+A  F PG F++ADE W+  + +P+  G ++
Sbjct  505   ANSNNRVNWRGYKKNIGKEIAAGFAPGVFILADE-WVRLSGVPYESGLMK  553



>gb|EYU43977.1| hypothetical protein MIMGU_mgv1a003434mg [Erythranthe guttata]
Length=585

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/590 (53%), Positives = 412/590 (70%), Gaps = 32/590 (5%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGE-----------ISTASKSVKEI  3072
             MG   + KK+AV G+ SI LVA VVA  V +    G E           +S  +K+V+ I
Sbjct  1     MGDDSKKKKMAVAGLCSILLVAMVVAVAVGIPKKNGDETDDAPTNGGGGVSATTKAVQAI  60

Query  3071  CAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
             C+PTDYK+TC  SL+GA  TD PKELIKVAF+ TV+NI ++I  S L K+A  D RT  A
Sbjct  61    CSPTDYKQTCTESLSGANSTD-PKELIKVAFEYTVKNIKESIKNSTLYKDAAADERTKGA  119

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LD C E+L  SI+DLERSFEK+  FD+ +V +  +D+K WLSGAIT QETC+DAFENTTG
Sbjct  120   LDVCSEVLNTSIEDLERSFEKIGEFDMSKVDDLVDDVKTWLSGAITYQETCLDAFENTTG  179

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK---------  2559
             DTGEKMK+LL+T+ EL SNGLAM+T F+ +L SL   G    RRLL+ E +         
Sbjct  180   DTGEKMKNLLQTSGELLSNGLAMVTDFSSILSSL---GGFSSRRLLSDEGRSLYHLDPTD  236

Query  2558  ---GeeqeeEF---PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                GE+ +  F   P FVD+  R+LL   PA++K + VVAKDGSGQY ++  AL+ +P K
Sbjct  237   YAPGEDPKMGFEGTPSFVDSKARKLLAATPATLKPNAVVAKDGSGQYGTIAAALKTLPKK  296

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T VI++KAGVY E V +PR +N IV +G+GP KTRI G+++  DG+ T+HTA +A+ 
Sbjct  297   TNQTFVIYVKAGVYKETVIIPRHVNNIVLIGDGPEKTRIIGNKNYADGVQTFHTAVLAVN  356

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GDGF+A++IG EN+AGAAKHQAVA+RVS D  IF+N H+D YQDTLY H+YRQFYRDC I
Sbjct  357   GDGFLAKDIGIENTAGAAKHQAVAVRVSGDNAIFYNVHMDGYQDTLYAHAYRQFYRDCQI  416

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFG+A  +FQ C+++VR+PM +Q CMVTAQGRKD+R     VLQ C+I+A+PA 
Sbjct  417   TGTIDFIFGDAVAIFQKCRLVVRQPMDDQACMVTAQGRKDQRSVGVTVLQGCDIVADPAF  476

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A  PP   +LGRPWKE+SRT++M + ID  + PEGWS W G   L T +Y EYQNRG G
Sbjct  477   LAVKPPLDAYLGRPWKEYSRTIVMQSNIDGFIAPEGWSPWMGNYALSTLYYGEYQNRGAG  536

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +    RV WKG K+ I+P +A+ FTPG  +  ++ W+  + IP+  G LQ
Sbjct  537   SGLSGRVTWKGIKK-ITPAIAQSFTPG-VVYKNDTWVSTSGIPYVSGMLQ  584



>ref|XP_002512459.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF49911.1| Pectinesterase precursor, putative [Ricinus communis]
Length=582

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 385/532 (72%), Gaps = 8/532 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+S + K++K +C PT YK+TCERSLA  A +T DPKELIK+AFK+  + I  A  KS  
Sbjct  55    EVSASMKAIKTLCQPTYYKQTCERSLAKSAGNTTDPKELIKIAFKLAEKQIDSASKKSLT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E +KDPRT  AL++CKEL+  SI++L  S EKV +FD  ++ E   D+K WLS AIT 
Sbjct  115   LLELEKDPRTRGALNSCKELMTMSINELRSSLEKVADFDFSQLDELMADIKTWLSAAITY  174

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC+DAFENTT + GEKMK  LKTA E+SSNGL +++  + +L  L+IPGV+  RRLL 
Sbjct  175   EETCLDAFENTTTNAGEKMKKALKTAMEMSSNGLDIVSGISSVLTDLQIPGVS--RRLLQ  232

Query  2570  AE---TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPF  2400
              +       +  + FP ++D  TRRLL+  P++IK D+VVAKDGSG YK+++EAL  +P 
Sbjct  233   DDIPVAGHGDISQAFPAWIDPGTRRLLSAPPSNIKPDLVVAKDGSGDYKTILEALPQIPK  292

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             K++ET V++IK G+Y E VE  R M  +V +G+GP KTRITGS++  DGI TY TATVA+
Sbjct  293   KSNETFVLYIKEGIYEEYVEFNRSMTNLVVIGDGPDKTRITGSKNFVDGINTYRTATVAV  352

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              GD F+ARNIGFENSAGA KHQAVALRVS+D  +F+NC +D YQDTLYTH+ RQFYRDCT
Sbjct  353   IGDNFVARNIGFENSAGAIKHQAVALRVSSDYAVFYNCSMDGYQDTLYTHAKRQFYRDCT  412

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             +SGT+DF+FG+APVVFQNC  +VRKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P 
Sbjct  413   VSGTIDFVFGDAPVVFQNCTFLVRKPLENQQCIVTAQGRKARRQPSAIIIQNSTITAHPE  472

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
             L+      K +LGRPWKEFSRT+IM TFIDD++ PEGWS W G+  L TCWY EY N GP
Sbjct  473   LEPVKDQYKSYLGRPWKEFSRTIIMETFIDDLIQPEGWSPWFGSFGLKTCWYGEYNNYGP  532

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             G+    RVKW G K  +S + A  FTPG FL  D  W+    +P++P   +P
Sbjct  533   GSDMKNRVKWNGIKP-VSRQHAIDFTPGRFLRGD-SWIKPTGVPYAPYLTRP  582



>gb|EYU45536.1| hypothetical protein MIMGU_mgv1a003444mg [Erythranthe guttata]
Length=585

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/587 (54%), Positives = 404/587 (69%), Gaps = 25/587 (4%)
 Frame = -1

Query  3218  MGSPEQNKK-VAVTGVASIFLvac-----------vvaatvsvgssggGEISTASKSVKE  3075
             MG  + NKK + V G+AS+ LVA                  +  +SGGG +ST++K+V+ 
Sbjct  1     MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  3074  ICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             IC+PTDYKETCE SLAGA +T DPKELI++AF   V NI DAI  S L K+A  D  T D
Sbjct  61    ICSPTDYKETCESSLAGA-NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTKD  119

Query  2894  ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             A D C ++L ++IDDL+R+ +KV  FD  +V EY  DLKVWLS  IT QETCIDAFENTT
Sbjct  120   AFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENTT  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP--GVNFKRRLLTAETK---Gee  2550
             GDT EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ E +   G +
Sbjct  180   GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSKEERVLYGGD  239

Query  2549  qeeEFPG-----FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
               +  PG          +RRLL+   A +K + VVA DGSGQ+K++ +A+  +P KN + 
Sbjct  240   PTDYAPGEDPYWIKSPHSRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQP  299

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VIFIKAG+Y E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F
Sbjct  300   FVIFIKAGLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDF  359

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             +A++IGFEN+AGA  HQAVALRVS D  IF N  ID YQDTLY H+YRQ+YRD TISGT+
Sbjct  360   MAKDIGFENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTI  419

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG++   FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEPA  A  
Sbjct  420   DFIFGDSLAYFQNCKFIVRKPMENQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATT  479

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
             PP   +LGRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG G+   
Sbjct  480   PPIDAYLGRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLA  539

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KRV WKG K+ I+PE+A  +T G     D+ W+  + +P++P F+QP
Sbjct  540   KRVTWKGIKK-ITPEIALSWTAGLAFKGDD-WIKSSGVPYNPSFMQP  584



>gb|EYU45538.1| hypothetical protein MIMGU_mgv1a003726mg [Erythranthe guttata]
Length=568

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/579 (54%), Positives = 402/579 (69%), Gaps = 28/579 (5%)
 Frame = -1

Query  3218  MGSPEQNKK-VAVTGVASIFLvacv-----------vaatvsvgssggGEISTASKSVKE  3075
             MG  + NKK + V G+AS+ LVA V                +  +SGGG +ST++K+V+ 
Sbjct  1     MGDSDGNKKKIIVGGMASVLLVAMVVCVTIGVSGRNSGGDAAASNSGGGGVSTSTKAVQA  60

Query  3074  ICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             IC+PTDYKETCE SL+GA +T DPKELI++AF   V NI DAI  S L K+A  D  T D
Sbjct  61    ICSPTDYKETCESSLSGA-NTTDPKELIRLAFNAAVNNIGDAIKNSTLFKDAAADSSTKD  119

Query  2894  ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             A D C ++L ++IDDL+R+ +KV  FD  +V EY  DLKVWLS  IT QETCIDAFENTT
Sbjct  120   AFDICDDVLGSAIDDLKRAGDKVGEFDATKVDEYVEDLKVWLSAVITYQETCIDAFENTT  179

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP--GVNFKRRLLTAETKGeeqee  2541
             GDT EKMK+LLKTA ELSSNGLAM++  + ++  L++   G +  RRLL+ +        
Sbjct  180   GDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGSTSRRLLSED--------  231

Query  2540  EFPGFVDAA-TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
               P ++ +  TRRLL+   A +K + VVA DGSGQ+K++ +A+  +P KN +  VIFIKA
Sbjct  232   --PYWIKSPHTRRLLSAAAAPLKPNAVVALDGSGQFKTIKDAINTIPKKNTQPFVIFIKA  289

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             G+Y E VE+P+K+N +V +GEGP KTRITGS+S   G+ T+HTATVA+ G+ F+A++IGF
Sbjct  290   GLYKEHVEIPKKVNGVVMIGEGPLKTRITGSKSYAGGVKTFHTATVAVNGEDFMAKDIGF  349

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AGA  HQAVALRVS D  IF N  ID YQDTLY H+YRQ+YRD TISGT+DFIFG++
Sbjct  350   ENTAGAEGHQAVALRVSGDRAIFLNVAIDGYQDTLYAHNYRQYYRDSTISGTIDFIFGDS  409

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
                FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+ +I AEPA  A  PP   +L
Sbjct  410   LAYFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGDITAEPAFLATTPPIDAYL  469

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWKE SRT+IM T I   + PEGWS W G   LDTC+Y EYQNRG G+   KRV WKG
Sbjct  470   GRPWKELSRTIIMQTNIGGFIAPEGWSPWMGNFALDTCYYGEYQNRGAGSGLAKRVTWKG  529

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              K+ I+PE+A  +T G     D+ W+  A +P++P F+Q
Sbjct  530   IKK-ITPEIALSWTAGLAFKGDD-WIKTAGVPYNPSFMQ  566



>ref|XP_011071430.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=573

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/533 (55%), Positives = 387/533 (73%), Gaps = 12/533 (2%)
 Frame = -1

Query  3104  ISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             IST S K+V+ ICAPTDYKETCE SL+ A  T+ P ELIK AF  TV+NI D I+ S L 
Sbjct  45    ISTGSTKAVQSICAPTDYKETCESSLSHANSTN-PNELIKAAFDFTVKNIGDIITNSPLF  103

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             KEA  D  T  AL+ C+E+L  +IDDL+RSF+ V+ FD+    EY  +LK WLS  IT Q
Sbjct  104   KEAANDDGTKQALEICQEVLDTAIDDLKRSFDSVDEFDITNASEYVENLKTWLSAVITNQ  163

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             ETCIDAFENTTGDTGEKMK+LLKTA E+SSNGLAM+   +  L SL++     ++ LL+ 
Sbjct  164   ETCIDAFENTTGDTGEKMKNLLKTAREMSSNGLAMVNEMSSFLSSLQLGNAASRKLLLSG  223

Query  2567  ETK-GeeqeeEFPG-----FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             +   G +  +  PG      +D+  RRLL+    S+K + VVA+DGSGQ+ ++  A+ +V
Sbjct  224   KIGYGGDPTDYAPGEEPHFNLDSNRRRLLSA--TSLKPNAVVAQDGSGQFNTISAAIASV  281

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATV  2226
             P KN++T VI +KAGVY E V++P+K+NKIV +G+GP KTRI+G ++  +G+ TYHTATV
Sbjct  282   PPKNNQTFVIHVKAGVYKEYVQIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATV  341

Query  2225  AIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRD  2046
             A+  D F+A++IGFEN+AGAA HQAVALRVS D  +F+N HID YQDTLY H+YRQ+YRD
Sbjct  342   AVNADDFLAKDIGFENTAGAAGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRD  401

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             C+ISGT+DFIFG++  +FQNCK +VRKPMANQ CMVTAQGR +R    A ++Q+ + +AE
Sbjct  402   CSISGTIDFIFGDSQALFQNCKFVVRKPMANQACMVTAQGRVERHSLGATIIQNGDFVAE  461

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNR  1686
             PAL  A+PP+KV+LGRPWK  SRT+IM + I   + PEGW+ W GT  LDT +YAEYQNR
Sbjct  462   PALLQASPPHKVYLGRPWKLLSRTIIMQSNIGGFIAPEGWAEWSGTFALDTLYYAEYQNR  521

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             GPG+    RVKWKG +  +SP++A+ +T G F   DE W+  + +P+ P  +Q
Sbjct  522   GPGSDLKNRVKWKGIQ-TLSPQMAESWTGGKFYGGDE-WVKNSGVPYIPTMMQ  572



>ref|XP_009774523.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=558

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/569 (53%), Positives = 400/569 (70%), Gaps = 30/569 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgs-----sggGEISTASKSVKEICAPTDYKETCERS  3033
             KK+A+ G++SI LVAC+V A V++       S   ++ST++K+V+ +C PT YKETCE+S
Sbjct  7     KKIAIAGISSILLVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYKETCEKS  66

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
             L+ AK+T DPKELIK AF  T+  I  +I  S   KEA  DPRT DAL  C E+L  SI+
Sbjct  67    LSSAKNTSDPKELIKTAFDSTINEIASSIKNSAPFKEAANDPRTKDALKVCDEVLDRSIE  126

Query  2852  DLERSFEKVENFDLER-VKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +++RSF K ++ D++  VK+Y  DL+ WLS A+T + TCIDAF NTTGDTGEKMK+LLK 
Sbjct  127   EIKRSFNKFDSSDVKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGEKMKNLLKN  186

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             A+ELS+N L +++ F + ++ L+I G+N  RRLLT               V+A  RRLL 
Sbjct  187   AHELSTNALDIVSSFEKQVEDLQILGIN-NRRLLT---------------VEAGNRRLLQ  230

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P  +K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VIFIKAG+YNE V+V   M  +
Sbjct  231   VAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNEYVQVANTMTNV  288

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG  KHQAVALRV
Sbjct  289   VFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRV  348

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP--  1962
             SA+M +F NC ID YQ TL TH  RQFYRDCTI+GT+DFIFG+A  VFQNCK+I RKP  
Sbjct  349   SAEMAVFQNCQIDGYQYTLMTHVGRQFYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEE  408

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLIM  1785
             M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK +LGRPWK +SRT+IM
Sbjct  409   MQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIM  468

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV WK Y +N +P+V  +F
Sbjct  469   QSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKF  528

Query  1604  TPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             TPG  L   +    W+ +  +P+ PG ++
Sbjct  529   TPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_009596737.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=558

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/569 (53%), Positives = 399/569 (70%), Gaps = 30/569 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgs-----sggGEISTASKSVKEICAPTDYKETCERS  3033
             KK+A+ G+ASI +VAC+V A V++       S   ++ST++K+V+ +C PT YKETCE+S
Sbjct  7     KKIAIAGIASILVVACIVGAAVTLTKKGNDDSSNSQVSTSTKNVQAMCQPTQYKETCEKS  66

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
             L+ AK+T DPKELIK AF  +V  I  +I  S   KEA  DPRT DAL  C E+L  SI+
Sbjct  67    LSSAKNTSDPKELIKTAFDSSVNEIASSIKNSAPFKEAANDPRTKDALKVCDEVLDRSIE  126

Query  2852  DLERSFEKVENFDLER-VKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             +++RSF K ++ DL+  VK+Y  DL+ WLS A+T + TCIDAF NTTGDTGEKMK+LLK 
Sbjct  127   EIKRSFNKFDSSDLKSLVKDYIYDLRSWLSSAVTFETTCIDAFANTTGDTGEKMKNLLKN  186

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             A+ELS+N L +++ F E +++L+I G+N  RRLLT               V+A  RRLL 
Sbjct  187   AHELSTNALDIVSSFEEQVENLQILGIN-NRRLLT---------------VEAGNRRLLQ  230

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               P  +K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VI IKAG+YNE V+V   M  +
Sbjct  231   VAP--LKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVILIKAGIYNEYVQVANTMTNV  288

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             VF+GEGP KT+ITG+++  DG+  + TATVAI G GF+A++IGFENSAG  KHQAVALRV
Sbjct  289   VFIGEGPNKTKITGNKNYLDGLPVFSTATVAISGQGFVAKDIGFENSAGPLKHQAVALRV  348

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP--  1962
             SA+M +F NC ID YQ TL TH  RQ YRDCTI+GT+DFIFG+A  VFQNCK+I RKP  
Sbjct  349   SAEMAVFQNCQIDGYQYTLMTHVGRQLYRDCTITGTIDFIFGDAVAVFQNCKLIARKPEE  408

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLIM  1785
             M  Q   + AQGR  + G  AI++Q+C I AEPAL A NPP NK +LGRPWK +SRT+IM
Sbjct  409   MQTQAITIAAQGRNQQFGTGAIIIQNCTITAEPALLAINPPRNKAYLGRPWKLYSRTIIM  468

Query  1784  FTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQF  1605
              + ID  + PEGW+ W GT  LDT ++ EYQNRGPGA+TDKRV WK Y +N +P+V  +F
Sbjct  469   QSQIDGFIDPEGWTPWAGTFALDTLYFVEYQNRGPGANTDKRVNWKNYIKNPTPDVIAKF  528

Query  1604  TPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             TPG  L   +    W+ +  +P+ PG ++
Sbjct  529   TPGVVLKGGDNTDTWVTKTGVPYEPGMMK  557



>ref|XP_008438906.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=570

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/576 (53%), Positives = 402/576 (70%), Gaps = 21/576 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvv-----------aatvsvgssggGEISTASKSVKEI  3072
             M    +NKK A+ GV+S+FLVA VV               S G     EIST++K+V+ +
Sbjct  1     MSDGGKNKKAALIGVSSLFLVAMVVAVAVGVNRKNPTTDSSGGDGATAEISTSTKAVQAL  60

Query  3071  CAPTDYKETCERSLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             C PTDYKETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP    
Sbjct  61    CQPTDYKETCEKALSEAGTNTSDPRELIKSGFHVAVNEIKWAIGNSTQLKEAASDPMAKQ  120

Query  2894  ALDTCKELLKNSIDDLERSFEKV-ENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALD C EL+  +IDDL  SF+++ +NFD++++ +Y  DLK+WLSGA+T QETCID FEN 
Sbjct  121   ALDACGELMDYAIDDLVISFDRITDNFDVQKLNDYVEDLKIWLSGALTYQETCIDGFENV  180

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             TGDTGEKM  LLKT+ EL+SNGL M++    ++ S  +P V   RRLLT E+  +E+E  
Sbjct  181   TGDTGEKMAKLLKTSKELTSNGLDMVSEVNSIMTSFGLPAVG--RRLLTEESNQQEEEPS  238

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
             + G      R LL    A++K D+VVAKDGSG+YK+V EAL  VP K+++T VI +KAGV
Sbjct  239   WVG----DRRGLLQATGATVKADVVVAKDGSGKYKTVTEALNDVPKKSNKTFVIHVKAGV  294

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFEN
Sbjct  295   YQEQVMVDKSMTWVMMIGDGPTKTKITAGKNYVDGTPTFKTATVSVIGSNFIAKDIGFEN  354

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAGAAKHQAVALRV +DM+IF+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGNA  
Sbjct  355   SAGAAKHQAVALRVQSDMSIFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNAAA  414

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I ++P        NK +LGR
Sbjct  415   VFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSDPTFFPVRHINKAYLGR  474

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK++SRT+IM   IDD++ PEGW  W G   L T +YAE  NRGPGA+TDKRVKWKG K
Sbjct  475   PWKQYSRTIIMQCQIDDLIQPEGWLPWMGDFALHTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + I+P+ A  FT G F+  D  W+    +P+S G +
Sbjct  535   K-ITPQHALDFTVGRFIRGDP-WIKPTGVPYSSGMM  568



>ref|XP_010258716.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=580

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/530 (54%), Positives = 392/530 (74%), Gaps = 9/530 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I T+ K++K IC PTDYKETC +SL+ A  +T DPK+L+K+AFK+  + I +A+++S +
Sbjct  52    QIQTSMKAIKAICQPTDYKETCIKSLSSAAGNTTDPKDLVKIAFKIATKQIKEAVNRSVV  111

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             LKE +KDPR S AL  C+EL+  +ID+L  SF+++ + D++ + +   +LK+WLS ++T 
Sbjct  112   LKELEKDPRASKALANCRELMDYAIDELNSSFDELGSIDIDDIDDALENLKIWLSASLTY  171

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F+NTTG+ GE M+  LKTA EL+ NGLAM+T    +L SL++P    KRRLL+
Sbjct  172   QETCLDGFQNTTGNAGESMRKALKTAGELTQNGLAMVTEVASILTSLQMPS---KRRLLS  228

Query  2570  AETKGe---eqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPF  2400
             +E + +     E+EFP +  AA RRLL    A+IK +I VAKDGSG+YK++ EALR VP 
Sbjct  229   SEQQSQCPFAMEDEFPTWTSAAKRRLLAASRANIKPNITVAKDGSGKYKTISEALRHVPK  288

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
              ++ET VI IKAGVY+E+V++ R M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+
Sbjct  289   NSNETFVIHIKAGVYHEQVQINRSMTHLMIIGDGPTKTKITGNKNFVDGTPTFKTATVAV  348

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              GDGF+A++IGFENSAG  KHQAVALRV +DM+IF+NC ID YQDTLY H++RQFYR+CT
Sbjct  349   IGDGFMAKDIGFENSAGPEKHQAVALRVQSDMSIFYNCQIDGYQDTLYAHTHRQFYRNCT  408

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGT+DFIFGN+ VV Q C+++VRKP+ NQ+ +VTA GRKDRR   AI+LQSC I+A+P 
Sbjct  409   ISGTIDFIFGNSAVVLQKCRIVVRKPLENQQNIVTAHGRKDRREPTAIILQSCRIVADPL  468

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
             L       + +LGRPWKE+SRT+IM T IDD++ P+GW  W G   L TC+YAEY NRGP
Sbjct  469   LFPVRNTTRSYLGRPWKEYSRTIIMQTLIDDLINPDGWLPWSGDFALKTCFYAEYNNRGP  528

Query  1679  GASTDKRVKWKGYKRNI-SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             GA   +RVKW+G K +I +PE A+QFT G F+  D  W+    +P+  G 
Sbjct  529   GAVLTQRVKWRGIKTSIMTPEKAQQFTAGRFIRGDS-WIKPTGVPYDSGL  577



>gb|EYU45535.1| hypothetical protein MIMGU_mgv1a003776mg [Erythranthe guttata]
Length=564

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/581 (54%), Positives = 396/581 (68%), Gaps = 35/581 (6%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGEIST-------------ASKSVK  3078
             MG   + KK+ + G+AS+ LVA VV  TV V  +  G+ +              A+K+V 
Sbjct  1     MGDDGKKKKILIGGLASVLLVAMVVCVTVGVQKNSAGDAAAPSTGGGSGGGISTANKAVH  60

Query  3077  EICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTS  2898
              IC+PTDYKETCE SL+GA +T DPKELIKVAF   V NI +AI  S LLK+A  D  T 
Sbjct  61    AICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNSTK  119

Query  2897  DALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALD C ++L+++IDDL+R+ +KV +FD  +V EY  DLKVWLS  IT QETCIDAFENT
Sbjct  120   DALDICNDVLESAIDDLKRAGDKVGSFDASKVDEYVEDLKVWLSAVITYQETCIDAFENT  179

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGee  2550
             TGDT EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +     
Sbjct  180   TGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND-----  234

Query  2549  qeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFI  2370
                      D   RR+L    A  K + VVA+DGSGQ+K++ EA+ +VP  N++T VI+I
Sbjct  235   ---------DWIKRRVLR-GKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIYI  284

Query  2369  KAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNI  2190
             KAGVY E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+NI
Sbjct  285   KAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNSEEFTAKNI  344

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             GFEN+AGA  HQAVALRVS D  +F+N  ID YQDTLY H+YRQFY DC+ISGT+DFIFG
Sbjct  345   GFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIFG  404

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             ++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  A  P    
Sbjct  405   DSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAIDA  464

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+    RV W
Sbjct  465   YLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVTW  524

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             KG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  525   KGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  563



>ref|XP_010105131.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC03939.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=577

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/526 (53%), Positives = 382/526 (73%), Gaps = 8/526 (2%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +ST +K+++ IC PTDY+ETCE SL + A +T DPKELIK AF V +++I+ AI  S  L
Sbjct  57    VSTTTKAIQAICQPTDYRETCENSLTSAAGNTSDPKELIKAAFNVAIDHISAAIRNSSTL  116

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             KE  KD RT+ AL  C ELLK +IDDL+ SF+++  F+ E++ EY +DLK+WLSGAIT +
Sbjct  117   KELAKDSRTNQALSNCDELLKYAIDDLKESFDRIGPFEYEKLDEYVDDLKIWLSGAITYE  176

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             +TC+D FENTTG+ G +MK +L+++ EL+SNGLAM+T  + +L S  +P  N  RRLL++
Sbjct  177   QTCLDGFENTTGEAGLRMKAMLRSSQELTSNGLAMVTEISSILASYNLP-FNVSRRLLSS  235

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             E   + +      ++    RRLL     +IK D+VVAKDGSG+Y++V EAL+ +P K ++
Sbjct  236   EDGDDTELS----WLSDGKRRLLQATGKTIKADVVVAKDGSGKYRTVNEALKDIPKKGNK  291

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
             T VI+IK GVY E+V   + M  ++ +G+GPTKTRITGS +  DG+ T+ TATV++ G  
Sbjct  292   TFVIYIKQGVYKEQVMFAKSMTHVMIIGDGPTKTRITGSLNFIDGVQTFKTATVSVIGSN  351

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             FIA++IGFENSAG  KHQAVALRV +DM+IF+NCH+D YQDTLY H++RQFYRDC I+GT
Sbjct  352   FIAKDIGFENSAGPQKHQAVALRVQSDMSIFYNCHMDGYQDTLYAHTHRQFYRDCVITGT  411

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++  VFQNCKM++RKP+ NQ C+VTAQGR +RR A A+VLQ+C I  +PA    
Sbjct  412   IDFIFGDSAAVFQNCKMVIRKPLDNQNCIVTAQGRTERREATALVLQNCTITGDPAYLPV  471

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                NK +LGRPWKEFSRT+IM + IDD++ PEGW  W G   L+TC+Y E  NRGPG+  
Sbjct  472   KDQNKGYLGRPWKEFSRTIIMNSRIDDVIAPEGWLPWAGDFALNTCFYTEILNRGPGSKL  531

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             D RVKW+G K+ +  + A ++TPG F+  D  W+  A +P+  G L
Sbjct  532   DGRVKWRGIKK-VPAQRAVEYTPGRFIRGD-WWIKAAGVPYVSGML  575



>gb|EYU45537.1| hypothetical protein MIMGU_mgv1a003747mg [Erythranthe guttata]
Length=566

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/582 (53%), Positives = 395/582 (68%), Gaps = 35/582 (6%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGEIST-------------ASKSVK  3078
             MG   + KK+ + G+AS+ LVA V+  TV V  + GG  +              A+K+V 
Sbjct  1     MGDDGKKKKILIGGLASVLLVAMVICVTVGVERNSGGNAAAPSTGGGSGGGISTANKAVH  60

Query  3077  EICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTS  2898
              IC+PTDYKETCE SL+GA +T DPKELIKVAF   V NI +AI  S LLK+A  D  T 
Sbjct  61    AICSPTDYKETCESSLSGA-NTTDPKELIKVAFNAAVNNIGEAIKNSALLKDAAADNSTK  119

Query  2897  DALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALD C ++L+++IDDL+R+ +KV  FD  +V EY  DLKVWLS  IT QETCIDAFENT
Sbjct  120   DALDICNDVLESAIDDLKRAGDKVGAFDATKVDEYVEDLKVWLSAVITYQETCIDAFENT  179

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGee  2550
             TGDT EKMK+LLKTA ELSSNGLAM++  + ++  L++     G    RRL + +     
Sbjct  180   TGDTAEKMKNLLKTARELSSNGLAMVSDVSSIIGQLQLGNLGGGATTSRRLFSND-----  234

Query  2549  qeeEFPGFVDAATRRLLTT-DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
                      D   RR+L     A  K + VVA+DGSGQ+K++ EA+ +VP  N++T VI+
Sbjct  235   ---------DWINRRVLKGRGKAYAKPNAVVAQDGSGQFKTIKEAIDSVPKNNEKTFVIY  285

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E VE+P+KMNKIVF+G+GP KTRITGS+S   G+ T+ TATVA+  + F A+N
Sbjct  286   IKAGVYKEHVEIPKKMNKIVFIGDGPLKTRITGSKSFAGGVKTFQTATVAVNAEEFTAKN  345

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             IGFEN+AGA  HQAVALRVS D  +F+N  ID YQDTLY H+YRQFY DC+ISGT+DFIF
Sbjct  346   IGFENTAGAEGHQAVALRVSGDKAVFYNVAIDGYQDTLYAHNYRQFYSDCSISGTIDFIF  405

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G++  +FQNCK IVRKPM NQ CMVTAQGR D R   AIV+Q+  I AE A  A  P   
Sbjct  406   GDSLSLFQNCKFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNGHITAEAAFLATKPAID  465

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              +LGRPWKE SRT+IM + ID  + P+GWS W G   LDTC+Y EYQNRG G+    RV 
Sbjct  466   AYLGRPWKELSRTIIMQSDIDGFISPDGWSPWMGNFALDTCYYGEYQNRGAGSGLANRVT  525

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             WKG K+ I+PE+A+ +T G     DE W+  A++P+ P  ++
Sbjct  526   WKGIKK-ITPEIAQSWTGGVAFKGDE-WIKAARVPYVPTLMK  565



>ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=686

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/530 (53%), Positives = 380/530 (72%), Gaps = 13/530 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             EIST++K++K IC PTDY+ETCE+SL+ A +T DPKELIK+ F+  +  I   I+ S  +
Sbjct  165   EISTSTKAIKAICQPTDYRETCEKSLSSA-NTTDPKELIKIGFQAAISEIKKVIANSSTV  223

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             KE  KDP    AL+ C EL+  +IDDL+ SF ++  FD  ++ EY  +LK+WL GAIT Q
Sbjct  224   KEVAKDPMARQALENCHELMDYAIDDLKNSFNQLGEFDFSKLDEYIENLKIWLGGAITYQ  283

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV---NFKRRL  2577
             +TC+D F NTTG+ G+KM+ LLKT+ EL+SNGLAM++  + +L +L I  +   +  +R 
Sbjct  284   QTCLDGFMNTTGEAGKKMQALLKTSQELTSNGLAMVSEISSILGNLNIQNIGEISTGQRR  343

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             L AE         FP +V +  R  +   PA+IK ++VVAKDGSG+Y S+ EAL+ VP  
Sbjct  344   LFAEN-------GFPMWVSSEQRSRIRQTPATIKPNVVVAKDGSGKYTSINEALQEVPKD  396

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             N  T VI+IKAGVY E+V V + M  ++F+G+G TKT+ITG  +  DG GT+ TATV + 
Sbjct  397   NPTTFVIYIKAGVYKEQVIVTKSMTNVMFIGDGRTKTKITGDLNYADGTGTFRTATVGVV  456

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GDGFIA++IGFEN+AGA KHQAVALRV +D +IF+NC +D YQDTLY HS+RQFYRDCTI
Sbjct  457   GDGFIAKDIGFENTAGAIKHQAVALRVQSDQSIFYNCQMDGYQDTLYAHSHRQFYRDCTI  516

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DFIFG++  V QNCK+IVRKP+ NQ+C+VTAQGR +RR  +A+VLQ+C I  +P  
Sbjct  517   SGTIDFIFGDSATVLQNCKIIVRKPLENQQCIVTAQGRIERREVSALVLQNCTISGDPEY  576

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
                   NK +LGRPWKEFSRTLIM + IDDI+ PEGW  W G   L+T WYAE+ NRGPG
Sbjct  577   LPVKDKNKAYLGRPWKEFSRTLIMQSQIDDIIAPEGWLPWNGDFALNTLWYAEFGNRGPG  636

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             A    RV W+G K+ I+  +A++FTPG FL  D+ W+ +A +P++PG ++
Sbjct  637   AVQTHRVTWRGIKK-INAAIARRFTPGVFLRGDD-WIPKAGVPYTPGLIR  684



>ref|XP_004162213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
 gb|KGN57132.1| hypothetical protein Csa_3G164510 [Cucumis sativus]
Length=570

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/576 (53%), Positives = 403/576 (70%), Gaps = 21/576 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvg-----------ssggGEISTASKSVKEI  3072
             M    +NKK A+ GV+S+FLVA VVA  V V            S+   EIST++K+VK +
Sbjct  1     MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAEISTSTKAVKAL  60

Query  3071  CAPTDYKETCERSLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             C PTDY+ETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP    
Sbjct  61    CQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPMAKQ  120

Query  2894  ALDTCKELLKNSIDDLERSFEKV-ENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             ALD C EL+  +IDDL  SF+++ +NFD++++ +Y  DLKVWLSGA+T QETCID FEN 
Sbjct  121   ALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGFENV  180

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             TGDTGEKM  LL+T+ EL+ NGL M++  T +L S  +P +   RRL+T E+  + +E  
Sbjct  181   TGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIG--RRLMTEESNEQREE--  236

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              P +V    R LL    A+IK D VVAKDGSG+YK+V  AL  VP K+++T VI++KAGV
Sbjct  237   -PSWV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVKAGV  294

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IGFEN
Sbjct  295   YQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIGFEN  354

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAGAAKHQAVALRV +DM++F+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGN  V
Sbjct  355   SAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGNGAV  414

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P        NK FLGR
Sbjct  415   VFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAFLGR  474

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TDKRVKWKG K
Sbjct  475   PWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWKGIK  534

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  535   K-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  568



>ref|XP_004134493.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cucumis sativus]
Length=573

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/579 (53%), Positives = 403/579 (70%), Gaps = 24/579 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatv--------------svgssggGEISTASKSV  3081
             M    +NKK A+ GV+S+FLVA VVA  V              S  ++   EIST++K+V
Sbjct  1     MSDQGKNKKAALIGVSSLFLVAMVVAVAVGVNRNSPNASGGGDSAATAATAEISTSTKAV  60

Query  3080  KEICAPTDYKETCERSLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPR  2904
             K +C PTDY+ETCE++L+ A  +T DP+ELIK  F V V  I  AI  S  LKEA  DP 
Sbjct  61    KALCQPTDYQETCEKALSEAGTNTSDPRELIKAGFNVAVNEIKWAIGNSTTLKEAASDPM  120

Query  2903  TSDALDTCKELLKNSIDDLERSFEKV-ENFDLERVKEYTNDLKVWLSGAITQQETCIDAF  2727
                ALD C EL+  +IDDL  SF+++ +NFD++++ +Y  DLKVWLSGA+T QETCID F
Sbjct  121   AKQALDACGELMDYAIDDLVISFQRITDNFDMQKLDDYIEDLKVWLSGALTYQETCIDGF  180

Query  2726  ENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             EN TGDTGEKM  LL+T+ EL+ NGL M++  T +L S  +P +   RRL+T E+  + +
Sbjct  181   ENVTGDTGEKMTKLLETSKELTINGLGMVSEVTSILTSFGLPAIG--RRLMTEESNEQRE  238

Query  2546  eeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
             E   P +V    R LL    A+IK D VVAKDGSG+YK+V  AL  VP K+++T VI++K
Sbjct  239   E---PSWV-RDRRGLLQATGANIKADAVVAKDGSGKYKTVTAALNDVPKKSNKTFVIYVK  294

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
             AGVY E+V V + M  ++ +G+GPTKT+IT  ++  DG  T+ TATV++ G  FIA++IG
Sbjct  295   AGVYQEQVMVEKSMTWVMMIGDGPTKTKITAGKNYIDGTPTFKTATVSVIGSNFIAKDIG  354

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAGAAKHQAVALRV +DM++F+NC +D YQDTLYTH++RQFYRDCTI+GT+DFIFGN
Sbjct  355   FENSAGAAKHQAVALRVQSDMSVFYNCQMDGYQDTLYTHAHRQFYRDCTITGTIDFIFGN  414

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
               VVFQNCK++VRKPM NQ+C+VTAQGR  R+   AI+LQ+C I + P        NK F
Sbjct  415   GAVVFQNCKILVRKPMDNQQCIVTAQGRTQRKEPTAIILQNCAISSAPDFFPIRHINKAF  474

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK++SRT+IM + IDD++ PEGW  W G   L+T +YAE  NRGPGA+TDKRVKWK
Sbjct  475   LGRPWKQYSRTIIMQSQIDDLIQPEGWLPWTGNFALNTLFYAEINNRGPGAATDKRVKWK  534

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             G K+ I+ E A  FT   F+  D  W+    +P++ G +
Sbjct  535   GIKK-ITMEHALDFTAARFIRGDP-WIKPTGVPYTSGMM  571



>ref|XP_011091005.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=570

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/578 (50%), Positives = 401/578 (69%), Gaps = 29/578 (5%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCERSLA  3027
             ++ KK+A+  ++SI LVA V+              + ++K+   +C   DYK TCE+SL+
Sbjct  3     DKMKKIAMASLSSILLVAMVLPLATGDSP------TNSNKAAHALCTSVDYKITCEKSLS  56

Query  3026  GAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDDL  2847
             GA ++ DP+ELIKVAF   + +I +AI  S L K+A  D RT  AL+ C+E+L  SIDDL
Sbjct  57    GA-NSSDPQELIKVAFNHAITDIQEAIKNSTLYKQAALDHRTKGALEVCEEVLDTSIDDL  115

Query  2846  ERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANE  2667
              RSF++V N D+ ++K+Y  D+KVWLSGAIT  ETC+DAF+NTTGDTGEKMK+LL ++  
Sbjct  116   RRSFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKMKNLLHSSGM  175

Query  2666  LSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE---------TKGeeqeeEF-------  2535
             + SNGLAM+   + +  SL + G    RRLL  E         T GE+ +  F       
Sbjct  176   MLSNGLAMVGDISSIFSSLSLGGFT-SRRLLEEEGSLAYGVDQTDGEDPKTAFDGKVTDA  234

Query  2534  ---PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
                P FVDA  RR++T +  ++K +IVVA+DGSGQ+K++  A+ ++P K D   VI +KA
Sbjct  235   AGPPSFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPKKGDGPFVIHVKA  294

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             G Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA + + GDGFIA++IG 
Sbjct  295   GFYKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVLGVNGDGFIAKDIGI  354

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             EN+AG  KHQAVA+RVS D +IF+N H++++QDTLY H+YRQ+YRDCTI+GT+DFIFG+A
Sbjct  355   ENTAGPIKHQAVAVRVSGDKSIFYNVHMNSFQDTLYAHAYRQYYRDCTITGTIDFIFGDA  414

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C ILAEPA  +  PP K +L
Sbjct  415   AAVFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAEPAFLSTKPPVKAYL  474

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKG  1644
             GRPWK+FSRT+IM T ID  + PEGW+ W+G   LDT +Y E++NRGPG+   +RV+WKG
Sbjct  475   GRPWKQFSRTIIMQTLIDGFIAPEGWAPWEGNFALDTLYYGEFKNRGPGSDMSRRVRWKG  534

Query  1643  YKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              +  I+P +A+ FTPG     DE W+ ++ +P+  G +
Sbjct  535   IQ-TITPAIAESFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_002314364.1| putative pectinesterase family protein [Populus trichocarpa]
 gb|EEF00535.1| putative pectinesterase family protein [Populus trichocarpa]
Length=571

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/573 (51%), Positives = 396/573 (69%), Gaps = 21/573 (4%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaat---------vsvgssggGEISTASKSVKEICAP  3063
             GS    KK A+ GV+SI LVA VVA               SS  G+IST SKS+K IC P
Sbjct  7     GSNAGKKKFAIIGVSSIILVAMVVAVAVGIGGSPGDSKQESSPKGQISTTSKSIKAICQP  66

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+ETCE SL+  A +T DP +L++  FKVT+E + +AI++S  LKE  KDP  S ALD
Sbjct  67    TDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALD  126

Query  2885  TCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C+EL+ ++I +LE SF+ +E+F   +  EY N+LKVWLS  IT Q TC+D FENTTG  
Sbjct  127   NCRELMDDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFENTTGSA  186

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             GEKMK LL  +++L+SNGLAM+   T +L+ L IPG+   RRLL A+ +       FP +
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLT-SRRLLEADDE-------FPSW  238

Query  2525  VDAATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             V+   R LL  + PA+IK D +VA+DGSGQYK++ EA+  +P K +ET VI+IK GVY E
Sbjct  239   VNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKKNETFVIYIKEGVYKE  298

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSAG
Sbjct  299   QVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAG  358

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A  HQAVALRV ADM++F+NC ID YQDTLY H+ RQFYRDCTI+GT+DFIFG+A  VFQ
Sbjct  359   AIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQ  418

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +LGRPW+
Sbjct  419   NCKLVVRKPLDNQQCIVTAQGRNETREPTGFVIQNCTITADPQYFPVRLQNKAYLGRPWR  478

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E SRT++M + IDD++ PEGW  W G+  L+T +Y+EY N+G GA    RVKW G K+ +
Sbjct  479   ELSRTIVMQSHIDDLIAPEGWLPWLGSFGLNTLFYSEYNNKGQGAVETNRVKWAGIKK-L  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  538   TPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_011006446.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
 ref|XP_011010878.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Populus euphratica]
Length=571

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/573 (51%), Positives = 396/573 (69%), Gaps = 21/573 (4%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaat---------vsvgssggGEISTASKSVKEICAP  3063
             GS    KK A+ GV+SI LVA VVA               SS  G+IST SKS+K IC P
Sbjct  7     GSNAGKKKFAIIGVSSIILVAMVVAVAVGIGGSHGDSKQESSPKGQISTTSKSIKAICQP  66

Query  3062  TDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+ETCE SL+  A +T DP +L++  FKVT+E + +AI++S  LKE  KDP  S ALD
Sbjct  67    TDYRETCEESLSKAAGNTTDPSKLVQAGFKVTIEALQNAINRSTTLKELAKDPMASQALD  126

Query  2885  TCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              C+EL+ ++I +LE SF+ +E+F   +  EY N+LKVWLS  IT Q TC+D F+NTTG  
Sbjct  127   NCRELMDDAIAELEHSFDLIESFQASQFDEYVNNLKVWLSATITYQRTCLDGFDNTTGSA  186

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             GEKMK LL  +++L+SNGLAM+   T +L+ L IPG+   RRLL A+ +       FP +
Sbjct  187   GEKMKELLMASSQLTSNGLAMVDGVTSILKDLNIPGLT-SRRLLEADDE-------FPSW  238

Query  2525  VDAATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             V+   R LL  + PA+IK D +VA+DGSGQYK++ EA+  +P KN+ET V++IK GVY E
Sbjct  239   VNGGKRMLLLKETPATIKADAIVAQDGSGQYKTIAEAIEKIPKKNNETFVLYIKEGVYKE  298

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V + R    ++ +G+GPTKT+ITG+ +  +G+ T+ TATV+I GD F+A++IGFENSAG
Sbjct  299   QVSLARSHTHVLMIGDGPTKTKITGNLNYANGVQTFKTATVSISGDHFMAKDIGFENSAG  358

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A  HQAVALRV ADM++F+NC ID YQDTLY H+ RQFYRDCTI+GT+DFIFG+A  VFQ
Sbjct  359   AIGHQAVALRVQADMSVFYNCQIDGYQDTLYAHTKRQFYRDCTITGTIDFIFGDAIAVFQ  418

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK++VRKP+ NQ+C+VTAQGR + R     V+Q+C I A+P        NK +LGRPW+
Sbjct  419   NCKLVVRKPLENQQCIVTAQGRNETREPTGFVIQNCTITADPKYFPVRLQNKAYLGRPWR  478

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
             E SRT++M + IDD++ PEGW  W G   L+T +Y+EY N+G GA    RVKW G K+ +
Sbjct  479   ELSRTIVMQSHIDDLIAPEGWLPWLGNFGLNTLFYSEYDNKGQGAVETNRVKWAGIKK-L  537

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +PE A  +T   F+  DE W+ +  +P++ G +
Sbjct  538   TPEAADGYTAAKFIQGDE-WIPQTGVPYTAGMI  569



>ref|XP_011071432.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=591

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 388/552 (70%), Gaps = 31/552 (6%)
 Frame = -1

Query  3107  EISTAS-KSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +IS  S K+V+ ICAPTDYK+TCE+ L+ A +T +P+ELIK AF+ TV+NI D +  S L
Sbjct  45    QISAGSTKAVQSICAPTDYKDTCEKGLSHA-NTTNPQELIKAAFEFTVKNIGDVVKNSPL  103

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
              KEA  D  T +AL+ C+ +L+ +IDDL+ SF+ V+ FD+    EY  DLK WLS  IT 
Sbjct  104   FKEASHDKSTKEALEICQLVLEIAIDDLKMSFDSVDEFDVTNASEYVEDLKTWLSAVITN  163

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETCIDAF+NTTGDTGEKMK+LLKTA E+SSNGLAM+T  + +L SL++  V   R+LL+
Sbjct  164   QETCIDAFDNTTGDTGEKMKNLLKTAREMSSNGLAMVTDMSSILTSLQLGNVA-SRKLLS  222

Query  2570  AETK-------------------GeeqeeEFPG-----FVDAATRRLLTTDPASIKHDIV  2463
              E +                   G +  +  PG      +D+  R LL+    S+K + V
Sbjct  223   EEGRFASKPNAGRKLQLSEKIGYGGDPTDYAPGEEPHFNLDSNRRHLLSA--TSLKPNAV  280

Query  2462  VAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTR  2283
             V++DGSGQ+ ++  A+  VP KND+T VI +KAGVY E+V +P+ MNKIV +G+GP KTR
Sbjct  281   VSQDGSGQFNTISAAIATVPKKNDQTFVIHVKAGVYKEQVLIPKHMNKIVLIGDGPLKTR  340

Query  2282  ITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCH  2103
             +TG  +  +G+ TYHTATVA+  D F+A++IGFEN+AGA  HQAVALR S D  +F+N H
Sbjct  341   VTGRLNFAEGVKTYHTATVAVSSDDFMAKDIGFENTAGAEGHQAVALRASGDRAVFYNVH  400

Query  2102  IDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGR  1923
             ID YQDTLY H+YRQ+YRDCTISGT+DFIFG+A  +FQNC+ ++RKP+ NQ CM+TAQGR
Sbjct  401   IDGYQDTLYAHTYRQYYRDCTISGTIDFIFGDALAIFQNCRFVIRKPLPNQACMITAQGR  460

Query  1922  KDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWS  1743
              DRR   AIV+Q+ +I AEPAL  A+PP+K++LGRPWK+FS T+IM + I   + PEGWS
Sbjct  461   VDRRSVGAIVIQNGDIAAEPALLQASPPHKLYLGRPWKQFSTTIIMQSNIGGFIAPEGWS  520

Query  1742  IWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG  1563
              W GT  LDT +YAEY+NRGPG+    RV+WKG +  +SP++A+ +T G     DE W+ 
Sbjct  521   PWAGTFALDTLYYAEYKNRGPGSDVKNRVQWKGIQ-TLSPQMAESWTGGKIYGGDE-WIR  578

Query  1562  RAQIPFSPGFLQ  1527
              + +P+ P  +Q
Sbjct  579   ISGVPYVPTMMQ  590



>ref|XP_010039612.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=579

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/525 (53%), Positives = 376/525 (72%), Gaps = 7/525 (1%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ST+ KS++ IC PTDY+ETC +SL+ A  ++ DPK+LI+  F+V +  +  AI  S ++K
Sbjct  59    STSMKSIQSICEPTDYRETCVKSLSAAGGNSTDPKDLIRTGFQVAINQVKAAIENSTVVK  118

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +  KDPR+  AL+TC+ LL+ SIDDL+ SFE++  FD+  + +Y  DL VWLSGAIT QE
Sbjct  119   DLAKDPRSKQALETCQHLLEYSIDDLQSSFERLGAFDVSNLDKYMADLHVWLSGAITFQE  178

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             +C+D FENTTG   +KMK +L+ + EL+SNGLAM+T  + LL SL IP V+  RRLLT E
Sbjct  179   SCLDGFENTTGAAAKKMKQILQGSRELTSNGLAMVTEISSLLGSLNIPDVS--RRLLTEE  236

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
               G  +   FP +VD   R+LL   P  IK D+VVA+DGSG+YK++ EAL  VP KN++T
Sbjct  237   QDGIPE---FPSWVDEGRRKLLAAAPKDIKPDVVVAQDGSGKYKTIREALNEVPKKNNKT  293

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI+IK GVY E+V V +K   ++ +G+GPTKT ITGS +  DG+ T +TAT    G  F
Sbjct  294   FVIYIKEGVYKEKVLVDKKTTNVMIIGDGPTKTVITGSLNYVDGVQTCNTATFTAIGSYF  353

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             IA++I FENSAGA KHQAVALRV +DM++ +NCH+DA+QDTLY H++RQFYRDCTISGT+
Sbjct  354   IAKDIKFENSAGAEKHQAVALRVQSDMSVIYNCHMDAFQDTLYAHAHRQFYRDCTISGTI  413

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAAN  1845
             DFIFG+A  VFQNC+M V+KP+ NQ+C+VTA GR +RR A+AIVLQ+C I A+PA     
Sbjct  414   DFIFGDALAVFQNCQMFVKKPLENQQCIVTASGRSERRSASAIVLQNCTISADPAYYPLR  473

Query  1844  PPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTD  1665
               NK +LGRPWK++SRT+IM + IDD++ P+GW  W G   L+TC+YAEY NRG G++T 
Sbjct  474   NINKAYLGRPWKDYSRTIIMQSQIDDLIQPQGWLAWMGNFALNTCFYAEYGNRGAGSATT  533

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              R KW+G K   +  +   FTP  F   D+ W+    +P+SP  +
Sbjct  534   GRAKWRGIKSMTAQHIV-DFTPKAFFKGDDAWITATGVPYSPKLM  577



>gb|KDP23449.1| hypothetical protein JCGZ_23282 [Jatropha curcas]
Length=581

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/585 (52%), Positives = 394/585 (67%), Gaps = 24/585 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaat--------------vsvgssggGEISTASKSV  3081
             M     NK++A+ G++SI LVA VVA T                      GEIS + K++
Sbjct  1     MADDANNKRLAIIGISSILLVAMVVAVTIGVGFSENGESEDITGKSHKSTGEISASMKAI  60

Query  3080  KEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPR  2904
             K IC P DYK+TCE+SL   A +T DPKELIK AFK+  + I +A  KS  L+E +KDPR
Sbjct  61    KSICQPADYKKTCEKSLEKSAGNTTDPKELIKAAFKIAQKKIREAAKKSATLEELEKDPR  120

Query  2903  TSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFE  2724
             T DAL +CKEL+  SI +L+ SF+KV +FD+  + ++  DL+ WLS  IT + TC+D FE
Sbjct  121   TRDALQSCKELMDMSISELQNSFDKVADFDITMLDDFMADLRTWLSAVITYEGTCLDGFE  180

Query  2723  NTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-ETKGeeq  2547
             NTT D GEKMK  +K A E+S+NGL +I   +  L  L+I GVN  RRLL   E  G + 
Sbjct  181   NTTSDAGEKMKKAMKAAIEMSTNGLDIIDGLSSALADLQITGVN--RRLLQEDEVLGHDD  238

Query  2546  e-eEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK---NDETVV  2379
                +FP +VDA TRRLL   P+ IK ++ VAKDGSG +K++  AL ++P     + +T V
Sbjct  239   VPSKFPSWVDAGTRRLLAAPPSKIKPNLTVAKDGSGDFKTIRGALDSIPKPKKGSTQTFV  298

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             ++IKAGVY E VE  + M+ ++ +G+GP KTRITG+++  DG+ TYHTATV + GD FIA
Sbjct  299   LYIKAGVYQEYVEFTKSMDYLMVIGDGPEKTRITGNKNFVDGVNTYHTATVVVLGDNFIA  358

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             +NIGFENSAGA KHQAVALRVSAD  +F+NC +D YQDTLYTH+ RQFYR+C+ISGT+DF
Sbjct  359   KNIGFENSAGAIKHQAVALRVSADFAVFYNCAMDGYQDTLYTHAKRQFYRECSISGTIDF  418

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             +FG+APVVFQNCK +VRKP+ NQ+C+VTAQGRK RR  + I++Q+    A P L      
Sbjct  419   VFGDAPVVFQNCKFLVRKPLENQQCIVTAQGRKQRRQPSGIIIQNGTFTAHPELVPVKKQ  478

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
              K +LGRPWK+FSRT+IM ++IDDI+ PEGW  W GT  L TCWY E+ N GPG+    R
Sbjct  479   YKSYLGRPWKQFSRTIIMESYIDDIIEPEGWLPWFGTFGLKTCWYTEFNNYGPGSDKKAR  538

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             VKW G K  I  + A  FTPG FL  D  W+    IP+SP   +P
Sbjct  539   VKWNGIK-TIDRQHALDFTPGRFLRGD-TWIKPTGIPYSPFLTRP  581



>ref|XP_011071429.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/523 (53%), Positives = 371/523 (71%), Gaps = 17/523 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ +CAPTDYK+TCE+SL+ A +T DPKELIK AF+ T +NI D I  S L KEA 
Sbjct  40    STKAVQNVCAPTDYKDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
              D  T  AL  C+E+L  +IDDL+RSF+KV  FD  +  EY  DLK WLS  IT  ETCI
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDASKANEYLEDLKTWLSAVITNHETCI  158

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G    R+LL+ E   
Sbjct  159   DAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSTASRKLLSEEEAD  217

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    RRL+   P     + VVA+DGSGQ+K++  A+  VP KN++  VI
Sbjct  218   L--------FISIKQRRLMGLQP-----NAVVAQDGSGQFKTISAAIATVPQKNNQPFVI  264

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
              +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A+
Sbjct  265   HVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAK  324

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YRDC+ISGT+DFI
Sbjct  325   DIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFI  384

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP 
Sbjct  385   FGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPV  444

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV
Sbjct  445   KVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRV  504

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  505   QWPGIQ-HFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_009620126.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=555

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/567 (53%), Positives = 395/567 (70%), Gaps = 24/567 (4%)
 Frame = -1

Query  3200  NKKVAVTGVASIFLvacvv----aatvsvgssggGEISTASKSVKEICAPTDYKETCERS  3033
             NKKV + G+ASI +VACVV      T    +S  G+++T++KSV+ +C PT YK+TCE++
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTQKDETSSTGQVTTSTKSVEAMCQPTPYKQTCEKT  62

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
             L+ AK+  DPK+ IKVAF+ TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I+
Sbjct  63    LSSAKNVTDPKDFIKVAFEATVTDIKNAIMNTDLIMKAASDPKTKDALHACEELFDLAIE  122

Query  2852  DLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
             DL  S  K+E+FDL ++K+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T 
Sbjct  123   DLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMAKLLNTT  182

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              ELS NGLAM+  F E++           R+LLT +            FV+A+ R+LL  
Sbjct  183   RELSINGLAMVNSFGEMITQT----TGLSRKLLTTDESS---------FVEASNRKLLQI  229

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
               A  K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E V+V + M  +V
Sbjct  230   SNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVDVEKGMTNVV  287

Query  2312  FVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             F+GEG TKT+ITG+++ K+ GIG T+HT TV + G+GF+AR+IGFEN+AGA K QAVALR
Sbjct  288   FIGEGSTKTKITGNKAVKEPGIGSTWHTCTVGVSGEGFVARDIGFENTAGAVKEQAVALR  347

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD  + +NC ID YQDTLY HS RQFYRDC I+GT+DF+FG+A  VFQNCK+IVRKP 
Sbjct  348   VNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIITGTIDFVFGDAAAVFQNCKLIVRKPG  407

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
               Q CMVTAQGR       A+V+Q+CEI AEP   A  PP K FLGRPWKE+SRT+IM +
Sbjct  408   DGQNCMVTAQGRTTPASKGALVMQNCEIKAEPEFLATKPPIKAFLGRPWKEYSRTIIMQS  467

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
             +ID  + P GW+ W  T + + TCWYAEYQNRGPGAS DKR+  W+GY++ IS +VA  F
Sbjct  468   YIDGFIDPTGWAPWNTTEFGIHTCWYAEYQNRGPGASLDKRISHWRGYQKGISGDVANSF  527

Query  1604  TPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             T G F+   D  +L +A IP+  G ++
Sbjct  528   TAGLFINPTDSSFLPKADIPYEAGMMK  554



>ref|XP_011071426.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/523 (53%), Positives = 372/523 (71%), Gaps = 17/523 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ ICAPTDY++TCE+SL+ A +T DPKELIK AF+ T +NI D I  S L KEA 
Sbjct  40    STKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
              D  T  AL  C+E+L  +IDDL+RSF+KV  FD  +  EY  DLK WLS  IT  ETCI
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVITNHETCI  158

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +  R+LL+ E   
Sbjct  159   DAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSSASRKLLSEEEAD  217

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    R L+   P     + VVA+DGSGQ+K++  A+ +VP KN++  VI
Sbjct  218   L--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVI  264

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
              +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ TYHTATV++  D F A+
Sbjct  265   HVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTYHTATVSVNADEFFAK  324

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YRDC+ISGT+DFI
Sbjct  325   DIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFI  384

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP 
Sbjct  385   FGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPV  444

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV
Sbjct  445   KVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRV  504

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  505   QWPGIQ-HFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>gb|EPS72184.1| pectinesterase family protein, partial [Genlisea aurea]
Length=560

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/520 (54%), Positives = 367/520 (71%), Gaps = 8/520 (2%)
 Frame = -1

Query  3092  SKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADK  2913
             +KSV+ IC+PTDYK+TCE SLAGA  TD PK LIK+AF+ TV+ I  AI  S L +EA  
Sbjct  49    TKSVQAICSPTDYKQTCEESLAGANSTD-PKYLIKLAFQNTVKGIRSAILNSTLYREAAA  107

Query  2912  DPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCID  2733
             DP T  AL  C+E+L NS+DDL+RSF++VE FD+ R+ EY +D+K WLSGAI  +E CID
Sbjct  108   DPNTKGALQVCEEVLDNSVDDLQRSFDQVEAFDVNRMDEYIDDIKTWLSGAIANKEACID  167

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe  2553
             A   T+GDT EKMK LL T +E+ SNGLA++T F+ +  SL++     +RRL+     GE
Sbjct  168   AVNGTSGDTAEKMKKLLNTTSEMLSNGLAIVTDFSTIFSSLQLGSFTSRRRLM-----GE  222

Query  2552  eqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIF  2373
              +E    GFV +A RRLL  +  +IK ++ VA+DGSGQ+K++  AL  +P K+++T VI 
Sbjct  223   GEENPDDGFVQSARRRLLAVNINTIKANVTVAQDGSGQFKTIGAALATLPKKSNDTFVIH  282

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             +KAGVY E V VP+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+A++
Sbjct  283   VKAGVYKETVIVPKKVNNVVIYGDGPEKTRVVNNKNYADGVQTFHTATLAVNSDGFMAKD  342

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             I FENSAG  KHQAVA+RVS D  +F+N  +D YQDTLY H YRQFYR+CTISGT+DF+F
Sbjct  343   IAFENSAGPTKHQAVAVRVSGDKAVFYNVVMDGYQDTLYAHGYRQFYRNCTISGTIDFVF  402

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             G+A  VFQ C+ IVRKP  NQ CMVTAQGRKD R     V+Q+ EI+ E    A  P   
Sbjct  403   GDATAVFQKCRFIVRKPDINQNCMVTAQGRKDSRSIGVTVIQNSEIVPEAGFTAVKPKID  462

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              FLGRPWKE+SRTLIM TFID  + P GWS W G   L+T +Y EYQN+GPGA T KRV 
Sbjct  463   AFLGRPWKEYSRTLIMNTFIDGFIDPAGWSPWMGNYGLNTLYYGEYQNKGPGADTSKRVT  522

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             WKG ++ I+PE+A  FT     + D  W+  + +P++PG 
Sbjct  523   WKGIQK-ITPEIALSFTAQKVYLND-GWVTNSSVPYTPGL  560



>ref|XP_009792453.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
 gb|AAX13972.1| pectin methylesterase [Nicotiana tabacum]
Length=555

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/567 (53%), Positives = 396/567 (70%), Gaps = 24/567 (4%)
 Frame = -1

Query  3200  NKKVAVTGVASIFLvacvvaatvsvg----ssggGEISTASKSVKEICAPTDYKETCERS  3033
             NKKV + G+ASI +VACVVAA V++     +S  G+++T++KSVK +C PT YK+TCE++
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTKNDETSSSGQVTTSTKSVKAMCQPTPYKQTCEKT  62

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
             L+ AK+  +PK+ IKVAF+ TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I+
Sbjct  63    LSSAKNASEPKDFIKVAFEATVTDIRNAIMNTDLIMQAASDPKTKDALHACEELFDLAIE  122

Query  2852  DLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
             DL  S  K+E+FDL ++K+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T 
Sbjct  123   DLRTSVSKLESFDLTKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMVKLLNTT  182

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              ELS NGLAM+  F E++           R+LLT +            FV+A+ R+LL  
Sbjct  183   RELSINGLAMVNSFGEMITQT----TGLSRKLLTTDESS---------FVEASNRKLLQI  229

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
               A  K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E VEV + M  +V
Sbjct  230   SNA--KPNAVVAQDGSGQYKTITDALKAVPKKNTEPFVILIKAGIYKEYVEVEKGMTNVV  287

Query  2312  FVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             F+GEG TKT+ITG++S K  GIG T+HT TV + G+GF+AR+IGFEN+AG A+ QAVALR
Sbjct  288   FIGEGSTKTKITGNKSVKGPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPAQEQAVALR  347

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD  + +NC ID YQDTLY HS RQFYRDC ISGT+DF+FG+A  VFQNCK+IVR+P 
Sbjct  348   VNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFVFGDAAAVFQNCKLIVRRPG  407

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
               Q CMVTAQGR       A V+Q+CEI AEP   AA P  K FLGRPWKE+SRT+IM +
Sbjct  408   DGQNCMVTAQGRTTSASKGAFVIQNCEIKAEPEFLAAKPQMKAFLGRPWKEYSRTIIMQS  467

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
             FID  + P GW+ W  T + + TCWYAEYQNRG GAS DKRV  W+GY+R IS +VA  F
Sbjct  468   FIDGFIDPSGWAPWNITDFGIHTCWYAEYQNRGAGASLDKRVSHWRGYQRGISGDVANSF  527

Query  1604  TPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             T G F+   D  +L +A IP+  G ++
Sbjct  528   TAGVFINPTDNSFLPKADIPYEAGMMK  554



>ref|XP_011071427.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/522 (54%), Positives = 371/522 (71%), Gaps = 14/522 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ ICAPTDYKETCE SL+ A +T DPKEL+K AF+ T +NI + I  S L +EA 
Sbjct  39    STKAVQSICAPTDYKETCESSLSHA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEAA  97

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
             KD  T  AL+ C+E+L  +IDDL+RSF+    FD  +  EY  DLK WLS  IT  ETCI
Sbjct  98    KDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVITNHETCI  157

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I G++  R+LL+ E   
Sbjct  158   DAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLS-SRKLLSEEEGA  216

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    RRLL    +S+K + VVA DGSGQ+ ++  A+ +VP KN++T VI
Sbjct  217   L--------FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVI  266

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             ++KAG+Y E V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  D F+A+
Sbjct  267   YVKAGLYKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAK  326

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  +F N HID YQDTLY H+YRQ+YRDC+ISGT+DFI
Sbjct  327   DIGFENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFI  386

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL  A PP 
Sbjct  387   FGDALALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPV  446

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+    RV
Sbjct  447   KVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRV  506

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW G + + + ++A+ +T G     DE W+  +  P+ P  +
Sbjct  507   KWPGIQ-HFTQQMAESWTGGRIYGGDE-WIRISGTPYVPTMM  546



>ref|XP_011071421.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=548

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/522 (54%), Positives = 370/522 (71%), Gaps = 14/522 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ ICAPTDYKETCE SL+ A +T DPKEL+K AF+ T +NI + I  S L +EA 
Sbjct  39    STKAVQSICAPTDYKETCESSLSDA-NTTDPKELVKAAFEFTEKNIGEVIKNSSLFQEAA  97

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
             KD  T  AL+ C+E+L  +IDDL+RSF+    FD  +  EY  DLK WLS  IT  ETCI
Sbjct  98    KDNGTKQALEICQEVLDTAIDDLKRSFDTFGEFDATKANEYVEDLKTWLSAVITNHETCI  157

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMKHL+KT  E+SSNGLAM+T+ + +L SL+I G++  R+LL+ E   
Sbjct  158   DAFENTTGDTGEKMKHLMKTTREMSSNGLAMVTNMSSILASLQIGGLS-SRKLLSEEEGA  216

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    RRLL    +S+K + VVA DGSGQ+ ++  A+ +VP KN++T VI
Sbjct  217   L--------FLSNNQRRLLAA--SSLKPNAVVALDGSGQFNTISAAIASVPPKNNQTFVI  266

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             ++KAG+Y E V++P+KMNKIV +G+GP KTRI+G ++  +G+ T+HTATVA+  D F+A+
Sbjct  267   YVKAGLYKEYVQIPKKMNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVAVSADEFMAK  326

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  +F N HID YQDTLY H+YRQ+YRDC+ISGT+DFI
Sbjct  327   DIGFENTAGPQGHQAVALRVSGDRAVFFNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFI  386

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR + R   A V+Q+ +I+AEPAL  A PP 
Sbjct  387   FGDALALFQNCKFVVRKPGPNQACMVTAQGRVEPRSLGATVIQNGDIVAEPALLQATPPV  446

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK  SRT+IM + I   V PEGW+ W G   LDT +YAEYQNRGPG+    RV
Sbjct  447   KVYLGRPWKLLSRTIIMQSNIGGFVAPEGWAEWSGNFALDTLYYAEYQNRGPGSDMKNRV  506

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             KW G + + + ++A+ +T G     DE W+     P+ P  +
Sbjct  507   KWPGIQ-HFTQQMAESWTGGRIYGGDE-WIRITGTPYVPTMM  546



>ref|XP_011091003.1| PREDICTED: pectinesterase-like isoform X1 [Sesamum indicum]
 ref|XP_011091004.1| PREDICTED: pectinesterase-like isoform X2 [Sesamum indicum]
Length=570

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/576 (50%), Positives = 396/576 (69%), Gaps = 31/576 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgssggGEISTAS-KSVKEICAPTDYKETCERSLAGA  3021
             KK+A+  ++S+ LVA V+            +I T S K+ + +C   DYK TCE+SL+ A
Sbjct  6     KKIAMASLSSVLLVAMVLPLATG-------DIPTISNKAAQALCTSVDYKITCEKSLSDA  58

Query  3020  KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDDLER  2841
               ++ P+ELIKVAF   + +I +AI  S L K+A  D RT  AL+ C+E+L  SIDDL R
Sbjct  59    HSSN-PQELIKVAFNHAITDIQEAIKNSTLYKQAATDHRTKGALEVCEEVLDTSIDDLRR  117

Query  2840  SFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELS  2661
             SF++V N D+ ++K+Y  D+KVWLSGAIT  ETC+DAF+NTTGDTGEKMK+LL ++  + 
Sbjct  118   SFDRVGNLDITKLKQYIEDVKVWLSGAITNHETCLDAFQNTTGDTGEKMKNLLHSSGMIL  177

Query  2660  SNGLAMITHFTELLQSLEIPGVNFKRRLLTAE---------TKGeeqeeEF---------  2535
             SNGLAM+   + +  SL + G     RLL  E         T GE+ +  F         
Sbjct  178   SNGLAMVGDISSIFSSLSLGGFT-SGRLLEEEGSLAYGVDQTDGEDLKTAFDGKVTDAAG  236

Query  2534  -PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              P FVDA  RR++T +  ++K +IVVA+DGSGQ+K++  A+ ++P K D   VI +KAG 
Sbjct  237   PPPFVDAEARRIMTANVNTLKANIVVAQDGSGQFKTITGAINSLPKKGDGPFVIHVKAGF  296

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E V  P+K+N +V +G+GP KTRI+GS++  DG+ T+HTA + + GDGFIA++IG EN
Sbjct  297   YKENVIFPKKVNNVVLIGDGPLKTRISGSKNYVDGVQTFHTAVLGVNGDGFIAKDIGIEN  356

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             +AG  KHQAVA+RVS D +IF+N H++ +QDTLY H+YRQ+YRDCTI+GT+DFIFG+A  
Sbjct  357   TAGPIKHQAVAVRVSGDKSIFYNVHMNGFQDTLYAHAYRQYYRDCTITGTIDFIFGDAAA  416

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC+MIVRKP+ANQ CMVTAQGRK+RR     V+Q+C ILAEPA  +  PP K +LGR
Sbjct  417   VFQNCQMIVRKPLANQGCMVTAQGRKERRSTGVTVIQNCHILAEPAFLSTTPPLKAYLGR  476

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYK  1638
             PWK+FSRT+IM T ID  + PEGW+ WQG   LDT +Y E++NRGPG+   +RV+WKG +
Sbjct  477   PWKQFSRTIIMQTLIDGFIAPEGWAPWQGNFALDTLYYGEFKNRGPGSDMSRRVRWKGIQ  536

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               I+P +A  FTPG     DE W+ ++ +P+  G +
Sbjct  537   -TITPAIADSFTPGRLFAGDE-WVRQSGVPYVAGMV  570



>ref|XP_011071425.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/523 (53%), Positives = 371/523 (71%), Gaps = 17/523 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ +CAPTDYK+TCE+SL+ A +T DPKELIK AF+ T +NI D I  S L KEA 
Sbjct  40    STKAVQSVCAPTDYKDTCEQSLSHA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
              D  T  AL  C+E+L  +IDDL+RSF+KV  FD  +  EY  DLK WLS  IT  ETCI
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVITNHETCI  158

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +  R+LL+ E   
Sbjct  159   DAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSSASRKLLSEEEAD  217

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    R L+   P     + VVA+DGSGQ+K++  A+ +VP KN++  VI
Sbjct  218   L--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVI  264

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
              +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A+
Sbjct  265   HVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAK  324

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YR C+ISGT+DFI
Sbjct  325   DIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFI  384

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP 
Sbjct  385   FGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPV  444

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV
Sbjct  445   KVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRV  504

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +W G  ++ SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  505   QWPGI-QHFSPQMAESWTGAKMYQGDE-WIRNSGVPYVPTMMK  545



>ref|XP_010046221.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Eucalyptus grandis]
Length=572

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/572 (50%), Positives = 394/572 (69%), Gaps = 11/572 (2%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssg-------gGEISTASKSVKEICAPT  3060
             M S  + KK+A+  V+S+ LV  VVA    V  S          E+S + K+++ +C P 
Sbjct  1     MASEGKKKKLAIVAVSSLILVVAVVAVVAGVTMSKGDSKQGETKEVSASMKAIEAMCQPA  60

Query  3059  DYKETCERSLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKE+C +SL  A  +  DPKELIK  F V ++ I++A  KS  LKE  KDPRTS AL  
Sbjct  61    DYKESCVKSLETAGPNVTDPKELIKAGFNVAMKKISEAAEKSVTLKELAKDPRTSQALQN  120

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL++ +IDDL+ SF+K+   D+ +V ++  DLK WL  +IT QETC+D FENTT D G
Sbjct  121   CKELMEYAIDDLQSSFDKLGGLDMSKVDDFLADLKTWLGASITYQETCLDGFENTTSDAG  180

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             EKM+  L    EL+SNGLAM+T  + +L +L +  ++  RRLL           EFP ++
Sbjct  181   EKMRKALNATAELTSNGLAMVTEISSVLANLNLNFLSGNRRLLQDSEVQVLGHGEFPMWM  240

Query  2522  DAATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             D   RRLL      ++K D+VVAKDGSG+YK++ EAL+ +P ++++T V+++K GVY E+
Sbjct  241   DPVRRRLLQAKVGVNLKPDLVVAKDGSGKYKTITEALKDIPLRSNKTFVLYVKEGVYREQ  300

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             +   +KM ++  +G+GPTKTRI  + +  DG+ T+ TATVA+ G+ F+A++IGFEN AGA
Sbjct  301   IIFDKKMWRLTLIGDGPTKTRIVYNSNYVDGVNTFKTATVAVLGEQFLAKDIGFENDAGA  360

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
              KHQAVALRV +D ++F+NCH+D YQDTLYTH++RQFYRDCTISGT+DFIFG+A  +FQN
Sbjct  361   IKHQAVALRVQSDFSVFYNCHMDGYQDTLYTHAHRQFYRDCTISGTIDFIFGDASAIFQN  420

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CKM+VRKP+ NQ+C+VTAQGRK+RR  +AI+LQ+C I A+ +        + FLGRPWKE
Sbjct  421   CKMLVRKPLDNQQCIVTAQGRKERRQPSAIILQNCTITADASYVPVKAKFRSFLGRPWKE  480

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+IM +FIDDI+ PEGW  W G   + TC+Y+E+ NRGPG+S   RVKWKG K  I+
Sbjct  481   YSRTIIMQSFIDDIIQPEGWLPWMGDFGIKTCFYSEFGNRGPGSSMTGRVKWKGIK-TIT  539

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             P  A  FT G FL  +  WL +  +PFS G +
Sbjct  540   PAHAVDFTVGTFLRGN-TWLPKFGVPFSAGMV  570



>ref|XP_011071655.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=546

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/523 (53%), Positives = 371/523 (71%), Gaps = 17/523 (3%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ ICAPTDY++TCE+SL+ A +T DPKELIK AF+ T +NI D I  S L KEA 
Sbjct  40    STKAVQNICAPTDYQDTCEQSLSNA-NTTDPKELIKAAFEFTEKNIGDVIKNSPLFKEAA  98

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
              D  T  AL  C+E+L  +IDDL+RSF+KV  FD  +  EY  DLK WLS  IT  ETCI
Sbjct  99    NDDGTKQALAICQEVLDTAIDDLKRSFDKVGEFDALKANEYLEDLKTWLSAVITNHETCI  158

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG  2556
             DAFENTTGDTGEKMK++L+TA ++SSNGLAM+++ + +  SL++ G +  R+LL+ E   
Sbjct  159   DAFENTTGDTGEKMKNVLQTARQMSSNGLAMVSNMSSIFTSLQV-GSSASRKLLSEEEAD  217

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                      F+    R L+   P     + VVA+DGSGQ+K++  A+ +VP KN++  VI
Sbjct  218   L--------FISMKQRSLMGLQP-----NAVVAQDGSGQFKTISAAIASVPQKNNQPFVI  264

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
              +KAGVY E VE+P+K+NKIV +G+GP KTRI+G ++  +G+ T+HTATV++  D F A+
Sbjct  265   HVKAGVYKEYVEIPKKVNKIVLIGDGPLKTRISGRKNYAEGVKTFHTATVSVNADEFFAK  324

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFEN+AG   HQAVALRVS D  IFHN HID YQDTLY H+YRQ+YR C+ISGT+DFI
Sbjct  325   DIGFENTAGPQGHQAVALRVSGDRAIFHNVHIDGYQDTLYAHTYRQYYRACSISGTIDFI  384

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  +FQNCK +VRKP  NQ CMVTAQGR +R    A V+Q+ + +AEPAL  A PP 
Sbjct  385   FGDAQALFQNCKFVVRKPGPNQACMVTAQGRVERHSLGATVIQNGDFVAEPALLQAAPPV  444

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             KV+LGRPWK+ SRT+IM + I   V+PEGWS+W G   L+T +YAEYQNRGPG+ T  RV
Sbjct  445   KVYLGRPWKQLSRTIIMQSNIGGFVLPEGWSVWDGNFALNTLYYAEYQNRGPGSDTKNRV  504

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +W G + + SP++A+ +T       DE W+  + +P+ P  ++
Sbjct  505   QWPGIQ-HFSPQMAESWTENVMYQGDE-WIRNSGVPYVPTMMK  545



>gb|EYU45539.1| hypothetical protein MIMGU_mgv1a004121mg [Erythranthe guttata]
Length=543

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/536 (54%), Positives = 373/536 (70%), Gaps = 31/536 (6%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +ST++K+V  IC PTDYKETCE SLAGA +T DPKELIKVAF   V NI DAI  S L+K
Sbjct  28    VSTSTKAVHAICTPTDYKETCESSLAGA-NTTDPKELIKVAFNAAVNNIADAIKNSTLMK  86

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A  D  T DALD C ++L++++DDL R+ +KV  FD  ++ EY  DLKVWLS  IT QE
Sbjct  87    DAAADNSTKDALDVCNDVLESAVDDLRRAGDKVGEFDATKMDEYVEDLKVWLSAVITYQE  146

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-----VNFKRR  2580
             TCIDAFENTTGDT EKMK+LLKTA ELSSN LAM++  + +L  L++        +  RR
Sbjct  147   TCIDAFENTTGDTAEKMKNLLKTARELSSNSLAMVSDISSILGQLQLGNLGGGGASSGRR  206

Query  2579  LLTAE-----TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEAL  2415
             L++ E     TKG                RLL  +P  +K + VVA+DGSGQ+K++ EA+
Sbjct  207   LMSEEEEPYWTKG----------------RLLAANP--LKPNAVVAQDGSGQFKTIKEAI  248

Query  2414  RAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHT  2235
               +P KN++T +I+IKAG+Y E VE+P+K+NK+VF+G+GP KTRITGS+S   G+ T+ T
Sbjct  249   NTIPKKNNQTFIIYIKAGLYKEHVEIPKKVNKVVFIGDGPFKTRITGSKSFAGGVKTFQT  308

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVA+ G+ F A+NI FEN+AGA  HQAVALRVSAD  IF N  ID YQDTLY H+YRQ+
Sbjct  309   ATVAVNGEEFTAKNIAFENTAGAEGHQAVALRVSADKAIFQNVAIDGYQDTLYAHNYRQY  368

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGT+DFIFG++  +FQNC  IVRKPM NQ CMVTAQGR D R   AIV+Q+  I
Sbjct  369   YRDCTISGTIDFIFGDSLCLFQNCVFIVRKPMDNQACMVTAQGRVDPRSVGAIVIQNSHI  428

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
              AEPA  +  P    +LGRPWKE SRT+IM + ID  + P+GWS W G   LDT +Y EY
Sbjct  429   TAEPAFLSTKPAIDAYLGRPWKELSRTIIMQSEIDGFISPKGWSPWMGNFALDTLYYGEY  488

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             QNRG G+    RV WKG  ++++ + A+++T G     DE W+  + +P+ P  +Q
Sbjct  489   QNRGAGSDLANRVTWKGI-QHMTQQKAEEWTGGAAFRGDE-WITSSGVPYVPTLMQ  542



>dbj|BAO02509.1| predicted pectin esterase ortholog [Nicotiana alata]
Length=555

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/567 (53%), Positives = 397/567 (70%), Gaps = 24/567 (4%)
 Frame = -1

Query  3200  NKKVAVTGVASIFLvacvvaatvsvg----ssggGEISTASKSVKEICAPTDYKETCERS  3033
             NKKV + G+ASI +VACVVAA V++     +S  G+++T++KSV+ +C PT YK+TCE++
Sbjct  3     NKKVVIGGIASILVVACVVAACVTLTKNDETSSSGQVTTSTKSVESMCQPTPYKQTCEKT  62

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
             L+ AK+  DPK+ IKVAF+ TV +I +AI  ++L+ +A  DP+T DAL  C+EL   +I+
Sbjct  63    LSSAKNASDPKDFIKVAFEATVTDIKNAIMNTDLIMQAASDPKTKDALHACEELFDLAIE  122

Query  2852  DLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
             DL  S  K+++FDL ++K+  +DLK WLS  +  +ETC+DAFE T GDTGEKM  LL T 
Sbjct  123   DLRTSVSKLDSFDLSKIKDIVDDLKTWLSAVVAYEETCLDAFEKTDGDTGEKMVKLLNTT  182

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              ELS NGLAM+  F E++           R+LLT   +          F++A+ R+LL  
Sbjct  183   RELSINGLAMVNSFGEMITQT----TGLSRKLLTTTEESS--------FIEASNRKLLQI  230

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
               +S K + VVA+DGSGQYK++ +AL+AVP KN E  VI IKAG+Y E VEV + M  +V
Sbjct  231   --SSAKPNAVVAQDGSGQYKTIKDALKAVPKKNAEPFVILIKAGIYKEYVEVEKGMTNVV  288

Query  2312  FVGEGPTKTRITGSRSNKD-GIG-TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             F+GEG TKT+ITG++  K  GIG T+HT TV + G+GF+AR+IGFEN+AG    QAVALR
Sbjct  289   FIGEGSTKTKITGNKGAKTPGIGSTWHTCTVGVSGEGFVARDIGFENTAGPTLEQAVALR  348

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD  + +NC ID YQDTLY HS RQFYRDC ISGT+DF+FG+A  VFQNCK+IVRKP+
Sbjct  349   VNADKAVIYNCKIDGYQDTLYAHSGRQFYRDCIISGTIDFLFGDAAAVFQNCKLIVRKPL  408

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              +Q CMVTAQGR       AIV+Q+CEI A+P   AA P    +LGRPWKE+SRT+IM +
Sbjct  409   DSQNCMVTAQGRTTSGSKGAIVIQNCEIKADPEFLAA-PRKPAYLGRPWKEYSRTIIMQS  467

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
             FID  + P GWS W  T + L TCWYAEYQNRGPGAS DKRV  W+GY+R IS +VA  F
Sbjct  468   FIDGFIDPAGWSPWNATDFGLHTCWYAEYQNRGPGASLDKRVSHWRGYQRGISGDVANSF  527

Query  1604  TPGPFLM-ADEQWLGRAQIPFSPGFLQ  1527
             T G F+  +   +L +A IP+  G ++
Sbjct  528   TAGQFINPSGSSFLPKADIPYEAGMMK  554



>ref|XP_003631952.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=585

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/573 (50%), Positives = 396/573 (69%), Gaps = 21/573 (4%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacv------------vaatvsvgssggGEISTASKSVKEICAPTDY  3054
             KKVA+ G +SI LVA V             +++ +  +  GG IST+ K+++ IC PTDY
Sbjct  15    KKVALMGFSSILLVAMVVGTVVTVNHRNGSSSSATDDAQAGGGISTSVKAIQAICQPTDY  74

Query  3053  KETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             KE C  SL  AK +T DPKEL++ AF+V +  I+ A+  S  L++ +KDPRT  AL+ C 
Sbjct  75    KEACVNSLTSAKANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCH  134

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             EL+  +IDDL  SF K+  FD+ ++ +Y  DLK+WLSGA+T QETC+D FENTTGD GEK
Sbjct  135   ELMDYAIDDLRNSFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTGDAGEK  194

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAET-KGeeqe---eEFPG  2529
             MK LLK+A EL+SNGLAMI   + +L +L+IPG++  RRLL+ E+ KGE +      +P 
Sbjct  195   MKALLKSAGELTSNGLAMIDEISSVLTNLQIPGIS--RRLLSDESGKGEYRSDEGGLYPS  252

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +     R+L    P +IK +++VA+DGSG+YK++ EAL  +P   + T V+++K GVY E
Sbjct  253   WASVGQRKLFQATPDTIKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKE  312

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
             +V   + M  ++ +G+GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFEN+AG
Sbjct  313   QVNFTKSMTNVMLIGDGPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAG  372

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A+KHQAVALRV +DM IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG++ VVFQ
Sbjct  373   ASKHQAVALRVGSDMAIFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQ  432

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NC ++VRKP+ NQ+C+VTAQGR +RR    IVLQ+C I A           K +LGRPWK
Sbjct  433   NCLILVRKPLDNQQCIVTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWK  492

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
              FSRT+IM + IDD++ PEGW  W G   L+TC+YAEY NRGP ++T  RV W+G K+ I
Sbjct  493   AFSRTIIMQSQIDDLISPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-I  551

Query  1628  SPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + +    FT G F+ +   WLG + +P++   +
Sbjct  552   TGQHVNDFTVGRFI-SGHLWLGASGVPYTSDMM  583



>ref|XP_008458409.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=575

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/527 (51%), Positives = 374/527 (71%), Gaps = 10/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EIS+++K+++ IC PTDYKETCE+SL A A +T DPKEL+KV FK+   ++ +AI  S  
Sbjct  58    EISSSTKAIQAICQPTDYKETCEKSLMAEAGNTTDPKELVKVGFKIATRSLNEAIRNSTT  117

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KDPRT+ AL  C+ELL+ +IDDL  SFE++  F + ++ E+  DLK+WLSGA+T 
Sbjct  118   LQELSKDPRTNQALQNCRELLEYAIDDLNESFERIGTFQMSKLDEFVADLKIWLSGALTY  177

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D FENTTGD G +M+  LK+A E+++NGL ++   + +L SL+IPG+   RRLL 
Sbjct  178   EQTCLDGFENTTGDAGTRMQEFLKSAQEMTTNGLGIVNELSTILGSLQIPGMT-GRRLLE  236

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              +        E P ++    RRL+    A +K D++VA+DGSG+YK++  AL  VP K++
Sbjct  237   DDDH------EMPSWISDGKRRLMQAGAAGMKPDLIVAQDGSGKYKTINAALADVPLKSN  290

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +T VI++KAG+Y E V +P+ M  +   G+GPTKT +TGS +  DGI T+ TAT +  G 
Sbjct  291   KTFVIYVKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGA  350

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F AR++GFEN+AG+AKHQAVALRV +D +IF+NC ID YQDTLY H++RQFYRDCTISG
Sbjct  351   NFYARDMGFENTAGSAKHQAVALRVQSDRSIFYNCQIDGYQDTLYAHAHRQFYRDCTISG  410

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FGNA   FQNCK++VRKPM NQ+C+VTA GR +R+   A++ Q C  + +PA   
Sbjct  411   TIDFVFGNAATNFQNCKLVVRKPMDNQQCIVTAHGRMNRKEPTALIFQGCHFMGDPAYLP  470

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK++SRT+I+ + IDDI+ PEGW  W G   L+T +YAE QN+GPGA 
Sbjct  471   FKSINKAYLGRPWKQYSRTIIIGSQIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGPGAV  530

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRVKW+G K +I+P+ A  FTP  F+  D  W+    IP+S G +
Sbjct  531   ETKRVKWRGIK-HITPQHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  575



>ref|XP_011071431.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=621

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/576 (50%), Positives = 382/576 (66%), Gaps = 57/576 (10%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             ++K+V+ ICAPTDYKETCE SL+ A +T +PKELI+ AF  TV+NI D +  S L KEA 
Sbjct  49    STKAVQSICAPTDYKETCESSLSHA-NTTNPKELIQAAFDFTVKNIGDIVKNSPLFKEAA  107

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCI  2736
              D  T  AL  C+E+L  +IDDL RSF+KV   D  +  EY  DLK WLS  +T QETC+
Sbjct  108   NDDDTKQALQICQEVLDVAIDDLTRSFDKVGELDAAKATEYVEDLKTWLSAVVTNQETCM  167

Query  2735  DAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAET--  2562
             DAFENTTGDTGEKMK+LLKTA E+SSNGLAM+   + L+ SL++ G    R+LL +E   
Sbjct  168   DAFENTTGDTGEKMKNLLKTAREMSSNGLAMVNEMSSLVSSLQL-GNAASRKLLLSEKIG  226

Query  2561  KGeeqeeEFPG-----FVDAATRRLLTT-----------------------DPA------  2484
              G +  +  PG      +D+  RRLL+                        DP       
Sbjct  227   YGGDPTDYAPGEEPQFSLDSNKRRLLSATSLKPNAGVAQDVVLSEKIGYGGDPTDYAPGE  286

Query  2483  -----------------SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
                              S+K + VVA+DGSGQ+ ++  A+ +VP KN++  VI +KAGVY
Sbjct  287   EPHFNLDSNRRHLLSATSLKPNAVVAQDGSGQFNTISAAIASVPPKNNQIFVIHVKAGVY  346

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
              E V++P+KMNKIV +G+GP KTRI+G ++  +G+ TYHTATVA+  D F+A++IGFEN+
Sbjct  347   KEYVQIPKKMNKIVLIGDGPLKTRISGRKNFAEGVKTYHTATVAVNADDFLAKDIGFENT  406

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRVS D  +F+N HID YQDTLY H+YRQ+YRDC+ISGT+DFIFG+A  +
Sbjct  407   AGALGHQAVALRVSGDRAVFYNVHIDGYQDTLYAHTYRQYYRDCSISGTIDFIFGDALAL  466

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCK +VRKP  NQ CM+TAQGR +R      V+Q+ +I+AEPAL  A+PP+KV+LGRP
Sbjct  467   FQNCKFVVRKPGPNQACMITAQGRVERHSLGVTVIQNGDIVAEPALLQASPPHKVYLGRP  526

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK  SRT+IM + I   + PEGW+ W GT  LDT +YAEYQNRGPG+    RV WKG ++
Sbjct  527   WKLLSRTIIMQSNIGGFIAPEGWAPWAGTFALDTLYYAEYQNRGPGSDLKARVTWKGIQK  586

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
              +SP++A+ +T G     DE W+  + +P+ P  +Q
Sbjct  587   -LSPQMAESWTGGKLFGGDE-WIRGSGVPYVPTMMQ  620



>gb|EPS70728.1| pectinesterase, partial [Genlisea aurea]
Length=560

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/521 (53%), Positives = 369/521 (71%), Gaps = 13/521 (2%)
 Frame = -1

Query  3092  SKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADK  2913
             +K+V+ IC+PTDYK+TCE SLAGA +T DPKELIK+AF  TV+ +  AI  S L K+A  
Sbjct  48    TKAVQAICSPTDYKQTCEESLAGA-NTTDPKELIKLAFDNTVKKVRAAILNSTLYKDAAA  106

Query  2912  DPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCID  2733
             DPRT  AL  C+E+L N IDDL+RSF++V +F++ ++ EY +D+K WLSGAI  +E CID
Sbjct  107   DPRTKGALKVCEEVLDNCIDDLQRSFDQVNDFNVNQMDEYIDDIKTWLSGAIANKEACID  166

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe  2553
             A +NTTGDT EKMK +L   +E+ SNGLA++T F+ +  SL++ G    RRL+  + + +
Sbjct  167   AVQNTTGDTAEKMKKVLNATSEMLSNGLAIVTDFSTIFSSLQL-GSFTSRRLMGEDEQQQ  225

Query  2552  eqeeEFPG---FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV  2382
                   PG   FV+ A R+LL  +  S+K +  VA+DGSG +K++  AL  +P K++ T 
Sbjct  226   ------PGIDSFVEFARRKLLAVNINSMKPNATVAQDGSGDFKTIGAALSTLPKKSNATF  279

Query  2381  VIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFI  2202
             VI +KAGVY E V +P+K+N +V  G+GP KTR+  +++  DG+ T+HTAT+A+  DGF+
Sbjct  280   VIHVKAGVYKETVIIPKKVNNVVIYGDGPNKTRVVNNKNYADGVETFHTATLAVNSDGFM  339

Query  2201  ARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVD  2022
             A++I FENSAGA+KHQAVA+RVS D  IF+N  +D YQDTLY H YRQ YR+CTISGT+D
Sbjct  340   AKDIAFENSAGASKHQAVAVRVSGDKAIFYNVVMDGYQDTLYAHGYRQLYRNCTISGTID  399

Query  2021  FIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANP  1842
             FIFG+A  VFQ C+MIVRKP  NQ CMVTAQGRKD+R     V+Q  EI+ EP   A  P
Sbjct  400   FIFGDATAVFQKCRMIVRKPDINQNCMVTAQGRKDQRSIGITVIQDSEIVPEPGFTAVVP  459

Query  1841  PNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDK  1662
                 FLGRPWKE+SRT+IM T+ID  + P GWS W G   L+T +Y EYQNRGPG+ T K
Sbjct  460   KIDAFLGRPWKEYSRTIIMQTYIDGFIDPAGWSPWMGNYALNTLYYGEYQNRGPGSDTSK  519

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             RV WKG K+ I+PE+A+ FT     + D  W+  + +P++P
Sbjct  520   RVTWKGIKK-ITPELAQTFTAQKVFLND-GWVTNSSVPYTP  558



>ref|XP_004150503.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004165248.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN47423.1| hypothetical protein Csa_6G318700 [Cucumis sativus]
Length=576

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/527 (51%), Positives = 376/527 (71%), Gaps = 10/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI++++K+++ IC PTDYKETCE+SL A A +T DPKEL+KV FK+   ++ +AI  S  
Sbjct  59    EITSSTKAIQAICQPTDYKETCEKSLEAEAGNTTDPKELVKVGFKIATRSLNEAIKNSTT  118

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             LKE  KDPRT+ AL  C+ELL+ +IDDL +SFE++  F + ++ ++  DLK+WLSGA+T 
Sbjct  119   LKELAKDPRTNQALQNCRELLEYAIDDLNQSFERIGTFQMSKLDDFVADLKIWLSGALTY  178

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D FENTTGD G +M+  LK+A ++++NGL ++   + +L SL++PG++  RRLL 
Sbjct  179   EQTCLDGFENTTGDAGVRMQEFLKSAQQMTTNGLGIVNELSTILGSLQLPGMS-GRRLLE  237

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              + +      E P +V    RRL+    A++K D+VVA+DGSG+YK++  AL  VP K++
Sbjct  238   DDDR------EMPSWVSDGKRRLMQAGAAAMKPDLVVAQDGSGKYKTINAALADVPLKSN  291

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +T VI +KAG+Y E V +P+ M  +   G+GPTKT +TGS +  DGI T+ TAT +  G 
Sbjct  292   KTFVIHVKAGIYKEIVVIPKHMTHLTMYGDGPTKTVVTGSLNFIDGIQTFKTATFSAIGA  351

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F AR++GFEN+AGAAKHQAVALRV +D +IF NC ID YQDTLY H++RQFYRDCTISG
Sbjct  352   NFYARDMGFENTAGAAKHQAVALRVQSDRSIFFNCQIDGYQDTLYAHAHRQFYRDCTISG  411

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FGNA   FQNCK++VRKP+ NQ+C+VTA GR +R+   A++ QSC  + +PA   
Sbjct  412   TIDFVFGNAATNFQNCKLVVRKPLDNQQCIVTAHGRLNRKEPTALIFQSCHFMGDPAYLP  471

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWKE+SRT+I+ + IDDI+ PEGW  W G   L+T +YAE QN+G GA 
Sbjct  472   FKAINKAYLGRPWKEYSRTIIIGSTIDDIIQPEGWLPWMGDFGLNTLFYAEVQNKGAGAD  531

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRVKW+G K +I+P+ A  FTP  F+  D  W+    IP+S G +
Sbjct  532   ESKRVKWRGIK-HITPQHAADFTPRRFIDGDA-WIPAKGIPYSSGMM  576



>ref|XP_008245483.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/575 (50%), Positives = 393/575 (68%), Gaps = 17/575 (3%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggG--------EISTASKSVKEICAPT  3060
             G   + KK+A+  V+S+FLVA V+A TV V +S           + +T++K+++ IC PT
Sbjct  3     GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSWSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  3059  DYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKETC++SL  A  ++ +PKELIK  FKV ++ + + I  S  L+E  KDP  + AL+ 
Sbjct  63    DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +I DL  SF+K+  FD+ ++  Y  DLK+WLS A+T ++TC+D F+NTTGD G
Sbjct  123   CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE---FP  2532
             EKMK LL +  EL+SNGLAM++  T +L S  +     +RRLL A   G  ++      P
Sbjct  183   EKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVK--QSQRRLLAAGAGGGTKKNTPKVIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAGVY  2355
              ++D  T  +    P S+K D+ VAKDGSGQ KS+ EA++ +P  N D+T VI++K GVY
Sbjct  241   VWIDKRTMDVARATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFENS
Sbjct  301   NEYVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENS  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A VV
Sbjct  361   AGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K +LGRP
Sbjct  421   FQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYILVKDKSKAYLGRP  480

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+
Sbjct  481   WKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK  540

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  541   -LTPEHAVDFTAGR-LMEGDKWIKPSGVPYVAGMV  573



>ref|XP_007227113.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
 gb|EMJ28312.1| hypothetical protein PRUPE_ppa026560mg [Prunus persica]
Length=575

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/575 (49%), Positives = 393/575 (68%), Gaps = 17/575 (3%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggG--------EISTASKSVKEICAPT  3060
             G   + KK+A+  V+S+FLVA V+A TV V +S           + +T++K+++ IC PT
Sbjct  3     GDNNKKKKIAIIAVSSLFLVAMVIAVTVGVTTSRSKGGSKSNDGQTTTSTKAIQAICQPT  62

Query  3059  DYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYKETC++SL  A  ++ +PKELIK  FKV ++ + + I  S  L+E  KDP  + AL+ 
Sbjct  63    DYKETCQKSLESAGVNSTEPKELIKAGFKVAMDKLHEVIKNSTTLQELAKDPGANQALEN  122

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL  +I DL  SF+K+  FD+ ++  Y  DLK+WLS A+T ++TC+D F+NTTGD G
Sbjct  123   CKELLDYAIGDLAASFDKLGPFDISKIDAYAEDLKIWLSAAMTYEQTCLDGFQNTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE---FP  2532
             EKMK LL +  EL+SNGLAM++  T +L S  +     +RRLL A   G+ ++      P
Sbjct  183   EKMKRLLNSTQELTSNGLAMVSEITSVLGSFNVK--QSQRRLLAAGAGGDTKKNTPKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN-DETVVIFIKAGVY  2355
              ++D     +    P S+K D+ VAKDGSGQ KS+ EA++ +P  N D+T VI++K GVY
Sbjct  241   VWIDKRAMDVSRATPQSLKPDVTVAKDGSGQVKSIGEAVKQIPKNNADKTFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             NE V + + M  ++ +G+GPTKT+ITG+++  DG  T+ TATVA+ GD F+A++IGFENS
Sbjct  301   NEHVMIDKFMTNVMMIGDGPTKTKITGNKNYADGTKTFQTATVAVVGDYFVAKDIGFENS  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCTISGT+DFIFG+A VV
Sbjct  361   AGAKGHQAVALRVQSDLSIFYNCQMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAVV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKPM NQ CMVTAQGR DRR   A+VLQ+C I  +P        +K +LGRP
Sbjct  421   FQNCKMIVRKPMDNQACMVTAQGRMDRRQPTAMVLQNCTISGDPEYIPVKDKSKAYLGRP  480

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK  +RT++M + IDDI+ PEGW  W G+    +CW+ EY NRGPG+   +RV W G K+
Sbjct  481   WKALARTIVMQSQIDDIITPEGWMEWTGSTNHKSCWFGEYGNRGPGSDMTRRVTWSGIKK  540

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G  LM  ++W+  + +P+  G +
Sbjct  541   -LTPEHAVDFTAGR-LMEGDRWIKPSGVPYVAGMV  573



>ref|XP_002872255.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48514.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=645

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/527 (52%), Positives = 363/527 (69%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+T+ K++K++CAPTDYKETCE +L   AK+T DP EL+K AF  T++ I+D   KS+ 
Sbjct  48    EITTSVKAIKDVCAPTDYKETCEDTLRKDAKNTSDPLELVKTAFNATMKQISDVAKKSQT  107

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  +I +L +SFE++  F+  +V E    L++WLS  I+ 
Sbjct  108   MIELQKDPRTKMALDQCKELMDYAIGELSKSFEELGRFEFHKVDEALIKLRIWLSATISH  167

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D F+ T G+ GE +K  LKTA +L+ NGLAM++  +  L  ++IP +N  RRLL+
Sbjct  168   EQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVSEMSNYLGQMQIPEMN-SRRLLS  226

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP ++D   RRLL    + +K DIVVA+DGSGQYK++ EAL  VP K +
Sbjct  227   QE---------FPSWMDGRARRLLNAPMSEVKLDIVVAQDGSGQYKTINEALNYVPKKKN  277

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IKAG+Y E V+V R M  +VF+G+GP KT I+GS+S KDGI TY TATVAI GD
Sbjct  278   TTFVVHIKAGIYKEYVQVNRSMTHLVFIGDGPEKTVISGSKSYKDGITTYKTATVAIVGD  337

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+NIGFEN+AGA KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  338   HFIAKNIGFENTAGAIKHQAVAIRVLSDESIFYNCKFDGYQDTLYAHSHRQFYRDCTISG  397

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A
Sbjct  398   TIDFLFGDAAAVFQNCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLA  457

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+SRT+IM TFI D + PEGW  W G   L+T +Y+E QN GPGA 
Sbjct  458   VKENSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLGDFGLNTLFYSEVQNTGPGAP  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRV W G K+ +S E    FTP  ++  D  W+    +P+ PG  
Sbjct  518   ITKRVTWPGIKK-LSEEEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  562



>ref|XP_010024084.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Eucalyptus grandis]
Length=575

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/529 (51%), Positives = 378/529 (71%), Gaps = 8/529 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSE  2934
             E+S + K+++ IC PTDYKE C RSL  AGA +T DPKELIK +FK  +++I +A  KS 
Sbjct  52    EVSASIKAIEGICQPTDYKEACVRSLREAGA-NTADPKELIKASFKAAMKHIAEAAKKST  110

Query  2933  LLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAIT  2754
             +LKE +K PR   AL  CK+L+  +I+DLERSF+K+   +  ++ +   DLKVWLS  +T
Sbjct  111   VLKELEKTPRAQQALSNCKKLMGFAINDLERSFDKLGELEFSKLDDALADLKVWLSAVVT  170

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
              Q+TC+D F+NTTG+ G KM+  LK++ EL+SN LAM+   +  L  + +   NF R+LL
Sbjct  171   YQDTCLDGFQNTTGNAGHKMREALKSSEELTSNVLAMVDEISLALAKMNL--TNFNRKLL  228

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + +       ++F  +  +  R+LL+   A +K ++VVAKDGSG+++++ EAL+ +P  +
Sbjct  229   SDDNV-IGHGDDFSMWATSLKRKLLSKTVAKLKPNLVVAKDGSGRFRTINEALKHIPLNS  287

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +T V+ IKAGVY E+V    KM  ++ VG+GPTKTRI+ +++  DG  T+ TATV++ G
Sbjct  288   RKTFVLHIKAGVYKEQVVFDEKMTNVMLVGDGPTKTRISFNKNYADGTTTFKTATVSVFG  347

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D FIAR+IGFENSAGA KHQAVAL V +DM IFHNCH+D YQDTLY HS RQFYRDCTI+
Sbjct  348   DNFIARDIGFENSAGAIKHQAVALMVRSDMAIFHNCHMDGYQDTLYAHSKRQFYRDCTIT  407

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+ G+A  VFQNCKM++RKP+ NQ+C+VTAQGR  RR A+A++LQ+C I A+P+  
Sbjct  408   GTIDFVLGDAAAVFQNCKMLIRKPLDNQQCIVTAQGRSKRREASALILQNCTITADPSYT  467

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                     +LGRPWK +SRT+IM ++IDDI+ P+GW  W G   L+TC+YAEY+NRGPGA
Sbjct  468   PFKGQILSYLGRPWKAYSRTIIMESYIDDIIQPKGWMPWLGDFGLNTCFYAEYKNRGPGA  527

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             ST +RVKWKG K+ I+P+ A +FT G F+  D +W+  A +P+  G L 
Sbjct  528   STARRVKWKGIKK-ITPQHAVEFTAGRFMKGD-RWIRTAGVPYVAGMLN  574



>ref|XP_010659656.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Vitis vinifera]
Length=589

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/568 (49%), Positives = 396/568 (70%), Gaps = 14/568 (2%)
 Frame = -1

Query  3203  QNKKVAVTGVASIFLvacvvaatvs-------vgssggGEISTASKSVKEICAPTDYKET  3045
             + KK+A+ G +SIFLVA V+A   S        G++   EIS++ K+++ IC PTDYK+ 
Sbjct  12    KKKKLAIIGFSSIFLVAMVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYKDA  71

Query  3044  CERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
             C  SL   A +T DPK+L++ AF   +E+++ A   S LL+E +KDPR S AL  C++L+
Sbjct  72    CVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCEDLV  131

Query  2867  KNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               +IDDL++SF +V +FD  ++     D+K+WLS  IT QETC+D FENTTGD GEKM+ 
Sbjct  132   NYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEKMRQ  191

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG--eeqeeEFPGFVDAA  2514
             +LKT+ ELSSNGLA++   + +L +L++   N  RRLL+ +        ++EFP +  + 
Sbjct  192   ILKTSMELSSNGLAIVGEVSSILSNLQL--ANLNRRLLSDDPADPDNHIDDEFPYWSHSE  249

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              R+LL  + + +K ++ VAKDGSG +K++ EA+R +P  +++T +++IK G+Y E+V++ 
Sbjct  250   GRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQIN  309

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENSAGAAKHQ
Sbjct  310   KTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENSAGAAKHQ  369

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV +D +IF+NC +D YQDTLYTH+ RQFYRDCTISGT+DFIFG+A V+FQNC  +
Sbjct  370   AVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFV  429

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K +LGRPWKEFSRT
Sbjct  430   VRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRT  489

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW+G K  I P  A
Sbjct  490   IIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHA  548

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               F PG FL  D +W+    +P++ G  
Sbjct  549   IDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|NP_198139.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
 sp|Q3E8Z8.1|PME28_ARATH RecName: Full=Putative pectinesterase/pectinesterase inhibitor 
28; Includes: RecName: Full=Pectinesterase inhibitor 28; AltName: 
Full=Pectin methylesterase inhibitor 28; Includes: RecName: 
Full=Pectinesterase 28; Short=PE 28; AltName: Full=Pectin 
methylesterase 28; Short=AtPME28 [Arabidopsis thaliana]
 gb|AED93739.1| putative pectinesterase/pectinesterase inhibitor 28 [Arabidopsis 
thaliana]
Length=732

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/527 (53%), Positives = 362/527 (69%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+T+ K++K++CAPTDYKETCE +L   AKDT DP EL+K AF  T++ I+D   KS+ 
Sbjct  49    EITTSVKAIKDVCAPTDYKETCEDTLRKDAKDTSDPLELVKTAFNATMKQISDVAKKSQT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPR   ALD CKEL+  +I +L +SFE++  F+  +V E    L++WLS  I+ 
Sbjct  109   MIELQKDPRAKMALDQCKELMDYAIGELSKSFEELGKFEFHKVDEALVKLRIWLSATISH  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D F+ T G+ GE +K  LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+
Sbjct  169   EQTCLDGFQGTQGNAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLS  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP ++DA  RRLL    + +K DIVVA+DGSGQYK++ EAL  VP K +
Sbjct  228   QE---------FPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALNFVPKKKN  278

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IK G+Y E V+V R M  +VF+G+GP KT I+GS+S KDGI TY TATVAI GD
Sbjct  279   TTFVVHIKEGIYKEYVQVNRSMTHLVFIGDGPDKTVISGSKSYKDGITTYKTATVAIVGD  338

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+NI FEN+AGA KHQAVA+RV AD +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  339   HFIAKNIAFENTAGAIKHQAVAIRVLADESIFYNCKFDGYQDTLYAHSHRQFYRDCTISG  398

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A
Sbjct  399   TIDFLFGDAAAVFQNCTLLVRKPLLNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLA  458

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+SRT+IM TFI D V PEGW  W G   L+T +Y+E QN GPGA+
Sbjct  459   VKEQSKTYLGRPWKEYSRTIIMNTFIPDFVPPEGWQPWLGEFGLNTLFYSEVQNTGPGAA  518

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRV W G K+ +S E   +FTP  ++  D  W+    +P+  G  
Sbjct  519   ITKRVTWPGIKK-LSDEEILKFTPAQYIQGDA-WIPGKGVPYILGLF  563



>ref|XP_002516960.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF45574.1| Pectinesterase precursor, putative [Ricinus communis]
Length=579

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/572 (48%), Positives = 384/572 (67%), Gaps = 22/572 (4%)
 Frame = -1

Query  3203  QNKKVAVTGVASIFLvacvvaat------------vsvgssggGEISTASKSVKEICAPT  3060
             + KK AV GV+SI LVA VVA               S  S   G++ST++KS++ IC PT
Sbjct  16    RKKKFAVIGVSSIILVAMVVAVAVGVNDGKEKGGESSPLSGSSGQLSTSTKSIQAICQPT  75

Query  3059  DYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE SL   A +T DP +L++  F+V ++ +  AI  S  LKE  KDP    ALD 
Sbjct  76    DYKQTCEDSLNKAAGNTSDPHKLVQAGFQVAIDALKVAIENSTTLKEVAKDPMAKQALDN  135

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +I DL+ SF++V +FD+ ++ EY  +LK+WLS  IT Q+TC+D F+NTTG  G
Sbjct  136   CKELMNTAISDLKTSFQQVGDFDISKLDEYVANLKIWLSATITYQQTCLDGFDNTTGPAG  195

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             +KMK +L T+++L+SNGLAM+T  + +LQ L++ G+  ++ L             FP ++
Sbjct  196   QKMKEILSTSSQLTSNGLAMVTGLSSILQDLDLSGLTGRKLLAQGNDN-------FPSWL  248

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               A RRLL   PA+IK ++VVA+DGSGQYK++ EA++ +P   + T V++IK GVY E V
Sbjct  249   SPAKRRLLAQTPATIKPNMVVAQDGSGQYKTINEAIKNIPKSGNSTFVLYIKEGVYKEVV  308

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
                R +  I+ +G+GPTKT+ITG  S   G+  Y TATV++ G  F+A++IGFENSAGA 
Sbjct  309   TFSRSLTHIMLIGDGPTKTKITGDLSFAGGVQIYKTATVSVSGSHFMAKDIGFENSAGAT  368

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
              HQA+AL+V +DM++F+NC ID YQ+TL++H+YRQFYR+CTI+GT+DFI G+A  VFQNC
Sbjct  369   GHQAIALKVQSDMSVFYNCQIDGYQNTLFSHTYRQFYRECTITGTIDFISGDAAAVFQNC  428

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             KM+VRKP+ NQ C +TAQGR + R     VLQ+C I AE         +  FLGRPWK +
Sbjct  429   KMVVRKPLENQRCTITAQGRNNTREPTGFVLQNCTITAEKDYLPVKLDSPSFLGRPWKPY  488

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT++M + IDDI+ P+GW+ W GT  +DTC  +EY NRGPGA+   RV WKG  + +SP
Sbjct  489   SRTIVMQSSIDDIIDPKGWAPWMGTFGIDTCSLSEYGNRGPGATLTSRVTWKGIVK-LSP  547

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + A+ FT G FL  D  W+    +P++ G ++
Sbjct  548   QDAEAFTAGKFLEGDS-WIAATGVPYTSGMMK  578



>emb|CBI39537.3| unnamed protein product [Vitis vinifera]
Length=769

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/568 (49%), Positives = 398/568 (70%), Gaps = 14/568 (2%)
 Frame = -1

Query  3203  QNKKVAVTGVASIFLvacvvaatvs-------vgssggGEISTASKSVKEICAPTDYKET  3045
             + KK+A+ G +SIFLVA V+A   S        G++   EIS++ K+++ IC PTDYK+ 
Sbjct  12    KKKKLAIIGFSSIFLVAMVIAVIASVSSSSSDSGNAQKQEISSSMKAIQAICQPTDYKDA  71

Query  3044  CERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
             C  SL + A +T DPK+L++ AF   +E+++ A   S LL+E +KDPR S AL  C++L+
Sbjct  72    CVNSLTSKAGNTTDPKDLVQAAFASAMEHLSAAAKNSTLLQELNKDPRASQALQNCEDLV  131

Query  2867  KNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
               +IDDL++SF +V +FD  ++     D+K+WLS  IT QETC+D FENTTGD GEKM+ 
Sbjct  132   NYAIDDLKKSFNQVGDFDYSKMDNIIADIKIWLSAVITYQETCLDGFENTTGDAGEKMRQ  191

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKG--eeqeeEFPGFVDAA  2514
             +LKT+ ELSSNGLA++   + +L +L++  +N  RRLL+ +        ++EFP +  + 
Sbjct  192   ILKTSMELSSNGLAIVGEVSSILSNLQLANLN--RRLLSDDPADPDNHIDDEFPYWSHSE  249

Query  2513  TRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
              R+LL  + + +K ++ VAKDGSG +K++ EA+R +P  +++T +++IK G+Y E+V++ 
Sbjct  250   GRKLLQANVSELKPNLTVAKDGSGDFKTINEAIRQLPKFSNQTFILYIKKGIYEEQVQIN  309

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             +    ++ VG+GPTKT+ITGS +  DG  T+ TATVA+ GDGFIA+ IGFENSAGAAKHQ
Sbjct  310   KTFTNLMMVGDGPTKTKITGSLNFVDGTPTFKTATVAVLGDGFIAKGIGFENSAGAAKHQ  369

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV +D +IF+NC +D YQDTLYTH+ RQFYRDCTISGT+DFIFG+A V+FQNC  +
Sbjct  370   AVALRVQSDRSIFYNCQMDGYQDTLYTHTKRQFYRDCTISGTIDFIFGDAAVIFQNCTFV  429

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VRKP+ NQ+C+VTAQGRK+RR  +AI++Q+    A+P         K +LGRPWKEFSRT
Sbjct  430   VRKPLDNQQCIVTAQGRKERRQPSAIIIQNSTFTADPEYYPYRNELKSYLGRPWKEFSRT  489

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM ++I+D++ P GW  W G   L TC+Y E++NRGPGA T  RVKW+G K  I P  A
Sbjct  490   IIMESYIEDLIQPSGWLPWAGDFALRTCFYTEFRNRGPGAKTHDRVKWRGIK-TIKPSHA  548

Query  1613  KQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               F PG FL  D +W+    +P++ G  
Sbjct  549   IDFAPGRFLSGD-RWIPSTGVPYNSGLF  575



>ref|XP_007224682.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
 gb|EMJ25881.1| hypothetical protein PRUPE_ppa025631mg [Prunus persica]
Length=574

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/575 (49%), Positives = 391/575 (68%), Gaps = 20/575 (3%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggG------EISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S         + ST++K+++ IC PTDY
Sbjct  4     GEVQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  3053  KETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDPR + AL  CK
Sbjct  64    KKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPRANQALQNCK  123

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL+ +IDDL  SF+K+  FD  ++  Y  DLKVWLS A+T ++TC+D FENTTGD GEK
Sbjct  124   ELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAGEK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-----ETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L +SL I      RRLL A     + K  ++ +  P
Sbjct  184   MRQFLKTSQELTSNGLAMVSEVSTLFKSLNI---KTGRRLLQAAATATDEKRFQRAKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  241   AWIDHRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG R+  DG  TY TATV + GD FIA+++GFEN+
Sbjct  301   DEHVFFNKHMTNVMLIGDGPTKTVITGRRNYADGTQTYLTATVGVVGDYFIAKDVGFENT  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  361   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTAQGR DRR  +A++LQ+C I  E         NK +LGRP
Sbjct  421   FQNCKMIVRKPLENQACMVTAQGRLDRRSPSALILQNCTISGERGYD--KELNKAYLGRP  478

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WK ++R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W+G K+
Sbjct  479   WKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFGEFGNRGVGAELSKRVTWRGMKK  538

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  539   -LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_004252915.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=559

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/570 (52%), Positives = 390/570 (68%), Gaps = 31/570 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvs------vgssggGEISTASKSVKEICAPTDYKETCER  3036
             KK+ + G+ASI LVACVV A V+        +S GGEIS+++KSV+ +C PT YKETC +
Sbjct  7     KKIVIAGIASILLVACVVGAAVTFTKKNDDSTSNGGEISSSTKSVQAMCQPTQYKETCAK  66

Query  3035  SLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSI  2856
             SL  AK+T +PKELIK AF  T+  IT++I  S   KEA  DPRT +AL  C E+L  SI
Sbjct  67    SLGSAKNTTNPKELIKAAFDNTLTEITNSIKNSAPFKEAANDPRTKNALKVCDEVLDRSI  126

Query  2855  DDLERSFEKVENFDLER-VKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             ++++RSF K+++ DL++ +KEY  D++ WLS A+T +ETCIDAF NTTGDTGEKMK++LK
Sbjct  127   EEIKRSFSKIDSNDLDKLIKEYIYDVRSWLSSAVTLEETCIDAFANTTGDTGEKMKNILK  186

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             TA+ELSS  L +++ F E +  L+  G+   RRLL AE               A  RRLL
Sbjct  187   TASELSSVALDIVSSFEEQMVGLQGLGIT-NRRLLVAE---------------AGNRRLL  230

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 A++K ++VVA+DGSGQ+KS+ EAL+ VP  N +  VIFIKAG+YNE +EV   M  
Sbjct  231   QI--ATLKPNVVVAQDGSGQHKSINEALKTVPPNNAQPYVIFIKAGIYNENIEVANTMTN  288

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +VF+GEG  KT+IT +++  DG+  + TATV+I G GF+A++I FENSAG  K +AVALR
Sbjct  289   VVFIGEGSNKTKITSNKNYLDGLPIFQTATVSISGQGFVAKDIAFENSAGPLKKEAVALR  348

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP-  1962
             VSA+MT F NC ID YQ TL TH  RQFYRDCTISGT+DFIFG+A  V QNCK+I RKP 
Sbjct  349   VSAEMTAFQNCQIDGYQSTLMTHIGRQFYRDCTISGTIDFIFGDAVAVLQNCKIIARKPE  408

Query  1961  -MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP-NKVFLGRPWKEFSRTLI  1788
              M  Q   + AQGR +  G   I++Q+C I AEPAL A NPP NK FLGRP K +SRT++
Sbjct  409   EMQTQAITIAAQGRMEPSGTGIIIIQNCTITAEPALVAINPPRNKAFLGRPAKMYSRTIV  468

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             M + ID  + PEGW+ + GT  L+T ++ EYQNRGPGA+TD+RV WK Y +N   +V  +
Sbjct  469   MQSQIDGFIEPEGWTPFFGTFGLETLYFVEYQNRGPGANTDERVTWKSYMKNPPQDVIAK  528

Query  1607  FTPGPFLMADEQ---WLGRAQIPFSPGFLQ  1527
             F PG  L   +    W+ +  +P+ P  ++
Sbjct  529   FAPGVVLKGGDNTDGWVTKTGVPYEPAMMK  558



>gb|KDP27834.1| hypothetical protein JCGZ_18914 [Jatropha curcas]
Length=569

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/572 (49%), Positives = 385/572 (67%), Gaps = 19/572 (3%)
 Frame = -1

Query  3218  MGSPE-QNKKVAVTGVASIFLvacvvaat-------vsvgssggGEISTASKSVKEICAP  3063
             +G P  + KK A+ GV S  LVA V+A            GS+   EI+T+SKSV+ IC P
Sbjct  6     VGDPTGKKKKYAIFGVTSFLLVAMVIAVAYGINSGDHQDGSNPSAEITTSSKSVQSICQP  65

Query  3062  TDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDY+E CE+SL   A +T DP +L++  F+VT++ +  A+  S  LKE  KDP    ALD
Sbjct  66    TDYREICEKSLRKAAGNTTDPHKLVQAGFQVTIDALQQALQNSSTLKEVAKDPMAKQALD  125

Query  2885  TCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              CKEL+ ++I DL+ SFE+V +FD+ ++ EY  +LK+WLS  IT Q+TC+D F+NTTG  
Sbjct  126   NCKELMDDAIHDLKVSFEEVGHFDVSKMDEYLENLKIWLSATITYQQTCLDGFDNTTGPA  185

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGF  2526
             G KMK +L  +++LSSNGLAMIT  + +L+ L + G+   RRLL   ++       FP +
Sbjct  186   GAKMKEILTLSSQLSSNGLAMITGLSSMLKDLNLAGLT-GRRLLKDNSE-------FPSW  237

Query  2525  VDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNER  2346
             +    RRLL   P ++K DIVVAKDGSGQYK++ EA+  +P   + T VI+IK G+Y E+
Sbjct  238   LSHEKRRLLAQTPDTVKPDIVVAKDGSGQYKTINEAVHKIPKNQNTTFVIYIKKGIYKEQ  297

Query  2345  VEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGA  2166
             V + R +  I+ +G+G TKTRITG  +   G+ T  T+TV++ G+ FIA++IGFEN+AGA
Sbjct  298   VTISRSVTHIMMIGDGATKTRITGDLNYAAGVQTLQTSTVSVSGNHFIAKDIGFENTAGA  357

Query  2165  AKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQN  1986
               HQAVALRV +DM+IF+NC +D YQDTL+ H++RQFYRDCTI+GT+DFIFG+A  VFQN
Sbjct  358   IGHQAVALRVQSDMSIFYNCQMDGYQDTLFAHTHRQFYRDCTITGTIDFIFGDAAAVFQN  417

Query  1985  CKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKE  1806
             CK++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+P        NK +LGRPWKE
Sbjct  418   CKIVVRKPLENQNCVVTAQGRNESREATGFVLQNCNITADPEYYPVRFENKAYLGRPWKE  477

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV WKG K+ +S
Sbjct  478   YSRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LS  536

Query  1625  PEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              + A  FT   F+  D  W+    + ++ G +
Sbjct  537   AQDAAAFTVAKFIGGD-LWIPATGVSYASGMM  567



>ref|XP_009352341.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=578

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/534 (51%), Positives = 370/534 (69%), Gaps = 14/534 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              ++T++K++K IC PTDYKETCERSL + A ++ +PK+LIK  F VT++ +   I  S  
Sbjct  49    HVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KD  T+ AL+ CKELL+ +IDD+  SF+K+  FD+ ++ +Y  DLKVWLS AIT 
Sbjct  109   LQELAKDESTNQALENCKELLEYAIDDITTSFQKLGPFDISKIDDYAEDLKVWLSAAITY  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NT GD GEKMKH L T  +L+SNGLAM+T  T +L SL +     +RRLL 
Sbjct  169   QQTCLDGFQNTKGDAGEKMKHFLNTTQQLTSNGLAMVTEITSVLGSLNLKA--NRRRLLA  226

Query  2570  AE---TKGeeqeeEFPGFVDAATRRLL---TTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
                  +  +   +  P +++   +R L   T  P SIK D VVAKDGSGQY+++ EA++ 
Sbjct  227   GGGGGSNAKNAPKVIPTWIN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKM  284

Query  2408  VPFKN-DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
             +P  N D+T VI++K GVY+E V + + M  ++ +G+G TKT++TGS++   G+ T+ TA
Sbjct  285   IPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGATKTKVTGSKNFAAGVQTFQTA  344

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV + GD FIA++IG ENSAGA  HQAVALRV +D++IF+ C +D YQDTLYT ++RQFY
Sbjct  345   TVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFY  404

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCTISGT+DFIFG+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I 
Sbjct  405   RDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTIS  464

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
              +P        NK +LGRPWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+
Sbjct  465   GDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYR  524

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPG+   KRVKW G K N+  + A  FT G F+  D +W+  + +P+  G +
Sbjct  525   NRGPGSDMSKRVKWSGIK-NLGADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_010546739.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=666

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/527 (51%), Positives = 360/527 (68%), Gaps = 15/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++KE+CAPTDYK+TCE +L   AK+T DP EL+K AF VT++ I +A  KS+ 
Sbjct  53    EITASVKAIKEVCAPTDYKKTCEETLTKNAKNTTDPMELVKTAFDVTMKQIAEAAKKSQT  112

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E  KDPRT  ALD C+EL+  +ID+L+ SFE++  F+  ++ E   +L++WLS AI+ 
Sbjct  113   LVELQKDPRTKMALDQCRELMNYAIDELKSSFEELGKFEFHKLDEALINLRIWLSAAISH  172

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             + TC++ FE T G+ GE MK  LKTA +L+ NGLAM++  +  +  L+IPG+N  RRLL+
Sbjct  173   ETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAMVSEMSNFVGQLDIPGLN-SRRLLS  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             ++         +P +V   +R LL      +K DIVVA+DGSGQYK++ EAL  +P K +
Sbjct  232   SD---------YPSWVGPRSRHLLAA--TEVKPDIVVAQDGSGQYKTINEALDNIPKKRN  280

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IKAG+Y E ++V R M  +VF+G+GP KT I+G +  KDGI T+ T TVAI GD
Sbjct  281   STFVVHIKAGLYKEYIQVNRSMTNLVFIGDGPDKTIISGDKGFKDGITTFRTQTVAIIGD  340

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+NIGFEN+AGA KHQAVA+RV +DM +FHNC  D YQDTLYTHS+RQF+RDCTISG
Sbjct  341   NFIAKNIGFENTAGAIKHQAVAVRVQSDMAVFHNCRFDGYQDTLYTHSHRQFFRDCTISG  400

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG++  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C I  EP   A
Sbjct  401   TIDFLFGDSATVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCRIEGEPDYLA  460

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+SRT+IM TFI D V P+GW  W     L T +Y+E QN GPG+ 
Sbjct  461   VKASSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWNADFGLKTLFYSEIQNTGPGSD  520

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+  S ++  QFTP  F+  D  W+    +P++PG L
Sbjct  521   LASRVTWAGIKKLTSKDI-DQFTPAKFIQGDS-WIPATGVPYTPGLL  565



>ref|XP_009111740.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=701

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/527 (51%), Positives = 366/527 (69%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++K++CAPTDYK+TCE +L   AKDT DP EL++ AF  T++ I++   KS  
Sbjct  48    EITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVAKKSLT  107

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD C EL+  +I +L +SF+++  F+L +V +    LKVWLS  I+ 
Sbjct  108   MIELQKDPRTKMALDQCTELMDFAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISH  167

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D F+ T GD GE MK  LKTA +L+ NGLAM++     L  +E+P +N  RRLL+
Sbjct  168   EQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMN-SRRLLS  226

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP +VD   RRLL    + +K D+VVA+DGSGQYK++ EALR VP KN+
Sbjct  227   QE---------FPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALRNVPKKNN  277

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IK+G Y E V+V R M  +VF+G+GPTK+ I+G++S KDGI TY TATVAI GD
Sbjct  278   ATFVVHIKSGTYKEYVQVNRTMPNLVFIGDGPTKSIISGNKSFKDGITTYRTATVAIIGD  337

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GFEN+AGA  +QAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTI+G
Sbjct  338   NFIAKNMGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITG  397

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ANQ C +TA GRKD R +   VLQ C I  E    A
Sbjct  398   TIDFLFGDAAAVFQNCTLLVRKPLANQACPITAHGRKDPRESTGFVLQGCTIAGEADYLA  457

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+S+T+IM TFI D +  EGWS WQG   LDT +Y+E +N GPGA+
Sbjct  458   VKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAA  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W+G K+ +S E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  518   VANRVTWQGIKK-LSEEEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_010268337.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Nelumbo nucifera]
Length=627

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/535 (50%), Positives = 370/535 (69%), Gaps = 10/535 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I ++ K++K IC PTDYKETC +SL+ A  +T DPKEL++V F+V +++I +A+S+SE 
Sbjct  58    DIQSSMKAIKAICQPTDYKETCVQSLSSAAGNTTDPKELVRVGFQVAMKHIREALSQSET  117

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             LKE +KDPR   AL +C+EL+  +IDDL+ SF+K+  FD+ +V     DLKVWL+   T 
Sbjct  118   LKEVEKDPRAKQALLSCQELMDYAIDDLKNSFDKLGAFDISKVDNILADLKVWLTSVNTY  177

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q TC D FENTTGD GE+MK  LKT+ EL+ N LAM+   + +L  L+IP +N +R   T
Sbjct  178   QVTCTDGFENTTGDAGERMKKALKTSGELTENALAMVDEISSILNQLQIPALNRRRLFST  237

Query  2570  AETKGeeqeeE-----FPGFVDAATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRA  2409
              E+    +         P ++    R+LL T P  ++K D+VVAKDG+G + +++EAL +
Sbjct  238   KESAESSETPTTAEDDIPAWIPNEHRKLLFTGPLDALKPDLVVAKDGTGNFATILEALES  297

Query  2408  VP-FKNDETVVIFIKAGVYNERVEVPRKM-NKIVFVGEGPTKTRITGSRSNKDGIGTYHT  2235
             +P  K ++T++++IK GVY+E VE+ R +    +  G+GPT+T+ITGS +  DG  T+ T
Sbjct  298   LPKTKENKTIIMYIKEGVYSEIVEISRNLTGSFIMYGDGPTRTKITGSLNFIDGTPTFKT  357

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATV++   GFI ++IG EN+AGA KHQAVAL+V ADM +F NC +D YQDTLY HS R F
Sbjct  358   ATVSVNAHGFICKDIGIENAAGAEKHQAVALKVVADMVVFFNCQMDGYQDTLYAHSGRHF  417

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             +RDCTISGT+D+IFGN   +FQNCKM++RKPM NQ  +VTAQGRK  R  +AIVLQ C I
Sbjct  418   FRDCTISGTIDYIFGNGESIFQNCKMVIRKPMVNQANIVTAQGRKTEREVSAIVLQGCTI  477

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
              A+P+L       K +LGRPWKEFSRT+IM T IDD + P+GW  W G   L TC+YAE+
Sbjct  478   SADPSLVPEKNVFKSYLGRPWKEFSRTIIMETDIDDSISPDGWMPWMGDFGLQTCYYAEF  537

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              NRGPGA    RVKW G K  ++PE A+++T  P++ AD+ W+    IP+ PG +
Sbjct  538   NNRGPGAVLTNRVKWPGIKTPLTPEQAQEYTAAPYIQADD-WVKPLGIPYVPGLM  591



>ref|XP_008223242.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=569

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/527 (51%), Positives = 360/527 (68%), Gaps = 7/527 (1%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +++ K+++ IC  T YKETC+ SL   A DT DPKELIK  F+V  + + + I  S  LK
Sbjct  45    ASSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKAGFQVAADKLDEVIQNSNTLK  104

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +  KDP  S ALD CKE+L  S +DL  + +K+  FD  ++ EY  DLKVWLS A+  Q+
Sbjct  105   DLAKDPMASQALDVCKEMLDTSTEDLLAAVDKMGPFDASKMNEYVEDLKVWLSAAVNHQQ  164

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+DAFE T G+ GEKMK  LKTA EL+SNGLAM++  + LL SL     + +RRLL + 
Sbjct  165   TCLDAFEGTKGEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGSLN--SNSHRRRLLGSS  222

Query  2564  TKGeeqeeE--FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             + G+ +      P ++ A    LLT  P S+K ++VVA+DG+G+YKS+ EAL+ VP K+ 
Sbjct  223   SGGQSKRVYKPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSITEALKEVPKKSA  282

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IK GVY E V V ++M  +V +G+GPTKTRI+GS++  DG  T +TAT A  GD
Sbjct  283   QPFVIYIKEGVYKEYVIVDKEMTNVVMIGDGPTKTRISGSKNYADGTATMYTATFAAVGD  342

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A+ IGFEN+AGAAKHQAVALRV +D +IF+NC+IDAYQDTLYT +YRQ+YRDCTISG
Sbjct  343   YFVAKGIGFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTISG  402

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+   +FQNC+M+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A
Sbjct  403   TVDFIFGDGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYMA  462

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 NK +LGRPWK F+R +++ + IDD + PEGW+ W G  +  +C+ AE  NRG GA 
Sbjct  463   VKDKNKAYLGRPWKGFARVVVIQSQIDDAIAPEGWTEWTGEKFHTSCFVAESGNRGAGAD  522

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRVKW+  K+ ++PE A  FTP      D +W+  + +P+  G +
Sbjct  523   MSKRVKWQTLKK-LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  567



>ref|XP_002318979.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
 gb|EEE94902.2| hypothetical protein POPTR_0013s01500g, partial [Populus trichocarpa]
Length=598

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/525 (53%), Positives = 370/525 (70%), Gaps = 8/525 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K+VK IC PTDY++TCE SL   A +T DPKELIK+AFK+  + I +A  KS+L
Sbjct  54    QVSASVKAVKAICQPTDYRKTCEESLQKAAGNTTDPKELIKIAFKIAEKQINEASEKSKL  113

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KDPRT  AL +CKEL+  S+ +L++S +KV +FDL  +++   D+K WLS +IT 
Sbjct  114   LEELSKDPRTRGALQSCKELMNMSVGELKQSLDKVTDFDLSELEKMMADVKTWLSASITY  173

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF-KRRLL  2574
             QETC+D FENTT D G+KMK  +K   ELS+N L +++  +  + SLE    +F  RRLL
Sbjct  174   QETCLDGFENTTTDAGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE----SFTHRRLL  229

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
               +       ++FP + D  TRRLL    + IK DIVVAKDGSG + ++ EAL+ VP K+
Sbjct  230   QDDLPVLGHGDQFPTWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKS  289

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +  V+ IKAGVY E +E+ + M  +V +G+G   TRI G+++  DGI T+HTATVA+ G
Sbjct  290   KKAFVLHIKAGVYQEYLEISKGMINLVVIGDGKENTRIIGNKNFVDGINTFHTATVAVLG  349

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A+NIGFEN+AGA KHQAVALRVSAD  IF+NC +D +QDTLYTH+ RQFYRDC+IS
Sbjct  350   DNFVAKNIGFENNAGAIKHQAVALRVSADYAIFYNCSMDGHQDTLYTHAKRQFYRDCSIS  409

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNCK +VRKP+ NQ+C+VTAQGRK RR  +A+++QS  I A P L 
Sbjct  410   GTIDFVFGDASAVFQNCKFLVRKPLENQQCIVTAQGRKMRRQPSALIIQSSTITAHPDLF  469

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPWKE+SRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+
Sbjct  470   PERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGS  529

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             S + RVKW G K  I+ + A  FTPG FL  D  W+    IP++P
Sbjct  530   SKNLRVKWNGIK-TINRQHAMDFTPGRFLKGDS-WIKATGIPYTP  572



>gb|KDP27833.1| hypothetical protein JCGZ_18913 [Jatropha curcas]
Length=569

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/571 (49%), Positives = 384/571 (67%), Gaps = 19/571 (3%)
 Frame = -1

Query  3215  GSPE-QNKKVAVTGVASIFLvacvvaat-------vsvgssggGEISTASKSVKEICAPT  3060
             G P  + KK A+ GVAS  LVA V+A            GS+   EIST+SKSV+ IC PT
Sbjct  7     GDPTGKKKKYAIFGVASFLLVAMVIAVAYGINSGDHQNGSNASAEISTSSKSVQAICQPT  66

Query  3059  DYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DY+E C +SL+  A +T DP +L++  F+VT++ +  A+  S  LK+  KDP    ALD 
Sbjct  67    DYREICGKSLSKAAGNTTDPLKLVQAGFQVTIDALQQALQNSSTLKDVAKDPMAKQALDN  126

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+ ++I DL+ SFE+VE+FD+ ++ EY  +LK WLS  IT Q+TC+D F+NTTG  G
Sbjct  127   CKELMDDAIHDLKVSFEEVEHFDVNKMDEYLANLKTWLSATITYQQTCLDGFDNTTGPAG  186

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
              KMK +L  +++LSSNGLA+IT  +  L+ L + G    RRLL   ++       FP ++
Sbjct  187   AKMKEILTLSSQLSSNGLALITGLSSTLKDLNLAGFT-GRRLLKDNSE-------FPSWL  238

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL   P +IK DIVVAKDGSGQYK++ EA+  +P K + T VI+IK G+Y ++V
Sbjct  239   SHEKRRLLAQTPDTIKPDIVVAKDGSGQYKTINEAVHKIPKKQNTTFVIYIKKGIYKQQV  298

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              + R ++ I+ +G+G TKT+ITG  +   G+ T+ T+TV++ G  FIA++IGFEN+AGA 
Sbjct  299   TISRSLSHIMMIGDGATKTKITGDLNYAAGVQTFKTSTVSVSGSHFIAKDIGFENTAGAI  358

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
              HQAVALRV +DM+IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG+A  VFQNC
Sbjct  359   GHQAVALRVQSDMSIFYNCQMDGYQDTLYAHTHRQFYRDCTITGTIDFIFGDAAAVFQNC  418

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             K++VRKP+ NQ C+VTAQGR + R A   VLQ+C I A+         NK +LGRPWKE+
Sbjct  419   KIVVRKPLENQNCIVTAQGRNESREATGFVLQNCNITADREYYPVRFENKAYLGRPWKEY  478

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M   IDD++ P+GW  W G+  LDT  Y+EY+NRGPG+ T  RV WKG K+ +S 
Sbjct  479   SRTVYMQCQIDDLIDPKGWLPWMGSFALDTLSYSEYENRGPGSVTKDRVTWKGIKK-LSA  537

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             + A  FT   F+  D  W+    I ++ G +
Sbjct  538   QDADAFTVAKFIGGD-LWIPDTGISYASGMM  567



>ref|XP_008390623.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Malus domestica]
Length=578

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/534 (50%), Positives = 368/534 (69%), Gaps = 14/534 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              ++T++K++K IC PTDYKETCERSL + A ++ +PK+LIK  F VT++ +   I  S  
Sbjct  49    HVTTSTKAIKAICQPTDYKETCERSLESAAGNSTEPKDLIKAGFNVTMDKLRAIIKNSTT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KD  T+ AL+ CKELL+ +IDDL  SF+K+  FD+ ++ +Y  DLKVWLS AIT 
Sbjct  109   LQELAKDESTNQALENCKELLEYAIDDLTTSFQKLGPFDISKIDDYAEDLKVWLSAAITY  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NT GD G+KMK  L T  +L+SNGLAM+T  T +L SL +     +RRLL 
Sbjct  169   QQTCLDGFQNTKGDAGDKMKRFLNTTQQLTSNGLAMVTEITSVLGSLNLKA--NRRRLLA  226

Query  2570  AET---KGeeqeeEFPGFVDAATRRLL---TTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
                     +   +  P +++   +R L   T  P SIK D VVAKDGSGQY+++ EA++ 
Sbjct  227   GGGGGGNAKNAPKVIPTWIN--NKRSLDVSTVTPQSIKPDAVVAKDGSGQYETIGEAVKM  284

Query  2408  VPFKN-DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
             +P  N D+T VI++K GVY+E V + + M  ++ +G+G  KT++TGS++   G+ T+ TA
Sbjct  285   IPKNNADKTFVIYVKEGVYSEYVMIDKYMTNVMLIGDGAXKTKVTGSKNFAAGVQTFQTA  344

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV + GD FIA++IG ENSAGA  HQAVALRV +D++IF+ C +D YQDTLYT ++RQFY
Sbjct  345   TVVVVGDYFIAKDIGIENSAGAEGHQAVALRVQSDLSIFYRCQMDGYQDTLYTQTHRQFY  404

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCTISGT+DFIFG+A VVFQNCKMIVRKPM NQ CMVTAQGR DRR  + I+LQ+C I 
Sbjct  405   RDCTISGTIDFIFGDAAVVFQNCKMIVRKPMDNQACMVTAQGRIDRRQPSGIILQNCTIS  464

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
              +P        NK +LGRPWK  +RT++M + ID I+ PEGW  W G+    +CW+ EY+
Sbjct  465   GDPEYIPVKDKNKSYLGRPWKNLARTVVMQSQIDGIIAPEGWMEWTGSNNHQSCWFGEYR  524

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPG+   KRVKW G K N+S + A  FT G F+  D +W+  + +P+  G +
Sbjct  525   NRGPGSHMSKRVKWSGIK-NLSADQAVAFTSGKFVEGD-KWIKPSGVPYVAGMV  576



>ref|XP_008245480.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Prunus mume]
Length=575

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/577 (49%), Positives = 390/577 (68%), Gaps = 22/577 (4%)
 Frame = -1

Query  3215  GSPEQNK--KVAVTGVASIFLvacvvaatvsvgssggG------EISTASKSVKEICAPT  3060
             G   QNK  K+A+ GV+++ LVA VVA TV V  S         + ST++K+++ IC PT
Sbjct  3     GGEAQNKRKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPT  62

Query  3059  DYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDP ++ AL  
Sbjct  63    DYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSSNQALQN  122

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL+ +IDDL  SF+K+  FD  ++  Y  DLKVWLS A+T ++TC+D FENTTGD G
Sbjct  123   CKELLEYAIDDLGDSFDKLGPFDFTKLDAYVEDLKVWLSAAMTYEQTCLDGFENTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA-----ETKGeeqeeE  2538
             EKM+  LKT+ EL+SNGLAM++  + L ++L I      RRLL A     + K  ++ + 
Sbjct  183   EKMRQFLKTSQELTSNGLAMVSEVSTLFKALNI---KTGRRLLQAAATATDEKRFQKAKI  239

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAG  2361
              P ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K G
Sbjct  240   IPAWIDHRKLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEG  299

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++IGFE
Sbjct  300   VYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGFE  359

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A 
Sbjct  360   NTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  419

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP+ NQ CMVTA GR DRR   A++LQ+C I  E         NK +LG
Sbjct  420   AVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTALILQNCTISGESGYD--KELNKAYLG  477

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK ++R ++M + IDD++ PEGW  W G    +TCW+ E+ NRG GA   KRV W+G 
Sbjct  478   RPWKSYARAIVMQSQIDDVIAPEGWMDWTGASNHNTCWFGEFGNRGVGAELSKRVTWRGM  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  538   KK-LTPEHAADFTAGKFIFGD-RWILPSGVPYVAGMM  572



>ref|XP_008223241.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=563

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/523 (50%), Positives = 364/523 (70%), Gaps = 7/523 (1%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEA  2919
             + K+++ IC PT YKETC+ SL   A DT DPKEL+K  F+V  + + + I  S+ LK+ 
Sbjct  45    SKKAIEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDL  104

Query  2918  DKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETC  2739
              KDP  S ALD CKELL  +++DL  + +K+  F++ +V +Y  DLKVWLS A+  Q TC
Sbjct  105   AKDPMASQALDICKELLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATC  164

Query  2738  IDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK  2559
             +DAF++T G+ G+KMK  LKTA EL+SNGLAM T  + LL SL +   N  RRLL+AE K
Sbjct  165   VDAFKDTKGEAGDKMKGFLKTAQELTSNGLAMATQISSLLGSLNL---NSHRRLLSAE-K  220

Query  2558  GeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVV  2379
              +   +  P ++ A   +LLT  P ++K ++VVA+DG+G+YK++ EAL+ VP K++ET V
Sbjct  221   SKRNYQAVPSWMGARQLQLLTATPQNLKPNVVVAQDGTGKYKTITEALKEVPKKSNETFV  280

Query  2378  IFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIA  2199
             I+IK GVY E++ + R+M  +  +G+GPTKT+I+G+++  DG  T HTAT A  GD F+A
Sbjct  281   IYIKEGVYKEQIIIDRQMTNVFMIGDGPTKTKISGNKNKADGTATMHTATFAAVGDYFVA  340

Query  2198  RNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDF  2019
             ++I FEN+AG  KHQAVALRV +D +IF+NCH+DAYQDTLYT +YRQ+YRDCTI+GTVDF
Sbjct  341   KDIRFENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDF  400

Query  2018  IFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPP  1839
             IFG+   +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    
Sbjct  401   IFGDGVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDK  460

Query  1838  NKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKR  1659
             NK +LGRPWK+F+R ++M + ID+ + PEGW  W G+M+ +TC+  EY N+GP A   +R
Sbjct  461   NKAYLGRPWKDFARVVVMQSQIDEAIQPEGWIEWAGSMFHNTCFLGEYGNKGPRADMAQR  520

Query  1658  VKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             VKW   K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  521   VKWPSLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  561



>ref|XP_009385286.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=576

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/527 (50%), Positives = 369/527 (70%), Gaps = 8/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E++T SK+++ IC PTDY E C+ SLA  A +  DPK+L++++F   ++++ +A + S +
Sbjct  57    ELTTTSKAIRAICRPTDYAEECQSSLAARAGNVTDPKKLVELSFTSAMDSLREAFNHSSV  116

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+EA KDPRTS+AL+ CKELL  +IDDL+ S  +    D+ ++ +  +DLKVWLS  IT 
Sbjct  117   LQEAAKDPRTSEALENCKELLDYAIDDLKNSVARFGGVDMAKMSDVVDDLKVWLSATITY  176

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NTTGD  + M   L +++ L+SN LA+I   + +L S ++  +   RRLL+
Sbjct  177   QQTCLDGFDNTTGDAADNMSKALNSSSALTSNALAIIDGISSVLASFQLSSLG--RRLLS  234

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              +   E +  EFP +V    R+LL      IK D+ VA+DGSG+YK++ +AL AVP K +
Sbjct  235   DD---EGERGEFPSWVGNDKRKLLALSTKDIKPDVTVAQDGSGKYKTITQALSAVPKKGN  291

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T VI+IK GVY E V V R M  ++  G+GPTKT+ITGS +  DG  T+ TAT+A+ GD
Sbjct  292   ATFVIYIKEGVYKENVMVDRSMTNVMMFGDGPTKTKITGSLNYVDGTSTFKTATLAVVGD  351

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GFI +N+G EN+AGAAKHQAVALRV +D ++F+ C +D YQDTLYTH+ RQFYR+CTISG
Sbjct  352   GFIGKNLGVENTAGAAKHQAVALRVQSDKSVFYLCQMDGYQDTLYTHTKRQFYRECTISG  411

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A VVFQNC M+VRKPMANQ+C+VTAQGRKDR  A  IVL +C I A+P L +
Sbjct  412   TIDFLFGDAAVVFQNCLMLVRKPMANQQCIVTAQGRKDRHEATGIVLHNCTISADPTLSS  471

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
             A+     +LGRPWKE+SRT+IM + ID ++  +GW  W G   L TC+Y E  NRGPGA+
Sbjct  472   ASTTTVSYLGRPWKEYSRTIIMQSQIDGLINEDGWQPWLGEFGLKTCFYTEIGNRGPGAA  531

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             T KRV WKGYK+ +    A ++T   F+   + WL +  +PF+PG +
Sbjct  532   TTKRVTWKGYKK-VDLTHAHKYTVQQFIQG-KTWLPKTGVPFTPGLM  576



>ref|XP_006290150.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
 gb|EOA23048.1| hypothetical protein CARUB_v10003818mg [Capsella rubella]
Length=734

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/527 (51%), Positives = 359/527 (68%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+T+ K++KE+CAPTDYK+TCE +L   A++T DP EL+K AF VT++ I+D   KS+ 
Sbjct  47    EITTSVKAIKEVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNVTMKQISDVAKKSQT  106

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPR   ALD CKEL+  +I +L  SFE++  F+  ++ E    L++WLS  I+ 
Sbjct  107   MIELQKDPRAKMALDQCKELMDYAIGELSNSFEELGKFEFHKIDEALVKLRLWLSATISH  166

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T GD GE +K  LKTA +L+ NGLAM++  +  L  L+IP ++  RRLL+
Sbjct  167   EETCLEGFQGTQGDAGETIKKALKTAVQLTHNGLAMVSEMSSYLGQLQIPEMS-SRRLLS  225

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              +         FP ++DA  RRLL    + +K DIVVA+DGSGQYK++ EAL  VP K +
Sbjct  226   QD---------FPSWMDARARRLLNAPMSEVKPDIVVAQDGSGQYKTINEALLNVPKKKN  276

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IK G+Y E V+V R M  +VF+G+G  KT ITG ++ KDGI TY TATVAI GD
Sbjct  277   TTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGSDKTVITGDKNYKDGITTYKTATVAIVGD  336

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+NIGFEN+AG  KHQAVA+RV AD +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  337   HFIAKNIGFENTAGPIKHQAVAIRVLADQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  396

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP   A
Sbjct  397   TIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLA  456

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKEFSRT+IM TFI D + PEGW  W G   L+T +Y+E +N GPG+ 
Sbjct  457   VKETSKSYLGRPWKEFSRTIIMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVRNIGPGSG  516

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRV W G K+ +S E    FTP  ++  D  W+    +P+ PG  
Sbjct  517   LTKRVTWPGIKK-LSEEEILTFTPAQYIQGD-AWIPGKGVPYIPGLF  561



>ref|XP_007225707.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
 gb|EMJ26906.1| hypothetical protein PRUPE_ppa003569mg [Prunus persica]
Length=564

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/519 (50%), Positives = 359/519 (69%), Gaps = 8/519 (2%)
 Frame = -1

Query  3083  VKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDP  2907
             ++ IC PT YKETC+ SL   A DT DPKEL+K  F+V  + + + I  S+ LK+  KDP
Sbjct  51    IEAICQPTSYKETCQSSLEKVAGDTTDPKELVKAGFQVAADKVNEVIQNSDTLKDLAKDP  110

Query  2906  RTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAF  2727
               S ALD CKE+L  +++DL  + +K+  F++ +V +Y  DLKVWLS A+  Q TC+DAF
Sbjct  111   MASQALDVCKEMLNTAVEDLLGAVDKMGPFEISKVDDYLEDLKVWLSAAVNHQATCVDAF  170

Query  2726  ENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeq  2547
             ++T G+ G+KMK  LKTA EL+SNGLAM+T  + LL SL +   N  RRLL+A +K    
Sbjct  171   KDTKGEAGDKMKGFLKTAQELTSNGLAMVTQISSLLGSLNL---NSHRRLLSAHSK--RN  225

Query  2546  eeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
              +  P ++ A   +LLT  P S+K ++VVA+DGSG+YK++ EAL+ VP K++ET VI+IK
Sbjct  226   YQAVPSWMGARQLQLLTATPQSLKPNVVVAQDGSGKYKTIKEALKEVPTKSNETFVIYIK  285

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVY E + + R+M  +  +G+GPTKT+I+GS++  DG  T HTAT A  GD F+A++I 
Sbjct  286   EGVYKEEIIIDRQMTNVFMIGDGPTKTKISGSKNKADGTATMHTATFAAVGDYFVAKDIR  345

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FEN+AG  KHQAVALRV +D +IF+NCH+DAYQDTLYT +YRQ+YRDCTI+GTVDFIFG+
Sbjct  346   FENTAGHIKHQAVALRVQSDFSIFYNCHMDAYQDTLYTQTYRQYYRDCTITGTVDFIFGD  405

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
                +FQNCKM+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   A    NK +
Sbjct  406   GVALFQNCKMLVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPEYMAVKDKNKAY  465

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             LGRPWK+F+R ++M + ID+ + PEGW  W G+ + +TC+  EY NRGP A   +RVKW 
Sbjct  466   LGRPWKDFARVVVMNSQIDEAIQPEGWIEWAGSQFHNTCFLGEYGNRGPRADMAQRVKWP  525

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               K+ ++ + A  FTP      D +W+  + +P+  G +
Sbjct  526   SLKK-LTADQAATFTPAKLFEGD-RWIKPSGVPYVSGMV  562



>emb|CDP21547.1| unnamed protein product [Coffea canephora]
Length=666

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/528 (50%), Positives = 362/528 (69%), Gaps = 5/528 (1%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +S + K+++ IC PTDYKETC ++L A A ++ DPKELI+ AFK T   I +A   S +L
Sbjct  43    VSDSQKAIQTICEPTDYKETCIKTLQAEAGNSTDPKELIQAAFKATTNYINEAAKNSTVL  102

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +E  KDPRT  AL+ CKEL   +++DLERSF K + FD   + +   D+KVWLSGA+T Q
Sbjct  103   QELQKDPRTKLALENCKELAHQAVEDLERSFAKFQTFDFSNIDDMLADIKVWLSGALTYQ  162

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             +TC+D FE   GD GEKM+  L+T+ EL+SNGLAMI   + +L SLE+P     RRLL+ 
Sbjct  163   QTCLDGFEGAEGDAGEKMRQSLETSMELTSNGLAMINDISSVLTSLELPAFT-NRRLLSD  221

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             +  G   +   P ++D   RRLL   P  +K D++VAKDGSG + ++ EAL  +    ++
Sbjct  222   DILGHGMDI-LPSWIDEGRRRLLRAKPRKVKPDLIVAKDGSGNFTTINEALLNITKNEEK  280

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
               V++IK GVY E+V   + +  +  +G+GPTKTRITG  +  DG+ TYHTATVA+ GD 
Sbjct  281   EFVLYIKEGVYEEKVTFHKNLLHLTVIGDGPTKTRITGKLNFIDGVPTYHTATVAVLGDF  340

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             FIA++IGFEN+AG  KHQAVA+RV AD TIF+NCH D +QDTLY H+YRQFYR+C ISGT
Sbjct  341   FIAKDIGFENAAGPEKHQAVAVRVGADKTIFYNCHFDGFQDTLYAHTYRQFYRNCKISGT  400

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG++  V QNC + VRKP+ NQ+C+VTAQGRKD R    +VLQ+C  +A+PA    
Sbjct  401   IDFVFGDSAAVLQNCTLEVRKPLDNQQCIVTAQGRKDVRQPTGLVLQNCSFVADPAYFPY  460

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                 K +LGRPWKEFSRT+IM +FIDD++ PEGW  W G+  LDT +YAE+ NRGP ++ 
Sbjct  461   RFQLKSYLGRPWKEFSRTIIMESFIDDLIQPEGWLAWNGSFALDTLFYAEFNNRGPSSNK  520

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
               R +W G K   S  V ++F P  F+  +  W+  A++P++ GF+ P
Sbjct  521   MLRAQWNGVKELPSSRV-ERFLPSKFIDGN-HWIKSARVPYNSGFIYP  566



>ref|XP_010551001.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Tarenaya hassleriana]
Length=669

 Score =   555 bits (1430),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 262/527 (50%), Positives = 362/527 (69%), Gaps = 12/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +++ + K++KE+CAPTDYK+TCE +L   A +T DP EL+K AF+VT++ I +A +KS+ 
Sbjct  53    QVTASVKAIKEVCAPTDYKKTCEDTLRKNANNTSDPLELVKTAFEVTMKQIAEAAAKSKT  112

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E  KDPRT  ALD CKEL+  + D+L+ SF+++  F+  ++ E   +L++WLS AI+ 
Sbjct  113   LIEIQKDPRTKMALDQCKELMDYAFDELKSSFDELGKFEFHKLDEALINLRIWLSAAISH  172

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             + TC++ FE T G+ GE MK  LKTA +L+ NGLA++T  ++ +  ++I G+N  RRLL+
Sbjct  173   ETTCLEGFEQTQGNAGETMKKALKTAIQLTHNGLAIVTEMSDFVGQMQISGLN-SRRLLS  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             +          +P +VDA  RRLL      +K DIVVA+DGSGQY ++ EAL  VP K +
Sbjct  232   SN--------GYPSWVDARARRLLAATVTDVKPDIVVAQDGSGQYATINEALEHVPKKKN  283

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IKAGVY E ++V + M  +VF+G+GP KT I+G +  KDGI TY T TVAI GD
Sbjct  284   VTFVVHIKAGVYKEYIQVNKSMTDLVFIGDGPDKTIISGDKGFKDGITTYRTQTVAIVGD  343

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA++IGFEN+AGA KHQAVA+RV +DM++F+NC  D YQDTLYTHS+RQF+RDCTISG
Sbjct  344   RFIAKDIGFENTAGAIKHQAVAVRVQSDMSVFYNCRFDGYQDTLYTHSHRQFFRDCTISG  403

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C+I  EP   +
Sbjct  404   TIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGFVFQGCQIAGEPDYLS  463

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWK +SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG+ 
Sbjct  464   VKATSKAYLGRPWKAYSRTIIMNTFIPDFVQPQGWQPWNGDFGLSTLFYSEIQNTGPGSD  523

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+  + ++  QFTP  F+  D  W+    +P++PGF 
Sbjct  524   VVNRVTWAGIKKLTNNDLL-QFTPAQFIQGDS-WIPATGVPYTPGFF  568



>ref|XP_006382447.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|ERP60244.1| pectin methylesterase family protein [Populus trichocarpa]
Length=578

 Score =   551 bits (1420),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 264/525 (50%), Positives = 366/525 (70%), Gaps = 7/525 (1%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K+VK IC PTDY++TCE +L   A +T DP+ELIK+AFK+  +++ +A  KS++
Sbjct  54    QVSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHVNEASKKSKV  113

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KDPRT  AL +C+EL+  S+D+L++S  KV +FD+  +++   D+K WLS +IT 
Sbjct  114   LEELSKDPRTRGALQSCRELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITY  173

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F+NTT + G++MK  LK + ELS+N LA+++  +  + SLE  G   +RRLL 
Sbjct  174   QETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG---QRRLLQ  230

Query  2570  AETKGeeqe-eEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
              +        + FP + D   RRLL    + IK DIVVAKDGSG + ++ +AL  VP K+
Sbjct  231   DDLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIRDALHHVPIKS  290

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +T V++IKAG+Y E ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + G
Sbjct  291   SKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLG  350

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A+NIGFEN+AGA KHQAVALRVSAD  +F+NC +D +QDT+YTH+ RQFYRDC+IS
Sbjct  351   DNFVAKNIGFENNAGAIKHQAVALRVSADYALFYNCSMDGHQDTMYTHAKRQFYRDCSIS  410

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNCK ++RKP+ NQ+C+VTAQGRK RR  +AI++Q+  I A P L 
Sbjct  411   GTIDFVFGDASAVFQNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIIIQNSTITAHPDLF  470

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPWKEFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+
Sbjct  471   PERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGS  530

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             S   RVKW G K  I  + A  FTPG F      W+    IP++P
Sbjct  531   SKAARVKWNGIK-TIDRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>emb|CDX99968.1| BnaC09g03330D [Brassica napus]
Length=677

 Score =   555 bits (1430),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 268/527 (51%), Positives = 363/527 (69%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++K++CAPTDYK+TCE +L   AKDT DP EL++ AF  T++ I++   KS  
Sbjct  48    EITASVKAIKDVCAPTDYKKTCEDTLRKDAKDTSDPLELVRTAFNATMKQISNVGKKSLT  107

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD C EL+  +I +L +SF+++  F+L +V +    LKVWLS  I+ 
Sbjct  108   MIELQKDPRTKMALDQCTELMDYAIGELSKSFDELGRFELHKVDDALIKLKVWLSATISH  167

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D F+ T GD GE MK  LKTA +L+ NGLAM++     L  +E+P +N  RRLL+
Sbjct  168   EQTCLDGFQGTQGDAGETMKKALKTAVQLTHNGLAMVSEMLNYLGQMELPEMN-SRRLLS  226

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP +VD   RRLL    + +K D+VVA+DGSGQYK++ EAL+ VP KN+
Sbjct  227   QE---------FPSWVDGRVRRLLNAPLSEVKPDMVVAQDGSGQYKTINEALQNVPKKNN  277

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T VI IK+G Y E V+V R M  +VF+G+GP K+ I+G++S KDGI TY TATVAI GD
Sbjct  278   ATFVIHIKSGTYKEYVQVNRTMPNLVFIGDGPDKSIISGNKSFKDGITTYRTATVAIIGD  337

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GFEN+AGA  +QAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTI+G
Sbjct  338   NFIAKNMGFENTAGALNYQAVAVRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTITG  397

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ANQ C +TA GR D R +   VLQ C I  E    A
Sbjct  398   TIDFLFGDAAAVFQNCTLLVRKPLANQACPITAHGRTDPRESTGFVLQGCTIAGEADYLA  457

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+S+T+IM TFI D +  EGWS WQG   LDT +Y+E +N GPGA+
Sbjct  458   VKETSKAYLGRPWKEYSKTIIMETFIPDFIPGEGWSPWQGNFGLDTLFYSEVRNTGPGAA  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+ +S E   ++TP  ++  D+ W+    +P++PGF 
Sbjct  518   VANRVTWPGIKK-LSEEEIVEYTPAKYIQGDD-WIPGKGVPYTPGFF  562



>ref|XP_009147301.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
Length=616

 Score =   553 bits (1424),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 270/529 (51%), Positives = 360/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+ + K+VK+ICAPTDYK+TCE SL     +T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  52    QITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQT  111

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  ++ +L  SFE++   +  ++ E   +L++WLS AI+ 
Sbjct  112   IIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISH  171

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL 
Sbjct  172   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN-SRRLLA  230

Query  2570  AETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD   RRLL   ++ +  K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  231   QE---------IPSWVDQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKK  281

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI 
Sbjct  282   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIV  341

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AGA KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  342   GDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  401

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  402   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDY  461

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPG
Sbjct  462   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPG  521

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  522   AALANRVTWPGIKTLSNEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>gb|EYU42197.1| hypothetical protein MIMGU_mgv1a000814mg [Erythranthe guttata]
Length=976

 Score =   565 bits (1456),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 278/566 (49%), Positives = 378/566 (67%), Gaps = 24/566 (4%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaa----tvsvgssggGEISTASKSVKEICAPTDYKETCERSL  3030
             KK+A+  V S+ LVA VVA     T +       ++S++ K++  IC  TDY++TC  SL
Sbjct  7     KKIAIVSVCSLILVAMVVALVIGGTENEEEDTVPDVSSSQKAISSICETTDYQQTCMNSL  66

Query  3029  AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDD  2850
             AG   T+ PK+LI+VAF+  V  I  A   S  L+  + DP    AL  C++L   +I+D
Sbjct  67    AGHNSTN-PKDLIEVAFQAAVNYINQAAENSSTLQHLETDPMAKSALQVCQDLANRAIND  125

Query  2849  LERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTAN  2670
             L+RSF K  NFD+  V +   DLK+WLSGAIT QETC+D FE+  G++G+KMK  LK + 
Sbjct  126   LQRSFAKFSNFDIINVDDILLDLKIWLSGAITHQETCLDGFEDVPGESGQKMKDALKISM  185

Query  2669  ELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD  2490
             EL+SN LAM+   +  L+++                 G +   E P + D   R+LLT  
Sbjct  186   ELTSNALAMVAEISTFLEAM-----------------GMQSFSELPDWADFNKRKLLTAS  228

Query  2489  PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVF  2310
             P  +K D+VVAKDGSG+Y+++ EAL+ +P K+++T V++IK GVY E+V++   +  ++ 
Sbjct  229   PKELKPDLVVAKDGSGKYRTINEALKDIPKKSNKTFVLYIKEGVYEEKVQINSSLTHLMM  288

Query  2309  VGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSA  2130
             VG+GPTKTRITG  +  DG GTY TATVA+QGD FIA+ IGFENSAGAAKHQAVALRVSA
Sbjct  289   VGDGPTKTRITGHLNFIDGTGTYQTATVAVQGDDFIAKEIGFENSAGAAKHQAVALRVSA  348

Query  2129  DMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQ  1950
             D +IF+NCH+D YQDTLY H+YRQFY+DC ISGTVDFIFG++  VFQ C ++VRKPM NQ
Sbjct  349   DKSIFYNCHMDGYQDTLYVHTYRQFYKDCVISGTVDFIFGDSAAVFQGCTLVVRKPMDNQ  408

Query  1949  ECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFID  1770
             +C+VTAQGRKD R    IV+Q+C  +A+P L         +LGRPWKE+SRT+IM +F+D
Sbjct  409   QCIVTAQGRKDVRQPTGIVIQNCSFVADPELYPVRHKILSYLGRPWKEYSRTIIMESFLD  468

Query  1769  DIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1590
             D + P+GW  W  T  L+T +Y E+ NRGP A   KRVKW G K  + P   ++FTPG F
Sbjct  469   DFIQPDGWMKWNETFALETLFYTEFNNRGPAAPKMKRVKWPGVKE-LPPSRVQRFTPGEF  527

Query  1589  LMADEQWLGRAQIPFSPGFLQP*NKQ  1512
             L  + +W+   Q+P++ GF+ P  K+
Sbjct  528   LDGN-RWIPPTQVPYAAGFIFPVPKE  552



>ref|XP_008223240.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=575

 Score =   550 bits (1418),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 280/577 (49%), Positives = 387/577 (67%), Gaps = 22/577 (4%)
 Frame = -1

Query  3215  GSPEQN--KKVAVTGVASIFLvacvvaatvsvgssggG------EISTASKSVKEICAPT  3060
             G   QN  KK+A+ GV+++ LVA VVA TV V  S         + ST++K+++ IC PT
Sbjct  3     GGEAQNMKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPT  62

Query  3059  DYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DYK+TCE +L+  A +  DPKEL+K  F+V ++ + + I  S  LKE  KDP  + AL  
Sbjct  63    DYKKTCEDNLSKVASNVTDPKELVKAGFQVAIDQLREVIKNSTTLKELAKDPSANQALQN  122

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKELL+ +IDDL  SF+K+  FD  ++  Y  DLKVWLS A+T ++TC+D FENTTGD G
Sbjct  123   CKELLEYAIDDLGDSFDKLGPFDFTKLDAYVGDLKVWLSAAMTYEQTCLDGFENTTGDAG  182

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGe-----eqeeE  2538
             EKM+  LKT+ EL+SNGLAM++  + L ++L I      RRLL A          ++ + 
Sbjct  183   EKMRQFLKTSQELTSNGLAMVSEVSTLFKTLNI---KTGRRLLQAAATATDENRFQRAKI  239

Query  2537  FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAG  2361
              P ++D     L T  P ++K D+VV+  G G+YK++ EAL+ +P  N+  V VI++K G
Sbjct  240   IPAWIDHRRLDLATATPLTLKPDVVVSNKGDGKYKTINEALKDIPKNNEVKVFVIYVKEG  299

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY+E V   + M  ++ +G+GPTKT ITG ++  +G  TY TATVA+ GD FIA++IGFE
Sbjct  300   VYDEHVFFNKHMTNVMLIGDGPTKTVITGRKNYAEGTQTYQTATVAVVGDYFIAKDIGFE  359

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             N+AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A 
Sbjct  360   NTAGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAA  419

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LG
Sbjct  420   AVFQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYN--KELNKAYLG  477

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             RPWK ++R ++M + IDD++ PEGW  W GT   +TCW++E+ NRG GA   KRV W G 
Sbjct  478   RPWKSYARAIVMQSQIDDVIAPEGWMDWTGTANHNTCWFSEFGNRGVGAELSKRVTWSGM  537

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             K+ ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  538   KK-LTPEHAADFTAGKFMFGD-RWILPSGVPYVAGMM  572



>ref|XP_009352343.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Pyrus x bretschneideri]
Length=569

 Score =   550 bits (1417),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 264/529 (50%), Positives = 354/529 (67%), Gaps = 8/529 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++    K+++ IC PT YKETC+ SL   A DT DPK+LIK  FKV  + + + I  S  
Sbjct  44    KVGAKKKAIETICQPTTYKETCQSSLEKEAGDTTDPKDLIKAGFKVAADKVNEVIKNSNT  103

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             LKE  KDP TS AL  CKELL+ +++DL  + +K+  FD  ++ +Y  DLKVWLS A+  
Sbjct  104   LKEHAKDPMTSQALGVCKELLETAVEDLLGAVDKMGPFDASKIDDYLADLKVWLSAAVNH  163

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q TC+DAF++T G+ GEKMK  LKTA EL+SNGLAM++  + L+ S   P +N  RRL++
Sbjct  164   QATCLDAFKDTKGEAGEKMKGFLKTAQELTSNGLAMVSEISRLVGS---PKLNSHRRLMS  220

Query  2570  AETKGeeqeeE--FPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             +   G+        PG++      LLT  P S+K ++VVAKDG+G+YK++ EAL+ VP K
Sbjct  221   SSKGGQRNRNYKPVPGWMSDRDLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQK  280

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             + E  VI+IK GVY E V V ++M  +V +G+GPT TRI+GS+S+ DG+ T  TAT A  
Sbjct  281   SKEAFVIYIKKGVYEETVIVDKQMTNVVMIGDGPTMTRISGSKSHADGVTTMKTATFAAL  340

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+ F+A+ IGFEN+AG  KHQAVALRV +D +IF NCH+DAYQDTLYT +YRQFYRDCTI
Sbjct  341   GNYFVAKGIGFENTAGHVKHQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTI  400

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GTVDFIFG+   +FQNCKM+VRKP   Q CMVTAQGR D      I LQ+C I  EP  
Sbjct  401   TGTVDFIFGDGVALFQNCKMVVRKPGETQACMVTAQGRTDHNEITGIFLQNCTITGEPDY  460

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    NK +LGRPWK F+R ++M + ID+ + PEGW+ W G  Y   C++ EY N GPG
Sbjct  461   MAVKDKNKAYLGRPWKNFARVVVMQSSIDEAIAPEGWTEWTGEEYHQNCFFGEYGNTGPG  520

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   +RVKW   KR ++P+ A  FTP      D +W+  + +P+ PG +
Sbjct  521   SDVTQRVKWSTVKR-LTPDQAAAFTPARVFEGD-KWIKPSGVPYVPGMM  567



>ref|NP_199729.1| putative pectinesterase/pectinesterase inhibitor 58 [Arabidopsis 
thaliana]
 sp|Q9FJ21.1|PME58_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
58; Includes: RecName: Full=Pectinesterase inhibitor 58; AltName: 
Full=Pectin methylesterase inhibitor 58; Includes: RecName: 
Full=Pectinesterase 58; Short=PE 58; AltName: Full=Pectin 
methylesterase 58; Short=AtPME58; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10336.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAL77687.1| AT5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AAM65978.1| pectin methylesterase [Arabidopsis thaliana]
 gb|AAN72223.1| At5g49180/K21P3_5 [Arabidopsis thaliana]
 gb|AED95779.1| putative pectin methylesterase [Arabidopsis thaliana]
Length=571

 Score =   550 bits (1417),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 268/534 (50%), Positives = 367/534 (69%), Gaps = 19/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I TA+ +V+ +CAPTDYKETC  SL  A  D+  P +LIK+ F VT+ +I D+I K+  
Sbjct  47    QIKTATTAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIEDSIKKASV  106

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  AL+ C++L+ ++ DDL++  +  + F + +++++  DL+VWLSG+I
Sbjct  107   ELTAKAANDKDTKGALELCEKLMNDATDDLKKCLDNFDGFSIPQIEDFVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TC+D FE T     + M+ + KT+ EL+SNGLAMIT+ + LL    + GV      
Sbjct  167   AYQQTCMDTFEETNSKLSQDMQKIFKTSRELTSNGLAMITNISNLLGEFNVTGVTGDLGK  226

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+AE       +  P +V   TRRL+ T    +K ++VVA DGSGQYK++ EAL 
Sbjct  227   YARKLLSAE-------DGIPSWVGPNTRRLMATK-GGVKANVVVAHDGSGQYKTINEALN  278

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             AVP  N +  VI+IK GVYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TY T
Sbjct  279   AVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYLT  338

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVSAD+ +F+NC ID YQDTLY HS+RQF
Sbjct  339   ATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADLAVFYNCQIDGYQDTLYVHSHRQF  398

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             +RDCT+SGTVDFIFG+  VV QNC ++VRKPM +Q CM+TAQGR D+R +  +VLQ+C I
Sbjct  399   FRDCTVSGTVDFIFGDGIVVLQNCNIVVRKPMKSQSCMITAQGRSDKRESTGLVLQNCHI  458

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EPA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W G   L+T +YAEY
Sbjct  459   TGEPAYIPVKSINKAYLGRPWKEFSRTIIMGTTIDDVIDPAGWLPWNGDFALNTLYYAEY  518

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +N GPG++  +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+   F
Sbjct  519   ENNGPGSNQAQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPNRVPYMGNF  570



>ref|XP_002884519.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60778.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=671

 Score =   553 bits (1426),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 271/529 (51%), Positives = 361/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K+VK++CAPTDY++TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  50    EITASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL 
Sbjct  170   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLLA  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      E FP ++D   R+LL    A   +K DIVVA+DGSGQY ++ EAL+ VP K
Sbjct  229   ---------EGFPSWLDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYTTINEALQFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+ FIA+NIGFEN+AGA KHQAVALRV +D +IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GNYFIAKNIGFENTAGAIKHQAVALRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R     V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPREVTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++   RV W G K  +S E   +FTP  ++  D  W+    +P++PG L
Sbjct  520   SALANRVTWAGIK-TLSDEDILKFTPAQYIQGD-TWVPGKGVPYTPGLL  566



>ref|XP_010455075.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
 ref|XP_010455076.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=876

 Score =   560 bits (1444),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 269/527 (51%), Positives = 359/527 (68%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+T+ K++K++CAPTDYK+TCE +L   A++T DP EL+K AF  T++ IT+   KS+ 
Sbjct  49    EITTSVKAIKDVCAPTDYKKTCEDTLRKDAQNTSDPLELVKTAFNATMKQITEVAKKSQT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  +I +L +SFE++  F+  +V E    L+VWLS  I+ 
Sbjct  109   MIELQKDPRTKMALDQCKELMDYAIGELSKSFEELGRFEFHKVDEALVKLRVWLSATISH  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC+D F+ T GD GE +K  LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+
Sbjct  169   EQTCLDGFQGTQGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLS  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP ++D  TRRLL    + +K DIVVA+DGSGQYK++ EAL  VP K +
Sbjct  228   QE---------FPSWMDGRTRRLLNAPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKN  278

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IK G+Y E V+V R M  +VF+G+GP KT I+G ++ KDGI TY TATVAI GD
Sbjct  279   TTFVVHIKGGIYKEYVQVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYKTATVAIVGD  338

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GFEN+AGA KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  339   HFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  398

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQ+C ++VRKP+ NQ C +TA GRKD R +   VLQ C I+ EP    
Sbjct  399   TIDFLFGDAAAVFQSCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIVGEPDYLT  458

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+SRT+ M TFI D + PEGW  W G   L+T +Y+E  N GPGA 
Sbjct  459   VKETSKSYLGRPWKEYSRTIFMNTFIPDFIPPEGWQPWLGNFGLETLFYSEVGNTGPGAD  518

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRV W G K+ +S E   + TP  ++  D  W+    +P+ PG  
Sbjct  519   VTKRVTWPGIKK-LSEEEILKITPAEYIQGD-AWIPGKGVPYIPGLF  563



>ref|NP_187212.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
 sp|Q8GX86.2|PME21_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
21; Includes: RecName: Full=Pectinesterase inhibitor 21; AltName: 
Full=Pectin methylesterase inhibitor 21; Includes: RecName: 
Full=Pectinesterase 21; Short=PE 21; AltName: Full=Pectin 
methylesterase 21; Short=AtPME21 [Arabidopsis thaliana]
 gb|AAF26136.1|AC011620_12 putative pectinesterase [Arabidopsis thaliana]
 gb|AEE74266.1| probable pectinesterase/pectinesterase inhibitor 21 [Arabidopsis 
thaliana]
Length=669

 Score =   553 bits (1425),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 270/529 (51%), Positives = 364/529 (69%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E++ + K+VK++CAPTDY++TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  50    EVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KD RT  ALD CKEL+  ++D+L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   IMELQKDSRTRMALDQCKELMDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL 
Sbjct  170   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL-  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      E FP +VD   R+LL    A   +K DIVVA+DGSGQYK++ EAL+ VP K
Sbjct  228   --------AEGFPSWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M+ +VF+G+GP KT I+G+++ KDGI TY TATVAI 
Sbjct  280   RNTTFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+ FIA+NIGFEN+AGA KHQAVA+RV +D +IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GNYFIAKNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++   RV W G K  +S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  520   SALANRVTWAGIK-TLSEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>ref|XP_006299753.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
 gb|EOA32651.1| hypothetical protein CARUB_v10015948mg [Capsella rubella]
Length=702

 Score =   554 bits (1428),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 271/529 (51%), Positives = 358/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K+VK++CAPTDY++TCE +L    ++T DP EL+K AF  T++ ITD   KS+ 
Sbjct  50    EITASVKAVKDVCAPTDYRKTCEDTLIQNGQNTTDPMELVKTAFSATMKQITDVAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD C EL+  ++ +L  SFE++  F+  ++ E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCTELMDYALGELSSSFEELGKFEFHKLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL 
Sbjct  170   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLL-  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      E FP +VD   RRLL    A   +K DIVVA+DGSGQY ++ +AL  VP K
Sbjct  228   --------AEGFPSWVDQRGRRLLQAAAAYSDVKPDIVVAQDGSGQYTTINDALMFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+G++S KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGNKSYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGFEN+AGA KHQAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GDYFIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D V P+GW  WQG   L T +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWQGDFGLKTLFYSEVQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K  +S E   +FTP  ++  D  W+    +P++ G L
Sbjct  520   ATVANRVTWAGIK-TLSDEDILKFTPAQYIQGD-TWVPGKGVPYTSGLL  566



>ref|XP_006408050.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
 gb|ESQ49503.1| hypothetical protein EUTSA_v10020314mg [Eutrema salsugineum]
Length=615

 Score =   550 bits (1418),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 271/529 (51%), Positives = 359/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+ + K+VK++CAPTDYK+TCE +L     +T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  50    QINASVKAVKDVCAPTDYKKTCEDTLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+  ++ E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHKLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  +EIPG+N  RRLL 
Sbjct  170   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMEIPGLN-SRRLLA  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD   RRLL    A    K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  229   QE---------IPSWVDQRGRRLLQDAAAYSDSKPDIVVAQDGSGQYTTINDALKNVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+G+++ KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGLYKEYVQVNKSMTHLVFIGDGPDKTIISGNKNYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AG  KHQAVA+RV +D +IF NC  D YQDTLYTHS+RQFYRDCTI
Sbjct  340   GDYFIAKNIGFVNTAGPIKHQAVAVRVQSDESIFFNCRFDGYQDTLYTHSHRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   LDT +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGNFGLDTLFYSEVQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K   + E+ K FTP  ++  +  W+    +P++PG L
Sbjct  520   AALASRVTWPGIKTLSNDEILK-FTPDQYIQGN-VWVPGKGVPYTPGLL  566



>gb|KFK26505.1| hypothetical protein AALP_AA8G257900 [Arabis alpina]
Length=736

 Score =   553 bits (1426),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 267/527 (51%), Positives = 357/527 (68%), Gaps = 13/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++K++CAPTDYK+TCE +L   AK+T DP EL+K AF  T++ I+D   KS+ 
Sbjct  51    EITASVKAIKDVCAPTDYKKTCEDTLKKDAKNTSDPLELVKTAFNATMKQISDVAKKSQT  110

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  ++ +L +SFE++  F+L +V E    LK+WLS  I+ 
Sbjct  111   MIDLQKDPRTKMALDQCKELMDYAVGELSKSFEELGKFELNKVDEALVKLKIWLSATISH  170

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TC++ F+ T GD GE +K  LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+
Sbjct  171   EQTCLEGFQGTQGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPELN-SRRLLS  229

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         FP ++D   R+LLT   + +K DIVVA+DGSGQY ++ EA+  VP K +
Sbjct  230   QE---------FPSWMDGRARKLLTAPMSEVKPDIVVAQDGSGQYATINEAMNHVPKKKN  280

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V+ IKAG+Y E V+V R M  +VF+G+GP KT I+GS+S KDGI TY T TVAI GD
Sbjct  281   MTFVVHIKAGIYKEFVQVNRSMTHLVFIGDGPDKTVISGSKSFKDGITTYRTTTVAIVGD  340

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GFEN+AGA KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  341   HFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  400

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC  +VRKP+ NQ C +TA GRKD R     VLQ C I  E    A
Sbjct  401   TIDFLFGDAAAVFQNCTFLVRKPLPNQACPITAHGRKDPRETTGFVLQGCTISGETDYLA  460

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWKE+SRT+IM TFI D + PEGW  W     L+T +Y+E +N GPGA 
Sbjct  461   VKETSKAYLGRPWKEYSRTIIMNTFIPDFIPPEGWQPWLDNFGLETLFYSEVRNTGPGAP  520

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+    E+ K FTP  ++  D  W+    +P++PG  
Sbjct  521   AMNRVTWPGIKKLGEEEILK-FTPAQYIQGD-AWIPGKGVPYTPGLF  565



>ref|XP_007221831.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
 gb|EMJ23030.1| hypothetical protein PRUPE_ppa020185mg [Prunus persica]
Length=570

 Score =   546 bits (1408),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 265/528 (50%), Positives = 357/528 (68%), Gaps = 8/528 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             S++ K+++ IC  T YKETC+ SL   A DT DPKELIK  F+V  + + + I  S  LK
Sbjct  45    SSSKKAIETICQTTSYKETCQSSLEKAAGDTSDPKELIKTGFQVAADKLDEVIKNSNTLK  104

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +  KDP  S ALD CKE+L  + +DL  + +K+  FD  ++ EY  DLKVWLS A+  Q+
Sbjct  105   DLAKDPMASQALDVCKEMLDTAAEDLLGAVDKMGPFDASKMNEYVEDLKVWLSAAVNHQQ  164

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL---  2574
             TC+DAFE T G+ GEKMK  LKTA EL+SNGLAM++  + LL S  +     +RRLL   
Sbjct  165   TCLDAFEGTKGEAGEKMKGFLKTAQELTSNGLAMVSEISSLLGS--VNSNTHRRRLLGSS  222

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + + K +   +  P ++ A    LLT  P S+K ++VVA+DG+G+YKS+ EAL+ VP K+
Sbjct  223   SGDQKSKRVYKPLPSWIGARKLDLLTATPQSLKPNVVVAQDGTGKYKSIQEALKEVPKKS  282

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +  VI+IK GVY E V V + M  +V +G+GPTKTRI+GS++  DG  T +TAT A  G
Sbjct  283   AQPFVIYIKEGVYKEYVIVDKDMTNVVMIGDGPTKTRISGSKNYADGTTTMYTATFAAVG  342

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A+ IGFEN+AGAAKHQAVALRV +D +IF+NC+IDAYQDTLYT +YRQ+YRDCTIS
Sbjct  343   DYFVAKGIGFENTAGAAKHQAVALRVQSDFSIFYNCYIDAYQDTLYTQTYRQYYRDCTIS  402

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GTVDFIFG+   +FQNC+M+VRKP  +Q CMVTAQGR D+    AIVLQ+C I  EP   
Sbjct  403   GTVDFIFGDGVAMFQNCRMVVRKPGDSQSCMVTAQGRTDKNEITAIVLQNCTITGEPDYM  462

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
             A    NK +LGRPWK F+R +++ + ID+ + PEGW+ W G  +  +C+ AE  NRG GA
Sbjct  463   AVKDKNKAYLGRPWKGFARVVVIQSQIDNAIAPEGWTEWTGEKFHTSCFVAESGNRGAGA  522

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                KRVKW+   + ++PE A  FTP      D +W+  + +P+  G +
Sbjct  523   DMSKRVKWQTLMK-LTPEQAAAFTPARLFEGD-KWVKPSGVPYVSGMM  568



>ref|XP_004494574.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=586

 Score =   546 bits (1408),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 283/579 (49%), Positives = 386/579 (67%), Gaps = 24/579 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssggGE---------ISTASKSVKEICAPTDY  3054
             ++ +++A+ GV++I LVA VVAATVSVG     E         IS++ K+V+ IC PTDY
Sbjct  8     QKKRRIAIIGVSTILLVAMVVAATVSVGFGKNVEAEDASKDSHISSSVKAVQTICEPTDY  67

Query  3053  KETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             ++ CE SL A A +  DP+EL+K+AF +T+  I+D +SK++LL E + D RT +ALDTCK
Sbjct  68    RKECEESLTAQAGNITDPRELVKIAFNITITKISDGLSKTQLLHEVESDERTKEALDTCK  127

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SID+ +RS EK  NFDL  +      LKVWLSGAIT QETC+DAFENTT + GEK
Sbjct  128   QLMNLSIDEFKRSLEKFSNFDLNNLDRVLTSLKVWLSGAITYQETCLDAFENTTTNAGEK  187

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqee---EFPGF  2526
             MK +L+TA  +SSNGL++I   ++    ++  G    RRLL  + +         EFP +
Sbjct  188   MKEILQTAMHMSSNGLSIINELSKTFTEMKPAG----RRLLKDDGELHVVGRGDFEFPEW  243

Query  2525  VD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
             VD     R+LL      ++  +VVAKDG+G + ++ EAL+ VP KN    VI+IK G+YN
Sbjct  244   VDDRVGVRKLLKMTGRKLQAHVVVAKDGTGNFTTINEALKHVPKKNLRPFVIYIKEGIYN  303

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSA  2172
             E VEV R M  +VF+G+G  K+RITG+++  DG+GTY TATVAI GD F+   IGFENSA
Sbjct  304   EYVEVSRNMTHVVFIGDGGRKSRITGNKNFIDGVGTYRTATVAILGDFFVGIGIGFENSA  363

Query  2171  GAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVF  1992
             G  KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYRDC I+GT+DF+FG++  V 
Sbjct  364   GPEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCVITGTIDFVFGDSVAVL  423

Query  1991  QNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPW  1812
             QNC  +VRKP+ NQ+C+VTAQGRK+R   + +++Q   I+++P        NK +L RPW
Sbjct  424   QNCTFVVRKPLENQQCIVTAQGRKERNQPSGLIIQGGSIVSDPKYFPVRFDNKAYLARPW  483

Query  1811  KEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWKGY  1641
             K FSRT+ M T+I D++ P+G+  WQ   G    +TC+YAEY NRGPG+   KRVKW+G 
Sbjct  484   KNFSRTIFMDTYIGDLITPDGYMPWQTIEGITGTETCYYAEYNNRGPGSDITKRVKWEGV  543

Query  1640  KRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             K  I+ E A  F P  F   D+ W+   ++P+ PG   P
Sbjct  544   K-TITSEGANTFLPTAFFHGDD-WIRVTRVPYYPGGAAP  580



>emb|CDY27751.1| BnaA05g31600D [Brassica napus]
Length=616

 Score =   548 bits (1411),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 268/529 (51%), Positives = 359/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+ + K+VK+ICAPTDYK+TCE SL     +T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  52    QITASVKAVKDICAPTDYKKTCEYSLIKNGNNTTDPMELVKTAFSVTMKQITDAAKKSQT  111

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  ++ +L  SFE++   +  ++ E   +L++WLS AI+ 
Sbjct  112   IIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISH  171

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N   RLL 
Sbjct  172   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQIDIPGLN-SCRLLA  230

Query  2570  AETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +V+   RRLL   ++ +  K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  231   QE---------IPSWVNQRGRRLLQAASEYSDAKPDIVVAQDGSGQYATINDALKHVPKK  281

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI 
Sbjct  282   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIV  341

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AGA KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  342   GDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  401

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  402   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTIAGEPDY  461

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPG
Sbjct  462   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPG  521

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  522   AALANRVTWPGIKTLSNEEILK-FTPDQYIQGD-VWVHGKGVPYTPGLL  568



>emb|CBI22967.3| unnamed protein product [Vitis vinifera]
Length=1281

 Score =   568 bits (1465),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 282/557 (51%), Positives = 382/557 (69%), Gaps = 29/557 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCERSLAGAK  3018
             KKVA+ G +SI LVA VV      G      IST+ K+++ IC PTDYKE C  SL  AK
Sbjct  15    KKVALMGFSSILLVAMVVGTVAGGG------ISTSVKAIQAICQPTDYKEACVNSLTSAK  68

Query  3017  -DTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDDLER  2841
              +T DPKEL++ AF+V +  I+ A+  S  L++ +KDPRT  AL+ C EL+  +IDDL  
Sbjct  69    ANTSDPKELVRTAFQVAINQISSALQNSTTLRDLEKDPRTKGALENCHELMDYAIDDLRN  128

Query  2840  SFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANELS  2661
             SF K+  FD+ ++ +Y  DLK+WLSGA+T QETC+D FENTTGD GEKMK LLK+A EL+
Sbjct  129   SFNKLGVFDISKIDDYVEDLKIWLSGALTYQETCLDGFENTTGDAGEKMKALLKSAGELT  188

Query  2660  SNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS  2481
             SNGLAMI   + +L +L+IPG++  RRLL  +                  R+L    P +
Sbjct  189   SNGLAMIDEISSVLTNLQIPGIS--RRLLVGQ------------------RKLFQATPDT  228

Query  2480  IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGE  2301
             IK +++VA+DGSG+YK++ EAL  +P   + T V+++K GVY E+V   + M  ++ +G+
Sbjct  229   IKPNVIVAQDGSGKYKTINEALVEIPKNGNTTFVLYVKEGVYKEQVNFTKSMTNVMLIGD  288

Query  2300  GPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMT  2121
             GPTKT I+GS +  DGIGT+ TATVA  G  F+A++IGFEN+AGA+KHQAVALRV +DM 
Sbjct  289   GPTKTTISGSLNFIDGIGTFRTATVAAVGSNFMAKDIGFENNAGASKHQAVALRVGSDMA  348

Query  2120  IFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECM  1941
             IF+NC +D YQDTLY H++RQFYRDCTI+GT+DFIFG++ VVFQNC ++VRKP+ NQ+C+
Sbjct  349   IFYNCRMDGYQDTLYVHAHRQFYRDCTITGTIDFIFGDSAVVFQNCLILVRKPLDNQQCI  408

Query  1940  VTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIV  1761
             VTAQGR +RR    IVLQ+C I A           K +LGRPWK FSRT+IM + IDD++
Sbjct  409   VTAQGRNERREPTGIVLQNCTISAADDYIPFKTKFKSYLGRPWKAFSRTIIMQSQIDDLI  468

Query  1760  VPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMA  1581
              PEGW  W G   L+TC+YAEY NRGP ++T  RV W+G K+ I+ +    FT G F+ +
Sbjct  469   SPEGWLPWMGDFGLNTCFYAEYGNRGPASATTSRVTWRGIKQ-ITGQHVNDFTVGRFI-S  526

Query  1580  DEQWLGRAQIPFSPGFL  1530
                WLG + +P++   +
Sbjct  527   GHLWLGASGVPYTSDMM  543



>dbj|BAC42986.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO64883.1| At3g05610 [Arabidopsis thaliana]
Length=669

 Score =   549 bits (1415),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 268/529 (51%), Positives = 363/529 (69%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E++ + K+VK++CAPTDY++TCE +L    K+T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  50    EVNASVKAVKDVCAPTDYRKTCEDTLIKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KD RT  ALD CKEL+  ++D+L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   IMELQKDSRTRMALDQCKELMDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  RRLL 
Sbjct  170   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMQIPGLN-SRRLLA  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      E FP +VD   R+LL    A   +K DIVVA+DGSGQYK++ EAL+ VP K
Sbjct  229   ---------EGFPSWVDQRGRKLLQAAAAYSDVKPDIVVAQDGSGQYKTINEALQFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M+ +VF+G+GP KT I+G+++ KDGI  Y TATVAI 
Sbjct  280   RNTTFVVHIKAGLYKEYVQVNKTMSHLVFIGDGPDKTIISGNKNYKDGITAYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+ FIA+NIGFEN+AGA KHQAVA+RV +D +IF NC  D YQ+TLYTHS+RQF+RDCTI
Sbjct  340   GNYFIAKNIGFENTAGAIKHQAVAVRVQSDESIFFNCRFDGYQNTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D V P+GW  W G   L T +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++   RV W G K  +S E   +FTP  ++  D+ W+    +P++ G L
Sbjct  520   SALANRVTWAGIK-TLSEEDILKFTPAQYIQGDD-WIPGKGVPYTTGLL  566



>gb|EPS59322.1| pectinesterase, partial [Genlisea aurea]
Length=537

 Score =   544 bits (1402),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 361/529 (68%), Gaps = 27/529 (5%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKE  2922
             ST++K+V+ +C+PT Y+ETCE++LA A +T DPKELI+  F V V+ I +A+ KS LLK+
Sbjct  31    STSNKAVQAVCSPTSYRETCEQTLAKA-NTSDPKELIRYGFGVAVDGIGEALKKSALLKQ  89

Query  2921  ADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQET  2742
             A  D  T DA   C+++L  ++ DL++S +++  F+ +++ +Y  DL+ WLSG +T Q T
Sbjct  90    AAADQSTKDAFYVCEDVLDLAVYDLQKSIDRIGEFNPQKLNDYVEDLRTWLSGVVTTQTT  149

Query  2741  CIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF---KRRLLT  2571
             CIDAFENTTGDTGEKMK LLKT  EL+SNGL M+T  T +L  L+I   N    +RRLL+
Sbjct  150   CIDAFENTTGDTGEKMKKLLKTVGELTSNGLDMVTDLTSILSQLQIGIGNVSAGRRRLLS  209

Query  2570  --AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
               AE K                 R+L      I+ + VVA DGSGQYKS+  A+ A P K
Sbjct  210   DWAEPK----------------MRMLA---GGIRANAVVALDGSGQYKSINAAINAAPSK  250

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             N    VI +KAG+Y E VEVP+    IV +G+G T+TRITG ++   G+ T+ TAT A+ 
Sbjct  251   NARPFVIHVKAGLYREYVEVPKHKTNIVILGDGATRTRITGRKNLAGGVKTFATATFAVN  310

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
              D F A++IG EN+AG   HQAVALRV+ D  + +N +ID +QDTLY H++RQFYR+C I
Sbjct  311   ADDFTAKDIGIENTAGPEGHQAVALRVTGDRAVLYNLNIDGFQDTLYAHAHRQFYRNCRI  370

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FGNA  +FQNC+ IVRKPMANQ CMVTAQGR  R    AIV+Q+ EI AE A 
Sbjct  371   SGTIDFVFGNALSIFQNCQFIVRKPMANQACMVTAQGRDQRNSNGAIVIQNGEIRAEQAF  430

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
               A P  + +LGRPWK+FS T+IM ++I   + P+GW+ W G+  LDTC+YAEY+NRGPG
Sbjct  431   INAKPKVQAYLGRPWKQFSTTIIMSSYIGGSISPQGWAPWAGSFALDTCYYAEYRNRGPG  490

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             ++T +RVKWKG K +I P+ A ++ PG     D+QW+ RA +P+  G +
Sbjct  491   SNTSQRVKWKGIK-HIDPQTAARYAPGK-AYGDDQWIRRAGVPYVSGMM  537



>ref|XP_011023718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=577

 Score =   546 bits (1406),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 274/525 (52%), Positives = 366/525 (70%), Gaps = 8/525 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K+VK IC PTDY++TCE SL   A +T +PKELIK+AFK+  + I +A  KS+L
Sbjct  54    QVSASVKAVKAICQPTDYRKTCEESLQKAAGNTTNPKELIKIAFKIAEKQINEASEKSKL  113

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KD RT  AL +CKEL+  S  +L++S  KV +FDL  ++    D+K WLS +IT 
Sbjct  114   LEELSKDARTRGALQSCKELMNMSAGELKQSLNKVTDFDLSELETLMADVKTWLSASITY  173

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF-KRRLL  2574
             QETC+D FENTT D G+KMK  +K   ELS+N L +++  +  + SLE    +F  RRLL
Sbjct  174   QETCLDGFENTTTDAGKKMKKGMKLGMELSANLLDIVSGISSAIPSLE----SFTHRRLL  229

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
               +       ++FP + D  TRRLL    + IK DIVVAKDGSG + ++ EAL+ VP K+
Sbjct  230   QDDLPVLGHGDQFPTWTDFGTRRLLAAPVSKIKADIVVAKDGSGDFSTIREALKHVPIKS  289

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +  V+ IKAGVY E +E+ + M  +V +G+G   TRI G+++  DGI T+HTATVA+ G
Sbjct  290   KKAFVLHIKAGVYQEYLEISKGMINLVVIGDGRENTRIIGNKNFVDGINTFHTATVAVLG  349

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A+NIGFEN+AGA KHQAVALRVSAD  +F+NC +D +QDTLYTH+ RQFYRDC+IS
Sbjct  350   DNFVAKNIGFENNAGAIKHQAVALRVSADYAVFYNCSMDGHQDTLYTHAKRQFYRDCSIS  409

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNCK +VRKP+ NQ+C+VTAQGRK RR  +A+++Q+  I A P L 
Sbjct  410   GTIDFVFGDASAVFQNCKFLVRKPLENQQCIVTAQGRKMRRQPSALIIQNSTITAHPDLF  469

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPWKE+SRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+
Sbjct  470   PERKQFKSYLGRPWKEYSRTIIMESFIDDLIQPEGWLPWLGTFGLKTCWYTEFNNYGPGS  529

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             S + RVKW G K  I+ + A  FTPG FL  D  W+    IP++P
Sbjct  530   SKNLRVKWNGIK-TINRQHAMDFTPGRFLKGDS-WIKATGIPYTP  572



>emb|CDY05188.1| BnaC05g46150D [Brassica napus]
Length=616

 Score =   547 bits (1409),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 269/529 (51%), Positives = 358/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+ + K+VK+ICAPTDYK+TCE SL    K+T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  52    QITASVKAVKDICAPTDYKKTCEDSLIKNGKNTTDPMELVKTAFSVTMKQITDAAKKSQT  111

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  ++ +L  SFE++   +  ++ E   +L++WLS AI+ 
Sbjct  112   IIDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKLEFHKLDEVLINLRIWLSAAISH  171

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IPG+N  R LL 
Sbjct  172   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNFVGQMDIPGLN-SRGLLA  230

Query  2570  AETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD    RLL   +  +  K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  231   QE---------IPSWVDQRGPRLLQAASGYSDAKPDIVVAQDGSGQYATINDALKHVPKK  281

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI 
Sbjct  282   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGPEKTIISGSKNYKDGITTYRTATVAIV  341

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AGA KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  342   GDYFIAKNIGFVNTAGAIKHQAVAIRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  401

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  402   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDVRESTGFVFQGCTISGEPDY  461

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPG
Sbjct  462   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNTGPG  521

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K   + E+ K FTP  ++  D  W+    +P++PG L
Sbjct  522   AALANRVTWPGIKTLSNEEILK-FTPDQYIQGDV-WVHGKGVPYTPGLL  568



>ref|XP_008351177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=569

 Score =   545 bits (1405),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 274/570 (48%), Positives = 375/570 (66%), Gaps = 13/570 (2%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssgg-----GEISTASKSVKEICAPTDYK  3051
              S  + KK+A+  V  + LVA +VA TV V  +        ++    K+++ IC  T YK
Sbjct  3     ASESKKKKIAIIAVLVVLLVAMIVAVTVGVKMAKKGNKKPAKVGAKKKAIETICQATTYK  62

Query  3050  ETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             ETC+ SL     DT DPK+LIK  F+V  + + + I  S  LKE  KDP  S AL  CKE
Sbjct  63    ETCQSSLEKETGDTTDPKDLIKAEFQVAADKVNEVIKNSNTLKEYAKDPMASQALGVCKE  122

Query  2873  LLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             LL+ +++DL  + +K+  FD+ ++ +Y  DLKVWLS A+  Q TC+DAFE+T G+ GEKM
Sbjct  123   LLETAVEDLLGAVDKMGPFDVSKISDYLADLKVWLSAAVNHQATCLDAFEDTKGEAGEKM  182

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE--FPGFVD  2520
             +  LKTA EL+SNGLAM++  + L+ S   P +N  RRL+++   G+ +      PG++ 
Sbjct  183   RGFLKTAQELTSNGLAMVSEISRLVDS---PKLNSHRRLMSSSKGGQTKRNYKPVPGWMS  239

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
                  LLT  P S+K ++VVAKDG+G+YK++ EAL+ VP K++E  VI+IK G+Y E V 
Sbjct  240   DRHLDLLTATPESLKPNVVVAKDGTGKYKTINEALKEVPQKSNEAFVIYIKKGMYEETVI  299

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             V ++M  +V +G+GPT TRI+GS+S+ DGI T +TAT A  G+ F+A+ IGFEN+AG  K
Sbjct  300   VDKEMTNVVMIGDGPTMTRISGSKSHADGITTMNTATFAAVGNYFVAKGIGFENTAGHVK  359

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV +D +IF NCH+DAYQDTLYT +YRQFYRDCTI+GTVDFIFG+   +FQNCK
Sbjct  360   HQAVALRVQSDFSIFFNCHMDAYQDTLYTQTYRQFYRDCTITGTVDFIFGDGVALFQNCK  419

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             M+VRKP   Q CMVTAQGR DR     I LQ+C I  EP   A    NK +LGRPWK+F+
Sbjct  420   MVVRKPGEAQACMVTAQGRTDRNEITGIFLQNCTITGEPDYMAVKDKNKAYLGRPWKKFA  479

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             R ++M + ID+ + PEGW+ W G  Y   C++ EY NRGP     +RVKW   KR ++P+
Sbjct  480   RVVVMQSSIDEAIAPEGWTEWTGEKYHQNCFFGEYGNRGPRKDMTQRVKWSTVKR-LTPD  538

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              A  FTP      D +W+  + +P+ PG +
Sbjct  539   QAAAFTPARVFEGD-KWVKPSGVPYVPGMM  567



>gb|KFK37969.1| hypothetical protein AALP_AA3G053300 [Arabis alpina]
Length=639

 Score =   548 bits (1411),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 270/529 (51%), Positives = 359/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K+VK++CAPTDYK+TCE +L    K+T DP EL+K AF++T+  ITDA  KS+ 
Sbjct  51    EITPSVKAVKDVCAPTDYKKTCEDTLIKNGKNTTDPVELVKTAFRITMNQITDAAKKSQT  110

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             ++E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  111   MRELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  170

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G+ GE MK  LKTA EL+ NGLA+I+  +  +  +++PG+N  RRLL 
Sbjct  171   EETCLEGFQGTQGNAGETMKKALKTAIELTHNGLAIISEMSNYVGQMQMPGLN-SRRLLA  229

Query  2570  AETKGeeqeeEFPGFVDAATRRLL-TTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD   RRLL    P S  K DIVVA+DGSGQY ++ +A++ VP K
Sbjct  230   DEV---------PSWVDQRGRRLLQAAAPYSDAKADIVVAQDGSGQYTTINDAMKNVPKK  280

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V R M  +VF+G+GP KT I+G+++ KDGI TY TATVAI 
Sbjct  281   KNTTFVVHIKAGIYKEYVQVNRSMTHLVFIGDGPDKTIISGNKNFKDGITTYRTATVAIV  340

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGFEN+AGA KHQAVA+RV +D  IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  341   GDHFIAKNIGFENTAGAIKHQAVAVRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTI  400

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D R     V Q C I  EP  
Sbjct  401   SGTIDFVFGDAAAVFQNCTLLVRKPLPNQACPITAHGRQDPREPTGYVFQGCTIAGEPDY  460

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM +FI D V P+GW  W G   L T +Y+E QN GPG
Sbjct  461   LAVKQTSKAYLGRPWKEYSRTIIMNSFIPDFVQPQGWQPWLGDFGLKTLFYSEVQNIGPG  520

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K   + E+ K F P  F+ +D  W+    +P+ PG L
Sbjct  521   AALASRVTWAGIKTLSNEEILK-FAPAEFIQSDA-WVPGKGVPYIPGLL  567



>ref|XP_009385223.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   545 bits (1403),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 263/527 (50%), Positives = 368/527 (70%), Gaps = 15/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST++K++K+ C PTDY+ TCE SL+  A +T DPKEL+ +AF+VT++++ +A + S +
Sbjct  38    ELSTSNKNIKDFCRPTDYQATCESSLSAVAGNTTDPKELVNLAFQVTIDHMKEAFNHSTV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L EA KD RTSDAL+ C+ELL  +I DL+ S ++++ F L ++ ++ +DLKVW+S +IT 
Sbjct  98    LSEAAKDSRTSDALENCRELLDYAIYDLKSSIDRLDGFSLTKLDKFLDDLKVWISASITY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT D  E M+  L ++ EL+SN LA++T+F   L SL +    F R+LL 
Sbjct  158   QETCLDGFENTTTDAAESMRKALNSSAELTSNILAIVTNFDSALDSLNL---GFNRKLLA  214

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E         +P ++    RRLL   PA +K +I VAKDGSG  K++ EA+  VP K++
Sbjct  215   EE---------YPSWISPGNRRLLQQSPAELKPNITVAKDGSGDVKTIGEAVLRVPTKSN  265

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T VI+IK GVY E+V+V R +  ++ +G+G +KT+ITG  +  DG  T+ TATVAI GD
Sbjct  266   YTFVIYIKEGVYEEQVQVNRSLTNVMMIGDGTSKTKITGKLNYIDGTATFKTATVAIVGD  325

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GFI +++  ENSAGAAKHQAVALRV +D ++F+N  +D YQDTLY H+ RQFYR+CTISG
Sbjct  326   GFIGKDLWIENSAGAAKHQAVALRVQSDKSVFYNVRMDGYQDTLYVHTKRQFYRECTISG  385

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG++P VFQNC +  RKP+ NQ+ +VTAQGRKDRR A+AI+L +C I A+PA   
Sbjct  386   TIDFIFGDSPTVFQNCLIQARKPLDNQQNIVTAQGRKDRRQASAIILHNCTISADPAYFP  445

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
             A      FLGRPWKEFSRT ++ + +DD++ P+GW  W G   L++C+Y E  NRGPGA 
Sbjct  446   ARKKLPTFLGRPWKEFSRTFVLQSQLDDLIDPKGWLPWSGDFGLNSCFYTELDNRGPGAD  505

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               +RV WKG K +I    A++FT   F+  +  WL +  +PF PG L
Sbjct  506   MSQRVNWKGVK-SIDYAHAQKFTVEHFIQGNA-WLPKTGVPFIPGLL  550



>ref|XP_011036905.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Populus euphratica]
Length=578

 Score =   545 bits (1404),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 264/525 (50%), Positives = 363/525 (69%), Gaps = 7/525 (1%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K+VK IC PTDY++TCE +L   A +T DP+ELIK+AFK+  +++ +A  KS++
Sbjct  54    QVSASMKAVKAICQPTDYRKTCEENLQKAAGNTTDPRELIKMAFKIAEKHLNEASKKSKV  113

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L+E  KDPRT  AL +CKEL+  S+D+L++S  KV +FD+  +++   D+K WLS +IT 
Sbjct  114   LEELSKDPRTRGALQSCKELMTMSVDELKQSLNKVTDFDITEIEKLMADVKTWLSASITY  173

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F+NTT + G++MK  LK + ELS+N LA+++  +  + SLE  G   +RRLL 
Sbjct  174   QETCLDGFQNTTTNAGKEMKKGLKLSMELSANLLAIVSGISSAIPSLESLG---QRRLLQ  230

Query  2570  AETKGeeqe-eEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
              +        + FP + D   RRLL    + IK DIVVAKDGSG + ++ EAL  VP K+
Sbjct  231   DDLPVLGHGDQIFPTWTDFGKRRLLAAPASKIKADIVVAKDGSGDFSTIREALHHVPIKS  290

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +T V++IKAG+Y E ++  + M  ++ +G+G   TRI G+++  DGI TYHTATV + G
Sbjct  291   SKTFVLYIKAGIYQEYIDFNKSMTNLMVIGDGRETTRIVGNKNFVDGINTYHTATVVVLG  350

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D F+A+NIGFE +AGA KHQAVALRVSAD  +F+NC +D +QDTLYT + RQF RDC++S
Sbjct  351   DNFVAKNIGFEKNAGAIKHQAVALRVSADYALFYNCSMDGHQDTLYTDAKRQFSRDCSVS  410

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNCK ++RKP+ NQ+C+VTAQGRK RR  +AIV+Q+  I A P L 
Sbjct  411   GTIDFVFGHASAVFQNCKFLIRKPLENQQCIVTAQGRKMRRQPSAIVIQNSTITAHPDLF  470

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPWKEFSRT+IM +FIDD++ PEGW  W GT  L TCWY E+ N GPG+
Sbjct  471   PERKLFKSYLGRPWKEFSRTIIMESFIDDVIQPEGWLPWLGTFGLKTCWYTEFNNNGPGS  530

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             S   RVKW G K  I  + A  FTPG F      W+    IP++P
Sbjct  531   SKAARVKWNGIK-TIDRQHALDFTPGRFFKGGA-WIKTTGIPYTP  573



>ref|XP_002865716.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41975.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=572

 Score =   545 bits (1404),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 269/536 (50%), Positives = 365/536 (68%), Gaps = 20/536 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T + +V+ +CAPTDYKETC  SL  A  D+  P +LIK+ F VT+ +I D I K+  
Sbjct  48    QIKTTTNAVEAVCAPTDYKETCVNSLMKASPDSTQPLDLIKLGFNVTIRSIKDGIKKASA  107

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  AL+ C++L+ ++ DDL++  +  + F + +++++  DL+VWLSG+I
Sbjct  108   ELKAKAANDNETKGALELCEKLMNDATDDLKKCLDNFDGFSITQIEDFVEDLRVWLSGSI  167

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + M  + KT+ EL+SNGLAMIT+ + LL    I G+     N
Sbjct  168   AYQQTCMDTFEEIKSNLSQDMHKIFKTSRELTSNGLAMITNISNLLGEFNITGLTGDLGN  227

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       +  P +V   TR+L+ T    +K ++VVA+DGSGQYK++ EAL 
Sbjct  228   YARKLLSTE-------DGIPSWVGPNTRQLMATK-GGVKANVVVAQDGSGQYKTINEALN  279

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N +  VI+IK GVYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  280   IVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNFYIGKVKTYHT  339

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVS D  +F+NC ID YQDTLY HS+RQF
Sbjct  340   ATVAINGDHFTAKNIGFENTAGPEGHQAVALRVSGDYAVFYNCQIDGYQDTLYVHSHRQF  399

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             +RDCTISGTVDFIFG+A VV QNC ++VRKPM  Q CM+TAQGR D R ++ +VLQ+C I
Sbjct  400   FRDCTISGTVDFIFGDAKVVLQNCNIVVRKPMKGQSCMITAQGRTDVRESSGLVLQNCHI  459

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EPA       NK +LGRPWKEFSRT+IM T ID+I+ P GW  W G   L+T +YAEY
Sbjct  460   TGEPAYLPVKSINKAYLGRPWKEFSRTIIMGTTIDNIIDPAGWLPWNGDFALNTLYYAEY  519

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +N GPG+   +RVKW G K+ ISP+ A++FTP  FL  +  W+   ++P+  G LQ
Sbjct  520   ENNGPGSDQAQRVKWPGIKK-ISPKQARRFTPARFLRGN-LWIPPNRVPYM-GNLQ  572



>ref|XP_006281463.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
 gb|EOA14361.1| hypothetical protein CARUB_v10027546mg [Capsella rubella]
Length=571

 Score =   545 bits (1403),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 266/536 (50%), Positives = 361/536 (67%), Gaps = 20/536 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+E+CAPTDYKETC  SL  A  D+  P ELIK+ F +T+++I D+I K+  
Sbjct  47    QIKTTTKAVQEVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSIKKASE  106

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A KD  T DAL+ C+ L+ ++ DDL++  +  + F +  +++   DL+VWLSG+I
Sbjct  107   ELKAKAAKDNETKDALELCESLMTDATDDLKKCLDNFDGFSITHIEDLVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D F+    +  + M  + KT+ EL+SNGLAMIT  +  L    + G+     +
Sbjct  167   AYQQTCMDTFDEINSNLSQDMHKIFKTSKELTSNGLAMITSISSFLGGFNMTGLTGDLGH  226

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ +       +  P +V   TRRL+ T    +K ++VVA+DGSGQYK++ EAL 
Sbjct  227   YARKLLSTK-------DGIPSWVGPNTRRLMATQ-GVVKPNVVVAQDGSGQYKTINEALN  278

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N    VI+IK GVYNE+V V +KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  279   LVPKANQNPFVIYIKQGVYNEKVNVTKKMTHVTFIGDGPTKTKITGSLNYHIGKVKTYHT  338

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVA+ GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  339   ATVAVNGDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYVHSHRQF  398

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+  VV QNC ++VRKPM NQ CM+TAQGR D R +  +VL +C I
Sbjct  399   YRDCTISGTVDFIFGDGKVVLQNCNIVVRKPMKNQSCMITAQGRTDVRESTGLVLHNCHI  458

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
             + EP        NK +LGRPWKEFSRT+IM T ID+++ P GW  W G   L T +YAE+
Sbjct  459   MGEPEYIPVKSINKAYLGRPWKEFSRTIIMRTNIDNVIDPAGWLPWDGDFALSTLYYAEF  518

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +N GPG+   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+  G LQ
Sbjct  519   ENTGPGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPNRVPYM-GNLQ  571



>ref|XP_006841651.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
 gb|ERN03326.1| hypothetical protein AMTR_s00003p00239700 [Amborella trichopoda]
Length=591

 Score =   545 bits (1405),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 275/571 (48%), Positives = 382/571 (67%), Gaps = 22/571 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssgg---------GEISTASKSVKEICAPTDY  3054
             ++ K++A+ GV+SI LVA VVA  V V    G           +  + K++K IC PTDY
Sbjct  19    QKKKRLAIIGVSSIILVAMVVAVAVGVSHHSGSGSSESGSDNHVQDSMKAIKTICQPTDY  78

Query  3053  KETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             KE C  SL      +T DPKEL+K++F+V +E +     +S LLKE +KDP T  AL  C
Sbjct  79    KEACVSSLTSVAGSNTTDPKELVKLSFEVALEKVKKVAGQSALLKEVEKDPGTRQALSIC  138

Query  2879  KELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
              E++  +ID+L+ S ++V  FDL  ++E   +++ WLS AIT QETC+DAFENTT   GE
Sbjct  139   DEIMDYAIDELKNSIDQVGGFDLSNMEEIIENIRSWLSAAITYQETCVDAFENTTSKAGE  198

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVD  2520
             +MK ++KTA +L+SN LA++T  +++  S +IP  NF RRLL+   +G      FP +V 
Sbjct  199   QMKKVMKTATKLTSNTLAIVTELSDVFASFKIP--NFNRRLLSTSNEG------FPEWVS  250

Query  2519  AATRRLLTTD-PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
              + RRL T D PA    D+VVA+DGSG   +V EAL  VP    +  VI++K G+Y E V
Sbjct  251   QSKRRLFTEDTPAESIPDVVVAQDGSGNCTTVNEALALVPAYGIKPFVIYVKEGIYKENV  310

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              + + M  +  +G+GPTK+ IT   +  DG+ T++TATV + G+GF+A+N+GFENSAGA 
Sbjct  311   NIEKNMTNVFMIGDGPTKSVITAGLNFVDGVKTFNTATVGVVGNGFVAKNMGFENSAGAE  370

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV +D +IF+NC +D YQDTLY H++RQFYR+CTISGT+DFIFGN+ VVFQNC
Sbjct  371   KHQAVALRVESDFSIFYNCQMDGYQDTLYAHTHRQFYRECTISGTIDFIFGNSAVVFQNC  430

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             +++VRKP+ NQ+  +TAQGR DRR   A++L +C I+A+P           +LGRPWKE+
Sbjct  431   QIVVRKPLDNQQNTITAQGRTDRRSPTALILHNCSIVADPEYYPLRNTLPTYLGRPWKEY  490

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SR  I+ + IDD+V P GW  W G   L+T +Y+EY NRGPGA+T +RVKW+G K +I+ 
Sbjct  491   SRAFILQSEIDDLVQPAGWLPWAGDFALNTLFYSEYDNRGPGAATAERVKWRGLK-SITA  549

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E A++FT   FL   E W+  A +PF PG +
Sbjct  550   EHAEKFTVARFLGGTE-WIKNASVPFIPGLI  579



>gb|EYU37278.1| hypothetical protein MIMGU_mgv1a002232mg [Erythranthe guttata]
Length=698

 Score =   549 bits (1415),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 287/573 (50%), Positives = 383/573 (67%), Gaps = 18/573 (3%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsv----gssggGEISTASKSVKEICAPTDYKETC-ERS  3033
             KK+A+  V S+ LVA VVA   +      + G  ++S + KS++ +C  TDY+ETC    
Sbjct  7     KKIAIVSVCSLLLVAMVVALFTTRHGNGNTDGEQDVSASQKSIQTLCQNTDYQETCVNSL  66

Query  3032  LAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSID  2853
              +   ++ DPKELI++AF+  ++ I DA + S +  E +KDPR  +AL++C+EL   +I+
Sbjct  67    TSSGSNSSDPKELIEIAFQAAIKQIRDAANNSTVFHEVEKDPRGKEALESCRELADRAIN  126

Query  2852  DLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTA  2673
             DL+RSF+K  NFD+  V+    DLK+WLSGAIT QETCID FE   GD  EKMK LLKT 
Sbjct  127   DLQRSFDKFNNFDITDVENILADLKIWLSGAITYQETCIDGFEEVPGDATEKMKELLKTG  186

Query  2672  NELSSNGLAMITHFTELLQSLEIPG--VNFKRRLLT----AETKGeeqeeEFPGFVDAAT  2511
              E++SNGLAM+T  + +LQS+   G      RRLL+     +  G   +E  PG++D+  
Sbjct  187   MEMTSNGLAMVTGISSVLQSIGGLGSYTTTSRRLLSNNDIIQIIGNSDDE-MPGWIDSNR  245

Query  2510  RRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR----AVPFKNDETVVIFIKAGVYNERV  2343
             R LL +    IK ++VVAKDGSG Y +V EALR     +  KN++T V++IK GVY E+V
Sbjct  246   RNLLRSSKKKIKPNLVVAKDGSGNYTTVNEALRNIVNIIDKKNNKTFVLYIKEGVYEEKV  305

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              V   +  ++F+G+GPTKT+ITG  +  DG  TY TATVAIQGD FIAR+IGFENSAGA 
Sbjct  306   VVNSSLTNLMFLGDGPTKTKITGRLNFIDGTNTYQTATVAIQGDHFIARDIGFENSAGAE  365

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRVSADM IF+NC +D YQDTLY H+YRQFYRDC ISGT+DFIFG++  VFQ C
Sbjct  366   KHQAVALRVSADMVIFYNCQMDGYQDTLYAHTYRQFYRDCVISGTIDFIFGDSAAVFQGC  425

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ+C+VTAQGRKD R    +VLQ+C  + +PA       NK +LGRPWKEF
Sbjct  426   SLVVRKPLDNQDCIVTAQGRKDLRQPTGLVLQNCSFVPDPAYYPVRNTNKAYLGRPWKEF  485

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+IM ++I D     GW  W     LDT +YAE+ NRGP ++   RVKW G K  +  
Sbjct  486   SRTIIMESYISDSFQAAGWLPWFEDFALDTLFYAEFNNRGPSSNKTDRVKWHGIKE-LPA  544

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             +  K+FT   FL   E+W+ R ++P+  GF+ P
Sbjct  545   KRVKRFTADEFLDG-ERWIPRTKVPYDGGFIFP  576



>emb|CDX80613.1| BnaC07g28310D [Brassica napus]
Length=678

 Score =   547 bits (1410),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 265/527 (50%), Positives = 354/527 (67%), Gaps = 14/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++KE+CAPTDYK+TCE +L   AKDT DP EL++  F VT++ IT+   KS+ 
Sbjct  35    EITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAGFNVTMKQITNVARKSQT  94

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  +I +L  SF ++  F+  +V E    +KVWLS  I+ 
Sbjct  95    MIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATISH  154

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TCID F+ T GD GE +K  LKTA +L+ NGLAM+T  +  L  ++   +N  RRLL 
Sbjct  155   QQTCIDGFKGTKGDAGETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQFTELN-SRRLLA  213

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E          P +VD   RRLLT   + +K D+VVA+DGSGQYK++ EA++ VP   +
Sbjct  214   QE----------PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKN  263

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V++IK GVY E V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD
Sbjct  264   VTFVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGD  323

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GFEN+AGAAKHQAV +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  324   RFIAKNMGFENTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  383

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A
Sbjct  384   TIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLA  443

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA 
Sbjct  444   VKESSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAG  503

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  504   VTGRVTWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  548



>ref|XP_008810219.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=589

 Score =   544 bits (1401),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 272/528 (52%), Positives = 363/528 (69%), Gaps = 14/528 (3%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +T SK++K IC PTDYKE CE SL   A +  DPK L++ AF VT+  I DA   S +L+
Sbjct  63    TTTSKAIKSICQPTDYKEICESSLTKAAGNASDPKVLVEAAFNVTISYIRDAFDHSSVLQ  122

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
                KDPRTSDALD CK+LL  +ID+L  SF K    D+  V +  +DLK+WLS A+T QE
Sbjct  123   ATAKDPRTSDALDDCKKLLDYAIDELRNSFTKFGQLDMNHVDDVIDDLKIWLSAAVTYQE  182

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+D FEN TGD  E M+  L ++  L+SN LA+I   + +L ++ +P    KRR L+ E
Sbjct  183   TCLDGFENITGDAAESMREALNSSQALTSNALAIIDEISSVLSTVRVP--FLKRRFLSHE  240

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
              +G  +   +P +V    RRLL      IK +I+VA+DGSG YK++ EAL A+P  ++  
Sbjct  241   EEGSGE---YPSWVANGKRRLLALAADQIKPNIIVAQDGSGNYKTIKEALGAIPKNSNSI  297

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGF  2205
              VI+IK GVY E+V + + M  ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ GDGF
Sbjct  298   FVIYIKEGVYKEQVWLDKSMMNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGDGF  357

Query  2204  IARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTV  2025
             IA+N+GFENSAGA KHQAVALRV +D +IF+NC +D +QDTLY+H+ RQFYRDCTI+GT+
Sbjct  358   IAKNLGFENSAGAEKHQAVALRVQSDRSIFYNCQMDGFQDTLYSHTKRQFYRDCTITGTI  417

Query  2024  DFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP---ALK  1854
             DFIFG+A  +FQNC + VRKP+ANQ+C+VTA GRKDRR A AI+L +C I A+P    L+
Sbjct  418   DFIFGDAASIFQNCIIRVRKPLANQQCIVTASGRKDRREATAIILHNCTIGADPDYLPLR  477

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
             A NP    +LGRPWK +SRTL++ + IDD + P+GW  W G   L+TC+YAE  NRGPGA
Sbjct  478   ARNPS---YLGRPWKPYSRTLVVQSQIDDFIHPQGWLPWLGDFGLNTCFYAEVDNRGPGA  534

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +  KRV WKGYK+ I    A++FT   F+  +  WL    +P+ PG L
Sbjct  535   TIAKRVAWKGYKK-IDYSHAQKFTVEQFIQGNS-WLKPTGVPYIPGLL  580



>ref|XP_007222393.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
 gb|EMJ23592.1| hypothetical protein PRUPE_ppa003441mg [Prunus persica]
Length=574

 Score =   543 bits (1400),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 275/575 (48%), Positives = 382/575 (66%), Gaps = 20/575 (3%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggG------EISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S         + ST++K+++ IC PTDY
Sbjct  4     GEVQNKKKIAIIGVSALILVAMVVAVTVGVTVSRHKGKSGGEQTSTSTKAIQSICQPTDY  63

Query  3053  KETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V +  + + I  S  LKE  KD R + AL  CK
Sbjct  64    KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKELAKDSRANQALQNCK  123

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL+ +IDDL  SF+K+  FD  ++  Y  DLKVWLS A+T ++TC+D F+NTTGD G K
Sbjct  124   ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-----TAETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L ++L I      RRLL       +    ++ +  P
Sbjct  184   MRQFLKTSQELTSNGLAMVSEVSTLFKALNI---KTGRRLLQDAATATDENRFQRAKIIP  240

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  241   AWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  300

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA+++GFEN+
Sbjct  301   DEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGFENT  360

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  361   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  420

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LGRP
Sbjct  421   FQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRP  478

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             W   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W G K+
Sbjct  479   WTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK  538

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  539   -LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  571



>ref|XP_008246353.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Prunus mume]
Length=609

 Score =   545 bits (1403),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 279/537 (52%), Positives = 367/537 (68%), Gaps = 18/537 (3%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             S ++K++K IC PTDYK+ C  SL + A +T DP +LIK+ F+ T++ I +A  KS LL+
Sbjct  58    SASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQATMKQIYEATKKSNLLQ  117

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKV---ENFDLERVKEYTNDLKVWLSGAIT  2754
             + +KDPRTS ALDTCKEL++ ++D+L +SF +V   ENF   + K +  DLKVWLS +IT
Sbjct  118   KLEKDPRTSMALDTCKELMELAVDELRQSFNRVGDIENF--SKYKTFIMDLKVWLSASIT  175

Query  2753  QQETCIDAFENTTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRR  2580
              QE+C+DAFENTT   D G++MK LLKT+  LSSNGLAM++     L  L  P  +  RR
Sbjct  176   YQESCLDAFENTTSSTDAGQEMKTLLKTSMRLSSNGLAMVSQIFSALTDLNNPDPSRHRR  235

Query  2579  LLTAETKGe----eqeeEFPGFVDAATRRLLTTD----PASIKHDIVVAKDGSGQYKSVV  2424
                    G       + EFP + +A  R+LLT      P + K D VVAKDGSG YK++ 
Sbjct  236   RRLLSLDGLPILGHGDLEFPEWYEAGVRKLLTISTAPSPKANKPDAVVAKDGSGSYKTIS  295

Query  2423  EALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGT  2244
             EAL  VP   +ET VI+IK GVYNE V V R M  ++ +G+G  KTRITG+++  DG  T
Sbjct  296   EALEHVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGTNKTRITGNQNFVDGTPT  355

Query  2243  YHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSY  2064
             Y TATVAI GD F+A +IGF+NSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH++
Sbjct  356   YRTATVAIHGDHFMAMDIGFDNSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTH  415

Query  2063  RQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQS  1884
             RQFYRDCTISGT+DF+FG+A  +FQNC  +VRKP+ +Q C+VTAQGRK+RR  +AIV+Q+
Sbjct  416   RQFYRDCTISGTIDFVFGDAAAIFQNCTFVVRKPLPDQSCIVTAQGRKERRQPSAIVIQN  475

Query  1883  CEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWY  1704
               I A+P        N+ +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y
Sbjct  476   STITADPDYFPVKNVNRAYLGRPWKEYSRTIIMESYIDDVIQPEGWLAWAGQWGLRTCFY  535

Query  1703  AEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              E+ N GP A+  +RV W+G K+ I+   A QFTPG F   DE W+  + +P  PG 
Sbjct  536   TEFCNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPCVPGL  590



>ref|XP_009352342.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Pyrus x bretschneideri]
Length=572

 Score =   543 bits (1398),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 264/530 (50%), Positives = 359/530 (68%), Gaps = 13/530 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ST++K+++ IC PTDYK+TCE SL+GA  +  DPKELIKV F+VT++ +   I KS  LK
Sbjct  49    STSTKAIQAICQPTDYKKTCEESLSGAAGNVTDPKELIKVGFQVTMDMLRGVIEKSTTLK  108

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +  KDP T DAL  CKELL+ +IDDL  SF+++  FD+ ++  Y  DLKVWLS A+T ++
Sbjct  109   DLAKDPSTGDALQNCKELLEYAIDDLGDSFDRIGAFDMSKLDLYVEDLKVWLSAAMTYEQ  168

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+D FENTTGD GEKM+  LKT+ EL++NGLAM+   + +  +L    V   RRLL A 
Sbjct  169   TCLDGFENTTGDAGEKMREFLKTSQELTNNGLAMVDQVSTMFGALN---VKSGRRLLEAT  225

Query  2564  T----KGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                  K  ++ +  P ++D     L T  P ++K D+VVAK G G+Y +V EAL+ +P  
Sbjct  226   AGTGAKKFQKAKVIPAWIDNRRLDLATATPQTLKPDVVVAKKGGGKYTTVNEALKDIPKD  285

Query  2396  NDETV-VIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             N   V VI++K GVY E V   + M  ++ +G+GPTKT ITG ++  +G  T  TATV +
Sbjct  286   NAVKVFVIYVKEGVYEEHVLFDKHMTNVMLIGDGPTKTIITGRKNFAEGTKTMQTATVGV  345

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              GD FIA++IGFEN+AGA  HQAVALRV +D++IF+NC +D YQDTLYT ++RQFYRDCT
Sbjct  346   VGDYFIAKDIGFENTAGAVGHQAVALRVQSDLSIFYNCKMDGYQDTLYTQTHRQFYRDCT  405

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGT+DFIFG+A  VFQNCKMIVRKP+ NQ CMVTA GR DRR    I+LQ+C I  EP 
Sbjct  406   ISGTIDFIFGDAAAVFQNCKMIVRKPLENQACMVTAHGRLDRRSPTGIILQNCTISGEPG  465

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
              +     NK +LGRPWK ++R ++M + IDD++ PEGW  W G+    +CW+ E+ NRG 
Sbjct  466   YE--KDLNKAYLGRPWKNYARAIVMQSQIDDVIAPEGWMEWIGSNNHQSCWFGEFGNRGL  523

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GA   KR  W+G K  ++ + A  FT G F+  D +W+  + +P+  G +
Sbjct  524   GADQTKRATWRGIKE-LTAQHAADFTAGRFVFGD-RWIQPSGVPYVAGMM  571



>ref|XP_006395088.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
 gb|ESQ32374.1| hypothetical protein EUTSA_v10003919mg [Eutrema salsugineum]
Length=567

 Score =   541 bits (1395),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 262/532 (49%), Positives = 362/532 (68%), Gaps = 18/532 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +C+PTD+K+TC  SL  A  ++ +P +LIK++F VT+ +I D I +S  
Sbjct  42    KIKTTTKAVQAVCSPTDFKDTCVNSLMEASPNSTEPLDLIKLSFDVTIRSIKDGIKRSST  101

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A KD  T  AL+ C+ L+ ++ DDL++ F+  + F + +++++  DL+VWLSG+I
Sbjct  102   ELKAKAAKDEETKGALELCENLMNDATDDLKKCFDNFDGFSITQIEDFVEDLRVWLSGSI  161

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + MK++ KT+ EL+SN LAMIT  + LL  + I  V     N
Sbjct  162   AYQQTCMDTFEEVKSNLAQDMKNIFKTSKELTSNSLAMITDLSILLGKVNITEVTGDLGN  221

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       E  P +V   TRRL+      +K ++VVA+DGSGQYKS+ EAL+
Sbjct  222   YARKLLSTE-------EGIPSWVGTNTRRLMAATQGGVKANVVVAQDGSGQYKSIDEALK  274

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             AVP  N    VI+IK G+Y E V+V +KM  + F+G+GPT+T+ITG+ + + G + TY T
Sbjct  275   AVPQNNRWPFVIYIKQGIYKENVDVTKKMTHVTFIGDGPTRTKITGNLNFRIGKVKTYQT  334

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC +D YQDTLY H++RQF
Sbjct  335   ATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQMDGYQDTLYVHAHRQF  394

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+A  +FQNC ++VRKPM  Q C+VTAQGR D R +  IVL +C I
Sbjct  395   YRDCTISGTVDFIFGDAKSLFQNCNIVVRKPMGGQSCIVTAQGRTDVRESTGIVLHNCRI  454

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EPA       NK +LGRPWK FSRT++M T ID+++ P GW  W G   L+T +YAEY
Sbjct  455   TGEPAYIPVKAVNKAYLGRPWKVFSRTIVMMTNIDNVIDPAGWLPWDGDFALNTLYYAEY  514

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             QN GPG++  +RV W G K NISP  A +FTP  FL  +  W+ +  +P++P
Sbjct  515   QNSGPGSNQAQRVNWAGIK-NISPRQALKFTPARFLRGN-LWIPQTHVPYTP  564



>ref|XP_003626199.1| Pectinesterase [Medicago truncatula]
 gb|AES82417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=593

 Score =   542 bits (1397),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 283/583 (49%), Positives = 389/583 (67%), Gaps = 28/583 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGE----------ISTASKSVKEICA  3066
             G  ++NK++A+ GV++  LVA VVA TV+VG +   E          +S + K+VK +CA
Sbjct  5     GDAKRNKRLAIIGVSTFLLVAMVVAVTVNVGFNNKKEPGEETSKESHVSQSVKAVKTLCA  64

Query  3065  PTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDAL  2889
             PTDYK+ CE SL A A +  +PKELIK+AF +T+  I++ + K+ LL+EA+KD RT  AL
Sbjct  65    PTDYKKECEDSLIAHAGNITEPKELIKIAFNITIAKISEGLKKTHLLQEAEKDERTKQAL  124

Query  2888  DTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGD  2709
             DTCK++++ SID+ +RS E+  NFDL  +      LKVWLSGAIT QETC+DAFENTT D
Sbjct  125   DTCKQVMQLSIDEFQRSLERFSNFDLNSLDRVLTSLKVWLSGAITYQETCLDAFENTTTD  184

Query  2708  TGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqee----  2541
              G+KMK +L+T+  +SSNGL++I   ++  + ++ P     RRLL     GEE       
Sbjct  185   AGKKMKEVLQTSMHMSSNGLSIINQLSKTFEEMKQPA---GRRLLKESVDGEEDVLGHGG  241

Query  2540  --EFPGFVD--AATRRLLTTDPA-SIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
               E P +VD  A  R+LL       ++  +VVAKDGSG + ++ EAL+ VP KN +  VI
Sbjct  242   DFELPEWVDDRAGVRKLLNKMTGRKLQAHVVVAKDGSGNFTTITEALKHVPKKNLKPFVI  301

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVY E VEV + M  +VF+G+G  KTRITG+++  DG+GT+ TA+VAI GD F+  
Sbjct  302   YIKEGVYKEYVEVTKTMTHVVFIGDGGRKTRITGNKNFIDGVGTFKTASVAITGDFFVGI  361

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              IGFENSAG  KHQAVALRV +D +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+
Sbjct  362   GIGFENSAGPEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFV  421

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG++  V QNC  +VRKP+ NQ+C+VTAQGRK++     +++Q   I+A+P        N
Sbjct  422   FGDSIAVLQNCTFVVRKPLENQQCIVTAQGRKEKNQPTGLIIQGGSIVADPKYYPVRLKN  481

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK+FSRT+ + T+I D++ PEG+  WQ   G    DTC+Y EY NRGPG+   
Sbjct  482   KAYLARPWKDFSRTIFLDTYIGDMITPEGYMPWQTPAGITGTDTCYYGEYNNRGPGSDVK  541

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             +RVKW+G K  I+ E A  F P  F   D+ W+   ++P+SPG
Sbjct  542   QRVKWQGVK-TITSEGAASFVPIRFFHGDD-WIRVTRVPYSPG  582



>ref|XP_010094457.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 ref|XP_010105652.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXB56090.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
 gb|EXC05633.1| Putative pectinesterase/pectinesterase inhibitor 28 [Morus notabilis]
Length=586

 Score =   541 bits (1395),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 274/576 (48%), Positives = 378/576 (66%), Gaps = 21/576 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacv------------vaatvsvgssggGEISTASKSVKEICAP  3063
             E+ K+ AV G++S+ LVA V             ++  S    G  E+S + K++K IC P
Sbjct  8     EKRKRYAVIGISSVLLVAMVIAVTVGVSLNNGQSSPASSNKDGSHEVSASMKAIKSICQP  67

Query  3062  TDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALD  2886
             TDYKE C  SL+  + +T DPK+LI+  FKV ++ +++A  KS +L++ +KDPR S AL 
Sbjct  68    TDYKEECINSLSSESGNTTDPKKLIQAGFKVAMKYLSEAAKKSVVLQDLEKDPRASKALG  127

Query  2885  TCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDT  2706
              CK+L++NSIDDL+ S +K+  FD+ +  +   DLK+WLS  +T QETC+D F+NTTG+ 
Sbjct  128   HCKQLMENSIDDLKHSVDKLGEFDISKFDQMLMDLKIWLSATVTYQETCLDGFQNTTGEA  187

Query  2705  GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPG-  2529
              EKMK  LKT+  LSSNGL M++  + +   L++  +   RRL + E + E         
Sbjct  188   AEKMKKALKTSMRLSSNGLTMVSEISSVFSDLQLSSMG--RRLFSDEEESELPVLGHSDE  245

Query  2528  --FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVY  2355
               +     RRL+   P  +K +IVVAKDGSG+Y ++ EAL+ +P +++ T VI+IK GVY
Sbjct  246   AEWFGGGVRRLMAVHPTKVKPNIVVAKDGSGKYTTINEALKDIPRRSENTFVIYIKEGVY  305

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
              E V + R M  ++ +G+G  KTRITG ++  DG  T  TATV + GD F AR+IGFEN+
Sbjct  306   KEYVTIERNMTNLLIIGDGANKTRITGDKNFIDGFPTSLTATVVVLGDHFRARDIGFENT  365

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA KHQAVALRV+AD  IF+ C +D YQDTLYTH+ RQFYRDC +SGT+DF+FG+A  V
Sbjct  366   AGAHKHQAVALRVNADEAIFYRCAMDGYQDTLYTHAKRQFYRDCNVSGTIDFVFGDAAAV  425

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNC+ IVR+PM NQ+C+VTAQGRK+RR  +AI++Q+   +A+P           +LGRP
Sbjct  426   FQNCRFIVRRPMDNQQCIVTAQGRKERRQPSAIIIQNGTFVADPDYYPVRFELPAYLGRP  485

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA-STDKRVKWKGYK  1638
             WKEFSRT+IM +FIDD++ P GW  W G   L TC+Y E+ NRGPGA    +R KWKG K
Sbjct  486   WKEFSRTIIMESFIDDLIQPRGWLPWAGDFGLRTCFYTEFGNRGPGAVEPSRRAKWKGVK  545

Query  1637  RNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              NI+ + A+ FTPG F   D  W+ R  IP+  G  
Sbjct  546   -NITAKHARDFTPGSFFKGD-WWIKRTGIPYVSGMF  579



>ref|XP_007226432.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
 gb|EMJ27631.1| hypothetical protein PRUPE_ppa024011mg [Prunus persica]
Length=577

 Score =   541 bits (1393),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 274/575 (48%), Positives = 381/575 (66%), Gaps = 20/575 (3%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggG------EISTASKSVKEICAPTDY  3054
             G  +  KK+A+ GV+++ LVA VVA TV V  S         + ST++K+++ IC PTDY
Sbjct  7     GEAQNKKKMAIIGVSALILVAMVVAVTVGVTVSRHQGKSGGEQTSTSTKAIQSICQPTDY  66

Query  3053  KETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+TCE +L+  A +  DPKEL+K  F+V +  + + I  S  LK   KD R + AL  CK
Sbjct  67    KKTCEDNLSKVASNVTDPKELVKAGFQVAIGQLREVIKNSTTLKALAKDSRANQALQNCK  126

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             ELL+ +IDDL  SF+K+  FD  ++  Y  DLKVWLS A+T ++TC+D F+NTTGD G K
Sbjct  127   ELLEYAIDDLGDSFDKLGPFDFTKLDSYVEDLKVWLSAAMTYEQTCLDGFQNTTGDAGAK  186

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL-----TAETKGeeqeeEFP  2532
             M+  LKT+ EL+SNGLAM++  + L ++L I      RRLL       +    ++ +  P
Sbjct  187   MRQFLKTSQELTSNGLAMVSEVSTLFKALNI---KTGRRLLQDAATATDENRFQRAKIIP  243

Query  2531  GFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETV-VIFIKAGVY  2355
              ++D     L T  P ++K D+VV+K G G+YK++ EAL+ +P  N+  V VI++K GVY
Sbjct  244   AWIDNRRLDLATATPLTLKPDVVVSKKGDGKYKTINEALKDIPKNNEVKVFVIYVKEGVY  303

Query  2354  NERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENS  2175
             +E V   + M  ++ +G+GPTKT ITG ++  DG  TY TATVA+ GD FIA+++GFEN+
Sbjct  304   DEHVFFDKHMTNVMLIGDGPTKTVITGRKNYADGTQTYQTATVAVVGDYFIAKDVGFENT  363

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AGA  HQAVALRV +D++IF+NC++D YQDTLYT ++RQFYRDCTISGT+DFIFG+A  V
Sbjct  364   AGAIGHQAVALRVQSDLSIFYNCNMDGYQDTLYTQTHRQFYRDCTISGTIDFIFGDAAAV  423

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
             FQNCKMIVRKP+ NQ CMVTA GR D R  +A++LQ+C I  E         NK +LGRP
Sbjct  424   FQNCKMIVRKPLENQACMVTAHGRLDMRSPSALILQNCTISGERGYD--KELNKAYLGRP  481

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             W   +R ++M + IDD++ PEGW  W GT   +TCW+ E+ NRG GA   KRV W G K+
Sbjct  482   WTSLARAIVMQSQIDDVIAPEGWMEWTGTANHNTCWFGEFGNRGVGAELSKRVTWSGMKK  541

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              ++PE A  FT G F+  D +W+  + +P+  G +
Sbjct  542   -LTPEQAADFTAGKFIFGD-RWILPSGVPYVAGMM  574



>ref|XP_010464089.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Camelina sativa]
Length=696

 Score =   545 bits (1403),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 358/529 (68%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+++ K+VK++CAPTDYK+TCE +L     +T DP EL+K AF+ T++ ITDA  KS+ 
Sbjct  50    EITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPVELVKTAFRATMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+  ++ E   ++++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F++T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL+
Sbjct  170   EETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLS  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      E  P +VD   R+LL    A    K DIVVA+DGSGQY ++ EAL+ VP K
Sbjct  229   ---------EGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINEALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+YNE V+V + M  +VF+G+GP KT I+G++S KDGI TY T TVAI 
Sbjct  280   KNTTFVVHIKAGIYNEYVQVNKSMTHLVFIGDGPDKTIISGNKSYKDGITTYRTCTVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGFEN+AGA KHQAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GDYFIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+S+T+IM TFI D + P+GW  W G   L T +Y+E +N GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  520   AGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_009151177.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Brassica rapa]
Length=693

 Score =   543 bits (1400),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 263/527 (50%), Positives = 354/527 (67%), Gaps = 14/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++KE+CAPTDYK+TCE +L   AKDT DP EL++ AF VT++ IT+   KS+ 
Sbjct  49    EITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  +I +L  SF ++  F+  +V E    +KVWLS  IT 
Sbjct  109   MIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITH  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TCID F+ T GD GE +K  LKTA +L+ N LAM+T  +  L  ++   ++  RRLL 
Sbjct  169   EQTCIDGFKGTKGDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELS-SRRLLA  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E          P +VD   RRLLT   + +K D+VVA+DGSGQYK++ EA++ VP   +
Sbjct  228   QE----------PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKN  277

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V++IK GVY E V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD
Sbjct  278   VTFVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGD  337

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GF+N+AGAAKHQAV +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  338   RFIAKNMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  397

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A
Sbjct  398   TIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLA  457

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA 
Sbjct  458   VKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAG  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  518   VTGRVTWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>ref|XP_009421439.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=556

 Score =   538 bits (1387),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 262/527 (50%), Positives = 362/527 (69%), Gaps = 15/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTD-DPKELIKVAFKVTVENITDAISKSEL  2931
             ++ST+ K+V++ C PTDYKETCE +L+     D DPKEL+ +AF +TV++I DAI  S +
Sbjct  38    QLSTSVKNVQDFCRPTDYKETCENTLSSVAGPDADPKELLNLAFNITVKHINDAIDHSTV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L EA KDP TS+AL+ C+ELL  +IDDL RS +++ +F +  + ++ +DLK+WLS  IT 
Sbjct  98    LSEAAKDPSTSEALENCRELLDYAIDDLRRSVDRLGDFSVANLDKFLDDLKIWLSATITY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FE TT + GE M+ +L +++EL+SN LA++ +F + L SL +P     R+LL 
Sbjct  158   QETCVDGFEGTTTNAGESMRKMLNSSSELTSNILAIVNNFDDTLSSLNLP---INRKLLA  214

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
                      E +P +V    RRLL T  A +K ++VVA+DGSG  K++ EA+  VP K  
Sbjct  215   ---------EGYPSYVTPGKRRLLATSTADLKPNVVVAQDGSGDVKTIGEAISRVPNKGA  265

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  +I IK G Y E+V V +    ++ +G+GPTKT+ITGS +  DG  T+ TATVA+ GD
Sbjct  266   DIFIIHIKEGEYKEKVHVNKSATNVMLIGDGPTKTKITGSLNYVDGTRTFDTATVAVVGD  325

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GF+A+++  ENSAGA KHQAVALRV +DM++F+NC ID YQDTLY H++RQFYRDCTISG
Sbjct  326   GFVAKDLWIENSAGAEKHQAVALRVQSDMSVFYNCRIDGYQDTLYVHTHRQFYRDCTISG  385

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG++  +FQNC ++ RKP+ NQ+ +VTAQGRK R+ A+AI+L +C I A+PA   
Sbjct  386   TIDFIFGDSASIFQNCLILARKPLDNQQNIVTAQGRKMRQQASAIILHNCTISADPAYYD  445

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                    FLGRPWK +SRT I+ + IDD++ P+GW  W G   L+TC+Y E  NRGPGA 
Sbjct  446   FRTKLPTFLGRPWKMYSRTFILQSQIDDLIHPDGWLPWFGDFGLNTCFYTEVDNRGPGAD  505

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
               KRV WKG K NI    AK+F+   FL    +WL R  +PF+   L
Sbjct  506   KSKRVTWKGVK-NIDYAHAKKFSVQQFLHGG-KWLPRTGVPFTAELL  550



>ref|XP_007207839.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
 gb|EMJ09038.1| hypothetical protein PRUPE_ppa023319mg [Prunus persica]
Length=589

 Score =   540 bits (1391),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 276/532 (52%), Positives = 364/532 (68%), Gaps = 16/532 (3%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             S ++K++K IC PTDYK+ C  SL + A +T DP +LIK+ F+  ++ I +A  KS LL+
Sbjct  58    SASTKAIKAICQPTDYKQECLSSLTSAAGNTTDPIQLIKIGFQAAMKQIYEATKKSNLLQ  117

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKV---ENFDLERVKEYTNDLKVWLSGAIT  2754
             + +KD RTS ALDTCKEL++ ++D+L +SF ++   ENF   + K +  DLKVWLS +IT
Sbjct  118   KLEKDHRTSMALDTCKELMELAVDELNQSFNRLGDTENF--YKYKTFIMDLKVWLSASIT  175

Query  2753  QQETCIDAFENTTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRR  2580
              QE+C+DAFENTT   D GE+MK LLKT+  LSSNGLAM+      L  L  P  + +RR
Sbjct  176   YQESCLDAFENTTSSNDAGEEMKTLLKTSMRLSSNGLAMVAQIFSALTDLNNPDPSHRRR  235

Query  2579  LLTAETKGeeqe--eEFPGFVDAATRRLLT--TDPASIKH--DIVVAKDGSGQYKSVVEA  2418
             LL+ +          E P + +A  R+LLT  T PA   H  D VV+KDGSG YK++ EA
Sbjct  236   LLSFDGLPILGHGDLELPEWYEAGVRKLLTISTAPAPKAHKPDAVVSKDGSGSYKTICEA  295

Query  2417  LRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYH  2238
             L  VP   +ET VI+IK GVYNE V V R M  ++ +G+G  KTRITG+ +  DG  TY 
Sbjct  296   LEHVPKYGNETFVIYIKEGVYNESVRVNRSMTNVMMIGDGANKTRITGNHNFVDGTPTYR  355

Query  2237  TATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQ  2058
             TA VAI GD F+A +IGFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH++RQ
Sbjct  356   TAAVAIHGDHFMAMDIGFENSAGPEKHQAVALRVSADEAIFYKCSMDGYQDTLYTHTHRQ  415

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
             FYRDCTISGT+DF+FG+A  +FQNC  +V KP+ +Q C+VTAQGRK+ R  +AIV+Q+  
Sbjct  416   FYRDCTISGTIDFVFGDAAAIFQNCTFVVHKPLPDQSCIVTAQGRKEGRQPSAIVIQNST  475

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             I A+P        NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W G   L TC+Y E
Sbjct  476   ITADPDYFLVKNVNKAYLGRPWKEYSRTIIMESYIDDVIQPEGWLPWAGQWGLRTCFYTE  535

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             ++N GP A+  +RV W+G K+ I+   A QFTPG F   DE W+  + +P+S
Sbjct  536   FRNTGPAANKARRVTWQGIKQ-ITRRHAAQFTPGKFFRGDE-WIKLSGVPYS  585



>ref|XP_010547008.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X2 [Tarenaya hassleriana]
Length=570

 Score =   539 bits (1388),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/530 (49%), Positives = 357/530 (67%), Gaps = 18/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +C PTDYKETC  SL A + ++  P +LI++ F +T+ +I   I K+  
Sbjct  46    QIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKKAAH  105

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL   A+KDP T  ALD C+EL+ ++IDDL++ F+K + F+L   +E+  DL+VWLSG+I
Sbjct  106   ELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVEDLRVWLSGSI  165

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    D  ++M  + KT+ EL+SNGLAM++  + LL    I GV     +
Sbjct  166   AFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGS  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       + FP ++    R+L+      +K + VVA DGSGQ+KS+  AL+
Sbjct  226   YARKLLSTE-------DGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALK  278

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP KN    VI+IK G+Y E+V+V + M+ + F+G+GPTKTRITG+ +   G + TY T
Sbjct  279   TVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQT  338

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVA+ G+ F A++IGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  339   ATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYQDTLYAHSHRQF  398

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGT+D+IFG+A   FQNC M+VRKPM  Q CMVTAQGR D+R    IVL +C I
Sbjct  399   YRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDKRETTGIVLHNCRI  458

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               +PA       NK +LGRPWK+FSRT+IM T I+DI+ P+GW  W G   LDT  YAE+
Sbjct  459   TGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWNGNFALDTLEYAEF  518

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +N+GPG++   RVKW G K+  +P  A +FT G FL     W+ + Q+P+
Sbjct  519   ENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGGT-WIPQTQVPY  566



>ref|XP_010440281.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   538 bits (1386),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 263/530 (50%), Positives = 353/530 (67%), Gaps = 20/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
              I   +K+++ +CAPTDYKETC  SL  A  D+  P ELIK+ F +T+++I D++ K+  
Sbjct  47    HIQATTKAIRAVCAPTDYKETCVDSLMHASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  ALD C++L+ ++ DDLE+       F +  ++++  DL+VWLSG+I
Sbjct  107   ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + M  + +T+ EL+SN LAMIT  +  L    I G+     N
Sbjct  167   AYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGN  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+ E       +  P +V   TRRL+  +   +K D+VVA+DGSGQYK++ EAL 
Sbjct  226   HARKLLSTE-------DGIPSWVGPNTRRLMA-EQGVVKPDVVVAQDGSGQYKTINEALS  277

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N +  VI+IK GVYNE+V+VP+KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  278   VVPKANQKPFVIYIKQGVYNEKVDVPKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHT  337

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  338   ATVAINGDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQF  397

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+  VV Q C ++VRKPM  Q CM+TAQGR D R +  +VL +C I
Sbjct  398   YRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTDERESTGLVLDNCHI  457

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EP        NK +LGRPWK+FSRT+IM T IDD+V P GW  W G+  L+T +YAEY
Sbjct  458   TGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIDDVVDPAGWLPWNGSFALNTLYYAEY  517

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +N GPG+   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  518   ENNGPGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>emb|CDY68790.1| BnaAnng28400D [Brassica napus]
Length=704

 Score =   543 bits (1398),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 263/527 (50%), Positives = 354/527 (67%), Gaps = 14/527 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+ + K++KE+CAPTDYK+TCE +L   AKDT DP EL++ AF VT++ IT+   KS+ 
Sbjct  49    EITASVKAIKEVCAPTDYKKTCEDTLRKDAKDTSDPLELVRAAFNVTMKQITNVARKSQT  108

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  +I +L  SF ++  F+  +V E    +KVWLS  IT 
Sbjct  109   MIELQKDPRTKMALDQCKELMDYAIGELSNSFVELGKFEFHKVDEVLIKVKVWLSATITH  168

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ++TCID F+ T GD GE +K  LKTA +L+ N LAM+T  +  L  ++   ++  RRLL 
Sbjct  169   EQTCIDGFKGTKGDAGETIKKALKTAVQLTHNALAMVTEMSNYLGQMQFTELS-SRRLLA  227

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E          P +VD   RRLLT   + +K D+VVA+DGSGQYK++ EA++ VP   +
Sbjct  228   QE----------PSWVDGRVRRLLTAPLSEVKPDMVVAQDGSGQYKTISEAMQNVPKNKN  277

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
              T V++IK GVY E V+V R M+ +VF+G+GP KT ITG +S +DGI TY TATVAI GD
Sbjct  278   VTFVVYIKTGVYKEFVQVDRTMSDLVFIGDGPDKTVITGEKSFQDGITTYRTATVAIIGD  337

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA+N+GF+N+AGAAKHQAV +RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISG
Sbjct  338   RFIAKNMGFQNTAGAAKHQAVGIRVLSDQSIFYNCRFDGYQDTLYAHSHRQFYRDCTISG  397

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR+D +     VLQ C I  E    A
Sbjct  398   TIDFLFGDAAAVFQNCILLVRKPLPNQACPITAHGREDPKETTGFVLQGCTIAGEADYLA  457

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 +K +LGRPWK +S+T+IM TFI D +  EGW  W+G   +DT +Y+E +N GPGA 
Sbjct  458   VKETSKAYLGRPWKAYSKTIIMDTFIPDFIAAEGWQQWKGNFGIDTLFYSEARNTGPGAG  517

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
                RV W G K+ +S E    +TP  ++  DE W+    +P++PG  
Sbjct  518   VTGRVTWPGIKK-LSDEDILGYTPAKYIQGDE-WIPSKGVPYTPGLF  562



>ref|XP_008450602.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Cucumis melo]
Length=583

 Score =   538 bits (1386),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 259/527 (49%), Positives = 366/527 (69%), Gaps = 9/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EIS++ K++K IC PTDYK+ C  SL A   ++ DP+EL++  FK  ++ I  A +KS  
Sbjct  53    EISSSMKAIKAICQPTDYKQECIASLKATGNNSSDPQELVQAGFKAAMKLIQAAANKSVD  112

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             LK+ +KDPRTS AL  CKEL+  +ID+L+ S  K+  FD+ ++ E   D+++WLS  IT 
Sbjct  113   LKQLEKDPRTSKALAGCKELMDFAIDELKYSMNKLGEFDITKLDEMLIDIRIWLSATITY  172

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F+NTTG+  EKMK  LKT+ +LSSNGLAM++ F+ +L  L+IPG++ +RRLL 
Sbjct  173   QETCLDGFQNTTGNAAEKMKKALKTSMKLSSNGLAMVSQFSSMLTELQIPGIS-RRRLLE  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP-FKN  2394
                 G +    +P + +   RRLL    + +K ++VVAKDGSGQ++++  AL  VP  KN
Sbjct  232   IPVLGHDD---YPDWANPGMRRLLAAG-SRVKPNVVVAKDGSGQFRTIQAALDQVPKRKN  287

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             + T VI IKAGVY E +++ + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  
Sbjct  288   NATYVIHIKAGVYQEYLQIKKTVTHLMLIGDGPKKTIITGNKNFVDGTPTFKTATVAVTA  347

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+AR+IGFEN+AG  KHQAVALRV AD  +F+NC +  YQDTLY H+ RQFYRDCT+S
Sbjct  348   EHFMARDIGFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVS  407

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQ C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C I A+  L 
Sbjct  408   GTIDFIFGDAAAIFQGCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSIKADKDLA  467

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   + FLGRPWKE+SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG+
Sbjct  468   PVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLKTCFYTEYNNYGPGS  527

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             +  KRVKW+G K  I+P+ A  FT G F+M D +W+    +P+  G 
Sbjct  528   NKSKRVKWRGIK-TITPQHALDFTAGRFVMGD-RWIKPTGVPYVSGM  572



>ref|XP_009124869.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brassica rapa]
 emb|CDY18812.1| BnaAnng02770D [Brassica napus]
Length=615

 Score =   539 bits (1389),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 354/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E++ + K+VK++CAPTDYK+TCE +L     +T DP EL+K AF VT++ ITDA  KS+ 
Sbjct  50    ELAASVKAVKDVCAPTDYKKTCEDTLLKNGHNTTDPMELVKTAFSVTMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   MMDLQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F+ T G  GE MK  LKTA EL+ NGLA+I+  +  +  + IP +N  RRLL+
Sbjct  170   EETCLEGFQGTQGKAGETMKKALKTAIELTHNGLAIISEMSSFVGQMGIPELN-SRRLLS  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDP--ASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +          P +VD   R LL      +  K DIVVA+DGSGQY ++ +A++ VP K
Sbjct  229   QD---------IPSWVDQRGRSLLQAAEGYSDAKADIVVAQDGSGQYTTINDAMKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAGVY E V+V + M  +VF+G+GP KT I+GS++ KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGVYKEYVQVNKSMTHLVFIGDGPDKTIISGSKNYKDGITTYRTATVAII  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AGA KHQAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  340   GDYFIAKNIGFVNTAGAIKHQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDARESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   LDT +Y+E QN GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWQPWLGNFGLDTLFYSEVQNIGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+   RV W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  520   AALAGRVTWPGIK-TLSDEEILSFTPDQYIQGD-VWVPGKGVPYTPGLL  566



>ref|XP_010429701.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Camelina sativa]
Length=677

 Score =   541 bits (1393),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 265/529 (50%), Positives = 356/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+++ K+VK++CAPTDYK+TCE +L     +T DP EL+K AFK T++ ITDA  KS+ 
Sbjct  50    EITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+  ++ E   ++++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F++T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL 
Sbjct  170   EETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLA  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      +  P +VD   R+LL    A    K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  229   ---------QGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+G  KT I+G++S KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGFEN+AGA KHQAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GDYFIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+SRT+IM TFI D + P+GW  W G   L T +Y+E +N GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSRTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  520   AGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_009402043.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Musa acuminata subsp. malaccensis]
Length=559

 Score =   536 bits (1381),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 269/562 (48%), Positives = 377/562 (67%), Gaps = 19/562 (3%)
 Frame = -1

Query  3200  NKKVAVTGVASIFLvacvvaatvsvgss----ggGEISTASKSVKEICAPTDYKETCERS  3033
             N KVA   V++I LVA V    V++ +        + S++ K++K+ C PTDY+ETCE +
Sbjct  3     NMKVAALSVSAIVLVAIVATVAVTISNLDSEPAKTQFSSSQKNIKDFCNPTDYQETCEST  62

Query  3032  L-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSI  2856
             L A A ++ DPKEL+ +AF++T++ I +A + S +L EA K+PRTSDAL+ C+ELL  +I
Sbjct  63    LSAAAGNSTDPKELVNLAFQITIDQIKEAFNHSTVLSEAAKNPRTSDALENCRELLDYAI  122

Query  2855  DDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             DDL  S +++E F L ++ ++ +DLKVW+S +IT QETC+D FENTT +  E M+  L +
Sbjct  123   DDLRSSIDQLEGFSLIKLDKFLDDLKVWISASITYQETCLDGFENTTTNAAESMRKALNS  182

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT  2496
             + E++SN LA++ +    L SL +      R+LL  E         +P +V    RRLL 
Sbjct  183   SAEMTSNILAIVINLDNTLDSLNL---GISRKLLAEE---------YPSWVSLGKRRLLQ  230

Query  2495  TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKI  2316
               PA +K ++ VA+DG+G  K++ +AL  VP K++ T VI+IK GVY E+V+V R +  +
Sbjct  231   LSPAELKPNVTVAQDGTGDVKTINDALLRVPKKSNHTFVIYIKEGVYKEKVQVNRSLTNV  290

Query  2315  VFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRV  2136
             + VG+G  KT+ITGS +  DG  T+ TATVA+ GDGFI +++  ENSAGAAKHQAVALRV
Sbjct  291   IMVGDGTNKTKITGSLNYIDGTATFKTATVAVIGDGFIGKDLWIENSAGAAKHQAVALRV  350

Query  2135  SADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMA  1956
              +D ++F+N  ID YQDTLY H+ RQFYRDC ISGT+DFIFG+   V QNC ++ RKPM 
Sbjct  351   QSDKSVFYNVRIDGYQDTLYVHTKRQFYRDCNISGTIDFIFGDGAAVLQNCLILARKPMD  410

Query  1955  NQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTF  1776
             NQ+ +VTAQGRKDRR A AIVL +C I A+PA          FLGRPWKEFSRT ++ + 
Sbjct  411   NQQNIVTAQGRKDRRQATAIVLHNCTISADPAFFPFREKLPTFLGRPWKEFSRTFVLQSQ  470

Query  1775  IDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPG  1596
             +DD++ P+GW  W     L+TC+Y E  NRGPGA+T +RVKWKG K  I    A++FT  
Sbjct  471   LDDLIDPKGWLPWFENFGLNTCFYTELDNRGPGANTSQRVKWKGVK-TIGYAHAQKFTVE  529

Query  1595  PFLMADEQWLGRAQIPFSPGFL  1530
              F+  +  WL ++ +P+ PG L
Sbjct  530   HFIQGN-TWLPKSGVPYIPGLL  550



>ref|XP_004135775.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 ref|XP_004157292.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Cucumis sativus]
 gb|KGN66044.1| Pectinesterase [Cucumis sativus]
Length=583

 Score =   536 bits (1381),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 260/527 (49%), Positives = 360/527 (68%), Gaps = 9/527 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EIS++ K++K IC PTDYK+ C  SL A   ++ DPKEL++  FK  ++ I  A +KS  
Sbjct  53    EISSSMKAIKAICQPTDYKQECVASLKATGNNSSDPKELVQAGFKAAMKLIQAAANKSVA  112

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L + +KDPR S AL  CKEL+  +ID+L+ S  K+  FD+ ++ E   D+++WLS  IT 
Sbjct  113   LNQLEKDPRASKALAGCKELMDFAIDELKYSMNKLGEFDISKLDEMLIDIRIWLSATITY  172

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F NTTG+  EKMK  LKT+ +LSSNGLAM++  + +L  L+IPG++ +RRLL 
Sbjct  173   QETCLDGFANTTGNAAEKMKKALKTSMKLSSNGLAMVSQISSMLSELQIPGIS-RRRLLE  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP-FKN  2394
                 G +    +P + +   RRLL    + +K ++VVAKDGSGQ+K++ EA+  VP  KN
Sbjct  232   IPVLGHDD---YPDWANPGMRRLLAAG-SKVKPNVVVAKDGSGQFKTIQEAIDQVPKRKN  287

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             + T VI IKAGVY E V V + +  ++ +G+GP KT ITG+++  DG  T+ TATVA+  
Sbjct  288   NATYVIHIKAGVYQEYVLVKKTLTHLMLIGDGPKKTIITGNKNFIDGTPTFKTATVAVTA  347

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             + F+AR+IGFEN+AG  KHQAVALRV AD  +F+NC +  YQDTLY H+ RQFYRDCT+S
Sbjct  348   EHFMARDIGFENTAGPQKHQAVALRVQADKAVFYNCEMHGYQDTLYVHTMRQFYRDCTVS  407

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DFIFG+A  +FQ+C  +VRKP+ NQ+C+VTA GRK+RR  +A+++Q+C       L 
Sbjct  408   GTIDFIFGDAAAIFQSCTFLVRKPLPNQQCIVTAHGRKERRQPSALIIQNCSFKPHADLV  467

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   + FLGRPWKE+SRT+IM ++I D++ PEGW  W G   L TC+Y EY N GPG+
Sbjct  468   PVQKQFRSFLGRPWKEYSRTIIMESYIGDLIQPEGWLPWAGDWGLRTCFYTEYNNYGPGS  527

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
                KRVKW+G K NI+P+ A  FTPG FL  D +W+    +P+  G 
Sbjct  528   DKSKRVKWRGIK-NITPQHAVDFTPGRFLKGD-RWIKPTGVPYVSGL  572



>ref|XP_009134836.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Brassica rapa]
Length=724

 Score =   541 bits (1395),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 353/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+++ K+VK++CAPTD+K+TCE SL     +T DP EL+K AF  T++ IT A  KS+ 
Sbjct  50    QITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ FE T G+ GE MK  LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+
Sbjct  170   EETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLS  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD   RRLL    A    K DIVVA+DGSGQYK++ EAL+ VP K
Sbjct  229   QE---------IPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V++IKAG+Y E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI 
Sbjct  280   KNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAII  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AG AK QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  340   GDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPG
Sbjct  460   LAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  520   AGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_010429777.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X2 [Camelina sativa]
Length=677

 Score =   540 bits (1390),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 264/529 (50%), Positives = 356/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+++ K+VK++CAPTDYK+TCE +L     +T DP EL+K AFK T++ ITDA  KS+ 
Sbjct  50    EITSSVKAVKDVCAPTDYKKTCEDTLIKNGNNTSDPIELVKTAFKATMKQITDAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+  ++ E   ++++WLS AI+ 
Sbjct  110   MMELQKDPRTRMALDQCKELMDYALGELSNSFEELGKFEFHKLDEALINMRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ F++T G+ GE MK  LKTA EL+ NGLA+I+  +  +  ++IP +N  RRLL 
Sbjct  170   EETCLEGFQDTKGNAGETMKKALKTAIELTHNGLAIISELSNFVGQMQIPSLN-SRRLLA  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                      +  P +VD   R+LL    A    K DIVVA+DGSGQY ++ +AL+ VP K
Sbjct  229   ---------QGIPSWVDQRGRKLLQDAAAYSDAKPDIVVAQDGSGQYTTINDALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IKAG+Y E V+V + M  +VF+G+G  KT I+G++S KDGI TY TATVAI 
Sbjct  280   KNTTFVVHIKAGIYKEYVQVNKSMTHLVFIGDGADKTIISGNKSYKDGITTYRTATVAIV  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGFEN+AGA KHQAVALRV +D  IF NC  D YQDTLYTHS+RQF+RDCTI
Sbjct  340   GDYFIAKNIGFENTAGAIKHQAVALRVQSDEAIFFNCRFDGYQDTLYTHSHRQFFRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG++  VFQNC ++VRKP+ NQ C +TA GR D R +   V Q C I  EP  
Sbjct  400   SGTIDFLFGDSAAVFQNCTLLVRKPLPNQACPITAHGRIDPRESTGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+S+T+IM TFI D + P+GW  W G   L T +Y+E +N GPG
Sbjct  460   LAVKETSKAYLGRPWKEYSKTIIMNTFIPDFIQPQGWLPWLGDFGLKTLFYSEVKNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K  +S E    FTP  ++  D  W+    +P++PG L
Sbjct  520   AGLANRVTWAGIK-TLSDEEVLMFTPAQYIQGD-IWVPGKGVPYTPGLL  566



>ref|XP_006394934.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
 gb|ESQ32220.1| hypothetical protein EUTSA_v10003734mg [Eutrema salsugineum]
Length=704

 Score =   540 bits (1392),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 261/529 (49%), Positives = 359/529 (68%), Gaps = 14/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             EI+T+ K++K++CAPTDYK+TCE +L   AK+  DP EL+K AF  T++ I++   KS+ 
Sbjct  47    EITTSVKAIKDVCAPTDYKKTCEDTLRKDAKNISDPLELVKTAFNATMKQISNVAKKSQT  106

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + +  KDPRT  ALD CKEL+  +I +L +SF+++ +F+L ++ E    LK+WLS  I+ 
Sbjct  107   MIDLQKDPRTKMALDQCKELMDYAIVELTKSFDEIGSFELHKMDEALIKLKIWLSATISH  166

Query  2750  QETCIDAFENTTGDT--GEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             ++TC+D F+ T G+   GE MK  LKTA +L+ NGLAM++  +  L  ++ P +N  RRL
Sbjct  167   EQTCLDGFQGTQGNNNAGETMKKALKTAVQLTHNGLAMVSEMSNSLGQMQFPELN-SRRL  225

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             L+ +        +FP ++D   R LL    +  K D+VVA+DGSGQYK++ EAL+ VP K
Sbjct  226   LSQD--------QFPSWLDVRARSLLNVPSSEAKPDMVVAQDGSGQYKTINEALQNVPKK  277

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V+ IK G+Y E V+V R M  +VF+G+GP KT ++G +S KDGI TY TATV I 
Sbjct  278   RNATFVVHIKEGIYKEYVQVNRSMPDLVFIGDGPDKTVLSGDKSFKDGITTYRTATVGII  337

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+N+GFEN+AGA KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTI
Sbjct  338   GDHFIAKNMGFENTAGAIKHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTI  397

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GRKD R +   VLQ C I  E   
Sbjct  398   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCRIAGESDY  457

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPWKE+S+T+IM TFI D V  +GW  WQG   LDT +Y+E +N GPG
Sbjct  458   LAVKETSKAYLGRPWKEYSKTIIMNTFIPDFVPAQGWQPWQGNFGLDTLFYSEVRNTGPG  517

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K+ +S E   +FTP  ++  D  W+    +P++PG  
Sbjct  518   APVTNRVTWPGIKK-LSEEEVLEFTPSRYIQGDA-WIPGKGVPYTPGLF  564



>emb|CDX74137.1| BnaA03g29100D [Brassica napus]
Length=708

 Score =   540 bits (1392),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 354/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+++ K+VK++CAPTD+K+TCE SL     +T DP EL+K AF  T++ IT A  KS+ 
Sbjct  50    QITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ FE T G+ GE MK  LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+
Sbjct  170   EETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLS  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E         FP +VD   RRLL      +  K DIVVA+DGSGQYK++ EAL+ VP K
Sbjct  229   QE---------FPSWVDQRGRRLLQAAAAYSDAKADIVVAQDGSGQYKTINEALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V++IKAG+Y E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI 
Sbjct  280   KNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAII  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AG AK QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  340   GDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPG
Sbjct  460   LAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  520   AGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_009134835.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
isoform X1 [Brassica rapa]
Length=745

 Score =   541 bits (1395),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 266/529 (50%), Positives = 353/529 (67%), Gaps = 15/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+++ K+VK++CAPTD+K+TCE SL     +T DP EL+K AF  T++ IT A  KS+ 
Sbjct  50    QITSSVKAVKDVCAPTDFKKTCEDSLNKNGNNTTDPVELVKTAFSATMKQITAAAKKSQT  109

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E  KDPRT  ALD CKEL+  ++ +L  SFE++  F+   + E   +L++WLS AI+ 
Sbjct  110   MMELQKDPRTKMALDQCKELMDYALGELSNSFEELGKFEFHLLDEALINLRIWLSAAISH  169

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             +ETC++ FE T G+ GE MK  LKTA EL+ NGLA+I+  +  +  + IP  +  RRLL+
Sbjct  170   EETCLEGFEGTQGNAGETMKKALKTAIELTRNGLAIISEMSNFVGQMGIPEFS-SRRLLS  228

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              E          P +VD   RRLL    A    K DIVVA+DGSGQYK++ EAL+ VP K
Sbjct  229   QE---------IPSWVDQRGRRLLQAAAAYSDAKPDIVVAQDGSGQYKTINEALKFVPKK  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              + T V++IKAG+Y E V++ + M  +VF+G+GP KT I+GS++ KDGI TY T TVAI 
Sbjct  280   KNTTFVVYIKAGIYQEYVQINKSMTHLVFLGDGPEKTIISGSKNYKDGITTYRTQTVAII  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FIA+NIGF N+AG AK QAVA+RV +D +IF NC  D YQDTLY HS+RQFYRDCTI
Sbjct  340   GDSFIAKNIGFVNTAGPAKFQAVAVRVQSDESIFFNCRFDGYQDTLYAHSHRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FG+A  VFQNC ++VRKP+ NQ C +TA GR D R A   V Q C I  EP  
Sbjct  400   SGTIDFLFGDAAAVFQNCTLLVRKPLPNQACPITAHGRSDAREATGFVFQGCTIAGEPDY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
              A    +K +LGRPW+EFSRT+IM +F+ D V P+GW  W G   LDT +Y+E QN GPG
Sbjct  460   LAVKATSKAYLGRPWREFSRTIIMNSFLPDFVQPQGWMPWMGNFGLDTLFYSEAQNTGPG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    RV W G K+  + E+ K FTP  F+     W+    +P++PG L
Sbjct  520   AGLANRVTWAGIKKLSNEEILK-FTPDQFIQGG-IWVPGKGVPYTPGLL  566



>ref|XP_009762317.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=680

 Score =   538 bits (1387),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 265/545 (49%), Positives = 363/545 (67%), Gaps = 7/545 (1%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +++T+ K+++ IC  T Y+ TC  SL + A+ + DPKELI+ +F+VT+E I +AI  S +
Sbjct  42    DVTTSQKAIESICQTTRYQHTCVESLESSAEGSSDPKELIQKSFQVTMEKIKEAIENSTM  101

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L++ +KDPR   AL+ C++L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT 
Sbjct  102   LQKLEKDPRAKLALENCQKLAWQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITY  161

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FE TTG+T EKMK  L ++ EL+SN L MIT  + +  SL     + +RRLL 
Sbjct  162   QETCLDGFEKTTGETEEKMKRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRRLLF  221

Query  2570  AETKGeeq-eeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
              E        E  P +VD   RRLL      IK DIVVAKDGSG+YK++ EAL+ +P   
Sbjct  222   DEAPVLGHGNELLPDWVDMRRRRLLAA--KEIKPDIVVAKDGSGKYKTINEALKNIPNNR  279

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
             ++T V++IK G+YNE+VE    M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ G
Sbjct  280   NQTYVLYIKQGIYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMG  339

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
             D FIA++IGFENSAG  KHQAVALRV+AD +IF+NCHID YQDTL  H+YRQFYRDC I 
Sbjct  340   DYFIAKDIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIR  399

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+   VFQNC + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +  
Sbjct  400   GTIDFVFGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYN  459

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
                   K +LGRPWKE+SRT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+
Sbjct  460   EVKGEVKTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGS  519

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLSS  1497
             S  +RVKW+G K  +     ++FT   FL  D  W+    IP++PG FL P  +   +  
Sbjct  520   SKKERVKWQGVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLSPPQQDTSVEY  577

Query  1496  HPTKD  1482
              P  D
Sbjct  578   SPVDD  582



>ref|XP_004298144.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   534 bits (1375),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/528 (49%), Positives = 369/528 (70%), Gaps = 12/528 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +T SK+++ +C PTDYKETC+ +L+  A +  DPKEL+K+ F++ +E + + I+ S+ LK
Sbjct  48    ATTSKAIETVCQPTDYKETCQNALSEKAGNVTDPKELVKIGFQIAIEKLQEVINNSDTLK  107

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             E  KD   + AL  C+EL++ SIDDL+RS +K+  F++ ++KEY  DLKVWLS ++  ++
Sbjct  108   EIAKDNLGNQALQNCRELIEYSIDDLKRSADKIGPFEVTKLKEYVEDLKVWLSASLQYEQ  167

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT-A  2568
             TC+D F+NT G+ G KMK+ LKT+ EL+ N LAM T    L ++  +     +RRLL   
Sbjct  168   TCLDGFDNTPGEAGAKMKNFLKTSQELTKNALAMATEIGNLFRTSSLKS---QRRLLADT  224

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND-  2391
                 ++  +  P +++     + T +P S+K D++VAKDGSG+YK+V EAL+ +P  N  
Sbjct  225   PMDPKKAPKIIPSWIEGRKLDIATANPISLKPDVIVAKDGSGKYKTVNEALKDIPKDNVL  284

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +T VI+IK GVY+E+V + + M  ++F+G+GPTKT+ITG+++  DG+ T+ TATVA+ GD
Sbjct  285   KTFVIYIKEGVYSEQVVLDKHMTNVMFIGDGPTKTKITGNKNYADGVQTFKTATVAVIGD  344

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              FIA++IGFEN+AGA  HQAVALRV +D++IF+NC ID YQDTLYT ++RQFYRDC ISG
Sbjct  345   YFIAKDIGFENTAGARGHQAVALRVQSDLSIFYNCQIDGYQDTLYTQTHRQFYRDCIISG  404

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DFIFG+A  VFQNCKMIVRKP  NQ CMVTAQGR D+R    IVLQ+C I  E    A
Sbjct  405   TIDFIFGDAAAVFQNCKMIVRKPGPNQSCMVTAQGRLDKREPTGIVLQNCTISGEKGFDA  464

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
             A      +LGRPWK +SRT++M + ID+++ P GW  W GT   +T W+ E+ NRG GA+
Sbjct  465   AT--TMAYLGRPWKMYSRTIVMQSQIDNVINPLGWMEWTGTTNHETSWFGEFSNRGLGAA  522

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             T++RVKW  YK   +PE A  F PG  L+ D +W+  + +P+  G ++
Sbjct  523   TNQRVKW--YKL-ATPEEAGAFAPGSILLGD-KWIMPSGVPYVAGMMR  566



>ref|XP_003591166.1| Pectinesterase [Medicago truncatula]
 gb|AES61417.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   533 bits (1374),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 279/581 (48%), Positives = 384/581 (66%), Gaps = 33/581 (6%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssg---------------gGEISTASKSV  3081
             G  ++ +++A+ GV+++ LVA VVA T+S+  +                   +++  K+V
Sbjct  4     GDAQKGRRIAIIGVSTLLLVAMVVAVTISINQNQNDVKDDFKDDLADNKKNHVASTLKAV  63

Query  3080  KEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKD  2910
             + IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++E+  E +KD
Sbjct  64    QTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETEMFSEIEKD  123

Query  2909  PRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDA  2730
             PR+ DALDTCK+L+  SI +  RS + +  FDL+ + +   +LKVWL+GA+T  +TC+D 
Sbjct  124   PRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVTYMDTCLDG  183

Query  2729  FENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee  2550
             FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F RRLL        
Sbjct  184   FENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRRLL--------  234

Query  2549  qeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET-VVIF  2373
             Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP + DET  VI+
Sbjct  235   QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEEDETPFVIY  294

Query  2372  IKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARN  2193
             IKAGVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQGD F A N
Sbjct  295   IKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQGDHFTAIN  354

Query  2192  IGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIF  2013
             +GFENSAG  KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDCTISGT+DF+F
Sbjct  355   MGFENSAGPQKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHAMRQFYRDCTISGTIDFVF  414

Query  2012  GNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNK  1833
             GNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+  G +AIV+Q   I+A+P        +K
Sbjct  415   GNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITGPSAIVIQGGSIVADPEFYPVRFDHK  474

Query  1832  VFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDK  1662
              +L RPWK FSRT+IM TFIDD++ P+G+  W    G + +DTC+YAEY N GPG++  K
Sbjct  475   SYLARPWKNFSRTIIMDTFIDDLIHPDGFFPWHTEVGPINMDTCFYAEYHNYGPGSNKSK  534

Query  1661  RVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             RVKW G   NI+ + A +F P  F    + W+    IP+ P
Sbjct  535   RVKWAGI-YNINSKAAHRFAPSKFFHGGD-WIKDTGIPYFP  573



>ref|XP_010932011.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Elaeis guineensis]
Length=590

 Score =   533 bits (1372),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 267/526 (51%), Positives = 362/526 (69%), Gaps = 8/526 (2%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             + T SK++K IC PTDYK+ CE SL   A +T DPK L++ AF VT++ I DA + S +L
Sbjct  63    LVTTSKAIKSICQPTDYKDICESSLTHAAGNTSDPKALVEAAFNVTIDYIRDAFNHSSVL  122

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             + A KDPRTSDALD CKELL  ++D+L  SF K    ++ ++ E  +DLK+WLS A+T Q
Sbjct  123   QAAAKDPRTSDALDDCKELLDYAVDELRNSFTKFGQLEISKIDEIIDDLKIWLSAAVTYQ  182

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             ETC+D FEN +GD  E MK  L  +  L+SN LA+I   + +L + +IP ++  RRLL+ 
Sbjct  183   ETCLDGFENISGDAAESMKKALNGSQALTSNSLAIIDEISSVLSTFQIPFLS--RRLLSE  240

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             E   E  + E+P +V    RRLL      +K DIVVA+DGSG Y+++ EAL A+P  ++ 
Sbjct  241   E---EADDGEYPSWVTNGKRRLLALTMDQMKPDIVVAQDGSGNYETIKEALAAIPKNSNT  297

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
             T VI+IK GVY E+V + + M  ++ +G+GPTKTRITG+ +  DG  T+ TAT A+ G+G
Sbjct  298   TFVIYIKEGVYKEQVWLDKSMTNVMMIGDGPTKTRITGNLNYIDGTTTFKTATFAVVGEG  357

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             FIA+++GFENSAG  KHQAVALRV +D +IF+NC +D YQDTLY H+ RQFYRDCTI+GT
Sbjct  358   FIAKDLGFENSAGPEKHQAVALRVQSDRSIFYNCQMDGYQDTLYCHTKRQFYRDCTITGT  417

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++  +FQNC + VRKP+ANQ+C+VTA GRKDRR A AI+L +C I A+      
Sbjct  418   IDFIFGDSASIFQNCLIKVRKPLANQQCIVTASGRKDRREATAIILHNCTISADSEYLPF  477

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
             +  N  +LGRPWK +SRT+IM + ID+ + PEGW  W G + L TC+YAE  N G GA+ 
Sbjct  478   HIQNPSYLGRPWKPYSRTIIMQSQIDEFIHPEGWLPWLGDVGLHTCFYAEVDNHGLGANV  537

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              KRV W+GYK+ I    A+QFT   F+  +  WL    +P+ PG L
Sbjct  538   TKRVTWRGYKK-IDSSHAQQFTVQRFIQGNS-WLRPTGVPYIPGLL  581



>ref|XP_007146999.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
 gb|ESW18993.1| hypothetical protein PHAVU_006G088200g [Phaseolus vulgaris]
Length=585

 Score =   531 bits (1369),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 272/587 (46%), Positives = 384/587 (65%), Gaps = 26/587 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsv-----------gssggGEISTASKSVKEI  3072
             MG   Q K++ + GV++  LVA VVA TVSV             +    ++++ K+VK +
Sbjct  1     MGGDAQKKRIVIIGVSTFLLVAMVVAVTVSVGLNNKGASEDETEARKSHVASSMKAVKTL  60

Query  3071  CAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             CAPTDY++ CE SL   A +  DP+ELIK+AF +T+  I+D + K++LL + + DPRT +
Sbjct  61    CAPTDYQKECEDSLNENAGNITDPRELIKLAFNITITRISDGLGKTQLLHDVESDPRTKE  120

Query  2894  ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALDTCK+L+  SI++  RS ++   F+L  +      LKVWLSGA+T QETC+DAF+NTT
Sbjct  121   ALDTCKQLMHLSIEEFNRSLQRFNKFELNSLDRILTSLKVWLSGAVTYQETCLDAFDNTT  180

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETK-----Gee  2550
              D G+KM+  L+TA  ++SNGLA+I+  ++ L  + +      RRLLTA         E 
Sbjct  181   TDAGKKMQGHLQTAMHMTSNGLAIISELSKTLSDMHVSKSG--RRLLTAADDLPVLGHET  238

Query  2549  qeeEFPGFVDA--ATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
              + + P +V++    RRLL          +VVAKDGSG + ++ +AL+ VP KN    +I
Sbjct  239   DDFDLPDWVESRFGVRRLLHMTGRKRMAHVVVAKDGSGNFTTINDALKHVPMKNLRPFII  298

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVY+E VEV R M  +V +G+G  K+RITGS++  DG+GTY TA+ AI GD F+A 
Sbjct  299   YIKEGVYDEYVEVSRNMTHVVMIGDGGRKSRITGSKNFIDGVGTYKTASAAIIGDFFVAI  358

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
              +GFEN+AGA KHQAVALRV +D +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+
Sbjct  359   GMGFENTAGAEKHQAVALRVQSDRSIFYKCRMDGYQDTLYAHAMRQFYRDCIISGTIDFV  418

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+A  V QNC   VRKPMANQ+C+VTAQGRK+R   + I++    I+++P+       N
Sbjct  419   FGDAVAVLQNCTFEVRKPMANQQCIVTAQGRKERNQPSGIIIHGGSIVSDPSYYPVRFDN  478

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK FSRT+IM ++IDD++ P+G+  WQ   G   +DTC+Y+E  N GPGA   
Sbjct  479   KAYLARPWKNFSRTIIMDSYIDDLITPDGYMPWQTVEGLSGMDTCFYSEINNHGPGADKS  538

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KRVKW+G K ++S ++A  F P PF   D+ W+   ++P+  G   P
Sbjct  539   KRVKWEGIK-SLSNDMATTFLPSPFFHGDD-WIRVTRVPYDSGLPSP  583



>ref|XP_003591168.1| Pectinesterase [Medicago truncatula]
 gb|AES61419.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=588

 Score =   531 bits (1367),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 266/541 (49%), Positives = 361/541 (67%), Gaps = 23/541 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERS-LAGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              +++  K+VK  C PTDYK+ CE + +A A +T D +ELIK+AF VTV  I+D I K+ L
Sbjct  48    HMASTVKAVKSFCHPTDYKKECEENVIANAGNTTDSRELIKIAFNVTVTKISDGIKKTNL  107

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E +K+PR   ALDTCK+L+  SI + +RS E ++NFDL  ++    +LKVWLSGAIT 
Sbjct  108   LHEVEKEPRAKMALDTCKQLMDLSIGEFDRSIEGIKNFDLNNLENILVNLKVWLSGAITY  167

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT D  +KMK++L T+  +SSN LA+I+   +    L++      RRL+ 
Sbjct  168   QETCLDGFENTTSDASKKMKNILTTSMHMSSNALAVISDLAD--NVLDLNATTDGRRLID  225

Query  2570  --------AETKGeeqeeEFPGFV----DAATRRLLTTDPASIKHDIVVAKDGSGQYKSV  2427
                      +   ++   + P +V        RRLL  +   +K ++VVAKDGSG++K +
Sbjct  226   DYKGEYVGEQVVAKDDVNDVPSWVGDGLSVGVRRLLHVNQHKLKANVVVAKDGSGKFKKI  285

Query  2426  VEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG  2247
              +AL+ VP KN +  VI IK GVY+E VEV +KM  +VF+G+G  KTRITG+++  DGI 
Sbjct  286   NDALKQVPKKNQKPFVIHIKEGVYHEYVEVTKKMTHVVFLGDGGNKTRITGNKNFIDGIN  345

Query  2246  TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHS  2067
             TY T TVAI+GD F+A NIGFENSAG  KHQAVA+RV AD  IF+ C +D YQDTLY H+
Sbjct  346   TYQTPTVAIEGDNFVAINIGFENSAGPQKHQAVAIRVQADKAIFYKCSMDGYQDTLYVHT  405

Query  2066  YRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQ  1887
              RQFYRDCTISGT+DFIFG+A  VFQNC  +V+KP+ NQ+C+VTAQGRK+R   + IV+Q
Sbjct  406   MRQFYRDCTISGTIDFIFGDAISVFQNCTFLVKKPLENQQCIVTAQGRKERHQPSGIVIQ  465

Query  1886  SCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQG----TMYL  1719
             +C I+A+         NK +L RPWK FSRT+ M T+I D++ P+G+  WQG       +
Sbjct  466   NCHIVADT--HNVKFDNKAYLARPWKNFSRTVFMKTYIGDLIQPDGFMPWQGPNGTVSGI  523

Query  1718  DTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             DTC+YAEY N+GPG+   KRVKW G K  ++ + A  F P  F   D+ W+   +IP+S 
Sbjct  524   DTCFYAEYNNKGPGSDKSKRVKWPGIK-TLTSQSASHFLPSMFFHGDD-WIKVTKIPYSS  581

Query  1538  G  1536
             G
Sbjct  582   G  582



>ref|XP_008370617.1| PREDICTED: pectinesterase [Malus domestica]
Length=608

 Score =   531 bits (1368),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 267/530 (50%), Positives = 356/530 (67%), Gaps = 14/530 (3%)
 Frame = -1

Query  3089  KSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEAD  2916
             K++K IC PTDYK+ C  SL  A    T DP +LI   FKV ++ + DA  KS+ L++ +
Sbjct  62    KAIKAICQPTDYKQECLDSLSYASGNTTTDPVQLIGYGFKVAMKYVYDAAKKSDFLRKLE  121

Query  2915  KDPRTSDALDTCKELLKNSIDDLERSFEKVENFD-LERVKEYTNDLKVWLSGAITQQETC  2739
             KDPRTS+ALDTC+EL++ ++ +L +S  ++   D L +  +   DLKVWLS  IT QE+C
Sbjct  122   KDPRTSNALDTCEELMELALGELRQSLVRLGFIDDLTKFNDMLMDLKVWLSATITYQESC  181

Query  2738  IDAFENTTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             +DAFENTT   D  E+MK++LKT+  LSSN LAM++        L  P  +  RRLL  +
Sbjct  182   LDAFENTTSSTDAAEEMKNVLKTSMHLSSNALAMVSQVFSAFTDLNNPDPS-HRRLLQFD  240

Query  2564  TKGeeqeeEF--PGFVDAATRRLLTTD----PASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
                     EF  P +     R+LLTT     P   K DI+VAKDGSG YK++ EAL+ VP
Sbjct  241   AFPVIGHSEFEDPKWYGGEGRKLLTTSTTSAPKINKPDIIVAKDGSGSYKTITEALKHVP  300

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
                +ET +I+IK G+YNE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVA
Sbjct  301   KYGNETFIIYIKEGIYNEHILVTRSMTNVMMIGDGANKTRITGNKNFVDGTTTYHTATVA  360

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             IQGD F+  +IGFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH+ RQFYRDC
Sbjct  361   IQGDHFMVMDIGFENSAGPEKHQAVALRVSADKAIFYRCSMDGYQDTLYTHAQRQFYRDC  420

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             TISGT+DF+FG+A  +FQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I A+P
Sbjct  421   TISGTIDFVFGDATAIFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITADP  480

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
                     NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N G
Sbjct  481   DYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAELGNTG  540

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             P A+  +RV W+G K+ I+   A  FTPG F   D +W+  + +P+ PG 
Sbjct  541   PAANKARRVTWRGIKK-ITENHAADFTPGRFFRGD-KWIRLSGVPYIPGL  588



>ref|XP_008388938.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Malus domestica]
Length=603

 Score =   531 bits (1367),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 268/530 (51%), Positives = 354/530 (67%), Gaps = 11/530 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             S + K++K IC PTDYK+ C  SL  A    T DP ELI+  FKV ++ +TDA  KS+ L
Sbjct  58    SASMKAIKTICQPTDYKQECLDSLSYASGNTTTDPIELIEYGFKVAMKYVTDAAKKSDFL  117

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFD-LERVKEYTNDLKVWLSGAITQ  2751
             ++ +KDPRTS+ALD C+EL+  ++ +L +S  ++   D   +  E   DLKVWLS  IT 
Sbjct  118   RKLEKDPRTSNALDACEELMDLALSELRQSLVRLGYIDDFTKFNEMLVDLKVWLSATITY  177

Query  2750  QETCIDAFENTTG--DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             QE+C+DAFENTT   D  E+MK +L T+  LSSN LAM++        L  P  +  RRL
Sbjct  178   QESCLDAFENTTSSTDAAEEMKSVLNTSMHLSSNALAMVSQVFSAFTDLNNPDSS-HRRL  236

Query  2576  LTAETKGeeqeeEF--PGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
             L  +        EF  P + +   R+L ++ P   K DI+VAKDGSG YK++ EAL  VP
Sbjct  237   LQFDAFPVIGHSEFEDPKWYEGGVRKL-SSAPKINKPDIIVAKDGSGSYKTITEALDHVP  295

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
                +ET +I+IK GVYNE + V R M  ++ +G+G  KTRITG+++  DG  TYHTATVA
Sbjct  296   KYGNETFIIYIKEGVYNEHILVTRSMTSVMMIGDGANKTRITGNKNFADGTPTYHTATVA  355

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             IQGD F+AR+IGFENSAG  KHQAVALRVSAD  IF+ C +D YQDTLYTH+ RQFY DC
Sbjct  356   IQGDHFMARDIGFENSAGPEKHQAVALRVSADEAIFYRCSMDGYQDTLYTHAQRQFYCDC  415

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             TISGT+DF+FG+A  VFQNC  ++RKP+ NQ C+VTAQGRK+RR  +AI++Q+  I AEP
Sbjct  416   TISGTIDFVFGDATAVFQNCTFLIRKPLPNQSCIVTAQGRKERRQPSAIIIQNSTITAEP  475

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
                     NK +LGRPWKE+SRT+IM ++IDD++ PEGW  W+G   L TC+YAE  N G
Sbjct  476   DYFPVKDENKAYLGRPWKEYSRTIIMDSYIDDVIQPEGWLPWEGEWGLKTCFYAESGNTG  535

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             P A+  +RV W+G K+ I+      FTPG F   D +W+  + +P+ PG 
Sbjct  536   PAANKARRVTWRGIKQ-ITENHTADFTPGRFFRGD-KWIRLSGVPYIPGL  583



>ref|XP_003591164.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591167.1| Pectinesterase [Medicago truncatula]
 gb|AES61415.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|AES61418.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=583

 Score =   530 bits (1364),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 261/532 (49%), Positives = 362/532 (68%), Gaps = 22/532 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKS  2937
              +++  K+++ IC PTDYK+ CE SL   A A +  DPKELIK+AF VT++ I + + ++
Sbjct  50    HVASTMKAIRTICQPTDYKKECEESLRAEAEADNVTDPKELIKIAFNVTIKKIGEKLKET  109

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++L E +KDPR+ DALDTCK+L+  SID+  RS + +   +++ ++    +LKVWL+GA+
Sbjct  110   DMLCELEKDPRSKDALDTCKQLMDLSIDEFTRSLDGIGKLNIQNIENILMNLKVWLNGAV  169

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             T  +TC+D FENTT + G+KMK LL ++  +SSN LA+IT F + +  + +  +  +R L
Sbjct  170   TYMDTCLDGFENTTSEAGKKMKELLTSSMHMSSNALAIITDFADTISDMNVTKIVGRRLL  229

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVP  2403
                +T         P +V+   R+LL     + KH  ++ VA DGSG +KS+ EAL+ VP
Sbjct  230   QDYKT---------PSWVEH--RKLLDAKTNAFKHTPNVTVALDGSGDFKSINEALKKVP  278

Query  2402  FKNDET-VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATV  2226
              +  +T  VI+IKAGVY E VEV   M  IVFVG+G  K+ ITG+++  DG+ TYHTATV
Sbjct  279   HEESKTPFVIYIKAGVYREYVEVLTNMTHIVFVGDGGKKSIITGNKNFMDGVTTYHTATV  338

Query  2225  AIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRD  2046
             AIQGD F A N+GFENSAG  KHQAVALRV  D  IF+NC +D YQDTLY H+ RQFYRD
Sbjct  339   AIQGDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFYNCSMDGYQDTLYVHAMRQFYRD  398

Query  2045  CTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             CTISGT+DF+FGNA  VFQNCK +VRKPM++Q+C+VTAQGRK+R   +AIV++   I+A+
Sbjct  399   CTISGTIDFVFGNAESVFQNCKFVVRKPMSDQQCIVTAQGRKERTAPSAIVIEGGSIVAD  458

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEY  1695
             P        +K +L RPWK FSRT+IM TFIDD++ P+G+  W   +G + +DTC+YAEY
Sbjct  459   PEFYPVRFDHKSYLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYAEY  518

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              N GPG+   KRVKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  519   HNYGPGSDKSKRVKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  568



>ref|XP_010547007.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
isoform X1 [Tarenaya hassleriana]
Length=583

 Score =   529 bits (1362),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 260/543 (48%), Positives = 357/543 (66%), Gaps = 31/543 (6%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +C PTDYKETC  SL A + ++  P +LI++ F +T+ +I   I K+  
Sbjct  46    QIKTTTKAVQAVCEPTDYKETCVHSLMAASPNSTQPLDLIRLGFNLTINSIHQGIKKAAH  105

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL   A+KDP T  ALD C+EL+ ++IDDL++ F+K + F+L   +E+  DL+VWLSG+I
Sbjct  106   ELKARAEKDPETKGALDLCQELMIDAIDDLKKCFDKFDGFNLNEAEEFVEDLRVWLSGSI  165

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    D  ++M  + KT+ EL+SNGLAM++  + LL    I GV     +
Sbjct  166   AFQQTCMDTFEEIKSDLAQEMAKIFKTSKELTSNGLAMVSGLSMLLPQFNITGVRGDLGS  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       + FP ++    R+L+      +K + VVA DGSGQ+KS+  AL+
Sbjct  226   YARKLLSTE-------DGFPTWMRPEARKLMAAKGTKVKPNAVVALDGSGQFKSINAALK  278

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP KN    VI+IK G+Y E+V+V + M+ + F+G+GPTKTRITG+ +   G + TY T
Sbjct  279   TVPMKNKFPFVIYIKQGIYKEKVDVTKTMSYVTFIGDGPTKTRITGNLNFGMGKVKTYQT  338

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAY------------  2091
             ATVA+ G+ F A++IGFEN+AG   HQAVALRVSAD  +FHNC ID Y            
Sbjct  339   ATVAVNGEHFTAKDIGFENTAGPKGHQAVALRVSADYAVFHNCQIDGYVDSFYANCQIDG  398

Query  2090  -QDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDR  1914
              QDTLY HS+RQFYRDCTISGT+D+IFG+A   FQNC M+VRKPM  Q CMVTAQGR D+
Sbjct  399   YQDTLYAHSHRQFYRDCTISGTIDYIFGDAKSFFQNCNMVVRKPMGGQSCMVTAQGRTDK  458

Query  1913  RGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ  1734
             R    IVL +C I  +PA       NK +LGRPWK+FSRT+IM T I+DI+ P+GW  W 
Sbjct  459   RETTGIVLHNCRITGDPAYIPVKKTNKAYLGRPWKQFSRTIIMRTTIEDIIDPKGWLEWN  518

Query  1733  GTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQ  1554
             G   LDT  YAE++N+GPG++   RVKW G K+  +P  A +FT G FL     W+ + Q
Sbjct  519   GNFALDTLEYAEFENKGPGSNQATRVKWPGIKK-FTPRQAGEFTAGKFLQGGT-WIPQTQ  576

Query  1553  IPF  1545
             +P+
Sbjct  577   VPY  579



>ref|XP_003604119.1| Pectinesterase [Medicago truncatula]
 gb|AES86316.1| pectinesterase/pectinesterase inhibitor, putative [Medicago truncatula]
Length=636

 Score =   530 bits (1365),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 264/529 (50%), Positives = 359/529 (68%), Gaps = 18/529 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKSE  2934
             +++  K+V+ IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++E
Sbjct  56    VASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKETE  115

Query  2933  LLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAIT  2754
             + +E +KDPR+ DALDTCK+L+  SI +  RS + +  FDL+ + +   +LKVWL+GA+T
Sbjct  116   MFREIEKDPRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAVT  175

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
               +TC+D FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F RRLL
Sbjct  176   YMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRRLL  234

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
                     Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP + 
Sbjct  235   --------QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGEE  286

Query  2393  DET-VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             DET  VI+IKAGVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAIQ
Sbjct  287   DETPFVIYIKAGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAIQ  346

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F A N+GFENSAG  KHQAVALRV  D  IF NC +D YQDTLY H+ RQFYRDCTI
Sbjct  347   GDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCTI  406

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FGNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P  
Sbjct  407   SGTIDFVFGNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPEF  466

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNR  1686
                   +K +L RPWK FSRT+IM TFIDD++ P+G+  W   +G + +DTC+Y EY N 
Sbjct  467   YPVRFDHKSYLARPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHNY  526

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             GPG+   KRVKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  527   GPGSDKSKRVKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  573



>ref|XP_010667121.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=589

 Score =   528 bits (1360),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 248/535 (46%), Positives = 365/535 (68%), Gaps = 12/535 (2%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ++T+SK+V+ IC   +Y+  CER+LA A  T+ PK+L++  F   +E +  A++ S  +K
Sbjct  57    LATSSKAVRSICQMVEYQRACERTLAHAHTTN-PKKLVQTTFNAAMEKLEGALTNSSTIK  115

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
              A  D R + AL+TCK++++ +I DL+RS +++++FD+ + +E+  ++++WLSGA+T QE
Sbjct  116   AAKDDRRNAGALETCKQVVEYAITDLKRSIDQMDHFDMHKKEEHVENMRIWLSGAMTSQE  175

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFK-RRLLTA  2568
             TCI+AF+NTTGD GEKMK  L  + EL+SNGL + T  +   +SL I   N K +R+L  
Sbjct  176   TCIEAFQNTTGDAGEKMKLFLNASRELTSNGLDVATELSTGFKSLNISHQNHKHKRMLLE  235

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN--  2394
             E    + +EE P +VD   ++LL     ++K D+VVAKDGSG +K++ EAL+  P  +  
Sbjct  236   EQGEAKNKEEIPHWVDTKQQKLLHVRGPNVKADVVVAKDGSGNFKTITEALKQAPIIDAT  295

Query  2393  ------DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
                   ++T VI+IK GVY E V+V   M  ++ +G+GPTKT+ITG ++  DG   + TA
Sbjct  296   KVEKGTNKTFVIYIKEGVYEEEVQVEANMWFVMLIGDGPTKTKITGKKNFADGFVLFKTA  355

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV+I G  FIA++IGFENSAGA KHQA+AL V +D ++F+NCHI+ YQDTLY HSYRQFY
Sbjct  356   TVSIFGHNFIAKDIGFENSAGAEKHQAIALLVQSDKSVFYNCHINGYQDTLYAHSYRQFY  415

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             R CT+SGT+DFIFGNA  VFQNCK+++RKP+ ++ C++TAQ R+  R     +LQ+C I+
Sbjct  416   RHCTVSGTIDFIFGNAAAVFQNCKLVIRKPLEDEGCVITAQARQHVREPTGFILQNCTIM  475

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
             A+P        +K FLG PWK+FSRT+IM +F+ D + PEGW  W GT    +C+++EY+
Sbjct  476   ADPLYYPLRLKSKAFLGHPWKKFSRTIIMQSFLPDSIAPEGWKPWMGTFGQSSCFFSEYE  535

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             NRGPGA+   RVKW G K+ I+P+ A  FTP  F   +  W+    +P+ PG + 
Sbjct  536   NRGPGAALLGRVKWHGIKK-ITPQQADGFTPSKFYQGN-HWIIPTGVPYEPGMMH  588



>ref|XP_003535332.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=589

 Score =   528 bits (1359),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 273/592 (46%), Positives = 385/592 (65%), Gaps = 32/592 (5%)
 Frame = -1

Query  3218  MGSPEQNKK-VAVTGVASIFLvacvvaa------------tvsvgssggGEISTASKSVK  3078
             MG   Q+K+ +A+ GV++IFLVA VVA             +         +I+++ K+VK
Sbjct  1     MGEDGQSKRRIAIIGVSTIFLVAMVVAVAVGVNYFNLNGGSNDDAHDDKSQIASSVKAVK  60

Query  3077  EICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRT  2901
              +C PTDY++ CE+SL A A +T DP+ELIK+AFK+T++ + + + K++ + E + DPR+
Sbjct  61    TLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDFMHEVENDPRS  120

Query  2900  SDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFEN  2721
               AL+TCK+L+  SID+ +RS E++  FDL  +    N L+VWLSGAIT QETC+D F+N
Sbjct  121   KMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQETCLDGFKN  180

Query  2720  TTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee---  2550
             TT   G KMK+LLK+   +SSN LA+I+   + +  + +   +   R L  ++  E    
Sbjct  181   TTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLVEDSGDEHVFG  240

Query  2549  qeeEFPGFVD-------AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             Q +  P +V+          RRLL      IK ++VVAKDGSG+YKS+ +AL+ VP KN 
Sbjct  241   QHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQALKKVPEKNQ  300

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY TA+VA++GD
Sbjct  301   KPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTYRTASVAVEGD  360

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A NIGFENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFYRDCTISG
Sbjct  361   YFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMRQFYRDCTISG  420

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDF+FG+A  VFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++      
Sbjct  421   TVDFVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSN---HT  477

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGP  1680
              N  NK +L RPWK  SRT+ M T+I+ ++ PEG+  WQG   L   D C+YAEY N GP
Sbjct  478   ENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNCFYAEYNNTGP  537

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             G++  KRVKW+G    ++ E   +++P  F   D+ W+   +IP+      P
Sbjct  538   GSNKSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVTAP  587



>ref|XP_003529778.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   527 bits (1358),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 278/577 (48%), Positives = 383/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgss-----------ggGEISTASKSVKEIC  3069
             G+  + KK+A+ GV+++ LVA VVA T+ V  +               ++++ K+V+ +C
Sbjct  4     GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKDHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  + + +K   ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP+ PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPYFPG  567



>gb|KHN01292.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=582

 Score =   527 bits (1357),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 280/577 (49%), Positives = 382/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgss-----------ggGEISTASKSVKEIC  3069
             G+  + KK+A+ GV+++ LVA VVA T+ V  +               ++++ K+V+ +C
Sbjct  4     GNAGKGKKIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_004495690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=595

 Score =   527 bits (1358),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 264/545 (48%), Positives = 363/545 (67%), Gaps = 28/545 (5%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             I++  KSVK  C PTDYK+ CE +L   A +T +P+ELIK+AF VT++ I D I K+ LL
Sbjct  51    IASTIKSVKSFCQPTDYKKECEENLIEIAGNTTEPRELIKLAFNVTIKKIGDGIKKTNLL  110

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
              E +K+PR   ALDTCK+L+  SI + ERS E ++ FDL  ++     LKVWLSGAIT Q
Sbjct  111   HEVEKEPRAKLALDTCKQLMDLSIGEFERSLEGIKTFDLNNLENILVSLKVWLSGAITYQ  170

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL--  2574
             ETC+D F+NTT D  +KM+++L T+  +SSN LA+I+   + +  L +   N +RRL+  
Sbjct  171   ETCLDGFQNTTSDASKKMQNILTTSMHMSSNALAIISDLAKSVLDLNL--TNNERRLIDN  228

Query  2573  -----------TAETKGeeqeeEFPGFV----DAATRRLLTTDPASIKHDIVVAKDGSGQ  2439
                          E      + E P +         RRLL  +   +K +++VAKDGSG+
Sbjct  229   NNNNNNNNNNDVGEQVFGHDDVEVPSWAGDGSSVGVRRLLHANHYKLKANVIVAKDGSGK  288

Query  2438  YKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK  2259
             +K + +AL+ VP KN +  VI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  
Sbjct  289   FKKINDALKHVPKKNKKIFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGNKTRITGNKNFI  348

Query  2258  DGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTL  2079
             DG+ TY T TVAI GD F+A NIGFENSAG  KHQAVA+RV AD +IF+ C ID YQDTL
Sbjct  349   DGVNTYKTPTVAIAGDYFVAINIGFENSAGPQKHQAVAIRVQADKSIFYKCSIDGYQDTL  408

Query  2078  YTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAA  1899
             Y H+ RQFYRDCTISGT+DF+FG+A  +FQNC  +VRKP+ NQ+C+VTAQGRKD+   + 
Sbjct  409   YAHTMRQFYRDCTISGTIDFVFGDAVAIFQNCTFVVRKPLENQQCIVTAQGRKDKHQPSG  468

Query  1898  IVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GT  1728
             IV+Q C I+++         NK +L RPWK +SRT+ M T+I D++ P+G+  WQ   GT
Sbjct  469   IVIQGCSIVSDT--HNVKFDNKAYLARPWKNYSRTIFMKTYIGDLIEPDGYMPWQLPNGT  526

Query  1727  MY-LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQI  1551
             +  +DTC+Y EY+N+GPG++  KRVKW+G K N++   A  F P  F   D+ W+   ++
Sbjct  527   LTGMDTCFYVEYKNKGPGSNKSKRVKWRGIK-NLTSHTASVFLPYKFFHGDD-WIKVTRV  584

Query  1550  PFSPG  1536
             P+S G
Sbjct  585   PYSSG  589



>ref|XP_011092100.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Sesamum indicum]
Length=793

 Score =   534 bits (1376),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 265/563 (47%), Positives = 367/563 (65%), Gaps = 7/563 (1%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssggGEI---STASKSVKEICAPTDYKETCER  3036
             E  KK+ +  V S  LVA VVA           E+   S++ K++  +C  TDY+E C  
Sbjct  3     ESKKKITIVAVCSCLLVAMVVALIAVGLQDEDKEVQDVSSSKKAITSLCETTDYQEACVE  62

Query  3035  SL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNS  2859
             SL A   ++ +PK+LI   F+  ++ I +A   S +L E   DPR   AL+ C+EL   +
Sbjct  63    SLNASGTNSTNPKDLIDAIFQSAIDYIKEASKNSTVLLELQTDPRAKAALENCQELADRA  122

Query  2858  IDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             + DLERSF+   NFD+  + +   +LK+WLSGAIT QETC+D FE   G+ GEKM+  L 
Sbjct  123   VHDLERSFQSFNNFDITNMDDLLLELKIWLSGAITHQETCLDGFEGVPGEAGEKMRVSLT  182

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
              A +++SN LAM+   +  ++SL I   +  RRLL+        ++E P ++D   RRLL
Sbjct  183   KAMQMTSNALAMMAELSTYIKSLGIES-STSRRLLSENEAVVGHDDELPNWMDLNKRRLL  241

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
             +  P  I+  +VVAKDGSG+++++ EAL+ +P K DE  V++IK GVY ERV+V   +  
Sbjct  242   SASPQQIRPHLVVAKDGSGKFRTINEALKHIPKKRDEIFVLYIKEGVYEERVQVNSSLTH  301

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             ++F+G+GPTKTRITG  +  DG  TY TATVA+QGD F+A NIGFENSAG  KHQAVALR
Sbjct  302   LLFIGDGPTKTRITGKLNFIDGTNTYRTATVAVQGDNFMAVNIGFENSAGPQKHQAVALR  361

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             VSAD  IF+NCH+D YQDTLYTH+YRQFYRDC ISGT+DFIFG++  VFQ C ++VRKP+
Sbjct  362   VSADKAIFYNCHMDGYQDTLYTHTYRQFYRDCVISGTIDFIFGDSAAVFQGCTLLVRKPL  421

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              NQ+C+VTAQGRKD R    +V+Q+C I A+ A        K +LGRPWK++SRT+IM +
Sbjct  422   DNQQCIVTAQGRKDVRQPTGLVIQNCSIKADEAYYPLRKQIKSYLGRPWKQYSRTIIMES  481

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
             F+DD++ P+GW  W  T  L T +Y E+ NRGP A   +RVKW G  R +     ++FT 
Sbjct  482   FLDDLIQPQGWLPWNETFALQTLFYTEFNNRGPAAPKSERVKWAGI-RELPSNRIRRFTL  540

Query  1598  GPFLMADEQWLGRAQIPFSPGFL  1530
               FL    +W+ + ++P + GF+
Sbjct  541   EEFLDG-HRWIPQTKVPHASGFI  562



>ref|XP_010442377.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   525 bits (1353),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 257/530 (48%), Positives = 352/530 (66%), Gaps = 20/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I   +K+++ +CAPTDYKETC  SL  A  D+  P ELIK+ F +T+++I D++ K+  
Sbjct  47    QIKATTKAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASG  106

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL  +A  D  T  ALD C++L+ ++ DDLE+       F +  ++++  DL+VWLSG+I
Sbjct  107   ELKAKAANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSI  166

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D FE    +  + M  + +T+ EL+SN LAMIT  +  L    I G+     N
Sbjct  167   AYQQTCMDTFEEINSNLSQDMHKIFETSKELTSNALAMITSISSFLGE-HITGLIGDHGN  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               R+LL+ E       +  P +V   TRRL+  +   +K ++VVA+DGSG+YK++ EAL 
Sbjct  226   HARKLLSTE-------DGIPSWVGPNTRRLMA-EQGVVKPNVVVAQDGSGEYKTINEALS  277

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
              VP  N +  VI+IK GVYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHT
Sbjct  278   VVPKANQKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHT  337

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             ATVAI GD   A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQF
Sbjct  338   ATVAINGDNLTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQF  397

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCTISGTVDFIFG+  VV Q C ++VRKPM +Q CM+TAQGR D R +  +VL +C I
Sbjct  398   YRDCTISGTVDFIFGDGKVVLQKCNIVVRKPMKSQSCMITAQGRTDERESTGLVLDNCHI  457

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               EP        NK +LGRPWK+FSRT+IM T I+D+V P GW  W G+  L+T +YAEY
Sbjct  458   TGEPEYIPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEY  517

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +N G G+   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  518   ENNGLGSDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>gb|KHN16095.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=566

 Score =   525 bits (1352),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 258/542 (48%), Positives = 363/542 (67%), Gaps = 19/542 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+++ K+VK +C PTDY++ CE+SL A A +T DP+ELIK+AFK+T++ + + + K++ 
Sbjct  28    QIASSVKAVKTLCKPTDYQKECEKSLRAEAGNTTDPRELIKIAFKITIKKMGNGLKKTDF  87

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E + DPR+  AL+TCK+L+  SID+ +RS E++  FDL  +    N L+VWLSGAIT 
Sbjct  88    MHEVENDPRSKMALETCKQLMNLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITY  147

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D F+NTT   G KMK+LLK+   +SSN LA+I+   + +  + +   +   R L 
Sbjct  148   QETCLDGFKNTTNKAGNKMKNLLKSTMHMSSNALAIISELADTVVKVNVTTKDIGHRQLV  207

Query  2570  AETKGee---qeeEFPGFVD-------AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVE  2421
              ++  E    Q +  P +V+          RRLL      IK ++VVAKDGSG+YKS+ +
Sbjct  208   EDSGDEHVFGQHKVIPSWVEDEEDGVGVGVRRLLHESAYKIKPNVVVAKDGSGKYKSINQ  267

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             AL+ VP KN +  VI+IK GVY+E VEV +KM  +VFVG+G  KTRITG+++  DG+ TY
Sbjct  268   ALKKVPEKNQKPFVIYIKEGVYHEYVEVAKKMTHVVFVGDGSKKTRITGNKNFVDGLNTY  327

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
              TA+VA++GD F+A NIGFENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ R
Sbjct  328   RTASVAVEGDYFVAVNIGFENSAGPEKHQAVAIRVQADKSIFYKCSMDGYQDTLYAHAMR  387

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYRDCTISGTVDF+FG+A  VFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q  
Sbjct  388   QFYRDCTISGTVDFVFGDAVAVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGS  447

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTC  1710
              I++       N  NK +L RPWK  SRT+ M T+I+ ++ PEG+  WQG   L   D C
Sbjct  448   SIVSN---HTENLDNKAYLARPWKNHSRTIFMNTYIEALIQPEGYMPWQGQNGLSGMDNC  504

Query  1709  WYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +YAEY N GPG++  KRVKW+G    ++ E   +++P  F   D+ W+   +IP+     
Sbjct  505   FYAEYNNTGPGSNKSKRVKWRGI-ITLTSESVSRYSPYKFFHGDD-WIKVTRIPYYSAVT  562

Query  1529  QP  1524
              P
Sbjct  563   AP  564



>ref|XP_003529788.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   525 bits (1353),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 279/577 (48%), Positives = 382/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgss-----------ggGEISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +               ++++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDYELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQ   G   +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGPEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>gb|KHN26239.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=576

 Score =   525 bits (1352),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 269/568 (47%), Positives = 381/568 (67%), Gaps = 25/568 (4%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaa------tvsvgssggGEISTASKSVKEICAPTDY  3054
             G+ E+ K++A+ GV+++ LVA VVA       + +  ++   +I+++ K+V+ +C PT+Y
Sbjct  4     GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  3053  KETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+ CE SL A A +T DPKELIK+ F +T+  I D + K+ LL E ++DPR   ALDTCK
Sbjct  64    KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SI++L RS + +  FDL+ + +   +LKVWLSGA+T Q+TC+D FENTT D G+K
Sbjct  124   QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LL     +SSN LA++T+  + +    +      RR L  ++K        P +VD 
Sbjct  184   MKDLLTAGMHMSSNALAIVTNLADTVDDWNV--TELSRRRLLQDSK-------LPVWVDQ  234

Query  2516  ATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RLL  + + ++H  ++ VA DGSG +KS+ EAL+ VP +N +  VI+IK GVY E V
Sbjct  235   --HRLLNENESLLRHKPNVTVAIDGSGDFKSINEALKQVPKENRKPFVIYIKEGVYQEYV  292

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENSAG  
Sbjct  293   EVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQ  352

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  +FQNC
Sbjct  353   KHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAIFQNC  412

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L RPWK +
Sbjct  413   TFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNY  472

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW G   N
Sbjct  473   SRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKWAGI-WN  531

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
             ++ + A+ F+   F    + W+    IP
Sbjct  532   LNSKAARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_010482197.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Camelina sativa]
Length=570

 Score =   525 bits (1351),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 258/524 (49%), Positives = 349/524 (67%), Gaps = 20/524 (4%)
 Frame = -1

Query  3089  KSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEA  2919
             K+++ +CAPTDYKETC  SL  A  D+  P ELIK+ F +T+++I D++ K+  EL  +A
Sbjct  53    KAIRAVCAPTDYKETCVNSLMKASPDSTQPLELIKLGFNITIQSIKDSVKKASGELKAKA  112

Query  2918  DKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETC  2739
               D  T  ALD C++L+ ++ DDLE+       F +  ++++  DL+VWLSG+I  Q+TC
Sbjct  113   ANDNETKGALDLCEKLMTDATDDLEKCLHNFHGFSITHIEDFVEDLRVWLSGSIAYQQTC  172

Query  2738  IDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFKRRLL  2574
             +D FE    +  + M  + +T+ EL+SN LAMIT  +  L    I G+     N  R+LL
Sbjct  173   MDTFEEINSNLSQDMHKIFETSKELTSNALAMITSISTFLGE-HITGLIGDHGNHGRKLL  231

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + E       +  P +V   TRRL+  +   +K D+VVA+DGSGQYK++ EAL  VP  N
Sbjct  232   STE-------DGIPSWVGPNTRRLMA-EQGVVKPDVVVAQDGSGQYKTINEALSIVPKAN  283

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQ  2217
              +  VI+IK GVYNE+V+V +KM  + F+G+GPTKT+ITGS +   G + TYHTATVAI 
Sbjct  284   QKPFVIYIKQGVYNEKVDVTKKMTHVTFIGDGPTKTKITGSLNYYIGKVKTYHTATVAIN  343

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F A+NIGFEN+AG   HQAVALRVSAD  +FHNC ID YQDTLY HS+RQFYRDCTI
Sbjct  344   GDNFTAKNIGFENTAGPEGHQAVALRVSADYAVFHNCQIDGYQDTLYLHSHRQFYRDCTI  403

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGTVDFIFG+  VV Q C ++VRKPM  Q CM+TAQGR + R +  +VL +C I  EP  
Sbjct  404   SGTVDFIFGDGKVVLQKCNIVVRKPMKGQSCMITAQGRTNERESTGLVLDNCHITGEPEY  463

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
                   NK +LGRPWK+FSRT+IM T I+D+V P GW  W G+  L+T +YAEY+N G G
Sbjct  464   IPVKSINKAYLGRPWKQFSRTIIMRTTIEDVVDPAGWLPWNGSFALNTLYYAEYENNGLG  523

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             +   +RVKW G K+ +SP+ A +FTP  FL  +  W+   ++P+
Sbjct  524   SDQSQRVKWPGIKK-LSPKQALRFTPARFLRGN-LWIPPTRVPY  565



>ref|XP_010315470.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=598

 Score =   526 bits (1354),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 258/546 (47%), Positives = 369/546 (68%), Gaps = 8/546 (1%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKD-TDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++++  K+++ IC  T Y+ TC  SL    + + DPKELI+ +F+VT++ I +AI  S  
Sbjct  42    DVTSTKKAIESICQTTQYQTTCVESLESTGECSSDPKELIQKSFQVTIKKIKEAIDNSTF  101

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             +++ +KDPR   AL+ C++L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT 
Sbjct  102   MQKLEKDPRAKMALENCEKLALQAVNDLNRTHLKFESFEFNDLSHWIADLKIWLSGAITY  161

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QE+C+D FE+TTG+ GEKMK  L  + +L+SN L+MIT  +++  SL   G N +RRLL 
Sbjct  162   QESCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLN-AGSN-RRRLLF  219

Query  2570  AETKGeeq-eeEFPGFVDAATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +T       E  P ++D   RRLL  + ++ IK D+VVAKDGSG+YK + +AL+ +P  
Sbjct  220   DDTPVLGHGIELLPDWIDVGRRRLLAVNVSNEIKPDVVVAKDGSGKYKFINDALKHIPEH  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T V++IK GVY+E+VE+   M+ +V +G+GPTKTRITG++S K G+ TY T+TVAI 
Sbjct  280   RNQTYVLYIKEGVYDEKVEILSTMSNLVIIGDGPTKTRITGNQSFKGGVPTYQTSTVAIM  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F+A++IGFEN+AG  KHQA+ALRV+AD +IF+NCH+D YQDTL  H+YRQFYRDCTI
Sbjct  340   GDYFVAKDIGFENTAGPDKHQALALRVAADKSIFYNCHMDGYQDTLCAHTYRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
              GT+DF+FG+A  VFQNC + VRKPM  Q C+VTAQGR D R  + IVLQ+C I+A+ + 
Sbjct  400   RGTIDFVFGDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDLRQPSGIVLQNCSIVADESY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
                    K +LGRPWK++SRT+IM + IDD++ PEGW  W  T   DT +Y E+ N+G G
Sbjct  460   NEVKGEAKTYLGRPWKQYSRTIIMESKIDDLIQPEGWLEWNKTFAFDTLFYTEFNNKGLG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF-LQP*NKQAKLS  1500
             +S   RV W G K  +  E  ++FT   FL AD  W+    +P++ GF L P    + + 
Sbjct  520   SSKADRVTWSGVKE-LPIERVQRFTASNFLDAD-LWIPSTGVPYTSGFLLSPPQSDSSIV  577

Query  1499  SHPTKD  1482
               P  D
Sbjct  578   YSPVND  583



>ref|XP_003555613.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=585

 Score =   525 bits (1351),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 270/583 (46%), Positives = 383/583 (66%), Gaps = 29/583 (5%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaa-----------tvsvgssggGEISTASKSVKEICAPT  3060
             ++ +++ + GV++IFLVA VVA            +          ++++ K+VK +C PT
Sbjct  7     QKKRRIVIIGVSAIFLVAVVVAVAVGVNLNIKGGSNDDAQDNKSHVASSVKAVKTLCKPT  66

Query  3059  DYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
             DY + CE+SL A A +T DP+ELIK+AF +T++ I + + K++++ + + DP +  ALDT
Sbjct  67    DYPKECEKSLSAEAGNTTDPRELIKIAFNITIKKIGNGLKKTDIMHKVENDPISKMALDT  126

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CK+L+  SID+ +RS E++  FDL  +    N L+VWLSGAIT Q+TC+D F+NTT + G
Sbjct  127   CKQLMDLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITYQDTCLDGFKNTTNEAG  186

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqe----eEF  2535
              KMK+LL ++  +SSN LA+I+   +++  + +       R L  +++G E      E  
Sbjct  187   NKMKNLLTSSMHMSSNALAIISEVADIVAKMNVN--KDGHRELVEDSRGGEHVFGHEEVI  244

Query  2534  PGFVD---AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
             P +V+      RRLL   P  +K ++VVAKDGSG+YKS+ +AL+ VP +N +  VI+IK 
Sbjct  245   PSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALKKVPARNQKPFVIYIKE  304

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA+VAI GD FIA NIGF
Sbjct  305   GVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTASVAILGDYFIAINIGF  364

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFYRDCTISGT+DF+FG+A
Sbjct  365   ENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFYRDCTISGTIDFVFGDA  424

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
              VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I++    K     NKV+L
Sbjct  425   VVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIVSNHTEKF---DNKVYL  481

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYAEYQNRGPGASTDKRVK  1653
              RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YAEY N GPG++  KRVK
Sbjct  482   ARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYAEYNNTGPGSNKSKRVK  541

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             W+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  542   WRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  582



>gb|KHN04170.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=558

 Score =   524 bits (1349),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 265/530 (50%), Positives = 359/530 (68%), Gaps = 19/530 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              ++++ K+V+ +C PT+Y++ CE SL AGA +T DPKEL+K+ F +T+  I D + ++ +
Sbjct  27    HVASSIKAVQTLCHPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNI  86

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E +++PR   ALDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T 
Sbjct  87    LHEIEEEPRAKMALDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTY  146

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D FENTT D G+KMK LL     +SSN LA++T   + +    I   +F RRLL 
Sbjct  147   QDTCLDGFENTTSDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL-  204

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                    Q+ E P +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP K
Sbjct  205   -------QDSELPSWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEK  255

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             N +  VI+IK GVY E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQ
Sbjct  256   NRKPFVIYIKEGVYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQ  315

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F+A N+GFENSAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTI
Sbjct  316   GDHFVAINMGFENSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTI  375

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FGNA  VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P  
Sbjct  376   SGTIDFVFGNALAVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEF  435

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNR  1686
              +    NK +L RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N 
Sbjct  436   YSVRFENKAYLARPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNI  495

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             GPG+   KRVKW G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  496   GPGSDKSKRVKWAGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  543



>ref|XP_003530310.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   525 bits (1351),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 275/577 (48%), Positives = 380/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvva-----------atvsvgssggGEISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA           +      +    + ++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSALLLVAMVVAITVGVNLNENGSNNDTEDNKKNHVVSSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+YK+ CE SL AGA +T DPKELIK+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYKKECEESLIAGAGNTTDPKELIKIFFNITITKIGDKLKETNILHEVEEEPRAKMA  123

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             L+TCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LETCKQLMDLSIGELTRSLDGIGEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  + + +K   ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPLKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPLENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_006344696.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Solanum tuberosum]
Length=687

 Score =   528 bits (1360),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 258/546 (47%), Positives = 370/546 (68%), Gaps = 8/546 (1%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++++  K+++ IC  T Y+ TC  SL A  + + DPK+LI+++F+VT++ I +AI  S  
Sbjct  42    DVTSTKKAIESICQTTQYQTTCVESLEATGECSSDPKDLIQMSFQVTIKKIKEAIDNSTF  101

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             +++ +KDPR   AL+ C+ L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT 
Sbjct  102   MQKLEKDPRAKMALENCEMLALQAVNDLNRTHIKFESFEFNDLSHWIADLKIWLSGAITY  161

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FE+TTG+ GEKMK  L  + +L+SN L+MIT  +++  SL   G N +RRLL 
Sbjct  162   QETCLDGFEDTTGEAGEKMKKALNVSMQLTSNALSMITEISDVFTSLN-AGSN-RRRLLF  219

Query  2570  AETKGeeq-eeEFPGFVDAATRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +T       E  P ++D   RRLL  + ++ IK D+VVAKDGSG+YK + +AL+ +P  
Sbjct  220   DDTPVLGHGIELLPDWIDVGRRRLLAVNMSNEIKPDVVVAKDGSGKYKFINDALKHIPEH  279

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T V++IK GVYNE+VE+   M+ +V +G+GPTKTRITG++S KDGI TY T+TVAI 
Sbjct  280   RNQTYVLYIKEGVYNEKVEILSTMSNLVIIGDGPTKTRITGNQSFKDGIPTYQTSTVAIM  339

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F+A++IGFEN+AG  KHQA+ALRV+AD +IF+NCH+D YQDTL  H+YRQFYRDCTI
Sbjct  340   GDYFVAKDIGFENTAGPDKHQALALRVAADKSIFYNCHVDGYQDTLCAHTYRQFYRDCTI  399

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
              GT+DF+FG+A  VFQNC + VRKPM  Q C+VTAQGR D R    +V Q+C I+A+ + 
Sbjct  400   RGTIDFVFGDAAAVFQNCTLAVRKPMKEQHCIVTAQGRTDARQPTGLVFQNCSIVADESY  459

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
                    K +LGRPWK++SRT+IM + IDD++ PEGW  W  T   +T +Y E+ N+G G
Sbjct  460   NEVKGEVKTYLGRPWKQYSRTIIMESNIDDLIQPEGWLEWNKTFAFETLFYTEFNNKGSG  519

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG-FLQP*NKQAKLS  1500
             +S   RV+W G K  +  E  ++FT   F+ AD  W+    +P++ G FL P    + + 
Sbjct  520   SSKTDRVRWSGVKE-LPIERVQRFTTSSFIDAD-LWIPSTGVPYTSGFFLSPPQSDSSIV  577

Query  1499  SHPTKD  1482
               P  D
Sbjct  578   YSPVDD  583



>ref|XP_004229262.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   523 bits (1346),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/530 (48%), Positives = 357/530 (67%), Gaps = 20/530 (4%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ++T++KSV+ +C PT YK+TCE++L+ AK+  DPK+ IKVAF+ TV +I +AI  +E +K
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVK  97

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A  DP T DAL  C+E+   ++++L  S  ++ENFD  ++K+  +DLK WLS  +  +E
Sbjct  98    KAASDPYTKDALLACEEVFDLAVEELRGSIARIENFDFSKMKDIVDDLKSWLSAVVAYEE  157

Query  2744  TCIDAFENTT-GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             TC+D F  +    T ++M  L+ T  ELSSN L+M+ +F E++           R+LL+ 
Sbjct  158   TCLDGFTKSEYSATRDEMMKLMSTTRELSSNALSMVNNFGEMITQ----NTGLTRKLLSN  213

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
                          FV+A+ R+LL    +  K + VV+  G GQYK++ EAL+AVP  +  
Sbjct  214   SDS----------FVEASNRKLLQISAS--KPNAVVSTSGGGQYKTIQEALQAVPRSSPT  261

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGD  2211
               VI IKAG Y E +E+ + M  +V +GEGPTKT ITG ++   + I T+HTAT+ + GD
Sbjct  262   PFVILIKAGTYKEHIEIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGD  321

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ +++G EN+AG  K QAVALR++AD  + +NC+ID YQDTLY HS RQFYRDCTI+G
Sbjct  322   GFVMKDMGIENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITG  381

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNCK+IVRKP  NQ CM+TAQGR  +      V+Q+C+I A+ AL +
Sbjct  382   TIDFLFGDASAVFQNCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADQALTS  441

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGA  1674
             ANPP KV+LGRPWKEFS+T+IM + ID  V P GWS W  T + + TC+YAEYQNRGPGA
Sbjct  442   ANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGA  501

Query  1673  STDKRVK-WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + DKRV  W+GY+++IS +V   FT G F+   + WL    IP+  G ++
Sbjct  502   ALDKRVSTWRGYQKDISGDVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_003516937.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Glycine max]
Length=576

 Score =   523 bits (1348),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 268/568 (47%), Positives = 381/568 (67%), Gaps = 25/568 (4%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaa------tvsvgssggGEISTASKSVKEICAPTDY  3054
             G+ E+ K++A+ GV+++ LVA VVA       + +  ++   +I+++ K+V+ +C PT+Y
Sbjct  4     GNAERGKRIAIIGVSTLLLVAMVVAVTVGVNVSENGSNNEDTKIASSVKAVQTLCHPTNY  63

Query  3053  KETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCK  2877
             K+ CE SL A A +T DPKELIK+ F +T+  I D + K+ LL E ++DPR   ALDTCK
Sbjct  64    KKECEESLIARAGNTTDPKELIKIVFNITITKIGDKLKKTNLLHEVEEDPRAKMALDTCK  123

Query  2876  ELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEK  2697
             +L+  SI++L RS + +  FDL+ + +   +LKVWLSGA+T Q+TC+D FENTT D G+K
Sbjct  124   QLMDLSIEELTRSLDGIGEFDLKNIDKILMNLKVWLSGAVTYQDTCLDGFENTTSDAGKK  183

Query  2696  MKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDA  2517
             MK LL     +SSN LA++T+  + +    +      RR L  ++K        P +VD 
Sbjct  184   MKDLLTAGMHMSSNALAIVTNLADTVDDWNV--TELSRRRLLQDSK-------LPVWVDQ  234

Query  2516  ATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                RLL  + + ++H  ++ VA DGSG ++S+ EAL+ VP +N +  VI+IK GVY E V
Sbjct  235   --HRLLNENESLLRHKPNVTVAIDGSGDFESINEALKQVPKENRKPFVIYIKEGVYQEYV  292

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV +KM  +VF+GEG  KTRITG+++  DG  TY TATVAIQGD F+A N+GFENSAG  
Sbjct  293   EVTKKMTHVVFIGEGGKKTRITGNKNFIDGTNTYRTATVAIQGDYFVAINMGFENSAGPQ  352

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  +FQNC
Sbjct  353   KHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALAIFQNC  412

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L RPWK +
Sbjct  413   TFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLARPWKNY  472

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+IM T+IDD++  +G+  WQG      ++TC+YAEY + GPG+   KRVKW G   N
Sbjct  473   SRTIIMDTYIDDLINVDGYLPWQGLEGPSGMNTCFYAEYHDSGPGSDKSKRVKWAGI-WN  531

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
             ++ + A+ F+   F    + W+    IP
Sbjct  532   LNSKAARWFSASKFFHGTD-WIEVTGIP  558



>ref|XP_010667122.1| PREDICTED: pectinesterase [Beta vulgaris subsp. vulgaris]
Length=585

 Score =   523 bits (1348),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 236/537 (44%), Positives = 350/537 (65%), Gaps = 14/537 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSEL  2931
             +I+  +K+++ IC PT YK+ CE +L  +  +T+DPKEL+K AF+V  E +  A+ KS+ 
Sbjct  44    KIAAGTKAIQSICQPTRYKQACESTLTNSGGNTNDPKELVKTAFRVAKEEVAKALEKSKT  103

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             ++ A  DPR ++ ++ C+E++  +I+DLER+ E V  F ++ + ++  DL+VW+ GAIT 
Sbjct  104   IQAAKDDPRAAEGIEICREVVGYAINDLERTVESVGAFSMDNIDDFLEDLRVWIGGAITY  163

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFK-----  2586
             QE C + FEN+T D G KM++    + ELSSN L +IT    +LQ L+IPG++       
Sbjct  164   QEVCFEGFENSTSDAGTKMRNFFNVSRELSSNALNIITEAKSMLQYLDIPGLDLSALNGG  223

Query  2585  -------RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSV  2427
                    RRLL    KG     E P +V    R+++    + +K D  V++ G GQYK++
Sbjct  224   GDGGAAHRRLLGKAPKGVWLAGEMPPWVTDPKRKMMNVPVSQLKPDATVSQSGGGQYKTI  283

Query  2426  VEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG  2247
              EA+  VP  N    +I+IKAG Y E + + +K   ++ VG+GPTKT ITGS++   GI 
Sbjct  284   SEAIAKVPMNNASPFIIYIKAGTYKEYINIEKKQTNVILVGDGPTKTIITGSKNFAAGIN  343

Query  2246  TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHS  2067
             T+ TATV + GDGF+AR++  ENS+G   HQAVAL+V +D+ + +NC     QDTLY   
Sbjct  344   TFKTATVGVLGDGFMARDLTIENSSGPEGHQAVALKVVSDLAVLYNCRFTGNQDTLYALR  403

Query  2066  YRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQ  1887
              RQFYRDCT+SGT+DFIFG+A  VFQNCK++VRKP  NQ+CMVTAQGR + +G  A + +
Sbjct  404   GRQFYRDCTVSGTIDFIFGDAQAVFQNCKLMVRKPGPNQQCMVTAQGRTEEKGPGAFIFE  463

Query  1886  SCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCW  1707
              C + +EP  KA    N  +LGRPWKE+S+T+ M++ IDD + P+GW+ WQG   LDT +
Sbjct  464   GCTVSSEPGYKAVKAKNPAYLGRPWKEYSKTIFMYSNIDDTIAPKGWTEWQGNFALDTLY  523

Query  1706  YAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             YAE++N+G GA   +RVKWKG K  +S + A  FTP    ++ ++W+  + +P++PG
Sbjct  524   YAEFENKGAGADKSQRVKWKGIK-TLSAQEADGFTPAKLFVSGDKWIPESGVPYAPG  579



>ref|XP_010558804.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Tarenaya hassleriana]
Length=571

 Score =   523 bits (1347),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/534 (48%), Positives = 358/534 (67%), Gaps = 21/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERS-LAGAKDTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+VK +CA TDYKETC  S ++ + ++  P +LI++ F +T+++I + I K+  
Sbjct  46    QIKTTTKAVKAVCAITDYKETCINSFMSASPNSTQPLDLIRLGFDLTIKSIHEGIKKAAD  105

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             EL ++A KDP    ALD C EL+ +S DDL + F+K + F+L  ++E+  DL+VWLSG++
Sbjct  106   ELKEKAAKDPEAKRALDLCHELMIDSTDDLSKCFDKFDGFNLSEIEEFVEDLRVWLSGSM  165

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID F+    D  + M  + KT+ EL+SNGLAM++  +  L    I  +N     
Sbjct  166   AFQQTCIDTFDEVKSDLAQDMAKIFKTSKELTSNGLAMVSGISTFLPQFNITEINDDLGS  225

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEA  2418
             + R+LL+ E       + FP ++   TR+L+   T P  +K + VVA DGSGQ+KS+ +A
Sbjct  226   YARKLLSTE-------DGFPTWMRPETRKLMAAVTGP-KVKPNAVVALDGSGQFKSINDA  277

Query  2417  LRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTY  2241
             L+ VP  N    VI+IK G+Y E+V+V + M  + F+G+GPTKT +TG+ +   G + TY
Sbjct  278   LKTVPKNNKFPFVIYIKQGIYKEKVDVTKTMTYVTFIGDGPTKTIVTGNLNFGIGNVKTY  337

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
              TATVA+ G+ F A++IGFEN+AG   HQAVALRVSAD  +F+NC ID YQDTLY HS+R
Sbjct  338   QTATVAVNGENFTAKDIGFENTAGPEGHQAVALRVSADYAVFYNCQIDGYQDTLYAHSHR  397

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYRDCTISGT+D+IFG+A   FQNCKM+VRKPM  Q CMVTAQGR D+R +  I+L +C
Sbjct  398   QFYRDCTISGTIDYIFGDAKSFFQNCKMVVRKPMGGQSCMVTAQGRTDKRESTGIILHNC  457

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
              I+ +PA       NK +LGRPWKEFSRT+IM T IDDI+ P+GW  W G   LDT  Y 
Sbjct  458   RIMGDPAYIPVKSTNKAYLGRPWKEFSRTIIMRTTIDDIIDPKGWLEWNGNFALDTLEYG  517

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             EY+N G G+  + RVKW G K+ +S   A QFT G FL  +  W+ R ++P++P
Sbjct  518   EYENNGSGSGQEMRVKWPGIKK-LSARQALQFTAGRFLRGN-TWIPRRRVPYTP  569



>ref|XP_004229264.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=552

 Score =   521 bits (1342),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 251/530 (47%), Positives = 356/530 (67%), Gaps = 20/530 (4%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ++T++KSV+ +C PT YK+TCE++L+ AK+  DPK+ IKVAF+ TV +I +AI  +E +K
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNAIKNTEPVK  97

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A  DP T DAL  C+E+   ++++L  S  ++ENFD  ++K+  +DLK WLS  +  +E
Sbjct  98    KAASDPYTKDALLACEEVFDLAVEELRGSIARIENFDFSKMKDIVDDLKSWLSAVVAYEE  157

Query  2744  TCIDAFENTT-GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             TC+D F  +    T ++M  L+ T  ELSSN L+M+  F E++           R+LL+ 
Sbjct  158   TCLDGFTKSEYSATRDEMMKLMSTTRELSSNALSMVNSFGEMITQ----NTGLTRKLLSN  213

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
                          FV+A+ R+LL    +  K + VV+  G GQYK++ EAL+AVP  +  
Sbjct  214   SDS----------FVEASNRKLLQISAS--KPNAVVSASGGGQYKTIQEALQAVPKSSPT  261

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN-KDGIGTYHTATVAIQGD  2211
               VI IKAG Y E +++ + M  +V +GEGPTKT ITG ++   + I T+HTAT+ + GD
Sbjct  262   PFVILIKAGTYKEHIQIEKNMLNVVLIGEGPTKTIITGDQAVVPNRISTWHTATLGVCGD  321

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ +++G EN+AG  K QAVALR++AD  + +NC+ID YQDTLY HS RQFYRDCTI+G
Sbjct  322   GFVMKDMGIENTAGPTKEQAVALRINADKAVLYNCNIDGYQDTLYAHSGRQFYRDCTITG  381

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNCK+IVRKP  NQ CM+TAQGR  +      V+Q+C+I A+ AL +
Sbjct  382   TIDFLFGDASAVFQNCKLIVRKPGPNQACMITAQGRMRKDSLGGFVIQNCDIKADKALTS  441

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGA  1674
             ANPP KV+LGRPWKEFS+T+IM + ID  V P GWS W  T + + TC+YAEYQNRGPGA
Sbjct  442   ANPPVKVYLGRPWKEFSKTIIMQSNIDGFVDPSGWSPWNTTDFGIHTCFYAEYQNRGPGA  501

Query  1673  STDKRVK-WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             + DKRV  W+GY+++IS +V   FT G F+   + WL    IP+  G ++
Sbjct  502   ALDKRVSTWRGYQKDISGDVINSFTAGKFINTQQPWLPMFDIPYEAGMMK  551



>ref|XP_003557035.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=587

 Score =   521 bits (1343),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 277/577 (48%), Positives = 381/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgss-----------ggGEISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +               ++++ K+V+ +C
Sbjct  9     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  68

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKEL+K+ F +T+  I D + ++ +L E +++PR   A
Sbjct  69    HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  128

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGAIT Q+TC+D FENTT 
Sbjct  129   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAITYQDTCLDGFENTTS  188

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  189   DAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSELP  239

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  240   SWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEGV  297

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  298   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  357

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  358   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  417

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  418   VFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  477

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  478   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  537

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  538   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  572



>gb|KHN03958.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=580

 Score =   521 bits (1343),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 270/584 (46%), Positives = 374/584 (64%), Gaps = 25/584 (4%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvs-----------vgssggGEISTASKSVKEI  3072
             MG   Q K++A+ GV++  LVA VVA TVS                   ++++ K+VK +
Sbjct  1     MGGDAQKKRIAIIGVSTFLLVAMVVAVTVSINLNNKGSSYDSKEESKSSVASSIKAVKTL  60

Query  3071  CAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSD  2895
             CAPTDYK+ CE SL   + +  DP+ELIK+AF VT+  I + + K+EL+ + + DPRT +
Sbjct  61    CAPTDYKKECEDSLIEHSNNITDPRELIKIAFHVTISKIGEGLEKTELMHQVENDPRTKE  120

Query  2894  ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             ALDTCK+L+  SI +  RS ++   FDL  +      LKVWLSGAIT QETC+DAFENTT
Sbjct  121   ALDTCKQLMNLSIGEFTRSLDRFTKFDLNNLDNILTSLKVWLSGAITYQETCLDAFENTT  180

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRLLTAETKGeeqee  2541
              D   KM+ LL++A  +SSNGL++IT  ++ L  + I  PG   +RRLL     G +  +
Sbjct  181   TDASLKMQRLLQSAMHMSSNGLSIITELSKTLSEMHIGKPG---RRRLLNNNVLGHDYFD  237

Query  2540  EFPGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
               P +VD     R+LL          +VVAKDGSG + ++ EAL+ VP KN    VI++K
Sbjct  238   -LPEWVDDQVGVRKLLHMTGRKRMAHVVVAKDGSGNFTTINEALKHVPKKNLRPFVIYVK  296

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIG  2187
              GVYNE VEV + M  +V +G+G  K+RITG+++  DG+GT+ TA+ AI GD F+   +G
Sbjct  297   EGVYNEYVEVSKNMTHVVMIGDGGKKSRITGNKNFVDGVGTFRTASAAILGDFFVGIGMG  356

Query  2186  FENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGN  2007
             FENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYRDC ISGT+DF+FG+
Sbjct  357   FENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYRDCIISGTIDFVFGD  416

Query  2006  APVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVF  1827
             A  V QNC  +VRKP+ NQ+C+VTAQGRK+    + +++Q   I+A+P        NK +
Sbjct  417   AVAVLQNCTFVVRKPLENQQCIVTAQGRKEMNQPSGLIIQGGSIVADPMYYPVRFDNKAY  476

Query  1826  LGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRV  1656
             L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+Y+E+ NRGPG+   KRV
Sbjct  477   LARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGLRGMDTCFYSEFNNRGPGSDKAKRV  536

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW+G K   S  ++  F P  F   D+ W+   ++P+  G   P
Sbjct  537   KWEGIKALDSDGIS-NFLPAKFFHGDD-WIRVTRVPYYSGQPSP  578



>gb|AGT17860.1| pollen-specific pectin methylesterase [Pisum sativum]
Length=584

 Score =   521 bits (1342),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 271/580 (47%), Positives = 381/580 (66%), Gaps = 32/580 (6%)
 Frame = -1

Query  3227  LTKMGSPEQNKKVAVTGVASIFLvacvvaatvsvgssg-----------gGEISTASKSV  3081
             + + G  ++ +++A+ GV+S+ LVA V+A TV    +               +S+  ++V
Sbjct  1     MAEGGDAQKGRRIAIIGVSSLLLVAMVIAVTVGANRNQNGFDDDIENNRKNHVSSTMRAV  60

Query  3080  KEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKD  2910
             + IC PTDYK+ C  +L   A A +  DPKELIK+AF VT++ I + I  ++L+ E +KD
Sbjct  61    QTICQPTDYKKECVDTLTAEAEAGNVTDPKELIKIAFNVTMKKIGEQIKATDLMHEVEKD  120

Query  2909  PRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDA  2730
             PR+ DA+DTCK+L+  SI +  R+ + ++ FDL+ +     +LKVWL+GA+T  +TC+D 
Sbjct  121   PRSKDAIDTCKQLMDLSIGEFARAMDGIDQFDLKDIDRILMNLKVWLNGAVTYMDTCVDG  180

Query  2729  FENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGee  2550
             F+NTT D G+KMK +L ++  +SSN LA+I+ F + + S  +  + F RRLL  +T    
Sbjct  181   FQNTTTDAGKKMKDILTSSMHMSSNALAIISDFADTVTSWNVTKI-FGRRLLDTDT----  235

Query  2549  qeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                  P +V +  R LL    +S  +K ++ VA DG+G  K++ EAL  VP K+++   I
Sbjct  236   -----PSWV-SEHRMLLDAKTSSFKLKPNVTVALDGTGDVKTINEALLKVPEKSEKPFFI  289

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVYNE VEV + M  +VF+G+G  K+RITGS++  DG+ TY TA+VAIQGD F A 
Sbjct  290   YIKEGVYNEYVEVGKHMTYVVFLGDGGQKSRITGSKNFIDGVNTYKTASVAIQGDHFTAI  349

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             N+GFENSAGA KHQAVALRV  D +IF NC +D YQDTLY H+ RQFYRDCTISGT+DFI
Sbjct  350   NMGFENSAGAHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFI  409

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FGNA  VFQNCK +VRKPMANQ+C+VTAQGRK+R   +AIV+Q   I+A+P        +
Sbjct  410   FGNALSVFQNCKFVVRKPMANQQCIVTAQGRKERFQPSAIVIQGGSIVADPEFYPVRFDH  469

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTD  1665
             K +L RPWK FSRT+ M TFIDD++ P+G+  WQ   G   +DTC+YAEY N GPG+   
Sbjct  470   KAYLARPWKNFSRTIFMDTFIDDLIHPDGYMPWQTPEGFSGMDTCFYAEYHNYGPGSDKS  529

Query  1664  KRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             KRV W G   +++ + A+ F P  F    + W+    +PF
Sbjct  530   KRVHWAGI-WSLNSKAARWFAPSKFFHGSD-WIEETGVPF  567



>ref|XP_010495536.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Camelina sativa]
Length=627

 Score =   522 bits (1345),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 256/511 (50%), Positives = 335/511 (66%), Gaps = 27/511 (5%)
 Frame = -1

Query  3017  DTDDPKELIKVAFKVTVENITDAISKSEL---------------LKEADKDPRTSDALDT  2883
             +T DP EL+K AF  T++ IT    KS+                L++  KDPRT  ALD 
Sbjct  4     NTSDPLELVKTAFNATMKQITGVAKKSQXSPPNLIKQKLTLLKRLRKXQKDPRTKMALDQ  63

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             CKEL+  +I +L +SFE++  F+  +V E    L+VWLS  I+ +ETC+D F+ T GD G
Sbjct  64    CKELMDYAIGELSKSFEELGRFEFHKVDEALVKLRVWLSATISHEETCLDGFQGTQGDAG  123

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             E +K  LKTA +L+ NGLAM+T  +  L  ++IP +N  RRLL+ E         FP ++
Sbjct  124   ETIKKALKTAVQLTHNGLAMVTEMSNYLGQMQIPEMN-SRRLLSQE---------FPSWM  173

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
             D  TRRLL +  + +K DIVVA+DGSGQYK++ EAL  VP K + T V+ IK G+Y E V
Sbjct  174   DGRTRRLLNSPMSEVKADIVVAQDGSGQYKTINEALNHVPKKKNTTFVVHIKGGIYKEYV  233

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             +V R M  +VF+G+GP KT I+G ++ KDGI TY TATVAI GD FIA+N+GFEN+AGA 
Sbjct  234   QVNRSMTHLVFIGDGPDKTVISGDKNYKDGITTYRTATVAIVGDHFIAKNMGFENTAGAI  293

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV +D +IF+NC  D YQDTLY HS+RQFYRDCTISGT+DF+FG+A  VFQNC
Sbjct  294   KHQAVAIRVLSDESIFYNCRFDGYQDTLYAHSHRQFYRDCTISGTIDFLFGDAAAVFQNC  353

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
              ++VRKP+ NQ C +TA GRKD R +   VLQ C I  EP        +K +LGRPWKE+
Sbjct  354   TLLVRKPLPNQACPITAHGRKDPRESTGFVLQGCTIAGEPDYLTVKETSKSYLGRPWKEY  413

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             SRT+ M TFI D + PEGW  W G   LDT +Y+E +N GPGA   KRV W G K+ +S 
Sbjct  414   SRTIFMNTFIPDFIPPEGWQPWLGNFALDTLFYSEVRNTGPGAGVTKRVTWPGIKK-LSE  472

Query  1622  EVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             E   +FTP  ++  D  W+    +P+ PG  
Sbjct  473   EEILKFTPAEYIQGDA-WIPGKGVPYIPGLF  502



>ref|XP_010922274.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=574

 Score =   520 bits (1338),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 250/526 (48%), Positives = 360/526 (68%), Gaps = 10/526 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +T+ K+++ +C PTDYK+ CE++L+  + +T D  EL+ VAF  +++ +TD   +SELLK
Sbjct  48    NTSIKAIQTVCQPTDYKDACEKTLSSFSHNTTDHMELVNVAFSASMKYVTDVFDRSELLK  107

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             E  KDP +++AL TC+ELL+ ++DDL++S  ++ N      ++   DLKVWLS AIT Q+
Sbjct  108   EVSKDPASTEALQTCRELLEYAMDDLKKSIVQLGNVHKNLYEQAVEDLKVWLSAAITYQD  167

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+D FE       E M+  ++ + +++SN LAM+     L++SL I  +  +R+LL+  
Sbjct  168   TCVDGFEGINTSAAETMRQAIENSTQITSNALAMVNQLDVLVRSLNISSL-LRRKLLS--  224

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                +    EFP ++ AA RRLL   PA I  ++ VA+DG+G ++++ EAL  VP  N+ T
Sbjct  225   ---DAGANEFPSWMPAAQRRLLKVRPAKIMPNVTVAQDGTGDFETITEALAQVPKDNNAT  281

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDG  2208
              VI++KAGVY ER  V + M K+  +G+GPTKT+ITG+ S   G I T+ TATVA+ G+ 
Sbjct  282   FVIYVKAGVYKERFLVDKHMTKVTMIGDGPTKTKITGNVSVIAGEISTFKTATVAVAGEW  341

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F+   +GFEN+AG  KHQAVALRV+AD ++F+NC +D YQDTLY HS RQFYRDCTI+GT
Sbjct  342   FVGIGLGFENTAGPEKHQAVALRVNADRSVFYNCRMDGYQDTLYAHSERQFYRDCTITGT  401

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++  +FQNC +I RKPM NQ+ +VTAQGRK+R+G  AIVLQ+C I ++PA    
Sbjct  402   IDFIFGDSATIFQNCMIIARKPMDNQQNIVTAQGRKERQGNGAIVLQNCTITSDPAYYPH  461

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                   +LGRPWK +SRTLI+ + +DD++ P+GW  W G + LDTC+YAE  NRGPGA  
Sbjct  462   RKVLPTYLGRPWKPYSRTLILQSQLDDLIHPDGWLPWTGDVGLDTCFYAELDNRGPGADL  521

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              KRV W G K N++   A+++T   +L   + W+ RA +PF PG L
Sbjct  522   TKRVTWPGIK-NLTYVEAQEYTIENYLYG-QTWISRAGVPFIPGLL  565



>ref|XP_004515520.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
 ref|XP_004515521.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   520 bits (1338),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 348/530 (66%), Gaps = 17/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKS  2937
              +++  K+V+ IC PTDYK+ CE +L   A A +  DPKELIK+AF VT++ I D I ++
Sbjct  51    HVASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             +LL E +KDPR+ DALDTCK+L+  SID+  RS + +  FDL+ + +   +LKVWL+GA+
Sbjct  111   DLLHEVEKDPRSKDALDTCKQLMDLSIDEFTRSLDGINEFDLQNIDKILMNLKVWLNGAV  170

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             T  +TC+D FENTT + G KMK LL ++  +SSN LA+I+ F + +       +  +  L
Sbjct  171   TYMDTCLDGFENTTSEAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATNILRRHLL  230

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
               +ET         P  VD   +     +    K ++ VA DGSG +KS+ EAL  VP K
Sbjct  231   HDSET---------PSSVDHHKQHNAMKNVFKHKPNVTVALDGSGDFKSINEALTRVPEK  281

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             + +  VI+IK GVY E VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VAIQ
Sbjct  282   SKKPFVIYIKEGVYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVAIQ  341

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD F+A N+GFENSAG  KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDCTI
Sbjct  342   GDHFVAINMGFENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDCTI  401

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DF+FGNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P  
Sbjct  402   SGTIDFVFGNALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEF  461

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNR  1686
                   NK +L RPWK FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY N 
Sbjct  462   YPVRFDNKAYLARPWKNFSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYHNF  521

Query  1685  GPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             GPG+   KRV W G   N++ + A  F P  F    + W+    IPF  G
Sbjct  522   GPGSDKSKRVNWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  569



>ref|XP_008795810.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28 
[Phoenix dactylifera]
Length=572

 Score =   519 bits (1336),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 251/526 (48%), Positives = 356/526 (68%), Gaps = 10/526 (2%)
 Frame = -1

Query  3101  STASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             +T+ K++K +C PTDYK+ CE++L+  + +T DP EL+ VAF  +++ +TDA  KSELLK
Sbjct  46    NTSIKAIKAVCEPTDYKDACEKTLSSMSHNTSDPMELVNVAFNASMKYVTDAFDKSELLK  105

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +  KDP +++AL TC ELL+ + DDL++S E++ +    R ++   DLKVWLS AIT Q+
Sbjct  106   DVSKDPASAEALRTCSELLEYATDDLKKSIEQLGSVQTNRYEQAVEDLKVWLSAAITYQD  165

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAE  2565
             TC+D FE       E M   +K + +++SN LAMI  F  L+ S  I   +  R+LL+  
Sbjct  166   TCVDGFEGINTSAAEAMHQAIKNSTQITSNALAMINQFDNLVGSFNISS-HAGRKLLSG-  223

Query  2564  TKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDET  2385
                  +  EFP ++ AA  R L   PA IK ++ VA+DG+G +K++ EAL+ VP +N++T
Sbjct  224   ----TRANEFPWWMSAAQERFLQPAPAQIKPNVTVAQDGTGDFKTISEALKHVPKQNNDT  279

Query  2384  VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDG  2208
              VI++KAGVY E V V + M  +  +G+GPTKT+ITG      G I T+ TATVA+ G+ 
Sbjct  280   FVIYVKAGVYKEGVLVDKHMTHVTMIGDGPTKTKITGDVHVIQGKISTFKTATVAVAGEW  339

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F    +GFEN+AG   HQAVALRV+AD ++F+NC +D YQDTLY HS RQFYRDCTI+GT
Sbjct  340   FTGMGLGFENTAGPQNHQAVALRVNADRSVFYNCRMDGYQDTLYAHSGRQFYRDCTITGT  399

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DFIFG++  + QNC +IVRKPM NQ+ +VTA GR DR+G  A+V+Q+C I ++PA   +
Sbjct  400   IDFIFGDSATMLQNCMIIVRKPMDNQQNIVTAHGRIDRQGNGALVIQNCTITSDPAYYPS  459

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
                   +LGRPWK +SRTLI+ + +DD+V P+GW  W G + LDTC+YAE  NRGPGA+ 
Sbjct  460   RKKLPTYLGRPWKPYSRTLILQSQLDDLVHPDGWMPWNGNIGLDTCFYAELDNRGPGANL  519

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
              KRV W G K+ +S + A++FT   +L   + W+ R  +PF PG L
Sbjct  520   TKRVTWPGIKK-LSYDEAQRFTVEHYLFG-QTWIPRTGVPFIPGLL  563



>gb|KHN43318.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=561

 Score =   518 bits (1333),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/534 (48%), Positives = 350/534 (66%), Gaps = 15/534 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              ++++ K+VK +CAPTDYK+ CE +L   A +  DP+ELIK+AF VT+  I + + K++L
Sbjct  27    HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  86

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E + DP T +ALDTCK+L+  SI +  RS +K   FDL  +      LKVWLSGAIT 
Sbjct  87    MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKFAKFDLNNLDNILTSLKVWLSGAITY  146

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRL  2577
             QETC+DAFENTT D G+KM+ LL+TA  +SSNGL++I   ++ L  + +  PG   +RRL
Sbjct  147   QETCLDAFENTTTDAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG---RRRL  203

Query  2576  LTAETKGeeqeeEF--PGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
             L           +F  P +VD     R+LL          +VVAKDGSG + ++ EAL+ 
Sbjct  204   LNNVDDLPVLGHDFDLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKY  263

Query  2408  VPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTAT  2229
             VP KN    VI++K GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+
Sbjct  264   VPKKNLRPFVIYVKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTAS  323

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
              AI GD F+   +GFENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYR
Sbjct  324   AAILGDFFVGIGMGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYR  383

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             DC ISGT+DF+FG+A  V QNC  +VRKP+ NQ+C+VTAQGRK+R   + +V+    I++
Sbjct  384   DCIISGTIDFVFGDAVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVS  443

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAE  1698
             +P        NK +L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+YAE
Sbjct  444   DPTYYPVRFDNKAYLARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGFSGMDTCFYAE  503

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + NRGPG+   KRVKW+G K  +  +    F P  F   D+ W+   +IP+  G
Sbjct  504   FNNRGPGSDKTKRVKWEGVK-TLDSDGITNFLPSMFFHGDD-WIRVTRIPYYSG  555



>ref|XP_003529774.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   518 bits (1334),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 275/577 (48%), Positives = 380/577 (66%), Gaps = 30/577 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgss-----------ggGEISTASKSVKEIC  3069
             G+  + K++A+ GV+++ LVA VVA T+ V  +               ++++ K+V+ +C
Sbjct  4     GNAGKGKRIAIIGVSTLLLVAMVVAVTIGVNLNENGSNNDIEDNKKNHVASSIKAVQTLC  63

Query  3068  APTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDA  2892
              PT+Y++ CE SL AGA +T DPKEL+K+ F +T+  I D + ++ +L E +++PR   A
Sbjct  64    HPTNYEKECEESLIAGAGNTTDPKELVKIFFNITITKIGDKLKETNILHEIEEEPRAKMA  123

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT 
Sbjct  124   LDTCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTTS  183

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E P
Sbjct  184   DAGKKMKDLLTIGMHMSSNALAIVTGLADTVNDWNITK-SFGRRLL--------QDSELP  234

Query  2531  GFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              +VD    RLL  +  P   K ++ VA D SG +KS+ EAL+ VP KN +  VI+IK GV
Sbjct  235   SWVDQ--HRLLNENASPFKRKPNVTVAIDDSGDFKSINEALKQVPEKNRKPFVIYIKEGV  292

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFEN
Sbjct  293   YQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFEN  352

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
             SAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  353   SAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNALA  412

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+ +  + IV+Q   I+++P   +    NK +L R
Sbjct  413   VFQNCTFVVRKPLENQQCIVTAQGRKEIQQPSGIVIQGGSIVSDPEFYSVRFENKAYLAR  472

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW 
Sbjct  473   PWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKWA  532

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  533   GI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  567



>ref|XP_003553713.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Glycine max]
Length=582

 Score =   518 bits (1334),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 256/534 (48%), Positives = 350/534 (66%), Gaps = 15/534 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              ++++ K+VK +CAPTDYK+ CE +L   A +  DP+ELIK+AF VT+  I + + K++L
Sbjct  48    HVASSMKAVKTLCAPTDYKKECEDNLIEHASNITDPRELIKIAFHVTISKIGEGLEKTQL  107

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + E + DP T +ALDTCK+L+  SI +  RS +K   FDL  +      LKVWLSGAIT 
Sbjct  108   MHEVENDPITKEALDTCKQLMNLSIGEFTRSLDKFAKFDLNNLDNILTSLKVWLSGAITY  167

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI--PGVNFKRRL  2577
             QETC+DAFENTT D G+KM+ LL+TA  +SSNGL++I   ++ L  + +  PG   +RRL
Sbjct  168   QETCLDAFENTTTDAGQKMQKLLQTAMHMSSNGLSIINELSKTLSEMHVNRPG---RRRL  224

Query  2576  LTAETKGeeqeeEF--PGFVD--AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
             L           +F  P +VD     R+LL          +VVAKDGSG + ++ EAL+ 
Sbjct  225   LNNVDDLPVLGHDFDLPEWVDDRVGVRKLLRMTGRKRMAHVVVAKDGSGNFSTINEALKY  284

Query  2408  VPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTAT  2229
             VP KN    VI++K GVYNE VEV + M  +V +G+G  K+RITGS++  DG+GTY TA+
Sbjct  285   VPKKNLRPFVIYVKEGVYNEYVEVSKNMTHVVMIGDGGKKSRITGSKNFIDGVGTYRTAS  344

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
              AI GD F+   +GFENSAGA KHQAVALRV AD +IF+ C +D YQDTLY H+ RQFYR
Sbjct  345   AAILGDFFVGIGMGFENSAGAEKHQAVALRVQADRSIFYKCRMDGYQDTLYAHTMRQFYR  404

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             DC ISGT+DF+FG+A  V QNC  +VRKP+ NQ+C+VTAQGRK+R   + +V+    I++
Sbjct  405   DCIISGTIDFVFGDAVAVLQNCTFVVRKPLENQQCIVTAQGRKERNQPSGLVIHGGSIVS  464

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAE  1698
             +P        NK +L RPWK FSRT+ M ++I D++ P+G+  WQ   G   +DTC+YAE
Sbjct  465   DPTYYPVRFDNKAYLARPWKNFSRTIFMDSYIGDLITPDGYMPWQTLEGFSGMDTCFYAE  524

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             + NRGPG+   KRVKW+G K  +  +    F P  F   D+ W+   +IP+  G
Sbjct  525   FNNRGPGSDKTKRVKWEGVK-TLDSDGITNFLPSMFFHGDD-WIRVTRIPYYSG  576



>ref|XP_004495691.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=583

 Score =   516 bits (1328),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 269/576 (47%), Positives = 373/576 (65%), Gaps = 32/576 (6%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssgg-----------GEISTASKSVKEIC  3069
             G   + +++A+ GV+++ LVA VVA TV    +               I++  K+V+ IC
Sbjct  4     GDANKGRRIAIIGVSTLLLVAMVVAVTVGANRNQNGYDDDIEDNQRNHIASTMKAVQTIC  63

Query  3068  APTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTS  2898
              PT+YK+ CE +L   A A +  DPKELIK+AF VT+  I++ I +++L+ E +KDPR+ 
Sbjct  64    HPTEYKKECEETLVAEAQADNVTDPKELIKIAFNVTMRRISEKIKETDLMHEVEKDPRSK  123

Query  2897  DALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENT  2718
             DALDTCK+L+  SI +  RS +    FDL+ + +   +LKVWL+GA+T  +TC+D F+NT
Sbjct  124   DALDTCKQLMDLSIGEFTRSLDGFSQFDLQDMDKILMNLKVWLNGAVTYMDTCVDGFDNT  183

Query  2717  TGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeE  2538
             T + G KMK LL ++  + SN LA+I+ F + L       V  +R L  +ET        
Sbjct  184   TTEAGAKMKELLTSSMHMGSNALAIISDFADTLADWNATKVFGRRLLHDSET--------  235

Query  2537  FPGFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKA  2364
              P +VD   R+L+ T   + +H  ++ VA DG+G +K++ EAL  VP K  +  +I+IK 
Sbjct  236   -PSWVDH--RQLIDTKTNTFRHKPNVTVALDGTGDFKTINEALAKVPEKTKKPFIIYIKE  292

Query  2363  GVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGF  2184
             GVY+E VEV ++M  +VFVG+G  K+ ITG+++  DG+ TY TA+VAIQGD F A N+GF
Sbjct  293   GVYSEYVEVTKRMTHVVFVGDGGKKSVITGNKNFIDGVNTYRTASVAIQGDHFTAINMGF  352

Query  2183  ENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNA  2004
             ENSAG  KHQAVALRV  D +IF NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA
Sbjct  353   ENSAGPHKHQAVALRVQGDKSIFFNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNA  412

Query  2003  PVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFL  1824
               VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P        NK +L
Sbjct  413   LAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDPEFYPVRFDNKAYL  472

Query  1823  GRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGPGASTDKRVK  1653
              RPWK FSRT+IM  FIDD++ P+G+  WQ   G   +DTC+YAEY N GPG+   KRV 
Sbjct  473   ARPWKNFSRTIIMDAFIDDLIHPDGYLPWQTIEGPSGMDTCFYAEYHNFGPGSDKTKRVH  532

Query  1652  WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             W G   N++ + A  F P  F    + W+    IPF
Sbjct  533   WAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPF  566



>ref|XP_004515516.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Cicer arietinum]
Length=584

 Score =   515 bits (1326),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 263/532 (49%), Positives = 350/532 (66%), Gaps = 20/532 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKS  2937
              I++  K+V+ IC PTDYK+ CE +L   A A +  DPKELIK+AF VT++ I D I ++
Sbjct  51    HIASTMKAVQTICHPTDYKKECEETLIAEAEADNVTDPKELIKIAFNVTMKRIGDKIKET  110

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             +LL E +KDPR+ DALDTCK+L+  SI++  RS + +  FDL+ + +   +LKVWL+GA+
Sbjct  111   DLLHEVEKDPRSKDALDTCKQLMDLSIEEFTRSLDGINEFDLKDIDKILMNLKVWLNGAV  170

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             T  +TC+D FENTT + G KMK LL ++  +SSN LA+I+ F + +       +  +R L
Sbjct  171   TYIDTCLDGFENTTSEAGTKMKELLTSSIHMSSNALAIISDFADTVSDWNATQILRRRLL  230

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVP  2403
               +ET         P  VD   ++         KH  ++ VA DGSG +KS+ EAL  VP
Sbjct  231   HDSET---------PSSVDHHHKQH-NAKKNVFKHKPNVTVALDGSGDFKSINEALTQVP  280

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
              K+ +  VI+IK GVY E VEV + M  +VFVG+G  KT ITG+++  DG+ TY TA+VA
Sbjct  281   KKSKKPFVIYIKEGVYPEYVEVTKHMTHVVFVGDGGKKTIITGNKNFIDGVNTYRTASVA  340

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             IQGD F+A N+GFENSAG  KHQAVALRV  D TIF NC +D YQDTLY H+ RQFYRDC
Sbjct  341   IQGDHFVAINMGFENSAGPHKHQAVALRVQGDKTIFFNCSMDGYQDTLYVHTMRQFYRDC  400

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
             TISGT+DF+FGNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+R   +AIV+Q   I+++P
Sbjct  401   TISGTIDFVFGNALAVFQNCKFVVRKPMSNQQCIVTAQGRKERFQPSAIVIQGGSIVSDP  460

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQ  1692
                     NK +L RPWK FSRT+IM  FIDD++  +G+  WQ   G   +DTC+YAEY 
Sbjct  461   EFYPVRFDNKAYLARPWKNFSRTIIMDAFIDDLIHTDGYLPWQTIEGPSGMDTCFYAEYH  520

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             N GPG+   KRV W G   N++ + A  F P  F    + W+    IPF  G
Sbjct  521   NFGPGSDKTKRVNWAGI-WNLNAKAAHWFAPSKFFHGGD-WIEATGIPFFSG  570



>ref|XP_009594458.1| PREDICTED: pectinesterase [Nicotiana tomentosiformis]
Length=684

 Score =   519 bits (1336),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 265/584 (45%), Positives = 369/584 (63%), Gaps = 36/584 (6%)
 Frame = -1

Query  3218  MGSPEQNKKVAVTGVASIFLvacvvaatvsvgssgg----GEISTASKSVKEICAPTDYK  3051
             M    + + VA+  V S+ LVA +VA  +++          + +T+ K+++ IC  T Y+
Sbjct  1     MAGNNRKRNVAIISVCSLILVAMIVAVAITMKGKDSDNNGQDATTSQKTIESICQTTRYQ  60

Query  3050  ETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
              TC  SL + A+ + DPK+LI+ +F+V ++ I +AI  S +L++ +KDPR   AL+ C++
Sbjct  61    HTCVESLESSAEGSSDPKDLIQKSFQVAIKKIKEAIENSTMLQKLEKDPRAKLALENCQK  120

Query  2873  LLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             L   +++DL R+  K E+F+   +  +  DLK+WLSGAIT QETC+D FE TTG+T EKM
Sbjct  121   LAWQAVNDLNRTHTKFESFEFNDLSHWIADLKIWLSGAITYQETCLDGFEKTTGETEEKM  180

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSL--------------EIPGVNFKRRLLTAETKG  2556
             K  L ++ EL+SN L MIT  + +  SL              E P +     LL      
Sbjct  181   KRALNSSMELTSNALYMITEISSVFTSLNAGSSSRRRLLLLDEAPILGHGNELL------  234

Query  2555  eeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVI  2376
                    P +VD   RRLL      IK DIVVAKDGS +YK++ EAL+ +P   ++T V+
Sbjct  235   -------PDWVDMRRRRLLAA--KEIKPDIVVAKDGSSKYKTINEALKNIPNNRNQTYVL  285

Query  2375  FIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIAR  2196
             +IK GVYNE+VE    M  ++ +G+GPTKTRITG+++ KDG  TY TAT A+ GD F+A+
Sbjct  286   YIKQGVYNEKVEFTSSMTNLMVIGDGPTKTRITGNQNFKDGTPTYLTATAAVMGDYFVAK  345

Query  2195  NIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFI  2016
             +IGFENSAG  KHQAVALRV+AD +IF+NCHID YQDTL  H+YRQFYRDC I GT+DF+
Sbjct  346   DIGFENSAGPEKHQAVALRVAADKSIFYNCHIDGYQDTLCVHTYRQFYRDCVIRGTIDFV  405

Query  2015  FGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPN  1836
             FG+   VFQNC + VRKP+  Q C+VTAQGR D R    +V Q+C I+A+ +        
Sbjct  406   FGDGAAVFQNCTLAVRKPLKEQHCIVTAQGRTDARQPTGLVFQNCSIVADSSYDEVKGEV  465

Query  1835  KVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRV  1656
             K +LGRPWKE+SRT+IM + IDD++ PEGW  W  T  L+T +Y E+ NRG G+S  +R 
Sbjct  466   KTYLGRPWKEYSRTIIMESSIDDLIQPEGWVEWNKTFALNTLFYTEFNNRGSGSSKTERA  525

Query  1655  KWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             KW+G K  +     ++FT   FL  D  W+    IP++PGF  P
Sbjct  526   KWQGVKE-LQINRVQRFTASQFLDGD-AWIPSTGIPYTPGFFLP  567



>ref|XP_007148795.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
 gb|ESW20789.1| hypothetical protein PHAVU_005G015000g [Phaseolus vulgaris]
Length=582

 Score =   515 bits (1326),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 250/528 (47%), Positives = 353/528 (67%), Gaps = 15/528 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
              +++  K+V+ +C PT+Y++ CE SL AGA +T DP+EL+K+AF +T+  I D + ++ L
Sbjct  52    HVASTVKAVQSLCHPTNYEKECEESLIAGAGNTTDPRELVKIAFNITITKIGDKLKETNL  111

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L + +K+PR   ALDTCK+L+  SI +L RS + +  F+L  +++   ++KVWLSGAIT 
Sbjct  112   LHDVEKEPRAKMALDTCKQLMDLSIGELSRSIDGISEFELINIEKILMNIKVWLSGAITY  171

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NTT + G+KMK  L T+  +SSN LA++T   + + +L +  +  +R L  
Sbjct  172   QDTCLDGFDNTTSEAGQKMKDSLMTSMHMSSNALALVTELGDTITNLNVTQLLGRRLLQD  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
             +E+         P +VD        T   + K ++ VA+DG+G +KS+ EAL+ VP KN 
Sbjct  232   SES---------PSWVDHQGLPNANTSLFNHKLNVTVAQDGNGDFKSINEALKQVPEKNK  282

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IK G Y E VEV + M  +VF+G+G  KTRI G+++  DGI TY TATVAIQGD
Sbjct  283   KPFVIYIKEGTYQEYVEVTKDMTHVVFIGDGGKKTRIIGNKNFIDGINTYRTATVAIQGD  342

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A N+GFEN AG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISG
Sbjct  343   YFVAINMGFENFAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISG  402

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FGNA  VFQNC  +VRKPM NQ+C+VTAQGRK+++  + IV+Q   I+++P   +
Sbjct  403   TIDFVFGNALAVFQNCTFVVRKPMKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYS  462

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQ---GTMYLDTCWYAEYQNRGP  1680
                 NK +L RPWK +SRT+IM T IDD++  +G+  WQ   G   +DTC+YAEY N GP
Sbjct  463   VRFENKAYLARPWKNYSRTIIMDTNIDDLIHADGYLPWQGPEGPTGMDTCFYAEYHNTGP  522

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G+   KRV W G   N++ + A  F+P  F      W+    IP+ PG
Sbjct  523   GSDKSKRVNWSGI-WNLNSKAAHSFSPSKFFHG-TNWIQVTGIPYFPG  568



>ref|XP_006342829.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=552

 Score =   513 bits (1322),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 248/530 (47%), Positives = 347/530 (65%), Gaps = 20/530 (4%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             ++T++KSV+ +C PT YK+TCE++L+ AK+  DPK+ IKVAF+ TV +I +A+  +E +K
Sbjct  38    VATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVADIKNALKNTEPIK  97

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +A  DP T DAL  C+EL   +++DL  S  K+ENFD  ++K+  +DLK WLS  +  +E
Sbjct  98    KAASDPYTKDALLACEELFDLAVEDLRGSVAKIENFDFSKIKDIVDDLKSWLSAVVAYEE  157

Query  2744  TCIDAFENTT-GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             TC+D F  +    T  +M  L+ T  ELS N L+M+  F E++           R+LL+ 
Sbjct  158   TCLDGFTKSEYSATRNQMVKLMNTTRELSINALSMVNSFGEMITQT----TGLTRKLLSD  213

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
                          FV+A+ R+L+    ++ K + VV+  G GQYK++ EA+ AVP  N  
Sbjct  214   SDS----------FVEASNRKLVQI--SASKPNAVVSASGGGQYKTIQEAVNAVPKNNPT  261

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNK-DGIGTYHTATVAIQGD  2211
               VI IKAG Y E +E+ +    +VF+GEGPTKT ITG R  K DG  T+HT  + + G+
Sbjct  262   PFVILIKAGTYKEHIEIDKNKPNVVFIGEGPTKTIITGDRGVKHDGYATWHTCALGVAGE  321

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
             GF+ ++IG EN+AG AK QAVALR++AD  + HNC ID YQDTLY HS+RQFYRDCTI+G
Sbjct  322   GFVIKDIGIENTAGPAKEQAVALRINADKAVVHNCKIDGYQDTLYAHSFRQFYRDCTITG  381

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             TVDFIFG+A  VFQNCK+IVRKP   Q CM+TAQGR         V+Q+C+I A+PA  +
Sbjct  382   TVDFIFGDASAVFQNCKLIVRKPGNAQACMITAQGRTVPTSFGGFVIQNCDIKADPAFTS  441

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGA  1674
               PP K +LGRPWKE+S+T+IM + ID  + P GW+ W  T + L TC+YAEYQNRGPGA
Sbjct  442   TTPPIKAYLGRPWKEYSKTIIMQSNIDAFIDPTGWAPWNSTDFGLHTCFYAEYQNRGPGA  501

Query  1673  STDKRVK-WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             +  KRV  W+GY++ IS +   ++T G F+   + WL +  IP+  G ++
Sbjct  502   ALGKRVSTWRGYQKGISGDAINKYTAGKFINTQQPWLPKFDIPYDAGMMK  551



>gb|AES86317.2| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=570

 Score =   513 bits (1322),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 259/530 (49%), Positives = 353/530 (67%), Gaps = 18/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKS  2937
              +++  K+V+ IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++
Sbjct  37    HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             E+  E +KD R+ DALDTCK+L+  SI +  RS + +  FDL+ + +   +LKVWL+GA+
Sbjct  97    EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAV  156

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             T  +TC+D FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F R L
Sbjct  157   TYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRCL  215

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             L        Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP +
Sbjct  216   L--------QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGE  267

Query  2396  NDET-VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
              DET  VI+IK GVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAI
Sbjct  268   EDETPFVIYIKEGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAI  327

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
             Q D F A N+GFENSAG  KHQAVALRV  D  IF NC +D YQDTLY H+ RQFYRDCT
Sbjct  328   QEDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCT  387

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGT+DF+FGNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P 
Sbjct  388   ISGTIDFVFGNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPE  447

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQN  1689
                    +K +L  PWK FSRT+IM TFIDD++ P+G+  W   +G + +DTC+Y EY N
Sbjct  448   FYPVRFDHKSYLACPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHN  507

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              GPG+   KRVKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  508   YGPGSDKSKRVKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  555



>ref|XP_010524549.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 43 
[Tarenaya hassleriana]
Length=585

 Score =   513 bits (1322),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 255/523 (49%), Positives = 350/523 (67%), Gaps = 12/523 (2%)
 Frame = -1

Query  3086  SVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKS--ELLKEADK  2913
             +V  IC+ TDYKETC  SL   + + DP+ LIK AF+  +++I   I+++  +L   A  
Sbjct  65    AVNVICSSTDYKETCVASLETVR-SPDPRNLIKSAFEFAIKSIQKGINQAAIDLRMRAKS  123

Query  2912  DPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCID  2733
             D RT +AL+ C EL++NS++DL +S EK   F   R+++   DL VWLSGAIT Q+TCID
Sbjct  124   DRRTREALENCVELMENSVEDLRKSNEKFAGFAFTRLRDIAEDLGVWLSGAITYQQTCID  183

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF--KRRLLTAETK  2559
              FE    D  E M+ + KTA +L+SNGLA+ T+   LL+   IP + F    R  T E  
Sbjct  184   GFEGIDSDAAEIMERIFKTAQQLTSNGLAIATNLDNLLKFFHIP-IPFLTTSRDSTDEDS  242

Query  2558  ---GeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
                   Q  EFP +V   +RRLL      I+ + VVAKDGSGQY+++ EAL AVP  N+ 
Sbjct  243   IEPVGRQLTEFPDWVTGHSRRLLAEKGGRIRANAVVAKDGSGQYRTITEALAAVPKNNER  302

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYHTATVAIQGD  2211
               VI+IK+GVY E VE+ +KM  ++F+G+GPTKT +TG+ S + + I TY T+TVA+ GD
Sbjct  303   RFVIYIKSGVYAENVELTKKMTHVMFIGDGPTKTIVTGNLSFHPNRISTYRTSTVAVNGD  362

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A+++ FEN+AG   HQAVALRVSAD  +F+NC +D YQDTLY H++RQFYRDC ISG
Sbjct  363   WFMAKDMAFENTAGPEGHQAVALRVSADYAVFYNCRMDGYQDTLYVHTHRQFYRDCRISG  422

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNC+ +VR+PM NQ+C+VTAQGRKDRR    IV+    I+ +P    
Sbjct  423   TIDFVFGDAKAVFQNCQFVVRRPMENQQCIVTAQGRKDRRETTGIVIHKSRIMGDPTYLP  482

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
                 N+ +LGRPWKE+SRT+IM + IDDI+ PEGW  W  T  LDT +YAEYQN GPG+ 
Sbjct  483   VKTKNRAYLGRPWKEYSRTVIMNSLIDDIIDPEGWMKWNETFALDTLYYAEYQNTGPGSD  542

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
                RV+W G + ++S   A Q+TP  FL  +  W+ + ++P++
Sbjct  543   QAGRVRWNGIQ-HLSDSAATQYTPDNFLRGN-TWIPKTRVPYA  583



>ref|XP_003604120.1| Pectinesterase [Medicago truncatula]
Length=614

 Score =   513 bits (1322),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 259/530 (49%), Positives = 353/530 (67%), Gaps = 18/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL---AGAKDTDDPKELIKVAFKVTVENITDAISKS  2937
              +++  K+V+ IC PT YK+ C  SL   A A +  DPKELIK+AF VT+  I + + ++
Sbjct  37    HVASTLKAVQTICHPTTYKKECVESLVVEAEAGNVTDPKELIKIAFNVTINKIGEKLKET  96

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             E+  E +KD R+ DALDTCK+L+  SI +  RS + +  FDL+ + +   +LKVWL+GA+
Sbjct  97    EMFSEIEKDSRSKDALDTCKQLMHLSIGEFTRSLDGISEFDLKHMNQILMNLKVWLNGAV  156

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRL  2577
             T  +TC+D FENTTGD  +KMKHLL ++  +SSN LA++++F + +  + +  + F R L
Sbjct  157   TYMDTCLDGFENTTGDASKKMKHLLTSSIHMSSNVLAIVSNFADTVSDMNVSKL-FGRCL  215

Query  2576  LTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
             L        Q+ E P +V+        T+ +  K ++ VA DGSG +KS+ EAL+ VP +
Sbjct  216   L--------QDSEIPSWVEHRILLDAMTNKSKPKPNVTVALDGSGDFKSINEALKKVPGE  267

Query  2396  NDET-VVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
              DET  VI+IK GVY E VEV + M  IVFVG+G  K+ ITG+++  DG+ TYHT TVAI
Sbjct  268   EDETPFVIYIKEGVYREYVEVLKNMTHIVFVGDGGKKSIITGNKNYMDGVTTYHTTTVAI  327

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
             Q D F A N+GFENSAG  KHQAVALRV  D  IF NC +D YQDTLY H+ RQFYRDCT
Sbjct  328   QEDHFTAINMGFENSAGPQKHQAVALRVQGDKAIFFNCSMDGYQDTLYVHAMRQFYRDCT  387

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ISGT+DF+FGNA  VFQNCK +VRKPM+NQ+C+VTAQGRK+    +AIV+Q   I+A+P 
Sbjct  388   ISGTIDFVFGNAESVFQNCKFVVRKPMSNQQCIVTAQGRKEITAPSAIVIQGGSIVADPE  447

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQN  1689
                    +K +L  PWK FSRT+IM TFIDD++ P+G+  W   +G + +DTC+Y EY N
Sbjct  448   FYPVRFDHKSYLACPWKNFSRTIIMDTFIDDLIHPDGFLPWHTEEGPINMDTCYYVEYHN  507

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              GPG+   KRVKW G   NI+ + A++F P  F    + W+    IP+ P
Sbjct  508   YGPGSDKSKRVKWAGI-YNINTKAAQKFAPSKFFHGGD-WIKDTGIPYYP  555



>ref|XP_007031044.1| Pectinesterase, putative [Theobroma cacao]
 gb|EOY11546.1| Pectinesterase, putative [Theobroma cacao]
Length=623

 Score =   512 bits (1319),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/546 (46%), Positives = 345/546 (63%), Gaps = 30/546 (5%)
 Frame = -1

Query  3089  KSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADK  2913
             K++K +C PTD+++TCE  L A A DT D KEL++ AFK  +++ + A+  S  L++ +K
Sbjct  59    KAIKSVCQPTDFRKTCEEQLRAEAGDTTDIKELVQAAFKAAMKSASQAVQNSTTLRDLEK  118

Query  2912  DPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCID  2733
             DPRT  ALD CK+L+  SI +L++S ++++  D+ +      DLK+WLS  IT Q+TC+D
Sbjct  119   DPRTKKALDVCKQLMTYSIKELKKSLDQIDKLDINKFDRMLADLKIWLSATITNQQTCLD  178

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFK-----------  2586
              F+NTT   GEKMK  L  + ELS NGLA+ T  + +L+ LEI GV+ +           
Sbjct  179   GFKNTTSKAGEKMKKALNVSMELSRNGLAIATEMSAVLKQLEIQGVSRRLLQENLPVLGH  238

Query  2585  --------------RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDG  2448
                           RRLL           +F   +    RRL+   P+ IK DIVVAKDG
Sbjct  239   GDWSTYLDIPMTRRRRLLQDNEPPVLGHGQFE--IQPGVRRLMAAPPSRIKADIVVAKDG  296

Query  2447  SGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSR  2268
             SG + ++  A+ ++P    +  VI+IK GVY E +E   KM  +  +G+G  KTRITG  
Sbjct  297   SGNFTTINAAMSSIPLNATKPFVIYIKEGVYEENLEFGYKMTNVALIGDGKEKTRITGHL  356

Query  2267  SNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQ  2088
             +N DG+ T+ TATVA+ GD F A+NIGFENSAGAAK QAVAL V +D ++F+NC +D YQ
Sbjct  357   NNADGVPTFRTATVAVNGDYFFAKNIGFENSAGAAKFQAVALLVISDFSVFYNCSMDGYQ  416

Query  2087  DTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRG  1908
             DTLY HS RQFYRDCTI+GT+DF+FG+A  VFQNC  +VR P+  Q+C+VTAQGR D R 
Sbjct  417   DTLYVHSKRQFYRDCTITGTIDFVFGDAAAVFQNCTFLVRVPLNGQQCIVTAQGRTDARQ  476

Query  1907  AAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT  1728
               AIV+Q+    A P L         +LGRPW  FSRT+IM +++DD++ PEGW+IW G 
Sbjct  477   PTAIVIQNSTFTAAPELVPVKDKYPTYLGRPWGNFSRTIIMESYLDDLIKPEGWAIWDGP  536

Query  1727  MYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIP  1548
               L+T +Y+E+ N GPG++   RV W+G KR IS   A  FTPG F+     W+   ++P
Sbjct  537   WGLNTSFYSEFNNYGPGSNKTGRVTWRGIKR-ISQATAFGFTPGKFING-AAWIKPRRVP  594

Query  1547  FSPGFL  1530
             ++PGF 
Sbjct  595   YTPGFF  600



>gb|EPS69059.1| hypothetical protein M569_05708 [Genlisea aurea]
Length=1231

 Score =   531 bits (1367),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 252/533 (47%), Positives = 361/533 (68%), Gaps = 15/533 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             ++S + +++  IC  TDY++TC  SLAG  ++ DPK LI+VA + ++ +I +A+  S  +
Sbjct  39    DVSASQRAIMSICDTTDYQQTCLDSLAG-HNSSDPKALIEVAIQSSINHIEEAVKNSTAI  97

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
              +A+K PR   AL+TC+EL   ++DDL+RSF   ++FD+  V +   +LK+WLSGAITQ 
Sbjct  98    HDAEKTPRGRLALETCRELANRAVDDLDRSFGTFDDFDITSVADVPLELKIWLSGAITQL  157

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG----VNFKRR  2580
             ETC+D+FE+  GD G +M+ +L+ + E++SN L M+   +  L S+   G        RR
Sbjct  158   ETCLDSFEDVPGDAGNRMRQVLRESMEMTSNVLTMVAEISTFLDSMGGGGGAQTAVTSRR  217

Query  2579  LLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPF  2400
             LL+ +       E  P +VDA  R+LL   P  +  D++VAKDG+G Y ++ EAL+ +P 
Sbjct  218   LLSTD-------EFLPEWVDAGKRKLLAATPQVVTPDLIVAKDGTGNYPTINEALKNIPK  270

Query  2399  KN-DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
                ++T+V++I+ GVY E+++    M  +  +G+GPTKTRITG  +  DG  TY TATVA
Sbjct  271   SGKNKTIVLYIREGVYEEKLQFNSSMKNLFVIGDGPTKTRITGKSNFIDGTNTYQTATVA  330

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             +QGD FIAR+IGFEN+AG  KHQAVALRVSAD  IF+NCH+DAYQDTLY H+YRQFYR+C
Sbjct  331   VQGDDFIARDIGFENTAGPEKHQAVALRVSADKAIFYNCHMDAYQDTLYAHAYRQFYRNC  390

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEP  1863
              ISGT+DFIFG++  VFQNC ++VRKP+ NQ+C+VTAQGRK+ R     +LQ+C I  + 
Sbjct  391   RISGTIDFIFGDSAAVFQNCTLLVRKPLENQQCVVTAQGRKEIRQPTGFILQNCSIRPDR  450

Query  1862  ALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
              L A     K +LGRPWK++SRT+IM +F+DD++ P GW  W GT  LDT +Y E+ NRG
Sbjct  451   DLYAIRKNIKTYLGRPWKQYSRTVIMESFLDDLICPTGWLPWNGTFALDTLFYTEFNNRG  510

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             P A   +R +W G K   S  + ++FT   FL  +  W+ R Q+P++PGF+ P
Sbjct  511   PAAPKKQRARWPGVKELPSSRI-QRFTAVEFLDGN-GWIPRTQVPYTPGFVFP  561



>ref|XP_009129764.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 58 
[Brassica rapa]
Length=570

 Score =   509 bits (1312),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 249/532 (47%), Positives = 346/532 (65%), Gaps = 16/532 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSEL  2931
              I   SK+V+ +CAPTD+KETC  S   A  ++ +P +LIK++F +T++ I D + KS +
Sbjct  47    NIKMTSKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
               +A  D  T  +L+ C+ L+ ++IDDL + F+    F +++++++  DL+VWLSG+I+ 
Sbjct  107   ELKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISY  166

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFK  2586
             Q+TC+DAFE       + MK + K + EL+SN LAMIT  + +     I        N  
Sbjct  167   QQTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNA  226

Query  2585  RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             R+LL AE       + FP +V   TRRL+      +K ++VVAKDGSGQYKS+ EAL+AV
Sbjct  227   RKLLNAE-------DGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAV  279

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTAT  2229
             P  N    VI+IK GVY E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T++
Sbjct  280   PINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSS  339

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
             + ++GD F+A+N+G EN+AG    QAVALRVSAD  +  NC ID YQDTLY HS+RQFYR
Sbjct  340   LTVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYR  399

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             D TISGTVDFIFG++  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ 
Sbjct  400   DSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIG  459

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQN  1689
             EPA       NK +LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N
Sbjct  460   EPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYEN  519

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              GPG++  +RVKW G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  520   SGPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>emb|CDY33925.1| BnaA02g30620D [Brassica napus]
Length=570

 Score =   508 bits (1309),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/532 (47%), Positives = 346/532 (65%), Gaps = 16/532 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKSEL  2931
              I   +K+V+ +CAPTD+KETC  S   A  ++ +P +LIK++F +T++ I D + KS +
Sbjct  47    NIKMTNKAVEAVCAPTDFKETCVNSFMKASPNSTEPLDLIKLSFNITIQAIKDGVKKSSV  106

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
               +A  D  T  +L+ C+ L+ ++IDDL + F+    F +++++++  DL+VWLSG+I+ 
Sbjct  107   ELKAKADHETKGSLELCETLMNDAIDDLTKCFDNFAGFSVDQIEKFVYDLRVWLSGSISY  166

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----NFK  2586
             Q+TC+DAFE       + MK + K + EL+SN LAMIT  + +     I        N  
Sbjct  167   QQTCMDAFEEVKSILAQDMKDIFKPSKELTSNSLAMITSMSSMFGKSNITEATGDLGNNA  226

Query  2585  RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             R+LL AE       + FP +V   TRRL+      +K ++VVAKDGSGQYKS+ EAL+AV
Sbjct  227   RKLLNAE-------DGFPSWVGPDTRRLMAAPQGGVKPNVVVAKDGSGQYKSINEALKAV  279

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTAT  2229
             P  N    VI+IK GVY E+V V ++M  + F+G+GPTKT+ITGS +   G + TY T++
Sbjct  280   PINNKVPFVIYIKQGVYKEKVVVTKQMYHVTFIGDGPTKTKITGSVNFAIGKVRTYLTSS  339

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
             + ++GD F+A+N+G EN+AG    QAVALRVSAD  +  NC ID YQDTLY HS+RQFYR
Sbjct  340   LTVEGDNFVAKNMGIENTAGPPGGQAVALRVSADCVVIFNCQIDGYQDTLYVHSHRQFYR  399

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             D TISGTVDFIFG++  +FQNC ++VRKPM  Q CMVTAQGR D R   AIVL +C I+ 
Sbjct  400   DSTISGTVDFIFGDSIAIFQNCNIVVRKPMGGQGCMVTAQGRTDVRAPTAIVLHNCRIIG  459

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQN  1689
             EPA       NK +LGRPWKEF+RT++M T I D++ P GW+ W G   L T +YAEY+N
Sbjct  460   EPAYLPVKNINKAYLGRPWKEFARTIVMRTTISDVIDPAGWAAWSGDFALKTLFYAEYEN  519

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              GPG++  +RVKW G +R   P+ A  F PG FL     W+ +  +P+ P  
Sbjct  520   SGPGSNKAQRVKWPGIQRITRPQ-ALGFAPGRFLRGGS-WIPQTGVPYLPNL  569



>ref|XP_011091007.1| PREDICTED: pectinesterase-like [Sesamum indicum]
Length=568

 Score =   508 bits (1307),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 250/535 (47%), Positives = 357/535 (67%), Gaps = 14/535 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             I+ + K++ ++C  T Y++TC  SL+ A  + D K+LI+ +F+  +E + + I +S  L+
Sbjct  38    INPSQKAIVDLCQNTYYQQTCINSLSKATISSDTKDLIRTSFRTAMEELGNVIKQSATLQ  97

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             EA K+P T++A  TC++LL +SI DL+++ E+ E+ D+  +    +D+K WL+GA+T QE
Sbjct  98    EASKNPETAEAYRTCQKLLNDSILDLQKTLERTESVDISNLNLLIDDIKTWLTGALTYQE  157

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-FKRRLLTA  2568
             TC+D FE+  GD  EKM   +K   EL+ NGLA+   F++LL    +P  +   RRLL  
Sbjct  158   TCLDCFEDAEGDAAEKMMEFMKLGKELTINGLALANGFSDLL----LPNDHGAGRRLLAD  213

Query  2567  ETK-GeeqeeEFPG--FVDAATR--RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVP  2403
               K G   + ++ G  +++ ATR  RLL   P  IK  + VAKDGSG + ++ EAL++VP
Sbjct  214   SNKMGLINKADYIGEHWLNYATRTRRLLYAAPGDIKPHVTVAKDGSGNFMTIGEALKSVP  273

Query  2402  FKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVA  2223
                ++T +I+IKAGVY E + V   M  ++F+G+GP  T+ITG++S   G  T+ TATV 
Sbjct  274   LSCNDTYIIYIKAGVYQENIIVGTSMWSVMFIGDGPNATKITGNKSKVGGTETFWTATVG  333

Query  2222  IQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDC  2043
             + GD FIA++IGFENSAGA+ HQAVALR S D +IF NC ID YQDT++ H++RQF+RDC
Sbjct  334   VDGDNFIAKDIGFENSAGASMHQAVALRASGDKSIFFNCQIDGYQDTVFAHNHRQFFRDC  393

Query  2042  TISGTVDFIFGNAPVVFQNCKMIVRKPMANQE-CMVTAQGRKDRRGAAAIVLQSCEILAE  1866
             TISGT+DFIFGNA  VFQNC ++VRKP+ NQ+ C+VTA+GR      +AIVLQ+C IL  
Sbjct  394   TISGTIDFIFGNARAVFQNCTLLVRKPLENQKACLVTAEGRTTINETSAIVLQNCRILPA  453

Query  1865  PALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT-MYLDTCWYAEYQN  1689
             P     +P  K +LGRPWK +SRT+IM + +D +V PEGW+ W  T  +LDTCWYAE  N
Sbjct  454   PEYPVNDPTYKTYLGRPWKPYSRTVIMDSHLDSLVDPEGWAPWNVTSAHLDTCWYAELNN  513

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             +GPGA   +RV W G K+ I+   A  FTPG F++ D  W+    IP+  G + P
Sbjct  514   KGPGADLSRRVAWPGIKK-ITVNEADDFTPGQFMVGD-SWIAGKGIPYDSGLILP  566



>ref|XP_006342828.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=550

 Score =   504 bits (1297),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 247/532 (46%), Positives = 342/532 (64%), Gaps = 24/532 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             E++T++KSV+ +C PT YK+TCE++L+ AK+  DPK+ IKVAF+ TV +I +AI   E +
Sbjct  37    EVATSTKSVESMCQPTPYKQTCEKTLSAAKNVSDPKDYIKVAFEATVTDIKNAIMNIEPI  96

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             K+A  DP T DAL  C+EL   +++DL  S  K+ENFD  ++K+  +DLK WLS  +  +
Sbjct  97    KKAASDPYTKDALHACEELFDLAVEDLRGSVAKIENFDFSKIKDVVDDLKTWLSAVVAYE  156

Query  2747  ETCIDAFENTT-GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             ETC+D F  +    T ++M  L+ T  ELS N L+M+  F E++           R+LL+
Sbjct  157   ETCLDGFTKSEYSATRDEMVKLMNTTRELSINALSMVNSFGEMITQT----TGLTRKLLS  212

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
                           FV+A+ R+LL    A  K + VV+  G GQYK++ EA+ AVP  N 
Sbjct  213   NSDS----------FVEASNRKLLQISAA--KPNAVVSASGGGQYKTIQEAVNAVPKNNP  260

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQ  2217
                +I IKAG Y E +E+ +    +VF+GEG TKT ITG R  K+G G  T+HT  + + 
Sbjct  261   TPFIILIKAGTYKEHIEIEKSKPNVVFIGEGATKTIITGDRGVKNGGGYATWHTCALGVA  320

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF+ R+IG EN+AG  K QAVALR++AD  I +NC ID +QDTLY HS+RQFYRDC I
Sbjct  321   GEGFVIRDIGLENTAGPEKEQAVALRINADKAIVYNCKIDGFQDTLYAHSFRQFYRDCII  380

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DF+FG+A  VFQNC++IVRKP   Q CMVTAQGR         V+Q+C+I  EP  
Sbjct  381   TGTIDFMFGDASAVFQNCQIIVRKPGNTQACMVTAQGRTVPTSVGGFVIQNCDIKPEPGF  440

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGP  1680
              +     K +LGRPWKEFS+T+IM + ID  + P GW+ W  T + + TC+YAEYQNRGP
Sbjct  441   PST---TKAYLGRPWKEFSKTIIMQSNIDAFIDPSGWAPWNTTDFGIHTCFYAEYQNRGP  497

Query  1679  GASTDKRVK-WKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQ  1527
             GA+ DKRV  W+GY+R IS +   QFT G F+  +  WL +  IP+  G ++
Sbjct  498   GAALDKRVSTWRGYQRGISGDAINQFTAGKFINTESPWLPKGDIPYDAGMMK  549



>ref|XP_004984909.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Setaria italica]
Length=564

 Score =   501 bits (1289),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 259/539 (48%), Positives = 343/539 (64%), Gaps = 15/539 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DYKETCER+L A A +   P +L KV FKVT + I  A  +S +
Sbjct  36    EMSTSVKSIKSFCQPVDYKETCERALEATAGNATSPTDLAKVIFKVTSDRIEKAARESAV  95

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L +   DPRTS AL  CKELL  +IDDL+ +F+++  F++   K   +DLK WLS A+T 
Sbjct  96    LNDLKNDPRTSGALRNCKELLDYAIDDLKTTFDRLGGFEMTNFKAAVDDLKTWLSSALTY  155

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT D   KM+  L T+ EL+ N LA++  F+E L SL +P  +F RRLL 
Sbjct  156   QETCLDGFENTTTDAAAKMRRALNTSQELTENILALVDEFSETLASLGLP--SFHRRLLA  213

Query  2570  AETKGeeqeeEFPGFV-DAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPF  2400
                         P ++ D A RR+L   P S   K D+ VA DGSG +K++  AL  VP 
Sbjct  214   GNGGA-------PSWMTDDAKRRVLKATPGSPDFKPDVTVAADGSGDFKTINAALAKVPT  266

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             K+    V+++KAG Y E V VPR +  +V VG+G TKT +TGS+S    I T  TAT+ +
Sbjct  267   KSATAYVMYVKAGTYKEYVSVPRNVTNLVVVGDGATKTVVTGSKSFAMNITTKDTATMEV  326

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              G+GF  R +G EN+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+ RQ+YRDC 
Sbjct  327   IGNGFQMRGVGVENTAGARNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCV  386

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             ++GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C +   P 
Sbjct  387   VTGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTVEPHPE  446

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
              +++    K +LGRPWKE SRTL + + I   V P+GW  W G   L TC+YAE +N GP
Sbjct  447   FESSAGRLKTYLGRPWKEHSRTLYIQSEIGGFVDPQGWLPWLGDFGLSTCYYAEVENHGP  506

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
             GA T KR KWKG K NI+ + A+Q       +  + WL +  +PF PG L P N+  ++
Sbjct  507   GADTSKRAKWKGVK-NITYQQAQQKYTVERFIQGQTWLPKLGVPFIPGLL-PQNQTGRI  563



>ref|XP_003529556.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=582

 Score =   501 bits (1290),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 264/573 (46%), Positives = 366/573 (64%), Gaps = 22/573 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaat------vsvgssggGEISTASKSVKEICAPTDYKET  3045
             E+ KK+AV  V+SI LVA VVAA         V   GG  I+ + ++ + IC   +YKET
Sbjct  10    EKKKKIAVLSVSSILLVAMVVAAAVGIRDGAEVVEEGGDTIAKSQRNQQVICESAEYKET  69

Query  3044  CERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLK  2865
             C +SLA A  T D KELI  AF  T E I + I  S L  E   D  T  A D CKE+L 
Sbjct  70    CHKSLAKASGTSDLKELIITAFNATAEEIANQIKNSTLYHELATDHMTKQATDICKEVLG  129

Query  2864  NSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              ++DD+ RS   +E FDL ++ +Y  DLKVW++G +  Q+TC+D FENT+ + G+ M  +
Sbjct  130   YAVDDIRRSVHTLEKFDLNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTSSEAGKTMAKV  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPG--VNFKRRLLTAETKGeeqeeEFPGFVDAAT  2511
             L  + ELS+N L ++   + L + L +    VN  R+LL+ ET      + FP +V    
Sbjct  190   LNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLSEET---ALVDGFPTWVSEGQ  246

Query  2510  RRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVP  2334
             RRLL   DP   K D+VVA+DGSGQ K++ EAL+ VP KN +  VI+IKAG+YNE + + 
Sbjct  247   RRLLQAVDP---KPDVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYIKAGIYNEYIIMN  303

Query  2333  RKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQ  2154
             + +  +  +G+GPTKTRITGS++  DG+ TY+TAT  +    F+A+NIGFEN+AGA KHQ
Sbjct  304   KHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNAANFMAKNIGFENTAGAEKHQ  363

Query  2153  AVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMI  1974
             AVALRV+AD  +F+NC++D +QDTLYT S RQFYRDCT++GT+DF+FG+A  VFQNCK I
Sbjct  364   AVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFI  423

Query  1973  VRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRT  1794
             VR P+ NQ+C+VTA GR      +A+V QSC    EP + A   P   +LGRPW+ +++ 
Sbjct  424   VRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVLALT-PKIAYLGRPWRLYAKV  482

Query  1793  LIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVA  1614
             +IM + IDDI VPEG+  W G+ + DT  Y E+ NRGPGA+T  R+ W G+K  ++P  A
Sbjct  483   VIMDSQIDDIFVPEGYMAWMGSAFKDTSTYYEFNNRGPGANTIGRITWPGFKV-LNPIEA  541

Query  1613  KQFTPGPFLM-----ADEQWLGRAQIPFSPGFL  1530
              ++ PG F         + W+  + +P+S G L
Sbjct  542   VEYYPGKFFQIANSTERDSWILGSGVPYSLGPL  574



>gb|KHN02946.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=555

 Score =   499 bits (1284),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/533 (46%), Positives = 345/533 (65%), Gaps = 16/533 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             I+ + ++ + IC   +YKETC +SLA A  T D KELI  AF  T E I + I  S L  
Sbjct  23    IAKSQRNQQVICESAEYKETCHKSLAKASGTSDLKELIITAFNATAEEIANQIKNSTLYH  82

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             E   D  T  A D CKE+L  ++DD+ RS   +E FDL ++ +Y  DLKVW++G +  Q+
Sbjct  83    ELATDHMTKQATDICKEVLGYAVDDIRRSVHTLEKFDLNKLNDYAYDLKVWIAGTLAHQQ  142

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG--VNFKRRLLT  2571
             TC+D FENT+ + G+ M  +L  + ELS+N L ++   + L + L +    VN  R+LL+
Sbjct  143   TCLDGFENTSSEAGKTMAKVLNASLELSNNALDIVNGVSSLFKGLNLSSFSVNSNRKLLS  202

Query  2570  AETKGeeqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
              ET      + FP +V    RRLL   DP   K D+VVA+DGSGQ K++ EAL+ VP KN
Sbjct  203   EET---ALVDGFPTWVSEGQRRLLQAVDP---KPDVVVAQDGSGQVKTIHEALKLVPKKN  256

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQG  2214
              +  VI+IKAG+YNE + + + +  +  +G+GPTKTRITGS++  DG+ TY+TAT  +  
Sbjct  257   KKPFVIYIKAGIYNEYIIMNKHLTYVTMIGDGPTKTRITGSKNYVDGVQTYNTATFGVNA  316

Query  2213  DGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTIS  2034
               F+A+NIGFEN+AGA KHQAVALRV+AD  +F+NC++D +QDTLYT S RQFYRDCT++
Sbjct  317   ANFMAKNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVT  376

Query  2033  GTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALK  1854
             GT+DF+FG+A  VFQNCK IVR P+ NQ+C+VTA GR      +A+V QSC    EP + 
Sbjct  377   GTIDFVFGDAVAVFQNCKFIVRMPLENQQCLVTAGGRSKIDSPSALVFQSCVFTGEPNVL  436

Query  1853  AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGA  1674
             A   P   +LGRPW+ +++ +IM + IDDI VPEG+  W G+ + DT  Y E+ NRGPGA
Sbjct  437   ALT-PKIAYLGRPWRLYAKVVIMDSQIDDIFVPEGYMAWMGSAFKDTSTYYEFNNRGPGA  495

Query  1673  STDKRVKWKGYKRNISPEVAKQFTPGPFLM-----ADEQWLGRAQIPFSPGFL  1530
             +T  R+ W G+K  ++P  A ++ PG F         + W+  + +P+S G L
Sbjct  496   NTIGRITWPGFKV-LNPIEAVEYYPGKFFQIANSTERDSWILGSGVPYSLGPL  547



>gb|KFK38146.1| hypothetical protein AALP_AA3G075300 [Arabis alpina]
Length=565

 Score =   498 bits (1282),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 244/531 (46%), Positives = 356/531 (67%), Gaps = 20/531 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETC-ERSLAGAKDTDDPKELIKVAFKVTVENITDAISKS--  2937
             EI   +K+V+ +CAPTDYKETC +R +    ++ +P +LIK++F VT+++I +++ K+  
Sbjct  43    EIRKTTKAVQAVCAPTDYKETCFDRMMNAEPESTEPLDLIKLSFNVTIQSIHESLQKASE  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++   A K+P    A   C+ ++ ++IDDL +SF++   F L R++ Y  DL+VWLSG+I
Sbjct  103   DVKARASKNPAAKGAFQLCEHVMLDAIDDLRKSFDR--GFSLARIEGYVEDLRVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TCID+FE    +  ++M ++ KT+ EL+SN LAM+T  + LL +  I G+     +
Sbjct  161   AFQQTCIDSFEEIKSNLLQEMINIFKTSRELTSNSLAMVTGMSTLLPNSNITGLTGVLAS  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LL+ E       +  P +V    RRL+      +K + VVA+DGSGQ+K++ +AL 
Sbjct  221   YARKLLSTE-------DGIPTWVGPEARRLMVAQIGPVKANAVVAQDGSGQFKTITDALN  273

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             AVP  +    +I IK G+Y E+V V +KM  + F+G+GPTKT ITGS + + G + T+ T
Sbjct  274   AVPKGDTLPFIIHIKEGIYKEKVIVTKKMPHVTFIGDGPTKTVITGSLNFRIGKVKTFLT  333

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             AT+ IQG+ F A++IG EN++G    QAVALRVSAD  +F+NC ID YQ+TLY HS+RQF
Sbjct  334   ATITIQGNHFTAKSIGIENTSGPKGGQAVALRVSADYAVFYNCQIDGYQNTLYVHSHRQF  393

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             YRDCT+SGTVDFIFG+A  + QNCK++VRKP  +Q CMVTAQGR D R    IVL +C I
Sbjct  394   YRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKRSQSCMVTAQGRSDVREPTGIVLHNCHI  453

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
             + +PA       NK +LGRPW++FSRT+IM T IDD++ P GW +WQG   L T +YAE+
Sbjct  454   VGDPAYIPVKSRNKAYLGRPWRQFSRTIIMKTTIDDVIDPAGWLLWQGESALKTLFYAEH  513

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              N GPG++  +RVKW G K+ +SPE A  FT   FL+ D  W+ +  +P++
Sbjct  514   LNIGPGSNQAQRVKWPGLKK-LSPEEALMFTGNRFLLGDT-WIPQTHVPYT  562



>ref|XP_002465396.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
 gb|EER92394.1| hypothetical protein SORBIDRAFT_01g037900 [Sorghum bicolor]
Length=568

 Score =   496 bits (1278),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 253/540 (47%), Positives = 340/540 (63%), Gaps = 15/540 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DY+ETCE++L A A +   P +L K  FKVT + I  A+ +S +
Sbjct  38    EMSTSVKSIKSFCQPVDYRETCEKALRAAAGNATSPTDLAKAIFKVTSDRIEKAVRESAV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E   DPRT  ALD C+ELL  +IDDL+ +F+++  F++   K   +DL+ WLS A+T 
Sbjct  98    LNELKNDPRTKGALDNCRELLDYAIDDLKTTFDRLGGFEMTNFKSAVDDLRTWLSSALTY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT     KM+  L ++ EL+ N LA++  F+E L +L IP  +F RRLL 
Sbjct  158   QETCLDGFENTTTAAAGKMRRALNSSQELTENILALVDEFSETLANLGIP--SFHRRLLA  215

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                 G       P ++  A RRL    P     K D+ VAKDGSG ++++  AL  VP K
Sbjct  216   DHAGG------VPSWMPDAKRRLRKVSPGDKGFKPDVTVAKDGSGDFRTINAALAKVPVK  269

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             +  T V+++KAG Y E V VPR +  +V VG+G TKT ITG +S    I T  TAT+   
Sbjct  270   SAATYVMYVKAGTYREYVSVPRNVTNLVMVGDGATKTVITGDKSFMMNITTKDTATMEAL  329

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF+ R IG EN+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+ RQ+YR+C I
Sbjct  330   GNGFLMRGIGVENTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRECVI  389

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR A   V+ +C I   P  
Sbjct  390   TGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSAGGTVIHNCTIEPHPEF  449

Query  1856  K--AANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRG  1683
             +  A +   + FLGRPWKE SRTL + + I   + P+GW  W G   L TC+YAE +NRG
Sbjct  450   EKSAGDGKLRTFLGRPWKEHSRTLYIQSEIGGFIDPKGWLPWLGDFGLSTCYYAEVENRG  509

Query  1682  PGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQAKL  1503
              GA T KRVKW+G K        +++T   F+   + WL +  +PF PG L P N+  ++
Sbjct  510   AGADTSKRVKWRGVKNITYQHALQKYTVESFIQG-QHWLPQLGVPFIPGLL-PQNQSGRI  567



>gb|KHG19164.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=545

 Score =   493 bits (1268),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/534 (45%), Positives = 353/534 (66%), Gaps = 19/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             EIS+++K+V+ +C PT+YKETC++SLA + ++ D KELI+  F+  +  I + ++ S  +
Sbjct  20    EISSSNKAVQALCQPTNYKETCQKSLA-SSNSSDVKELIRTGFQAGLVEIKNVLAHSVTV  78

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +E  KD     AL  C+E+L  +IDD ++SF+ +  +D+ ++ +Y  +LK WLSGA T Q
Sbjct  79    QELIKDKNNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKTWLSGAFTSQ  138

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN------FK  2586
             +TCID+F  ++ ++ +KM+ +LKT+ E++SN LAM+   + +++ L IP V         
Sbjct  139   QTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDTTGVN  198

Query  2585  RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             R+LL+AE        + P ++  A R+LL   P  +K ++VVAKDGSG+Y ++ +AL  V
Sbjct  199   RKLLSAE--------DMPEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEV  250

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTA  2232
             P K+ +  VI IKAG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TA
Sbjct  251   PVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTA  310

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV + G GF+A++IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y
Sbjct  311   TVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLY  370

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
              +C I+GTVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I 
Sbjct  371   SNCLITGTVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTIS  430

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
               P   +    NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ 
Sbjct  431   GAPDYISVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFG  490

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPGA T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  491   NRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  542



>ref|XP_003534836.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
 gb|KHN26531.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=579

 Score =   494 bits (1271),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 262/575 (46%), Positives = 367/575 (64%), Gaps = 25/575 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssgg--------GEISTASKS-VKEICAPTDY  3054
             EQ ++ AV G++SI LVA V A  V++   G           + TA ++ V+ IC  T+Y
Sbjct  8     EQKRRFAVLGISSILLVAMVAAVAVTINRGGNKGEEGDDESRVQTAQRNNVEMICNSTEY  67

Query  3053  KETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTC  2880
             KETC++SL  A + +  D KELIK AF  +   + + I  S L KE  KD  T  A+D C
Sbjct  68    KETCKKSLEKASSDENADTKELIKAAFNASAVELLNHIKNSTLYKELAKDNMTRQAMDIC  127

Query  2879  KELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGE  2700
             KE+   +ID +++S E ++ F+  ++ EY  DLKVWL+G+++ Q+TC+D FENT    GE
Sbjct  128   KEVFDYAIDGVQKSIETLDKFEFIKLSEYVYDLKVWLTGSLSHQQTCLDGFENTNTKAGE  187

Query  2699  KMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-VNFKRRLLTAETKGeeqeeEFPGFV  2523
             KM   +  + ELSSN L MI   + L++ L I   V   RRLL+  +K E   + +P +V
Sbjct  188   KMAKAMNASLELSSNALDMINFISGLIKDLNISSLVGNNRRLLS--SKEEALVDGYPSWV  245

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL    +SIK +  VAKDGSGQ+ ++ +AL+ VP KN +  VI++KAGVY E V
Sbjct  246   SEGQRRLLGL--SSIKPNATVAKDGSGQFATLTDALKTVPPKNAQAFVIYVKAGVYKENV  303

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              V   M  +  +G+GP KTR +GS + KDG+ T+++AT A+    F+A+++GFEN+AGA 
Sbjct  304   NVGMDMTHVTVIGDGPKKTRFSGSLNYKDGVQTFNSATFAVNAANFMAKDVGFENTAGAE  363

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV+AD  +F+NC +DA+QDTLY  S RQFYRDCTI+GT+DFIFG+A  VFQNC
Sbjct  364   KHQAVALRVTADQAVFYNCQMDAFQDTLYVQSQRQFYRDCTITGTIDFIFGDAFGVFQNC  423

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV-FLGRPWKE  1806
             K+IVR P+ NQ+CMVTA GR     A+ +V QSC    EP  + A    K+ +LGRPW+ 
Sbjct  424   KLIVRPPLPNQQCMVTAGGRNKVDSASGLVFQSCHFSGEP--QVAQLTRKIAYLGRPWRP  481

Query  1805  FSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNIS  1626
             +S+ +IM + ID+I +PEG+  W G+ + +TC Y EY N+GPGA T +RVKW G K   S
Sbjct  482   YSKVVIMDSQIDNIFLPEGYMAWMGSQFKETCIYYEYNNKGPGADTSQRVKWPGVKTITS  541

Query  1625  PEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              E  K + PG F         + W+  A++P+S G
Sbjct  542   VEATKYY-PGRFFELVNSTERDSWIVDARVPYSLG  575



>gb|KDO39972.1| hypothetical protein CISIN_1g039111mg [Citrus sinensis]
Length=595

 Score =   494 bits (1271),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 253/544 (47%), Positives = 356/544 (65%), Gaps = 19/544 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  51    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  110

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  111   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDRQARYKMGPMINNLKTWLSST  170

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D FENTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  171   ITYQETCLDGFENTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  230

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  231   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  290

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  291   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  350

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV++ G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  351   VDGTPTMHTATVSVLGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  410

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  411   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  470

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  471   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  530

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+    +P+ 
Sbjct  531   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYV  589

Query  1541  PGFL  1530
              GF+
Sbjct  590   SGFV  593



>ref|XP_006649944.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Oryza brachyantha]
Length=565

 Score =   492 bits (1266),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 247/530 (47%), Positives = 336/530 (63%), Gaps = 15/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DY+ETCE +L A A +  +P +L K  FK T E I  A+ +S +
Sbjct  38    ELSTSVKSIKSFCQPVDYRETCESTLEASAGNASNPTDLAKAIFKATSEKIEQAVRESTV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L +   D RTS AL  CKELL  +IDDL+ +F+K+  F++   K   +DLK WLS A+T 
Sbjct  98    LNDLKNDQRTSGALKDCKELLDYAIDDLKTTFDKLGGFEMSNFKHAVDDLKTWLSSALTY  157

Query  2750  QETCIDAFENTTG-DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
             QETC+D FEN T  D  EKMK+ LK++ EL+ N LA++  F + L +L++P  +F RRLL
Sbjct  158   QETCLDGFENATSTDASEKMKNALKSSQELTENILALVDQFGDTLANLDLP--SFSRRLL  215

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPF  2400
               +          PG++  A RRLL   P +   K D+ VA DGSG +K++ EAL  VP 
Sbjct  216   GDD--------GLPGWISDAKRRLLQASPGAPEFKPDVTVAADGSGDFKTINEALAKVPI  267

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             K   T V+++KAG Y E V V R +  +V +G+G TKT ITG++S    I T  TAT+  
Sbjct  268   KATATYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEA  327

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              G+GF  R IG EN+AGA  HQAVALRV +D ++F+ C  D YQDTLYTH+ RQ+YR+CT
Sbjct  328   IGNGFFMRGIGVENTAGAKNHQAVALRVQSDQSVFYQCQFDGYQDTLYTHTSRQYYRECT  387

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             I+GT+DFIFGNA VVFQNC +  R+ M NQ+ +VTAQGRK++  A   V+ +C I     
Sbjct  388   ITGTIDFIFGNAQVVFQNCLIQARRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHAD  447

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
              KA     + FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE +NRG 
Sbjct  448   FKADAAKFRTFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGA  507

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GA   KR KW+G K     +  +++T   F+   +QW+ +  +PF PG L
Sbjct  508   GADMSKRAKWRGVKTVTYQQAQQKYTVERFIQG-QQWIPKYGVPFIPGLL  556



>gb|AEL79481.1| pectin methylesterase-like protein [Capsicum annuum]
Length=553

 Score =   491 bits (1263),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 254/565 (45%), Positives = 359/565 (64%), Gaps = 25/565 (4%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvv----aatvsvgssggGEISTASKSVKEICAPTDYKETCERSL  3030
             KKV + GVASI +VACVV      T     +    ++T++KSV+ +C PT YK+TCE++L
Sbjct  3     KKVIIGGVASILVVACVVAACVTLTKHDAETSSKGLATSTKSVQSMCQPTPYKQTCEKTL  62

Query  3029  AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDD  2850
             + AK+  DPK+ IKVAF+ TV  + + I   E +K+A  DP T DAL  C++L   + +D
Sbjct  63    SIAKNVSDPKDYIKVAFEATVTELKNIIKSIEPIKKAASDPYTKDALLACEQLFDLAAED  122

Query  2849  LERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAF-ENTTGDTGEKMKHLLKTA  2673
             L  S  K++NFD+  +K+  +DLK WLS  +  ++TC+D F +    +T EKM  L+ T 
Sbjct  123   LRTSITKIQNFDISMIKDVVDDLKTWLSAVLAYEDTCLDGFTKKEYSETREKMAKLMNTT  182

Query  2672  NELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTT  2493
              EL+ N L M+  F +++           R+LL+               ++A+ R+LL  
Sbjct  183   QELTLNVLYMVDSFGQMITQT----TGLTRKLLSNS----------DSIIEASNRKLLQI  228

Query  2492  DPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIV  2313
               +S + + VV+ DGSGQYK++ +A+ AVP KN +  VI IK G+Y E +E+ +    +V
Sbjct  229   --SSAQPNAVVSADGSGQYKTIKDAINAVPKKNTKPFVILIKEGIYKENIEIEKDKLNVV  286

Query  2312  FVGEGPTKTRITGSRSNKDGIG--TYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
              +GEGPTKT ITG  + K+G G  T+HT+T+ + G GF+ ++IG +N+AG  K QAVALR
Sbjct  287   LIGEGPTKTIITGDNAVKNGGGMTTWHTSTLGVSGFGFVMKDIGIQNTAGPEKEQAVALR  346

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD    +NC ID YQDTLY HS RQFYRDC I+GT+DF+FG A  VFQNCK+IVRKP 
Sbjct  347   VNADKAAVYNCKIDGYQDTLYAHSNRQFYRDCNITGTIDFVFGAAAAVFQNCKLIVRKPG  406

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
               Q CM+TAQG  D +     V+Q+C+I AEP   A NP  K +LGRPWK +SRT+IM +
Sbjct  407   DTQNCMMTAQGNVDVKSTGGFVIQNCDISAEPEFLATNPAIKAYLGRPWKMYSRTIIMQS  466

Query  1778  FIDDIVVPEGWSIWQGTMY-LDTCWYAEYQNRGPGASTDKRVK-WKGYKRNISPEVAKQF  1605
              ID  +  EGW+ W  T + + TC+YAEYQNRGPGA+ DKRV  W+GY+++IS +   +F
Sbjct  467   NIDAFINSEGWAPWNTTDFGIHTCFYAEYQNRGPGATLDKRVSHWRGYQKDISGDTINKF  526

Query  1604  TPGPFLMADEQWLGRAQIPFSPGFL  1530
             T   F+  + QWL  A IP+    +
Sbjct  527   TADKFINTNPQWLPVADIPYEADMM  551



>dbj|BAC42959.2| putative pectin methylesterase [Arabidopsis thaliana]
Length=568

 Score =   491 bits (1264),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 256/576 (44%), Positives = 369/576 (64%), Gaps = 28/576 (5%)
 Frame = -1

Query  3218  MGSP-EQNKKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDY  3054
             MGS  ++ KK  V G  S FLV  VV+  V        +    I   +K+V+ +CAPTD+
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  3053  KETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEADKDPRTSDALDT  2883
             K+TC  SL GA  D+DDP +LIK+ FKVT+++I +++ K+  ++  EADK+P    A + 
Sbjct  61    KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAEADKNPEAKGAFEL  120

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C++L+ ++IDDL++  +    F +++++ +  DL+VWLSG+I  Q+TC+D+F     +  
Sbjct  121   CEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNLM  178

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGeeqeeE  2538
             + M  + KT+ ELSSN LAM+T  + L+ +  + G+      + R+LL+ E       + 
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTE-------DS  231

Query  2537  FPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
              P +V    RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I IK
Sbjct  232   IPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIK  291

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNI  2190
              G+Y E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+NI
Sbjct  292   EGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNI  351

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             G EN+AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIFG
Sbjct  352   GIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFG  411

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK 
Sbjct  412   DAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKA  471

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW
Sbjct  472   YLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKW  531

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  532   PGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>ref|XP_006472135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Citrus sinensis]
Length=599

 Score =   492 bits (1266),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 253/544 (47%), Positives = 355/544 (65%), Gaps = 19/544 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  55    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  115   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D F NTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV+I G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  415   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  474

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  475   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  534

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+    +P+ 
Sbjct  535   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGVPYV  593

Query  1541  PGFL  1530
              GF+
Sbjct  594   SGFV  597



>gb|KEH32301.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=582

 Score =   491 bits (1264),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 258/574 (45%), Positives = 358/574 (62%), Gaps = 27/574 (5%)
 Frame = -1

Query  3212  SPEQNKKVAVTGVASIFLvacvvaatvsvgssggGE------ISTASKSVKEICAPTDYK  3051
             S    KK A+ GV+SI L+A V A  V V  +G  E      I+ + K+VK +C  T+YK
Sbjct  10    SHASKKKFAILGVSSILLIAMVAAVAVGVNDAGQVESEGDNQITKSQKNVKVLCGTTEYK  69

Query  3050  ETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKEL  2871
             +TCE+SLA   +  D KELIK AF  T E +   I  S L KE   +  T  A+D CKE+
Sbjct  70    QTCEKSLAKTGN-KDMKELIKQAFNATAEELVKQIHNSTLYKELATNDMTKQAMDICKEV  128

Query  2870  LKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMK  2691
             L  ++DD+ +S   ++ FDL ++ E   DLKVWLSG +  Q+TC+D FENTT   G+ M 
Sbjct  129   LGYAVDDVHQSIHSLDKFDLNKIDEIAYDLKVWLSGTLANQQTCLDGFENTTTHAGQTMA  188

Query  2690  HLLKTANELSSNGLAMITHFTELLQSLEIP----GVNFKRRLLTAETKGeeqeeEFPGFV  2523
              +L  + ELS+N L +I   +  ++ L +      +N  R+LL+ +          P +V
Sbjct  189   KVLNASLELSNNALDIINGLSGFVKDLNLSSFASALNNNRKLLSED--------GLPSWV  240

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
               + R+LL   P ++K ++VVA+DGSGQ+K++ EAL  VP KN    VI +KAG+Y E V
Sbjct  241   SQSQRKLLAA-PQNVKPNVVVAQDGSGQFKTLTEALATVPKKNKVPFVIHVKAGIYKEYV  299

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
              +    + +  +G+GP KT  TGS+S  DG+ TY+TAT ++    F A N+GFENSAGAA
Sbjct  300   ALDNHRDHVTIIGDGPKKTIFTGSKSYGDGVQTYNTATFSVNSAHFTAFNVGFENSAGAA  359

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVALRV+AD  +F+NC ++ YQDTLYT S RQFYRDCTI+GT+DF+FG+A  VFQNC
Sbjct  360   KHQAVALRVTADKALFYNCEMNGYQDTLYTQSKRQFYRDCTITGTIDFVFGDAVGVFQNC  419

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
             K+IVRKPMA Q+CMVTA GR      +A+V Q+C    EP +     P   +LGRPW+ F
Sbjct  420   KLIVRKPMATQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYLGRPWRNF  478

Query  1802  SRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISP  1623
             S+ +I+ + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW G K  IS 
Sbjct  479   SKVVIVDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-TISA  537

Query  1622  EVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
               A ++ PG F       A + W+  + IP++ G
Sbjct  538   GEAAKYYPGKFYEIANATARDDWITESGIPYAMG  571



>gb|KHG22352.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   490 bits (1262),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 239/534 (45%), Positives = 351/534 (66%), Gaps = 19/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             EIS+++K+V+ +C PT+YKETC++SLA + ++ D KELI+  F+  +  I + +  S  +
Sbjct  36    EISSSNKAVQALCQPTNYKETCQKSLA-SSNSSDVKELIRTGFQAGLVEIKNVLGHSVTV  94

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +E  KD     AL  C+E+L  +IDD ++SF+ +  +D+ ++ +Y  +LK WLSGA T Q
Sbjct  95    QELTKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKTWLSGAFTSQ  154

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN------FK  2586
             +TCID+F  ++ ++ +KM+ +LKT+ E++SN LAM+   + +++ L IP V       F 
Sbjct  155   QTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFN  214

Query  2585  RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             R+LL+ E        +   ++  A R+LL   P  +K ++VVAKDGSG+Y ++ +AL  V
Sbjct  215   RKLLSTE--------DMLEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEV  266

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTA  2232
             P K+ +  VI IKAG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TA
Sbjct  267   PVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTA  326

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV + G GF+A++IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y
Sbjct  327   TVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLY  386

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
              +C I+GTVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I 
Sbjct  387   SNCLITGTVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTIS  446

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
               P   +    NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ 
Sbjct  447   GAPDYISVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFG  506

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPGA T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  507   NRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>ref|XP_003550542.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Glycine 
max]
Length=579

 Score =   490 bits (1261),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 245/529 (46%), Positives = 339/529 (64%), Gaps = 16/529 (3%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             I  + ++V+ IC   +YKETC +SLA A +T D KELI  AF  T E I   I  S L  
Sbjct  51    IVKSQRNVQVICESAEYKETCHKSLAKASETSDLKELIITAFNATAEEIAKQIKNSTLYH  110

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             E   D     A+D CKE+L  ++DD+ +S  K+E F+L ++ +Y  DLKVW++G +  Q+
Sbjct  111   ELATDDMNKQAMDICKEVLGYAVDDMHQSVRKLEEFELNKLNDYAYDLKVWIAGTLAHQQ  170

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKR-RLLTA  2568
             TC+D FENTT + G+ M  +L T+ ELS+N L ++   + L + L +   +    R L +
Sbjct  171   TCLDGFENTTNEAGKTMARVLNTSLELSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLS  230

Query  2567  ETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDE  2388
             E  G      FP +V    RRLL    A  K D+VVA+DGSGQ K++ EAL+ VP KN +
Sbjct  231   EVDG------FPTWVSEGQRRLL--QAADAKADVVVAQDGSGQVKTIHEALKLVPKKNKK  282

Query  2387  TVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDG  2208
               VI++KAGVY E + + + +  +  +G+GPTKTRITGS++  DGI TY+TAT  +    
Sbjct  283   PFVIYVKAGVYQEYIMINKHLTHVTMIGDGPTKTRITGSKNYVDGIKTYNTATFGVNAAN  342

Query  2207  FIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGT  2028
             F+A NIGFEN+AGA KHQAVALRV+AD  +F+NC++D +QDTLYT S RQFYRDCT++GT
Sbjct  343   FMAMNIGFENTAGAEKHQAVALRVTADKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGT  402

Query  2027  VDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAA  1848
             +DF+FG+A  VFQNCK IVRKPM NQ+CMVTA GR      +A+V QSC    EP + A 
Sbjct  403   IDFVFGDAVAVFQNCKFIVRKPMENQQCMVTAGGRTKIDSPSALVFQSCIFTGEPDVFAL  462

Query  1847  NPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAST  1668
             + P   +LGRPW+ +++ +IM + IDDI VPEG+  W G+ + DT  Y E+ NRG GA+T
Sbjct  463   S-PKIAYLGRPWRVYAKVVIMDSQIDDIFVPEGYMPWMGSAFKDTSTYYEFNNRGFGANT  521

Query  1667  DKRVKWKGYKRNISPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
               R+ W G+K  I+P  A  + PG F         + W+  + +P+S G
Sbjct  522   QGRITWPGFKV-ITPIEATDYYPGKFFEIANSTERDSWIVGSGVPYSLG  569



>ref|NP_187339.2| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
 sp|Q8GXA1.3|PME23_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
23; Includes: RecName: Full=Pectinesterase inhibitor 23; AltName: 
Full=Pectin methylesterase inhibitor 23; Includes: RecName: 
Full=Pectinesterase 23; Short=PE 23; AltName: Full=Pectin 
methylesterase 23; Short=AtPME23; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABO38766.1| At3g06830 [Arabidopsis thaliana]
 gb|AEE74464.1| probable pectinesterase/pectinesterase inhibitor 23 [Arabidopsis 
thaliana]
Length=568

 Score =   489 bits (1259),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 255/576 (44%), Positives = 369/576 (64%), Gaps = 28/576 (5%)
 Frame = -1

Query  3218  MGSP-EQNKKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDY  3054
             MGS  ++ KK  V G  S FLV  VV+  V        +    I   +K+V+ +CAPTD+
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  3053  KETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEADKDPRTSDALDT  2883
             K+TC  SL GA  D+DDP +LIK+ FKVT+++I +++ K+  ++  +ADK+P    A + 
Sbjct  61    KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFEL  120

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C++L+ ++IDDL++  +    F +++++ +  DL+VWLSG+I  Q+TC+D+F     +  
Sbjct  121   CEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNLM  178

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----FKRRLLTAETKGeeqeeE  2538
             + M  + KT+ ELSSN LAM+T  + L+ +  + G+      + R+LL+ E       + 
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLTGLTGALAKYARKLLSTE-------DS  231

Query  2537  FPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIK  2367
              P +V    RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I IK
Sbjct  232   IPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIK  291

Query  2366  AGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNI  2190
              G+Y E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+NI
Sbjct  292   EGIYKEKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNI  351

Query  2189  GFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFG  2010
             G EN+AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIFG
Sbjct  352   GIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFG  411

Query  2009  NAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV  1830
             +A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK 
Sbjct  412   DAKCILQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKA  471

Query  1829  FLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKW  1650
             +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW
Sbjct  472   YLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKW  531

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  532   PGIKK-LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  565



>tpg|DAA44942.1| TPA: hypothetical protein ZEAMMB73_754551 [Zea mays]
Length=566

 Score =   489 bits (1259),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 245/529 (46%), Positives = 331/529 (63%), Gaps = 12/529 (2%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DY+ETCE++L A A +   P EL K  FKVT + I  A+ +S L
Sbjct  38    EMSTSVKSIKSFCQPVDYRETCEKALEAAAGNATSPTELAKAIFKVTSDRIAKAVRESAL  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E   D RTS AL  C ELL  +IDDL  +F+++  F++   K   +DL+ WLS A+T 
Sbjct  98    LNELKHDRRTSGALHNCGELLDYAIDDLRTTFDRLGGFEMTNFKSAVDDLRTWLSSALTY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT     KM+  L ++ EL+ N LA++  F+E L +L +P  +F RRLL 
Sbjct  158   QETCLDGFENTTTPAAGKMRKALNSSQELTENILALVDEFSETLANLGLP--SFHRRLLA  215

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPA--SIKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
                +G       P ++  A RRLL   P     + D+ VAKDGSG ++++  AL  VP K
Sbjct  216   EHARGA------PSWMPDAKRRLLLVSPGEKGFRPDVTVAKDGSGDFRTINAALAKVPLK  269

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             +  T V+++KAG Y E V V R +  +V VG+G TKT ITG +S    I T  TAT+   
Sbjct  270   SATTYVMYVKAGKYREYVSVARNVTNLVMVGDGATKTVITGHKSFMMNITTKDTATMEAI  329

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF+ R IG +N+AGA  HQAVALRV +DM+ F+ C  D YQDTLYTH+ RQ+YRDC I
Sbjct  330   GNGFLMRGIGVKNTAGAKNHQAVALRVQSDMSAFYECRFDGYQDTLYTHTSRQYYRDCVI  389

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFGNA VVFQNC + VRK M NQ+ +VTAQGRK+RR     V+ +C +   P  
Sbjct  390   TGTIDFIFGNAQVVFQNCLIQVRKCMDNQQNIVTAQGRKERRSVGGTVIHNCTVAPHPEF  449

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
             + +    + FLGRPWKE SRTL + + I   + P+GW  W G   L TC+YAE +N GPG
Sbjct  450   EKSVGRFRTFLGRPWKEHSRTLYIQSEIGGFIDPQGWLPWLGDFGLSTCYYAEVENHGPG  509

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A+  +RVKW+G K        +++T   F+   + WL +  +PF PG L
Sbjct  510   ANMTRRVKWRGIKNITYQHALQKYTVESFIQG-QHWLPQLGVPFIPGLL  557



>gb|KHG02742.1| putative pectinesterase/pectinesterase inhibitor 21 -like protein 
[Gossypium arboreum]
Length=561

 Score =   488 bits (1257),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/534 (45%), Positives = 351/534 (66%), Gaps = 19/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             EIS+++K+V+ +C PT+YKETC++SLA + ++ D KELI+  F+  +  I + ++ S  +
Sbjct  36    EISSSNKAVQALCQPTNYKETCQKSLA-SSNSSDVKELIRTGFQAGLVEIKNVLAHSVTV  94

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             +E  KD     AL  C+E+L  +IDD ++SF+ +  +D+ ++ +Y  +LK WLSGA T Q
Sbjct  95    QELIKDENNKAALGVCQEVLDLAIDDFQKSFDMLGEYDMSKIGKYLLELKTWLSGAFTSQ  154

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN------FK  2586
             +TCID+F  ++ ++ +KM+ +LKT+ E++SN LAM+   + +++ L IP V       F 
Sbjct  155   QTCIDSFAQSSNESSQKMQSILKTSMEITSNALAMLNGLSTIVKELNIPNVGNIDSTGFN  214

Query  2585  RRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAV  2406
             R+LL+ E        +   ++  A R+LL   P  +K ++VVAKDGSG+Y ++ +AL  V
Sbjct  215   RKLLSTE--------DMLEWISQADRKLLQAKPMDLKPNVVVAKDGSGKYDTINKALAEV  266

Query  2405  PFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITG--SRSNKDGIGTYHTA  2232
             P K+ +  VI IKAG Y E++ V ++M  +VF+G+GPTKT IT   S +    + TY TA
Sbjct  267   PVKSPDRFVIHIKAGTYKEKINVTKQMTNVVFIGDGPTKTIITNDISVAKNPPVRTYRTA  326

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             TV + G GF+A++IGF+NSAG   HQAVA R +AD  I  NCH   YQDTLY H  RQ Y
Sbjct  327   TVGVDGAGFMAKDIGFDNSAGPEGHQAVAFRATADRVIMFNCHFTGYQDTLYAHRERQLY  386

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
              +C I+GTVDFIFG+A  +FQNC +IVRKP   Q CMVTAQGR D    +AIVLQ+C I 
Sbjct  387   SNCLITGTVDFIFGDAASIFQNCMLIVRKPGPGQNCMVTAQGRNDLGTNSAIVLQNCTIS  446

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
               P        NK +LGRPWK+F+R++IM + IDDI+ PEG++   GT+ +DT + AE+ 
Sbjct  447   GAPDYIPVKDTNKAYLGRPWKQFARSIIMQSQIDDIIQPEGYAPMTGTIGIDTSFIAEFG  506

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             NRGPGA T++RV WKG K+ I    A ++TP  +L + E W+  + +P+SP  +
Sbjct  507   NRGPGADTNRRVAWKGIKK-IDINEANKWTPRVYLES-ETWISSSDVPYSPDMV  558



>gb|AAF63815.1| pectin methylesterase, putative [Arabidopsis thaliana]
Length=562

 Score =   487 bits (1254),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 254/571 (44%), Positives = 367/571 (64%), Gaps = 24/571 (4%)
 Frame = -1

Query  3218  MGSP-EQNKKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDY  3054
             MGS  ++ KK  V G  S FLV  VV+  V        +    I   +K+V+ +CAPTD+
Sbjct  1     MGSDGDKKKKFIVAGSVSGFLVIMVVSVAVVTSKHSPKDDENHIRKTTKAVQAVCAPTDF  60

Query  3053  KETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEADKDPRTSDALDT  2883
             K+TC  SL GA  D+DDP +LIK+ FKVT+++I +++ K+  ++  +ADK+P    A + 
Sbjct  61    KDTCVNSLMGASPDSDDPVDLIKLGFKVTIKSINESLEKASGDIKAKADKNPEAKGAFEL  120

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C++L+ ++IDDL++  +    F +++++ +  DL+VWLSG+I  Q+TC+D+F     +  
Sbjct  121   CEKLMIDAIDDLKKCMD--HGFSVDQIEVFVEDLRVWLSGSIAFQQTCMDSFGEIKSNLM  178

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV  2523
             + M  + KT+ ELSSN LAM+T  + L+ +  +    + R+LL+ E       +  P +V
Sbjct  179   QDMLKIFKTSRELSSNSLAMVTRISTLIPNSNLT-AKYARKLLSTE-------DSIPTWV  230

Query  2522  DAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYN  2352
                 RRL+      P  +K + VVA+DG+GQ+K++ +AL AVP  N    +I IK G+Y 
Sbjct  231   GPEARRLMAAQGGGPGPVKANAVVAQDGTGQFKTITDALNAVPKGNKVPFIIHIKEGIYK  290

Query  2351  ERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENS  2175
             E+V V +KM  + F+G+GP KT ITGS +   G + T+ TAT+ I+GD F A+NIG EN+
Sbjct  291   EKVTVTKKMPHVTFIGDGPNKTLITGSLNFGIGKVKTFLTATITIEGDHFTAKNIGIENT  350

Query  2174  AGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVV  1995
             AG    QAVALRVSAD  +FH+C ID +QDTLY HS+RQFYRDCT+SGTVDFIFG+A  +
Sbjct  351   AGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVHSHRQFYRDCTVSGTVDFIFGDAKCI  410

Query  1994  FQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRP  1815
              QNCK++VRKP   Q CMVTAQGR + R +  +VL  C I  +PA       NK +LGRP
Sbjct  411   LQNCKIVVRKPNKGQTCMVTAQGRSNVRESTGLVLHGCHITGDPAYIPMKSVNKAYLGRP  470

Query  1814  WKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKR  1635
             WKEFSRT+IM T IDD++ P GW  W G   L T +YAE+ N GPG++  +RVKW G K+
Sbjct  471   WKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTLYYAEHMNTGPGSNQAQRVKWPGIKK  530

Query  1634  NISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  531   -LTPQDALLYTGDRFLRGD-TWIPQTQVPYT  559



>gb|KEH32300.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=585

 Score =   488 bits (1255),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 258/569 (45%), Positives = 354/569 (62%), Gaps = 27/569 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgssggGE------ISTASKSVKEICAPTDYKETCER  3036
             KK A+ GV+SI L+A V A  V V   G  E      I  + K V+ +C  T YK+TCE+
Sbjct  15    KKFAILGVSSILLIAMVAAVAVGVKDGGQVESEGGNQIVKSQKIVQVLCGTTGYKQTCEK  74

Query  3035  SLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSI  2856
             SLA    TD  KELIK  FK T E ++  I  S+L KE   +  T  A+D CKE+L  ++
Sbjct  75    SLAKTGKTD-MKELIKAVFKATAEELSKQIHNSKLYKELATNDMTKQAMDICKEVLGYAV  133

Query  2855  DDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKT  2676
             DD+ +S   ++ FD+ ++ E   DLKVWLSG +  Q+TC+  FENTT    + M  +LK 
Sbjct  134   DDVHQSIHSLDKFDIRKIDEIAYDLKVWLSGTLANQQTCLYGFENTTTHAEQTMAKVLKA  193

Query  2675  ANELSSNGLAMITHFTELLQSLEIPGV----NFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
             + EL++N L +I   +  ++ L +  +    N  R+ L+ +          P +V  + R
Sbjct  194   SLELTNNALDIINGLSGFVKDLNLSSLTSVLNNNRKHLSED--------GLPSWVSQSQR  245

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             +LL   P ++K + VVA+DGSGQ+K++ EAL  VP KN    VI +KAG+Y E V V + 
Sbjct  246   KLLAA-PENVKPNAVVAQDGSGQFKTLTEALALVPKKNQVPFVIHVKAGIYKEYVSVDKD  304

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
              + +  +G+GPTKT  TGS+S  DG+ TY+TAT  +    F A N+GFENSAGAAKHQAV
Sbjct  305   RDHVTIIGDGPTKTIFTGSKSYADGVQTYNTATFGVNSAHFTALNVGFENSAGAAKHQAV  364

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRV+AD  +F+NC +D YQDTLYT S RQFYRDCTISGT+DF+FG+A  VFQNCK++VR
Sbjct  365   ALRVTADKALFYNCQMDGYQDTLYTQSKRQFYRDCTISGTIDFVFGDAVGVFQNCKLVVR  424

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLI  1788
             KPMANQ+CMVTA GR      +A+V Q+C    EP +     P   +LGRPW+ FS+ +I
Sbjct  425   KPMANQQCMVTAGGRTKVDSVSALVFQNCHFTGEPEVLTMQ-PKIAYLGRPWRNFSKVVI  483

Query  1787  MFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQ  1608
             + + ID + VPEG+  W G ++ +TC Y EY N+G GA+T+ RVKW G K  IS   A +
Sbjct  484   VDSLIDGLFVPEGYMPWMGNLFKETCTYLEYNNKGAGAATNLRVKWPGVK-TISAGEAAK  542

Query  1607  FTPGPFL-----MADEQWLGRAQIPFSPG  1536
             + PG F       A + W+  + IP+S G
Sbjct  543   YYPGKFYEIANGTARDDWITESGIPYSIG  571



>ref|XP_004487827.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=624

 Score =   488 bits (1257),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 256/576 (44%), Positives = 354/576 (61%), Gaps = 28/576 (5%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaat--------vsvgssggGEISTASKSVKEICAPT  3060
             G  +Q K+  + GV+S+ LVA V A           +      G+IS+  ++V+ IC  T
Sbjct  11    GGGDQRKRFTLLGVSSVLLVAMVGAVAVGLTSKGDTNSEQGQNGQISSTQRNVEIICEST  70

Query  3059  DYKETCERSLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDT  2883
              Y+ETC +SL  A  +T D KELIK AF  T E +   I  + L  E  KD  T  A++ 
Sbjct  71    QYQETCHKSLDKASNETSDMKELIKAAFNATAEELIKQIHNTTLYDELAKDNMTKQAMNI  130

Query  2882  CKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTG  2703
             C E+L  ++D + RS + ++ +D  ++ EY  DLKVWL+G ++ Q+TC+D FENTT   G
Sbjct  131   CNEVLDYAVDGIHRSIDTMDKYDFNKLSEYAYDLKVWLTGTLSHQQTCLDGFENTTTKAG  190

Query  2702  EKMKHLLKTANELSSNGLAMITHFTELLQSL--EIPGVNFKRRLLTAETKGeeqeeEFPG  2529
             E M   L T+ ELSSN L +I   + LL+        VN  R+LL+ +         FP 
Sbjct  191   EIMAKALNTSLELSSNSLDIINAVSSLLKDAGENNVNVNLNRKLLSND--------GFPS  242

Query  2528  FVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNE  2349
             +V    R +L     + K + VVA+DGSGQ+K++ EAL  VP  N E  VI++KAG+YNE
Sbjct  243   WVSEGQRHILM--EGNFKPNAVVAQDGSGQFKTLSEALLTVPSYNAEPFVIYVKAGIYNE  300

Query  2348  RVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAG  2169
              V V ++M  +  +G+GPTKTR T S +  DG+ TY+TAT  + G  F+A+++GFEN+AG
Sbjct  301   NVNVLKEMTHVTIIGDGPTKTRFTASLNYVDGVQTYNTATFGVNGANFMAKDVGFENTAG  360

Query  2168  AAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQ  1989
             A KHQAVALRV+AD  +F+NC +D +QDTLYT S RQFYRDC++SGT+DFIFG+A  VFQ
Sbjct  361   AEKHQAVALRVTADQAVFYNCQMDGFQDTLYTQSQRQFYRDCSVSGTIDFIFGDAFGVFQ  420

Query  1988  NCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWK  1809
             NCK+IVRKP  +Q+C+VTA GR     A+ ++ Q+C    E  L A   P   +LGRPWK
Sbjct  421   NCKLIVRKPSEDQQCLVTAGGRIKADSASGLIFQNCHFTGEAEL-AVMRPKISYLGRPWK  479

Query  1808  EFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNI  1629
              +S+ +IM + IDDI VPEG+  W G+ + +TC Y EY N+GPGA T  RVKW G K  I
Sbjct  480   PYSKVVIMDSQIDDIFVPEGYMPWAGSAFEETCIYYEYNNKGPGADTSSRVKWVGVK-TI  538

Query  1628  SPEVAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
             S + A  + PG F         + W+  + IP+S G
Sbjct  539   SSDEAVDYYPGRFFEIVNSTQRDSWIVDSGIPYSLG  574



>ref|XP_004296866.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21-like 
[Fragaria vesca subsp. vesca]
Length=559

 Score =   486 bits (1250),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 370/564 (66%), Gaps = 19/564 (3%)
 Frame = -1

Query  3203  QNKKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDYKETCER  3036
             + KK+A+ GV++I LVA VVA  V V  S G +     +T+SK+++ +C PTD+K+TC+ 
Sbjct  9     KKKKIAIIGVSAIILVAMVVAVAVGVTKSKGHKEDNTPATSSKAIEAVCQPTDFKDTCKT  68

Query  3035  SLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNS  2859
             +LA  A +  DPKELIKVA K+  + + + +  S+ + E  KDP    AL  CKEL++ S
Sbjct  69    TLAANAGNVTDPKELIKVAMKIATDKLQEVVDNSQTMHEVVKDPLGDQALQNCKELIQYS  128

Query  2858  IDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             I+D++++F  +  FD+ +VK Y  +L+ WLS +++ ++TC+D F +  GD G+KMK+ LK
Sbjct  129   INDIKKAFGNMGPFDVSKVKNYVKELENWLSASVSYEQTCLDGFNSVKGDAGDKMKNFLK  188

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
              + EL+ NGLAMI+  ++L+       +  +RRLL      +      P ++D     L 
Sbjct  189   QSQELTKNGLAMISEISKLMGGA--IDIKPQRRLLADGDSSKTS----PSWIDGRKLDLA  242

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
             T   +S+K D+VVA+DGSG+YK+V EAL+ +P ++ +T VI+IK G Y E V + ++M  
Sbjct  243   TASASSLKPDVVVAQDGSGKYKTVGEALKDIPKESPKTFVIYIKEGEYKEHVVLEKEMKN  302

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             ++F+G+GPTKT+ITG ++  DG   + TATV + GD FIA+++GFENSAGA  HQA+ALR
Sbjct  303   VMFIGDGPTKTKITGDKNFADGTHPFRTATVVVIGDYFIAKDMGFENSAGAKGHQAMALR  362

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V +D +IF+NC +D YQ+TL+T +YRQFYRDCTISG VD IFG+A VVFQNCKMI+RKP 
Sbjct  363   VQSDQSIFYNCQMDGYQNTLFTQTYRQFYRDCTISGAVDIIFGDAAVVFQNCKMIIRKPE  422

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
              + +  VTAQ R D+R   AIV Q+  I A+   K        FLGRP   +SRT++M +
Sbjct  423   GDDKATVTAQERSDKRQPTAIVFQNSTISADKEYK----DKTAFLGRPAHTYSRTVVMQS  478

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              IDD++ PEGW+ W G    + CW+ E+ NRG G++T+KRV W    + ++ + A +F+ 
Sbjct  479   QIDDVISPEGWTPWTGQSNTEECWFGEFSNRGSGSATNKRVSW---FKMVTRDQADEFSA  535

Query  1598  GPFLMADEQWLGRAQIPFSPGFLQ  1527
                L   E W+  + +P+  G ++
Sbjct  536   SSLLFG-ENWIKPSGVPYEAGLMR  558



>ref|XP_010674078.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Beta vulgaris subsp. vulgaris]
Length=983

 Score =   499 bits (1285),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 246/564 (44%), Positives = 352/564 (62%), Gaps = 41/564 (7%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             +++ +SK+V+ IC PTDYK+ C +SLA  K TDDPKEL++ AF   +  + +  S S +L
Sbjct  36    KLAASSKAVQAICNPTDYKDACVKSLATVK-TDDPKELVRAAFASAMAELKEIASNSTIL  94

Query  2927  KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQ  2748
             K  + DP+T+ A+  CKEL +++IDD +RSF+++   D  +V     +LK+W+S   T Q
Sbjct  95    KVLEMDPKTAQAVKDCKELFQDAIDDFQRSFDEIGKLDWNQVNSVLENLKIWISATRTYQ  154

Query  2747  ETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTA  2568
             ETC+D FENTTGD   K++ +L+T+ E+SSNGLA++   + L  +L+I     +R L T 
Sbjct  155   ETCLDGFENTTGDATVKVRKVLQTSMEMSSNGLAIVNDLSTLFSTLDISSFTGRRLLATY  214

Query  2567  ETK----------------------------------GeeqeeEFPGFVDAATRRLLT--  2496
             +                                        +   P +VD   R+LL   
Sbjct  215   KVHRRLFGDDDGNNVLLSDDEEDRKRRKLLNTVHVVGHGSDDLLLPEWVDGFRRKLLASP  274

Query  2495  --TDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMN  2322
               TD    K ++VVA+DGSG++K++ EA++ +P    ET +I+IK GVYNE + + + M 
Sbjct  275   MLTDDLKAKANVVVAQDGSGKFKTIEEAIKEIPRDGKETFIIYIKEGVYNEYLVLYKWMT  334

Query  2321  KIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVAL  2142
              +VFVG+GPTKTRIT +++  DG  T+ TAT+++ GD F+A++IG ENSAGA KHQAVA 
Sbjct  335   NVVFVGDGPTKTRITNNKNYADGTKTFKTATLSVLGDFFMAKDIGVENSAGAIKHQAVAF  394

Query  2141  RVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKP  1962
             R  +D +IF NCH D YQDTLYTH+YRQFYRDC I+GT+DFIFG+A V FQNC  +VRKP
Sbjct  395   RAQSDKSIFFNCHFDGYQDTLYTHTYRQFYRDCKITGTIDFIFGDAAVFFQNCTFVVRKP  454

Query  1961  MANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMF  1782
             + NQ C+VTAQGR +R     I++ + +  A+P        NK +LGRPWKE+S+T+IM 
Sbjct  455   LENQNCIVTAQGRMERHQPTGIIIHNSKFEADPDYYPVRNKNKAYLGRPWKEYSKTIIME  514

Query  1781  TFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFT  1602
             + I D++ PEGW  W+G   LDT +Y EY N G GA    RVKW+G K  I    A++F 
Sbjct  515   SEIGDLIQPEGWLPWEGNFGLDTSYYGEYNNFGDGARLTNRVKWRGVK-TIVRTRAEKFM  573

Query  1601  PGPFLMADEQWLGRAQIPFSPGFL  1530
             P P L  ++ W+  + IP+ P  +
Sbjct  574   P-PILYENDDWIRDSGIPYDPALI  596



>ref|XP_007154304.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
 gb|ESW26298.1| hypothetical protein PHAVU_003G107300g [Phaseolus vulgaris]
Length=588

 Score =   485 bits (1249),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 245/532 (46%), Positives = 342/532 (64%), Gaps = 21/532 (4%)
 Frame = -1

Query  3089  KSVKEICAPTDYKETCERSLAGAKDTD-DPKELIKVAFKVTVENITDAISKSELLKEADK  2913
             ++VK IC   +YKETC++SL  A D + D K+LI  AF  T E I   I  S L +E   
Sbjct  57    RNVKVICQSAEYKETCQKSLEKASDENSDLKQLIITAFNATAEEIHSKIKNSTLFQELAT  116

Query  2912  DPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCID  2733
             D  T  A++ C+E+L  ++DD+ +S   +E FDL  + EY  DLKVW++G +  Q+TC+D
Sbjct  117   DNMTKQAMEICQEVLGYAVDDINKSSATLEKFDLSMLNEYAYDLKVWIAGTLAHQQTCLD  176

Query  2732  AFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF------KRRLLT  2571
              F +TT + G+ M  +L  + E+S N L ++   + L +     G+NF       R+LL+
Sbjct  177   GFNHTTTEAGKTMTRVLNASLEMSHNALDIVNGASALFK-----GLNFTSFAASNRKLLS  231

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKND  2391
              E   +   + FP +V    R++L  + A+ K D+VVA DGSGQ   + EAL+ VP  N 
Sbjct  232   EEPLVDGLVDGFPSWVTEGQRKIL--EDANPKPDVVVALDGSGQVTKIHEALKLVPKNNK  289

Query  2390  ETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGD  2211
             +  VI+IKAG+Y E V + + M+ +  +G+GPT+TRITG+++  DG  TY+TAT      
Sbjct  290   KPFVIYIKAGIYQEYVRMNKHMSFVTMIGDGPTRTRITGNKNYVDGEQTYNTATFGANAA  349

Query  2210  GFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISG  2031
              F+A+NIGFENSAGA KHQAVALRV+AD  +F+NCH+D YQDTLYT S RQFYRDCT+SG
Sbjct  350   NFMAKNIGFENSAGAEKHQAVALRVTADKAVFYNCHMDGYQDTLYTQSQRQFYRDCTVSG  409

Query  2030  TVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKA  1851
             T+DF+FG+A  VFQNCK +VRKPM NQ+CMVTA GR      +A+V QSC    EP L A
Sbjct  410   TIDFVFGDAVAVFQNCKFVVRKPMENQQCMVTAGGRSKIDSPSALVFQSCTFTGEPDLVA  469

Query  1850  ANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGAS  1671
               P    +LGRPW+ +S+ +I+ + IDDI VPEG+  W G+ + DTC Y E+ NRGPGA+
Sbjct  470   VTPKIS-YLGRPWRIYSKVVIIDSQIDDIFVPEGYMPWMGSAFRDTCTYYEFNNRGPGAN  528

Query  1670  TDKRVKWKGYKRNISPEVAKQFTPGPFL-MAD----EQWLGRAQIPFSPGFL  1530
             T  RV W G+K  I+P  A ++ PG F  +A+    + W+  + +P+S G L
Sbjct  529   TAGRVTWPGFKV-INPTEAAEYYPGKFFEIANSTDRDAWILESGVPYSLGSL  579



>ref|XP_010464272.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=565

 Score =   484 bits (1247),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 236/532 (44%), Positives = 346/532 (65%), Gaps = 20/532 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I   +K+V+ +CAPTD+KETC  SL  A   + +P +LIK++F VT+++I + + K+  
Sbjct  43    QIKKTTKAVQAVCAPTDFKETCVNSLMNASPKSTEPMDLIKLSFDVTIKSINEGLKKASG  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +A KDP    A + C++++ ++I+DL++  +    F ++++  +  DL+VWLSG+I
Sbjct  103   DVKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD--HGFSVDKIDAFVEDLRVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-----VN  2592
               Q+TC+D+FE    +  ++M+H+ KT  ELSSN LAM+T  + LL +    G      N
Sbjct  161   AFQQTCMDSFEEIKSNLMQEMQHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFAN  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LLT E       +  P +V    RRL+   P  +K + VVA+DGSGQ+K++ +AL 
Sbjct  221   YARKLLTTE-------DGIPTWVGPEARRLMAAGPGPVKANAVVAQDGSGQFKTINDALN  273

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             A+P  N    VI IK G+Y E+V V RKM  + F+G+G TKT ITG+++   G + T+ T
Sbjct  274   AIPKGNTVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNQNYGIGKVKTFQT  333

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             A + ++GD F  +NIG EN+AG    QAVALRVSAD  +FH+C  D YQDTLY HS+R F
Sbjct  334   APLIVEGDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGYQDTLYVHSHRHF  393

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             +RDCT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I
Sbjct  394   FRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHI  453

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               +PA       +K +LGRPWK+FSRT++M T IDD++ P GW  W G   L T +YAEY
Sbjct  454   TGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTLIDDVIDPAGWLEWSGDFALKTLYYAEY  513

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              N GPG++  +RVKW G  R I+P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  514   LNTGPGSNQAQRVKWPGI-RKITPQDALSYTGDRFLGGNT-WIPQTQVPYTP  563



>ref|XP_006407898.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
 gb|ESQ49351.1| hypothetical protein EUTSA_v10020401mg [Eutrema salsugineum]
Length=566

 Score =   484 bits (1246),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 247/533 (46%), Positives = 348/533 (65%), Gaps = 23/533 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             EI   +K+VK +CAPTD+KETC  SL  A   + +P +LIK+ F VT+++I +A+ K+  
Sbjct  41    EIRKNTKAVKAVCAPTDFKETCVNSLMNASPKSTEPLDLIKLGFNVTIKSINEALQKASR  100

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +ADK P    A + C++L+ ++IDDL++  +    F + ++  +  DL+VWLSG+I
Sbjct  101   DVKAKADKAPEAKGAFELCEKLMTDAIDDLQKCVD--HGFSVAKIDGFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               QETC+D+FE    +  + M  + KT+ ELSSN LAM+T  + +L +  I G+     N
Sbjct  159   AFQETCMDSFEEIKSNLLQDMLKIFKTSRELSSNSLAMVTDLSTILPNSNITGLTGTLAN  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS---IKHDIVVAKDGSGQYKSVVE  2421
             + R+LL+ +       +  P +V    RRL+         +K + VVA+DGSGQ+K++ +
Sbjct  219   YARKLLSTK-------DGIPTWVGPEARRLMAAPQGGGPPVKANAVVAQDGSGQFKTIAD  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGT  2244
             AL AVP  N    VI IK G+Y E+V V +KM  + F+G+GPTKT+ITGS +   G + T
Sbjct  272   ALNAVPKDNRLPFVIHIKQGIYKEKVIVTKKMPYVTFIGDGPTKTKITGSLNFGLGKVKT  331

Query  2243  YHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSY  2064
             + TATV I G+ F A+NI  EN+AG    QAVALRVSAD  +F++C ID YQDTLY HS 
Sbjct  332   FLTATVTIDGEHFTAKNIWIENTAGPEGGQAVALRVSADYAVFYSCQIDGYQDTLYVHSQ  391

Query  2063  RQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQS  1884
             RQFYRDCT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +
Sbjct  392   RQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKGGQSCMVTAQGRTDVRESTGLVLHN  451

Query  1883  CEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWY  1704
             C I+ EPA       NK +LGRPWK+FSRT+IM T IDD++ P GW  W+G   L+T +Y
Sbjct  452   CHIVGEPAYIPVKSVNKAYLGRPWKKFSRTIIMKTTIDDVIDPAGWLPWRGDFALETLYY  511

Query  1703  AEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             AE+ N GPG++  +RV W G K+ +SPE A  +T G FL  D  W+ + Q+P+
Sbjct  512   AEHLNIGPGSNQAQRVNWPGIKK-LSPEEALLYTGGRFLHGD-TWIPQTQVPY  562



>ref|XP_003561714.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 21 
[Brachypodium distachyon]
Length=561

 Score =   481 bits (1239),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 241/529 (46%), Positives = 328/529 (62%), Gaps = 14/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DYKE CE +L   A +     EL K  FK T E I  A+ +S +
Sbjct  38    ELSTSVKSIKSFCEPVDYKEACESTLEKTAGNATSTTELAKAIFKATSERIEQAVRESSV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L E   D RT+ AL+ CKELL  ++DDL+ +FE++  F++   K   +DLK WLS A+T 
Sbjct  98    LNELKHDQRTAGALNNCKELLNYAMDDLKTTFEQLGGFEMTNFKHALDDLKTWLSSALTY  157

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QETC+D FENTT D   KMK  L  + EL+ N L+++  F + L +LE+P  N  RRLL 
Sbjct  158   QETCVDGFENTTTDAAAKMKKALNASQELTENILSIVDEFGDTLANLELP--NLSRRLLG  215

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +          PG++    RRLL   P+    K DI VA DGSG YK++ EAL  VP K
Sbjct  216   DD--------GVPGWMSDTKRRLLQAKPSEPEFKPDITVASDGSGDYKTINEALAKVPLK  267

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
             + +T V++IKAG Y E V V R +  +V +G+G +KT ITG +S    I T  T+T+   
Sbjct  268   SADTFVMYIKAGTYKEYVSVARNVTNLVMIGDGASKTIITGDKSFMLNITTKDTSTMEAI  327

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF  R IG EN+AGA  HQAVALRV +D ++F+ C  D YQDTLYTH+ RQ+YRDCT+
Sbjct  328   GNGFFMRGIGVENTAGAKNHQAVALRVQSDQSVFYECQFDGYQDTLYTHTSRQYYRDCTV  387

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             +GT+DFIFGNA VVFQNC + VR+ M NQ+ ++TAQGRK++  A   V+ +C I   P  
Sbjct  388   TGTIDFIFGNAQVVFQNCLIQVRRCMDNQQNIITAQGRKEKHSAGGTVILNCTIEPHPEF  447

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
             K      + FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE  N GPG
Sbjct  448   KEHAGRLRTFLGRPWKEYSRTLYIQSEIGGFIDPQGWLPWLGDFGLNTCYYAEVDNHGPG  507

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             +   KR KW+G K     +  +++T   F+   + W+ +  +P+ PG L
Sbjct  508   SDMSKRAKWRGVKTVTYQQAQQKYTIEKFIQG-QTWIPKYGVPYIPGLL  555



>emb|CDY24663.1| BnaA05g30620D [Brassica napus]
Length=569

 Score =   481 bits (1238),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 242/537 (45%), Positives = 347/537 (65%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIK++F  T+++I D   K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNFKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDL++  ++   F + +++ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ K++ ELSSN LAM T    +L +  I G+      
Sbjct  159   AFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP------ASIKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K ++ VA+DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMQAEPKPKEGGPPVKANVAVAQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ EPA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGEPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  512   LYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_002882495.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58754.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   481 bits (1238),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/536 (45%), Positives = 347/536 (65%), Gaps = 25/536 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTD-DPKELIKVAFKVTVENITDAISKS--  2937
              I   +K+V+ +CAPTD+K+TC  SL GA  +  +P +LIK+ F +T+++I +++ K+  
Sbjct  43    HIKKTTKAVQAVCAPTDFKDTCVNSLMGASPSSAEPLDLIKLGFNITIKSINESLKKASG  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +ADK+P    A + C++L+ ++IDDL++  +    F ++R++ +  DL+VWLSG+I
Sbjct  103   DVKAKADKNPEAKGAFELCEKLMIDAIDDLKKCMD--HGFSVDRIEVFVEDLRVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D+F     +  + M  + +T+ ELSSN LAM+T  + LL +  I G+     N
Sbjct  161   AFQQTCMDSFGEIKSNLMQDMLKIFQTSRELSSNSLAMVTSISTLLPNSNITGLTGALAN  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS-----IKHDIVVAKDGSGQYKSV  2427
             + R+LL+ E       +  P +V    RRL+           +K + VVA+DGSGQ+K++
Sbjct  221   YARKLLSTE-------DGIPNWVGPEARRLMAAQGGGPGPGPVKANAVVAQDGSGQFKTI  273

Query  2426  VEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-I  2250
              +AL  VP  N    VI IK G+Y E+V V RKM  + F+G+GP KT ITGS +   G +
Sbjct  274   TDALNGVPKGNTVPFVIHIKQGIYKEKVMVTRKMPYVTFIGDGPNKTVITGSLNFGIGKV  333

Query  2249  GTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTH  2070
              T+ TAT+ ++GD F A+NIG EN+AG    QAVALRVSAD  +FH+C ID +QDTLY H
Sbjct  334   KTFLTATITVEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAVFHSCQIDGHQDTLYVH  393

Query  2069  SYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVL  1890
             S+RQFYRDCT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL
Sbjct  394   SHRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPNKGQSCMVTAQGRSNVRESTGLVL  453

Query  1889  QSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTC  1710
               C I  +PA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W G   L T 
Sbjct  454   HGCHITGDPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWSGDFALKTL  513

Query  1709  WYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             +YAE+ N GPG++  +RVKW G K+ ++P+ A  +T   FL  D  W+ + Q+P++
Sbjct  514   YYAEHMNTGPGSNQAQRVKWPGIKK-LTPQDALLYTGDRFLRGDT-WIPQTQVPYT  567



>gb|EYU43978.1| hypothetical protein MIMGU_mgv1a003697mg [Erythranthe guttata]
Length=569

 Score =   481 bits (1237),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 249/525 (47%), Positives = 341/525 (65%), Gaps = 13/525 (2%)
 Frame = -1

Query  3104  ISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELLK  2925
             IST+ K+++++C  T Y++TC  +L+ A ++ DP+ LI+  F++ + ++ + I +S  L+
Sbjct  43    ISTSQKAIQDLCQSTYYQQTCTETLSNATNSSDPQTLIQTIFEIAISHLNNTIQQSGPLQ  102

Query  2924  EADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQE  2745
             +   DP+TS A  TC ++L +SI DL ++  + E FD      + +D+K WL+GA+T QE
Sbjct  103   QISNDPKTSQAYKTCTKVLDDSIQDLRKTIHRTETFDFFDFSIFIDDIKTWLTGALTYQE  162

Query  2744  TCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTEL-LQSLEIPGVNFKRRLLTA  2568
             TC+D+FE+T GD  E M+ LLK + EL++NGLA+      L L +L  P V   +  L A
Sbjct  163   TCLDSFEDTKGDHAETMRQLLKLSRELTTNGLAIANQIHRLFLPNLLAPPVAPTKHQL-A  221

Query  2567  ETKGeeqeeEFPGFVDAATRRLL--TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKN  2394
             + K        P       R+LL   +D      ++VVAKDGSG+YK+V EAL+ VP ++
Sbjct  222   DRKPLS-----PRGDSNYYRKLLQMASDRRYDTPNVVVAKDGSGKYKTVTEALKEVPERS  276

Query  2393  DETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRS-NKDGIGTYHTATVAIQ  2217
             +ET VI +K GVY E VE+   M  +V VG+GPTKTRITG +S   DG+GTY TATV I 
Sbjct  277   NETFVIHVKEGVYEEYVEITSGMWSVVLVGDGPTKTRITGKKSYGGDGLGTYFTATVGID  336

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             GD FI ++IGFEN+AGA  +QAVALRVSAD  IF+NCHID YQDTLY H++RQ+YRDCTI
Sbjct  337   GDNFIGKDIGFENTAGAIGYQAVALRVSADKAIFYNCHIDGYQDTLYAHNHRQYYRDCTI  396

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DFIFGNA  + QNC ++VRKP+ NQ C+VTA GR      +A V+    ++A P  
Sbjct  397   SGTIDFIFGNARALIQNCTLLVRKPLDNQACVVTANGRTLSNETSAFVIHGSRVVAAPEY  456

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTM-YLDTCWYAEYQNRGP  1680
                +   + FLGRPWKE+S+T+ M + I+  + PEGWS W  T  +LDTCWYAE  NRGP
Sbjct  457   PVDDKRIQSFLGRPWKEYSKTIFMASEIEGFISPEGWSPWDNTADHLDTCWYAEVGNRGP  516

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             GA    RVKW G K NI+   A QF P  + M    W+    IPF
Sbjct  517   GADLTNRVKWPGIK-NITMAEAAQFAPTMY-MDSGHWIEGKGIPF  559



>ref|XP_009147125.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=569

 Score =   481 bits (1237),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/537 (45%), Positives = 348/537 (65%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIK++F  T+++I D + K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDL++  ++   F + +++ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ K++ ELSSN LAM T    +L +  I G+      
Sbjct  159   AFQQTCIDTFEEIKSNLKRDMLNIFKSSRELSSNSLAMTTDLPTILPNSNITGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP------ASIKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K ++ VA+DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMQAEPKPKGGGPPVKANVAVAQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGRKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNC ++VRKP   Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCNIVVRKPKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ +PA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGDPAYIRVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N GPG++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P+S
Sbjct  512   LYYAEHLNAGPGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYS  566



>ref|XP_006433459.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46699.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=711

 Score =   485 bits (1249),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 255/552 (46%), Positives = 354/552 (64%), Gaps = 26/552 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  55    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  115   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D F NTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV+I G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  415   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  474

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  475   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  534

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------  1563
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+        
Sbjct  535   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRW  593

Query  1562  RAQIPFSPGFLQ  1527
             R   P  P  LQ
Sbjct  594   RLHRPLCPRTLQ  605



>ref|XP_006433461.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46701.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=727

 Score =   486 bits (1250),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 255/552 (46%), Positives = 354/552 (64%), Gaps = 26/552 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  55    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  115   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D F NTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV+I G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  415   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  474

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  475   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  534

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------  1563
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+        
Sbjct  535   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRW  593

Query  1562  RAQIPFSPGFLQ  1527
             R   P  P  LQ
Sbjct  594   RLHRPLCPRTLQ  605



>ref|XP_006433460.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46700.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=714

 Score =   485 bits (1249),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 255/552 (46%), Positives = 354/552 (64%), Gaps = 26/552 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  55    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  115   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D F NTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV+I G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  415   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  474

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  475   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  534

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------  1563
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+        
Sbjct  535   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRW  593

Query  1562  RAQIPFSPGFLQ  1527
             R   P  P  LQ
Sbjct  594   RLHRPLCPRTLQ  605



>ref|XP_006433462.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
 gb|ESR46702.1| hypothetical protein CICLE_v10000415mg [Citrus clementina]
Length=706

 Score =   485 bits (1248),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 255/552 (46%), Positives = 354/552 (64%), Gaps = 26/552 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             ++S + K++K +C PTDY++ C  SL   + +T DPKELI+ AF+V  +++  A  +S  
Sbjct  55    QVSASMKAIKTVCQPTDYQKQCVESLQTESGNTTDPKELIRAAFQVAKKHVAAAAKRSRT  114

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLE---RVKEYTNDLKVWLSGA  2760
             LK+ +KDPR S AL+ C EL+  +I+DL+RSFE++   D +   ++    N+LK WLS  
Sbjct  115   LKQLEKDPRASLALEDCNELMDEAIEDLQRSFEELGKSDHQARYKMGPMINNLKTWLSST  174

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             IT QETC+D F NTTG+ G KM+ +LKT+ EL+ N +AM++  + +L +L+I      G 
Sbjct  175   ITYQETCLDGFANTTGEAGVKMREILKTSIELTINAIAMVSKISSILGNLDINREINLGS  234

Query  2594  NFKRRLLTAETKGe--------eqeeEFPGFVDAATRRLL-TTDPASIKHDIVVAKDGSG  2442
             +  R L+    K          E  + +P ++    R+LL   D A  K D+VVAKDGSG
Sbjct  235   SHHRGLIENNAKVLGHGGIHVLEHGDLYPSWLGPRNRKLLGLIDQAQFKPDVVVAKDGSG  294

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
                ++ EAL  +P K+++T  I+IK G+Y E+V + R M ++  +G+G  KTRITG+ + 
Sbjct  295   NCTTINEALNFIPKKSNKTTTIYIKEGIYQEKVYLNRSMARVFMIGDGMYKTRITGNLNY  354

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DG  T HTATV+I G+ F+A+NIGFENSAG  KHQAVALRV ADM+IF+NC +D YQDT
Sbjct  355   VDGTPTMHTATVSILGEFFMAKNIGFENSAGPEKHQAVALRVDADMSIFYNCSMDGYQDT  414

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LYTH+ RQ+YRDCTI+GT+DFIFG+    FQNCK+IVRKP+ NQ C+VTAQGR       
Sbjct  415   LYTHAKRQYYRDCTITGTIDFIFGDGSAFFQNCKIIVRKPLDNQHCIVTAQGRNVTHQPT  474

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
             AIV+Q+  I+A+          K +LGRPW+  SRT+IM TFIDD++ P+GW  W+G   
Sbjct  475   AIVIQNSSIIADHVYWPVRNKIKSYLGRPWRIHSRTVIMETFIDDLIQPQGWLPWEGEFG  534

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLG-------  1563
             + TC+YAEY N GPGA+   RV W+G K     E A +FT G F   D+ W+        
Sbjct  535   IHTCFYAEYGNYGPGANKTGRVTWQGVKSIDRLEEAFEFTAGKFFDGDD-WIKPRGHPRW  593

Query  1562  RAQIPFSPGFLQ  1527
             R   P  P  LQ
Sbjct  594   RLHRPLCPRTLQ  605



>ref|NP_001049858.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|ABF95479.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11772.1| Os03g0300500 [Oryza sativa Japonica Group]
 gb|EAY89657.1| hypothetical protein OsI_11188 [Oryza sativa Indica Group]
 gb|EAZ26616.1| hypothetical protein OsJ_10519 [Oryza sativa Japonica Group]
Length=565

 Score =   479 bits (1232),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 245/530 (46%), Positives = 333/530 (63%), Gaps = 15/530 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E+ST+ KS+K  C P DY+ETCE +L   A +  +P +L K  FK T E I  A+ +S +
Sbjct  38    ELSTSVKSIKSFCQPVDYRETCETTLEQTAGNATNPTDLAKAIFKATSERIEKAVRESAV  97

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L +   DPRTSDAL  C+ELL  +IDDL+ +F+K+  F     K   +D+K WLS A+T 
Sbjct  98    LNDLKNDPRTSDALKDCEELLDYAIDDLKTTFDKLGGFQTSNFKRAVDDVKTWLSSALTY  157

Query  2750  QETCIDAFENTTG-DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
             QETC+D FEN+T  +  EKM+  LK++ EL+ N LA++  F + L +L+I G  F RRLL
Sbjct  158   QETCLDGFENSTSTEASEKMRKALKSSQELTENILAIVDQFADTLANLDITG--FSRRLL  215

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPF  2400
               +          P ++  A RRLL   P S   K D+ VA DGSG +K++ EAL  VP 
Sbjct  216   GDD--------GVPVWMSNAKRRLLEATPGSKEFKPDVTVAADGSGDFKTINEALAKVPV  267

Query  2399  KNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAI  2220
             K+  T V+++KAG Y E V V R +  +V +G+G TKT ITG++S    I T  TAT+  
Sbjct  268   KSTGTYVMYVKAGTYKEYVSVARNVTNLVMIGDGATKTIITGNKSFMLNITTKDTATMEA  327

Query  2219  QGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCT  2040
              G+GF  R IG EN+AG+  HQAVALRV +D + F+ C  D +QDTLYTH+ RQ+YRDCT
Sbjct  328   IGNGFFMRGIGVENTAGSKNHQAVALRVQSDQSAFYECQFDGHQDTLYTHTSRQYYRDCT  387

Query  2039  ISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPA  1860
             I+GT+DFIFGNA VV QNC++ VR+ M NQ+ +VTAQGRK++  A   V+ +C I     
Sbjct  388   ITGTIDFIFGNAQVVLQNCRIQVRRCMDNQQNIVTAQGRKEKHSAGGTVIHNCTIEPHED  447

Query  1859  LKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGP  1680
              KA     K FLGRPWKE+SRTL + + I   + P+GW  W G   L+TC+YAE +NRG 
Sbjct  448   FKADAAKFKTFLGRPWKEYSRTLYIQSDIGGFIDPQGWLPWLGDFGLNTCYYAEVENRGD  507

Query  1679  GASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             GA   KR KW+G K     +  +++T   F+   + WL +  +PF PG L
Sbjct  508   GADMSKRAKWRGVKTVTYQQAQQKYTVERFIQG-QTWLPKFGVPFIPGLL  556



>ref|XP_007144961.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16955.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=578

 Score =   479 bits (1233),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 253/569 (44%), Positives = 366/569 (64%), Gaps = 26/569 (5%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaat--------vsvgssggGEISTASKSVKEICAPTDYKETC  3042
             +++AV GV++IFLVA VVA           +  S     + ++ K+V+ +C PT Y++ C
Sbjct  10    RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  3041  ERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLK  2865
             E+SL   A +T D +ELIK+ F +T++ I     K + +  A+++PR   AL TCK+L+ 
Sbjct  70    EKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLMN  129

Query  2864  NSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              S+ + +R+ EK+  FDL+ +      LKVWLSGAIT QETC+D F NTT   G +M++L
Sbjct  130   LSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGNRMRNL  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV------  2523
             L T   +SSN LA+IT     +   E+  VN KR+L+  +     Q+E     +      
Sbjct  190   LTTTMHMSSNALAIITALANTVS--ELSDVN-KRQLVEDDEHVFGQDEVISSLIFDDDDD  246

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL  +P  +K + +VAKDGS ++KS+ +AL+ VP KN +  VI+I+ GVYNE +
Sbjct  247   GGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVYNEYI  306

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV + M ++VFVG+G  KTRITG+R+  DG+ TY TA+VAI GD F+A NIGFENSAG  
Sbjct  307   EVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASVAIHGDYFVAINIGFENSAGPH  366

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV AD +IF+ C +D Y+DTLY H+ RQFYRDCTISGT DF+FG+A  VFQNC
Sbjct  367   KHQAVAIRVQADRSIFYRCSMDGYEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNC  426

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ  +VTAQGRK++   + IV+Q   I++   +K      K +L RP K +
Sbjct  427   TFVVRKPLENQPLIVTAQGRKEKHQPSGIVIQGSSIVSNHRMKF---DKKAYLARPLKNY  483

Query  1802  SRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+ M T+++  + P+G+  W   QG   ++TC+YAEY N GPG++  KRVKW G K+ 
Sbjct  484   SRTIFMNTYMEGFIEPDGYVPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIKK-  542

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++ + A +++P  F   D+ W+   +IP+
Sbjct  543   LNSKSASEYSPLNFFHGDD-WVKITRIPY  570



>ref|XP_004508195.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Cicer 
arietinum]
Length=576

 Score =   478 bits (1231),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 247/573 (43%), Positives = 358/573 (62%), Gaps = 27/573 (5%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssgg--------GEISTASKSVKEICAPTDYK  3051
             E+ KK AV G++SI LVA V A  V V ++           +++T+ K+VK IC   +YK
Sbjct  10    EKKKKYAVVGLSSILLVAMVAAVAVGVSTTDEISGESGGDNQLATSQKNVKVICDSAEYK  69

Query  3050  ETCERSLAG-AKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKE  2874
             +TCE+SLA  + +T D K L+  AF  T E +   I  S L  E   D  T  A+D CKE
Sbjct  70    QTCEKSLANVSSETTDMKTLVIAAFNATAEELLSKIHNSTLYNELATDNMTKQAMDICKE  129

Query  2873  LLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKM  2694
             +L  ++DD+ +S   ++ F+L ++ EY  D+K+W++G ++ Q TC+D FENTT + G+ M
Sbjct  130   VLGYAVDDIHQSIHTLDRFELSKIDEYAYDIKIWIAGTLSHQRTCLDGFENTTTEAGQTM  189

Query  2693  KHLLKTANELSSNGLAMITHFTELLQSLEIPGVN--FKRRLLTAETKGeeqeeEFPGFVD  2520
               +L  + ELS+N + ++      ++ L +  +     R+LL+ +          P +V 
Sbjct  190   AKVLNASLELSNNAMDIVNGVAGFVKGLNLSSLTSAMSRKLLSED--------GIPSWVG  241

Query  2519  AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVE  2340
              + RRLL   P  +  +++VA+DGSGQ+K++ EAL  VP KN    VI++KAGVYNE V 
Sbjct  242   QSQRRLLEA-PHDVTPNVIVAQDGSGQFKTLNEALELVPKKNKIPFVIYVKAGVYNEYVA  300

Query  2339  VPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
             + +  + +  +G+GPTKT  TG+++  DG+ TY+TAT +I    F+A N+GFENSAGA K
Sbjct  301   LDKHKSHVHIIGDGPTKTIFTGNKNYVDGVQTYNTATFSINAADFMAINVGFENSAGAEK  360

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
             HQAVALRV+AD  +F+NC +D +QDTLYT S RQFYRDCT+SGT+DFIFG+A  VFQNCK
Sbjct  361   HQAVALRVTADKAVFYNCQMDGFQDTLYTQSKRQFYRDCTVSGTIDFIFGDAAGVFQNCK  420

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             +IV+KPM NQ+CMVTA GR       A+V Q+C    EP + A  P    +LGRPW+E+S
Sbjct  421   LIVKKPMENQQCMVTAGGRTKVDSPTALVFQNCHFTGEPDVVALKPKIS-YLGRPWREYS  479

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             + +IM + IDDI +PEG+  W G+   +TC Y EY N+G GA+T+ RVKW   K  I+  
Sbjct  480   KVVIMDSVIDDIFLPEGYMAWMGSANKETCTYYEYNNKGLGANTEHRVKWPNVK-TIAAN  538

Query  1619  VAKQFTPGPFL-----MADEQWLGRAQIPFSPG  1536
              A  + P  F         + W+ ++ +P+S G
Sbjct  539   EAVNYYPEKFFELVNSTQRDAWIVQSGVPYSIG  571



>gb|EPS65387.1| pectinesterase, partial [Genlisea aurea]
Length=553

 Score =   476 bits (1224),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 237/535 (44%), Positives = 340/535 (64%), Gaps = 35/535 (7%)
 Frame = -1

Query  3095  ASKSVKEICAPTDYKETCERSLAGAKD-TDDPKELIKVAFKVTVENITDAISKSELLKEA  2919
             A  ++  +C+ TDYK+ C  +L  + + T DPKEL+++AF+ T++ I  A   S +L+E 
Sbjct  41    AMVTIDTLCSSTDYKKACVDTLRDSGNSTSDPKELMEIAFRATMDRIAAAGRNSSVLREV  100

Query  2918  DKDPRTSDALDTCKELLKNSIDDLERSFEKVEN----FDLERVKEYTNDLKVWLSGAITQ  2751
              +DPR  +A+D C EL + ++ DL R+FEK       FDL    E   DLK+WLSGA+T 
Sbjct  101   QRDPRGREAVDACAELAERAVADLNRTFEKFSKEFSEFDLTNADEVVGDLKIWLSGAVTY  160

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNF------  2589
             QETC+D FE  +GD G++M+ LL  + ++SSN LAM+T    +L S      +       
Sbjct  161   QETCLDGFEGVSGDAGDRMRDLLTLSMQMSSNALAMMTGMQSILSSFSSSSSSAAALGSR  220

Query  2588  KRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRA  2409
             +RRLL+ +          P                 +K D++VAKDGSG +K++ EAL  
Sbjct  221   RRRLLSEKDD-------LPKL-------------NIMKPDLIVAKDGSGDFKTINEALFK  260

Query  2408  VPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTAT  2229
             VP  +++T V++IK G+Y E+V++      ++ VG+GP KTRITG  +  +G  TY +AT
Sbjct  261   VPENSEKTFVLYIKEGIYEEQVKINSSFTNLLVVGDGPLKTRITGKLNFVNGTTTYQSAT  320

Query  2228  VAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYR  2049
             VA+ GD F A ++GFEN+AG   HQAVALRVSAD+ +F+NCH+D YQDTLY H+YRQFYR
Sbjct  321   VAVHGDRFTAMDVGFENAAGPEGHQAVALRVSADLAVFYNCHMDGYQDTLYAHTYRQFYR  380

Query  2048  DCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILA  1869
             DCTISGT+D+IFG+A  +FQ C M+VRKP+ANQ C+VTAQGRKD      +VLQ+C ++ 
Sbjct  381   DCTISGTIDYIFGDAAALFQGCTMVVRKPLANQYCIVTAQGRKDVHQPTGLVLQNCSVVG  440

Query  1868  EPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQN  1689
             +PA       NK +L RPWK +SR +IM ++ID I+ P+G+  W GT  LDT +Y E+ N
Sbjct  441   DPAYYPVMDVNKAYLARPWKLYSRAVIMESYIDRIIQPDGYLEWNGTFALDTLFYTEFNN  500

Query  1688  RGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWL--GRAQIPFSPGFL  1530
             RGPGA   +R+KW G K  ++ +  K+FT   F+    +W    + +IP+  GF+
Sbjct  501   RGPGADKSRRLKWTGIK-ELTGKRMKRFTGDDFIDG-SRWTKHNKMKIPYKGGFV  553



>ref|XP_010445248.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=568

 Score =   476 bits (1224),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/535 (44%), Positives = 344/535 (64%), Gaps = 23/535 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I   +K+V+ +CAPTD+KETC  SL  A   + +P +LIK+ F VT+++I + + K+  
Sbjct  43    QIKKTTKAVQAVCAPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASE  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +A KDP    A + C++++ ++I+DL++  +    F ++++  +  DL VWLSG+I
Sbjct  103   DVKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD--HGFSVDKIDSFVEDLLVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-----VN  2592
               Q+TC+D+FE    D  ++M+H+ KT  ELSSN LAM+T  + LL +    G      N
Sbjct  161   AFQQTCMDSFEEIKSDLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFAN  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVE  2421
             + R+LL+AE       +  P +V    RRL+      P  +K + VVA+DGSGQ+K++ E
Sbjct  221   YARKLLSAE-------DGIPTWVGPEARRLMAAQGGGPGPVKANAVVAQDGSGQFKTIAE  273

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGT  2244
             AL AVP  N    VI IK G+Y E+V V RKM  + F+G+G TKT ITG+ +   G + T
Sbjct  274   ALNAVPKGNTVPYVIHIKQGIYKEKVMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKT  333

Query  2243  YHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSY  2064
             + TA + I+GD F  +NIG EN+AG    QAVALRVSAD  +FH+C  D +QDTLY HS+
Sbjct  334   FLTAPLTIEGDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSH  393

Query  2063  RQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQS  1884
             R F+R+CT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +
Sbjct  394   RHFFRECTVSGTVDFIFGDAKCILQNCKIVVRKPKKGQSCMVTAQGRTDVRESTGLVLHN  453

Query  1883  CEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWY  1704
             C I  +PA       +K +LGRPWK+FSRT+IM T IDD++ P GW  W G   L T +Y
Sbjct  454   CHITGDPAYIPVKSVSKSYLGRPWKQFSRTIIMKTMIDDVIDPAGWLAWSGDFALKTLYY  513

Query  1703  AEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
             AE+ N GPG++  +RVKW G  R ++P+ A  +T   FL  +  W+ + Q+P++P
Sbjct  514   AEHLNTGPGSNQAQRVKWPGI-RKLTPQDALLYTGDRFLGGN-TWIPQTQVPYTP  566



>ref|XP_009124640.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Brassica rapa]
Length=560

 Score =   474 bits (1220),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 253/569 (44%), Positives = 356/569 (63%), Gaps = 25/569 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVAS--IFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCERS  3033
             ++ KK  + GV S  + ++   VA   S  S    EI   +K+VK +CAPTDYKETC +S
Sbjct  6     DKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNENEIRQNTKAVKTVCAPTDYKETCLKS  65

Query  3032  LAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEADKDPRTSDALDTCKELLKN  2862
             L  A   + +P  LIK++F VT+++I + + K+  ++  +ADK P   DA + C++++ +
Sbjct  66    LMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVMND  125

Query  2861  SIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             +I DL++  +      ++ ++ +  DL+VW+SG+I  Q+TCID FE         M ++ 
Sbjct  126   AIADLKKCVD--HKVSVDEIERFIKDLRVWISGSIAFQQTCIDTFEEIKSTLKHDMINIF  183

Query  2681  KTANELSSNGLAMITHF----TELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K + +LSSN LAM+T      TEL  + E    N  R+LL+ E  G       P +V   
Sbjct  184   KRSRQLSSNSLAMVTDLNSNATELTGAFE----NNARKLLSTEEDG------VPTWVGPE  233

Query  2513  TRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
              RRL+       +K + VVA+DGSGQ+K++ +AL AVP +N    VI IK GVY E+V V
Sbjct  234   ARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVV  293

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
              RKM  + F+G+GPTKT ITGS +   G + TY TA + ++G+ F A+ IG EN+AG   
Sbjct  294   TRKMPYVTFIGDGPTKTVITGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAGPEG  353

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
              QAVALRVS D  +F +C ID YQDTLY HS RQFYRDCT+SGTVDFIFG++  + QNCK
Sbjct  354   GQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCK  413

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKPMA Q CMVTAQGR D R    IVL +C I+ +PA       +K +LGRPWKEFS
Sbjct  414   IVVRKPMAGQSCMVTAQGRSDVREPTGIVLHNCHIVGDPAYIPVRTASKAYLGRPWKEFS  473

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT++M T +DD++ P GW  W G   L T +YAE+ N GPGA+  +RVKW G K+ ++PE
Sbjct  474   RTIVMKTIVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTPE  532

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A  +T   FL  +  W+ R Q+P++ G 
Sbjct  533   QALSYTGDRFLSGN-TWIPRTQVPYTAGM  560



>emb|CAB65290.2| pectin methyl-esterase PER [Medicago truncatula]
Length=602

 Score =   475 bits (1222),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 244/564 (43%), Positives = 349/564 (62%), Gaps = 34/564 (6%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCER  3036
             G  +Q+K+ A+ GV+SI LVA V             +      +V+ +C  T Y++TC +
Sbjct  8     GGHDQSKRFALVGVSSILLVAMVATVA---------DAQQGQPNVQILCESTQYQQTCHQ  58

Query  3035  SLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNS  2859
             SLA A  +T   K+LIK AF  T E +   I+ S L++E  +D  T  A++ C E+L  +
Sbjct  59    SLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEVLDYA  118

Query  2858  IDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             +D + +S   V+ FD+ ++ EY+ DLKVWL+G ++ Q+TC+D F NTT   GE M   L 
Sbjct  119   VDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETMARALN  178

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             T+ +LSSN + M+    +L         N KRRLL+ +         +P +V    RRLL
Sbjct  179   TSIQLSSNAIDMVDAVYDL--------TNAKRRLLSLDN-------GYPLWVSEGQRRLL  223

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 A++K ++VVA+DGSGQ+K++ +A++ VP  N +  VI++K GVYNE V VP+ M  
Sbjct  224   AE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVPKDMAF  281

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +  +G+GP KT+ TGS +  DG+  Y+TAT  + G+ F+A++I  EN+AG  KHQAVALR
Sbjct  282   VTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQAVALR  341

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD  IF+NC ID YQ TL+  S RQFYRDC+ISGT+D I+G+A  VFQNCK+IVRKP+
Sbjct  342   VTADKAIFYNCQIDGYQATLFAESQRQFYRDCSISGTIDMIYGDAFAVFQNCKLIVRKPL  401

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
               Q+C V A GR     ++  V QSC    EP + A   P   +LGRPWK +S+ +IM +
Sbjct  402   EEQQCFVAADGRTKSDSSSGFVFQSCHFTGEPEV-AKIDPKIAYLGRPWKSYSKVVIMDS  460

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              IDDI  PEG+  W G+ + DTC + EY N+GPGA T KRVKW G K +IS   A  F P
Sbjct  461   NIDDIFDPEGYMPWMGSAFKDTCTFYEYNNKGPGADTSKRVKWPGVK-SISSTEAAAFYP  519

Query  1598  GPFL-MAD----EQWLGRAQIPFS  1542
             G F  +A+    + W+ ++ +P+S
Sbjct  520   GKFFEIANATDRDTWIVKSGVPYS  543



>gb|KEH37212.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=614

 Score =   475 bits (1222),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 244/564 (43%), Positives = 349/564 (62%), Gaps = 34/564 (6%)
 Frame = -1

Query  3215  GSPEQNKKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCER  3036
             G  +Q+K+ A+ GV+SI LVA V             +      +V+ +C  T Y++TC +
Sbjct  8     GGHDQSKRFALVGVSSILLVAMVATVA---------DAQQGQPNVQILCESTQYQQTCHQ  58

Query  3035  SLAGA-KDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNS  2859
             SLA A  +T   K+LIK AF  T E +   I+ S L++E  +D  T  A++ C E+L  +
Sbjct  59    SLAKAPAETAGVKDLIKAAFSATSEELLKHINSSSLIQELGQDKMTKQAMEVCNEVLDYA  118

Query  2858  IDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLK  2679
             +D + +S   V+ FD+ ++ EY+ DLKVWL+G ++ Q+TC+D F NTT   GE M   L 
Sbjct  119   VDGIHKSVGAVDKFDINKIHEYSYDLKVWLTGTLSHQQTCLDGFANTTTKAGETMARALN  178

Query  2678  TANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLL  2499
             T+ +LSSN + M+    +L         N KRRLL+ +         +P +V    RRLL
Sbjct  179   TSIQLSSNAIDMVDAVYDL--------TNAKRRLLSLDNG-------YPLWVSEGQRRLL  223

Query  2498  TTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNK  2319
                 A++K ++VVA+DGSGQ+K++ +A++ VP  N +  VI++K GVYNE V VP+ M  
Sbjct  224   AE--ATVKPNVVVAQDGSGQFKTLTDAIKTVPANNAQNFVIYVKEGVYNETVNVPKDMAF  281

Query  2318  IVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALR  2139
             +  +G+GP KT+ TGS +  DG+  Y+TAT  + G+ F+A++I  EN+AG  KHQAVALR
Sbjct  282   VTIIGDGPAKTKFTGSLNYADGLLPYNTATFGVNGENFMAKDISIENTAGPEKHQAVALR  341

Query  2138  VSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPM  1959
             V+AD  IF+NC ID YQ TL+  S RQFYRDC+ISGT+D I+G+A  VFQNCK+IVRKP+
Sbjct  342   VTADKAIFYNCQIDGYQATLFAESQRQFYRDCSISGTIDMIYGDAFAVFQNCKLIVRKPL  401

Query  1958  ANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFT  1779
               Q+C V A GR     ++  V QSC    EP + A   P   +LGRPWK +S+ +IM +
Sbjct  402   EEQQCFVAADGRTKSDSSSGFVFQSCHFTGEPEV-AKIDPKIAYLGRPWKSYSKVVIMDS  460

Query  1778  FIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTP  1599
              IDDI  PEG+  W G+ + DTC + EY N+GPGA T KRVKW G K +IS   A  F P
Sbjct  461   NIDDIFDPEGYMPWMGSAFKDTCTFYEYNNKGPGADTSKRVKWPGVK-SISSTEAAAFYP  519

Query  1598  GPFL-MAD----EQWLGRAQIPFS  1542
             G F  +A+    + W+ ++ +P+S
Sbjct  520   GKFFEIANATDRDTWIVKSGVPYS  543



>emb|CDY05295.1| BnaC05g45080D [Brassica napus]
Length=569

 Score =   473 bits (1217),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 240/537 (45%), Positives = 345/537 (64%), Gaps = 26/537 (5%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I T +K+V+ +CAPTD+KE C +SL  A  ++ +P ELIK++F  T+++I D + K+  
Sbjct  41    QIRTTTKAVRAVCAPTDFKEACVKSLMDASPNSTEPLELIKLSFNATIKSINDNLKKASE  100

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +ADKDP    A   C+ L+ ++IDDL++  ++   F + +++ +  DL+VWLSG+I
Sbjct  101   DVKPKADKDPGAKGAFQLCERLMIDAIDDLKKCVDR--EFSVTQIEIFVEDLRVWLSGSI  158

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVN-----  2592
               Q+TCID FE    +    M ++ KT+ ELSSN LAM T    +L +    G+      
Sbjct  159   AFQQTCIDTFEEIKSNLMRDMLNIFKTSRELSSNSLAMTTDLPTILPNSNTTGLTGALAK  218

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPAS------IKHDIVVAKDGSGQYKS  2430
             + R+LL  E       +  P +V    RRL+  +P        +K + VV +DGSG +K+
Sbjct  219   YARKLLYTE-------DGIPTWVGPHARRLMAEEPKPKGGGPLVKANAVVDQDGSGHFKT  271

Query  2429  VVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-  2253
             + +AL+ VP  N    +I IK G+Y ERV+V +KM  + F+G+GP KT+ITG+ +   G 
Sbjct  272   ITDALKVVPKNNRMPFIIHIKEGIYKERVKVTKKMAYVTFIGDGPNKTKITGNLNFGIGK  331

Query  2252  IGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYT  2073
             + T+ T+T+ I+G+ F A+NIG EN+AG    QAVALRVSAD  +F++C ID YQDTLY 
Sbjct  332   VKTFLTSTLTIEGEHFTAKNIGIENTAGPKGGQAVALRVSADYAVFYSCQIDGYQDTLYV  391

Query  2072  HSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIV  1893
             HS RQFYRDCT+SGTVDFIFG+A  + QNCK++VRK    Q CMVTAQGR D R +  +V
Sbjct  392   HSQRQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKAKRGQSCMVTAQGRSDVRESTGLV  451

Query  1892  LQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDT  1713
             L +C I+ EPA       NK +LGRPWKEFSRT+IM T IDD++ P GW  W+G   L T
Sbjct  452   LHNCHIMGEPAYIPVKSVNKAYLGRPWKEFSRTIIMKTTIDDVIDPAGWLPWKGDFALKT  511

Query  1712  CWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
              +YAE+ N G G++   RVKW G K+ +SPE A  +T G FL+ D  W+ + Q+P++
Sbjct  512   LYYAEHLNAGAGSNEALRVKWPGIKK-LSPEEALLYTGGRFLVGD-TWIPQTQVPYT  566



>ref|XP_010486213.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 23 
[Camelina sativa]
Length=564

 Score =   473 bits (1216),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 234/532 (44%), Positives = 341/532 (64%), Gaps = 21/532 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I   +K+V+ +C PTD+KETC  SL  A   + +P +LIK+ F VT+++I + + K+  
Sbjct  43    QIKKTTKAVQAVCEPTDFKETCVNSLMSASPKSTEPIDLIKLGFDVTIKSINEGLKKASE  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +A KDP    A + C++++ ++I+DL++  +    F ++++  +  DL+VWLSG+I
Sbjct  103   DVKAKASKDPEAKGAFELCEKVMVDAIEDLKKCMD--HGFSVDKIDAFVEDLRVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPG-----VN  2592
               Q+TC+D+FE    D  ++M+H+ KT  ELSSN LAM+T  + LL +    G      N
Sbjct  161   AFQQTCMDSFEEIKSDLMQEMRHIFKTTKELSSNSLAMVTSMSTLLPNSNATGSTGGFAN  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
             + R+LLT E       +  P +V    RRL+   P  +K + VVA+DGSGQ+K++ +AL 
Sbjct  221   YARKLLTTE-------DGIPTWVGREARRLMAA-PGPVKANAVVAQDGSGQFKTIADALN  272

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHT  2235
             AVP  N    VI IK G+Y E++ V RKM  + F+G+G TKT ITG+ +   G + T+ T
Sbjct  273   AVPKGNTVPFVIHIKQGIYKEKIMVTRKMPYVTFIGDGQTKTVITGNLNYGIGKVKTFLT  332

Query  2234  ATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQF  2055
             A + I+GD F  +NIG EN+AG    QAVALRVSAD  +FH+C  D +QDTLY HS+R F
Sbjct  333   APLTIEGDHFTMKNIGVENTAGPEGGQAVALRVSADYAVFHSCQFDGHQDTLYVHSHRHF  392

Query  2054  YRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEI  1875
             +RDCT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR D R +  +VL +C I
Sbjct  393   FRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKLGQSCMVTAQGRTDVRESTGLVLHNCHI  452

Query  1874  LAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEY  1695
               +PA       +K +LGRPWK+FSRT++M T IDD++ P GW  W G   L T +YAE+
Sbjct  453   TGDPAYIPVKSVSKSYLGRPWKQFSRTIVMKTMIDDVIDPAGWLAWSGDFALKTLYYAEH  512

Query  1694  QNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSP  1539
              N GPG++  +RVKW G  R ++P+ A  +T   FL     W+   Q+P++P
Sbjct  513   LNTGPGSNQAQRVKWPGI-RKLTPQDALLYTGDRFL-GGNTWIPPTQVPYTP  562



>ref|XP_006299740.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
 gb|EOA32638.1| hypothetical protein CARUB_v10015933mg [Capsella rubella]
Length=568

 Score =   472 bits (1215),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 238/534 (45%), Positives = 345/534 (65%), Gaps = 23/534 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAK-DTDDPKELIKVAFKVTVENITDAISKS--  2937
             +I   +K+V+ +CAPTD+KETC  SL  A   + +P +LIK+ F VT+++I + + K+  
Sbjct  43    QIKKTTKAVQAVCAPTDFKETCVNSLMSASPKSAEPLDLIKLGFDVTIKSINEGLKKASG  102

Query  2936  ELLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAI  2757
             ++  +A KDP    A + C++L+ ++I+DL++  +    F ++RV+ +  DL+VWLSG+I
Sbjct  103   DIKAKAGKDPDAKGAFELCEKLMVDAIEDLKKCMD--HGFSVDRVEVFVEDLRVWLSGSI  160

Query  2756  TQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGV-----N  2592
               Q+TC+D+FE    +  + M+++ +T+ ELSSN LAM++  + L  S    G+     N
Sbjct  161   AFQQTCMDSFEEIKSNLMQDMQNIFQTSKELSSNSLAMVSSMSTLFPSSNDTGLTGTLTN  220

Query  2591  FKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD---PASIKHDIVVAKDGSGQYKSVVE  2421
             + R+LL+AE       +  P +V    RRLL      P  +K + VVA+DGSGQ+K++ +
Sbjct  221   YARKLLSAE-------DGIPTWVRPEARRLLAAQGGGPGPVKANAVVAQDGSGQFKTIAD  273

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDG-IGT  2244
             AL AVP  N    VI IK G+Y E+V V RKM  + F+G+GP KT ITGS +   G + T
Sbjct  274   ALNAVPKGNTVPFVIHIKQGIYKEKVIVTRKMPYVTFIGDGPNKTVITGSLNFGIGKVKT  333

Query  2243  YHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSY  2064
             + T ++ I+GD F A+NIG EN+AG    QAVALRVSAD   F +C ID +QDTLY HS+
Sbjct  334   FLTGSITIEGDHFTAKNIGIENTAGPEGGQAVALRVSADYAAFQSCQIDGHQDTLYVHSH  393

Query  2063  RQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQS  1884
             RQFYRDCT+SGTVDFIFG+A  + QNCK++VRKP   Q CMVTAQGR + R +  +VL +
Sbjct  394   RQFYRDCTVSGTVDFIFGDAKCILQNCKIVVRKPKKGQSCMVTAQGRSNVRESTGLVLHN  453

Query  1883  CEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWY  1704
             C I  + A       +K +LGRPWKEFSRT++M T IDD++ P GW  W G   L T +Y
Sbjct  454   CHITGDSAYIPVKSESKAYLGRPWKEFSRTIVMKTAIDDVIDPAGWLPWSGDFALKTLYY  513

Query  1703  AEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             AE+ N GPG++   RVKW G K+ ++P+ A  +T   FL   E W+ + Q+P++
Sbjct  514   AEHLNTGPGSNQAHRVKWPGIKK-LTPQDALLYTGDKFL-GGETWIPQTQVPYT  565



>gb|KHN03341.1| Pectinesterase/pectinesterase inhibitor [Glycine soja]
Length=554

 Score =   471 bits (1212),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 347/563 (62%), Gaps = 35/563 (6%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCERSLA  3027
             ++ +K+A+  V+S+ L                  I  + ++V+ IC   +YKETC +SLA
Sbjct  11    KKKRKLAILSVSSLLLEGGD-------------SIVKSQRNVQVICESAEYKETCHKSLA  57

Query  3026  GAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDDL  2847
              A +T D KELI  AF  T E I   I  S L  E   D     A+D CKE+L  ++DD+
Sbjct  58    KASETSDLKELIITAFNATAEEIAKQIKNSTLYHELATDDMNKQAMDICKEVLGYAVDDM  117

Query  2846  ERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTANE  2667
              +S  K+E F+L ++ +Y  DLKVW++G +  Q+TC+D FENTT + G+ M  +L T+ E
Sbjct  118   HQSVRKLEEFELNKLNDYAYDLKVWIAGTLAHQQTCLDGFENTTNEAGKTMARVLNTSLE  177

Query  2666  LSSNGLAMITHFTELLQSLEIPGVNFKR-RLLTAETKGeeqeeEFPGFVDAATRRLLTTD  2490
             LS+N L ++   + L + L +   +    R L +E  G      FP +V    RRLL   
Sbjct  178   LSNNALDIVNGVSNLFKGLNLSSFSNNNNRKLLSEVDG------FPTWVSEGQRRLL--Q  229

Query  2489  PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVF  2310
              A  K D+VVA+DGSGQ K++ EAL+ VP KN +  VI++KAGVY E + + + +  +  
Sbjct  230   AADAKADVVVAQDGSGQVKTIHEALKLVPKKNKKPFVIYVKAGVYQEYIMINKHLTHVTM  289

Query  2309  VGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSA  2130
             +G+GPTKTRITGS++  +G          +    F+A NIGFEN+AGA KHQAVALRV+A
Sbjct  290   IGDGPTKTRITGSKNYING------GLAGVNAANFMAMNIGFENTAGAEKHQAVALRVTA  343

Query  2129  DMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQ  1950
             D  +F+NC++D +QDTLYT S RQFYRDCT++GT+DF+FG+A  VFQNCK IVRKPM NQ
Sbjct  344   DKAVFYNCNMDGFQDTLYTQSQRQFYRDCTVTGTIDFVFGDAVAVFQNCKFIVRKPMENQ  403

Query  1949  ECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFID  1770
             +CMVTA GR      +A+V QSC    EP + A + P   +LGRPW+ +++ +IM + ID
Sbjct  404   QCMVTAGGRTKIDSPSALVFQSCIFTGEPDVFALS-PKIAYLGRPWRVYAKVVIMDSQID  462

Query  1769  DIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1590
             DI VPEG+  W G+ + DT  Y E+ NRG GA+T  R+ W G+K  I+P  A  + PG F
Sbjct  463   DIFVPEGYMPWMGSAFKDTSTYYEFNNRGFGANTQGRITWPGFKV-ITPIEATDYYPGKF  521

Query  1589  L-MAD----EQWLGRAQIPFSPG  1536
               +A+    + W+  + +P+S G
Sbjct  522   FEIANSTERDSWIVGSGVPYSLG  544



>dbj|BAK06954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=563

 Score =   471 bits (1211),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 238/529 (45%), Positives = 325/529 (61%), Gaps = 14/529 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA-GAKDTDDPKELIKVAFKVTVENITDAISKSEL  2931
             E++T+ KS+K  C P DYK  CE++L   A +     EL K  FK T E I  A+ +S L
Sbjct  37    ELTTSLKSIKSFCQPVDYKVACEKTLEETAGNATTTTELAKAIFKATSERIEKAVRESSL  96

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             L +   DPRTS AL  CKELL  +IDDL+ +F+++  F++   K   +DLK WLS A+T 
Sbjct  97    LNDLKHDPRTSGALKNCKELLHYAIDDLKTTFDQLGGFEMTNFKHAMDDLKTWLSSALTY  156

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             QE+C+D F+NTT +   KM+  L  + EL+ N L+++  F + + +L++    F RRLL 
Sbjct  157   QESCLDGFDNTTTNAAAKMRKALNVSQELTENILSIVDEFGDTIANLDLS--IFSRRLLG  214

Query  2570  AETKGeeqeeEFPGFVDAATRRLLTTDPAS--IKHDIVVAKDGSGQYKSVVEALRAVPFK  2397
              +          P ++  A RRLL   P+    K D+ VA DGSG + ++ EAL  VP K
Sbjct  215   HDGA--------PRWMSDAKRRLLEVSPSEPDFKPDVTVAADGSGDFTTINEALAKVPLK  266

Query  2396  NDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQ  2217
              ++T V+++K G Y E V VPR ++ +V +G+G  KT ITG +S    I T  TAT+   
Sbjct  267   REDTYVMYVKEGTYKEYVSVPRNVSNLVMIGDGADKTVITGEKSFMMNITTKDTATMEAI  326

Query  2216  GDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTI  2037
             G+GF  R I  EN+AGA  HQAVALRV +D ++F+ C    YQDTLYTH+ RQ+YRDCT+
Sbjct  327   GNGFFMRGITVENTAGAKNHQAVALRVQSDQSVFYECQFHGYQDTLYTHTSRQYYRDCTV  386

Query  2036  SGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPAL  1857
             SGT+DFIFGNA VVFQNC + VRK M NQ+ ++TAQGRK+R  A  IV+ +C I   P  
Sbjct  387   SGTIDFIFGNAQVVFQNCLIQVRKCMENQQNIITAQGRKERHSAGGIVIHNCTIEPHPEF  446

Query  1856  KAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPG  1677
             K      + FLGRPWKE SRTL + + I D V PEGW  W G   L+TC+YAE +NRGPG
Sbjct  447   KDHMGRLRTFLGRPWKEHSRTLYIQSEIGDFVDPEGWLPWLGEFGLNTCYYAEVENRGPG  506

Query  1676  ASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFL  1530
             A    R  WKG K     +  +++T   F+   + W+ +  +PF PG L
Sbjct  507   ADMSNRATWKGVKHITYQQAEEKYTVERFIQG-QLWISKYGVPFIPGLL  554



>ref|XP_002528621.1| Pectinesterase-4 precursor, putative [Ricinus communis]
 gb|EEF33779.1| Pectinesterase-4 precursor, putative [Ricinus communis]
Length=568

 Score =   470 bits (1209),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 241/536 (45%), Positives = 337/536 (63%), Gaps = 21/536 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGAKDTDDPKELIKVAFKVTVENITDAISKSELL  2928
             ++ST++KSV +IC PTDYKE CE+SL   KDT DPKE +K A   TVE  T + + S  L
Sbjct  41    QVSTSTKSVAQICQPTDYKEACEKSLNSVKDTKDPKEYVKAAILATVEAATKSFNLSSNL  100

Query  2927  ----KEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
                 K AD D R S  L+ CK+LL++++ +L+ SF  V    +  + +   +L+ WLS  
Sbjct  101   IVDAKNADNDTRMS--LEDCKDLLQDAVQELQASFSTVGESTVNTMDQRIAELQNWLSAV  158

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEI-------P  2601
             ++ Q+TC++ F +   +   +M+  +  A +L+SN LA+I   +++L + ++        
Sbjct  159   VSYQDTCLEQFGDPNSNYKSQMQDGMVDATQLTSNALAIINALSQMLSTFDLKFDLTSES  218

Query  2600  GVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVE  2421
             G N  R+LL+ +  G       P + D A RRL+  D ++IK +I VA+DGSG  K+V E
Sbjct  219   GDN-SRKLLSVDETG------VPIWFDGAKRRLMAADTSAIKPNITVAQDGSGDVKTVTE  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             A+  +P K++   +I++KAG Y E   V +KM  +   G+GP KT ITGS SN  G  T 
Sbjct  272   AIAKIPLKSENPFIIYVKAGTYKEYPIVEKKMLNVFMYGDGPKKTIITGSHSNHTGWKTM  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
              +AT A  G GF+A+++GFEN+AG   HQAVALRV AD   F +C+ID YQDTLYT ++R
Sbjct  332   RSATFAALGPGFMAKSMGFENTAGPEGHQAVALRVQADRAAFFDCNIDGYQDTLYTQAHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFY  C+ISGT+DFIFG+A VV QN K++VRKPM NQ   VTA GR  +     ++LQ+C
Sbjct  392   QFYYGCSISGTIDFIFGDASVVIQNSKIVVRKPMKNQGNTVTAHGRTMKHETTGLILQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
             +I+AE  L       K +LGRPWK +SRT++M + I D++ PEGW  W G +YLDT  YA
Sbjct  452   QIIAEDLLFPERTVVKSYLGRPWKAYSRTIVMESEITDVIQPEGWLPWNGDLYLDTLDYA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY N G  ++TDKRVKWKG+    S + A+QFT GPF+   E WL    IPF  GF
Sbjct  512   EYANTGAASATDKRVKWKGFHVITSKKEAEQFTVGPFIQGGE-WLNGTGIPFKLGF  566



>gb|KHN20255.1| Putative pectinesterase/pectinesterase inhibitor 21 [Glycine 
soja]
Length=475

 Score =   466 bits (1199),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 234/479 (49%), Positives = 319/479 (67%), Gaps = 17/479 (4%)
 Frame = -1

Query  2930  LKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQ  2751
             + + + DP +  ALDTCK+L+  SID+ +RS E++  FDL  +    N L+VWLSGAIT 
Sbjct  1     MHKVENDPISKMALDTCKQLMDLSIDEFKRSLERMGKFDLNNLDNILNSLRVWLSGAITY  60

Query  2750  QETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLT  2571
             Q+TC+D F+NTT + G KMK+LL ++  +SSN LA+I+   +++  + +       R L 
Sbjct  61    QDTCLDGFKNTTNEAGNKMKNLLTSSMHMSSNALAIISEVADIVAKMNVN--KDGHRELV  118

Query  2570  AETKGeeqe----eEFPGFVD---AATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALR  2412
              +++G E      E  P +V+      RRLL   P  +K ++VVAKDGSG+YKS+ +AL+
Sbjct  119   EDSRGGEHVFGHEEVIPSWVEEDGVGVRRLLHESPHKVKPNVVVAKDGSGKYKSINQALK  178

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
              VP +N +  VI+IK GVY+E VEV +KM  +VFVG+G +KTRITG+++  DGI TY TA
Sbjct  179   KVPARNQKPFVIYIKEGVYHEYVEVTKKMTHVVFVGDGGSKTRITGNKNFVDGINTYRTA  238

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             +VAI GD FIA NIGFENSAG  KHQAVA+RV AD +IF+ C +D YQDTLY H+ RQFY
Sbjct  239   SVAILGDYFIAINIGFENSAGPEKHQAVAIRVQADRSIFYKCSMDGYQDTLYAHAMRQFY  298

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCTISGT+DF+FG+A VVFQNC  +VRK + NQ+C+VTAQGRK+R   +  V+Q   I+
Sbjct  299   RDCTISGTIDFVFGDAVVVFQNCTFVVRKALENQQCIVTAQGRKERHQPSGTVIQGSSIV  358

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYL---DTCWYA  1701
             +    K     NKV+L RPWK  SRT+ M T+I D++ PEG+  WQG   L   D+C+YA
Sbjct  359   SNHTEKF---DNKVYLARPWKNHSRTIFMDTYIGDLIQPEGYMPWQGPSGLSGMDSCFYA  415

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP  1524
             EY N GPG++  KRVKW+G    ++ E    + P  F   D+ W+    IP+S     P
Sbjct  416   EYNNTGPGSNKSKRVKWRGI-MTLTLESVSHYLPYKFFHGDD-WIKVTGIPYSSAVTAP  472



>gb|KHN04165.1| Putative pectinesterase/pectinesterase inhibitor 28 [Glycine 
soja]
Length=461

 Score =   460 bits (1183),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 236/458 (52%), Positives = 309/458 (67%), Gaps = 18/458 (4%)
 Frame = -1

Query  2894  ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTT  2715
             AL+TCK+L+  SI +L RS + +  F+L  V +   +LKVWLSGA+T Q+TC+D FENTT
Sbjct  2     ALETCKQLMDLSIGELTRSLDGINEFNLINVDKILMNLKVWLSGAVTYQDTCLDGFENTT  61

Query  2714  GDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEF  2535
              D G+KMK LL     +SSN LA++T   + +    I   +F RRLL        Q+ E 
Sbjct  62    SDAGKKMKDLLTIGMHMSSNALAIVTDLADTVNDWNITK-SFGRRLL--------QDSEL  112

Query  2534  PGFVDAATRRLLTTD--PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAG  2361
             P +VD    RLL  +  P   K ++ VA DGSG +KS+ EAL+ VP KN +  VI+IK G
Sbjct  113   PSWVDQ--HRLLNENASPFKRKPNVTVAIDGSGDFKSINEALKQVPEKNRKPFVIYIKEG  170

Query  2360  VYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFE  2181
             VY E VEV +KM  +VF+GEG  KTRI+G+++  DG  TY TATVAIQGD F+A N+GFE
Sbjct  171   VYQEYVEVTKKMTHVVFIGEGGKKTRISGNKNFIDGTNTYRTATVAIQGDHFVAINMGFE  230

Query  2180  NSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAP  2001
             NSAG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA 
Sbjct  231   NSAGPHKHQAVALRVQADKSIFYNCSMDGYQDTLYAHTMRQFYRDCTISGTIDFVFGNAL  290

Query  2000  VVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLG  1821
              VFQNC  +VRKPM NQ+C+VTAQGRK+R+  + IV+Q   I+++P   +    NK +L 
Sbjct  291   AVFQNCTFVVRKPMENQQCIVTAQGRKERQQPSGIVIQGGSIVSDPEFYSVRFENKAYLA  350

Query  1820  RPWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKW  1650
             RPWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG+   KRVKW
Sbjct  351   RPWKNYSRTIIMDTYIDDLIDADGYLPWQGLEGPSGMDTCFYAEYHNIGPGSDKSKRVKW  410

Query  1649  KGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
              G   N++ + A+ F+P  F    + W+    IP  PG
Sbjct  411   AGI-WNLNSKAARWFSPSKFFHGTD-WIEVTGIPCFPG  446



>ref|XP_007138937.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
 gb|ESW10931.1| hypothetical protein PHAVU_009G250600g [Phaseolus vulgaris]
Length=573

 Score =   463 bits (1192),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 242/572 (42%), Positives = 363/572 (63%), Gaps = 22/572 (4%)
 Frame = -1

Query  3206  EQNKKVAVTGVASIFLvacvvaatvsvgssg-----gGEISTASK-SVKEICAPTDYKET  3045
             +Q ++ A+ GV+SI LVA V A  V++            I+++ + SV+ +C  T+Y +T
Sbjct  9     DQQRRFAILGVSSILLVAVVAAVAVTLNQGEEPADDAAHITSSQRTSVEILCHSTEYAKT  68

Query  3044  CERSLAGAKDTD-DPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELL  2868
             C++SLA   D + D + L+K A   T   +   I  S L ++  KD  T  A++ CKE+ 
Sbjct  69    CKKSLAKVPDRNADTRALVKAAINATAVELLSHIKNSTLYRDLGKDNMTRQAVEICKEVF  128

Query  2867  KNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKH  2688
             + +I  +++S + ++ F+  ++ EY  DLKVW+SG++T Q TC+  FE+T    G KM  
Sbjct  129   EYAIHGIQKSVDTIDKFEYGKLSEYIYDLKVWISGSLTHQYTCLYGFEHTDTKAGAKMNK  188

Query  2687  LLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATR  2508
             +L T+ EL+SN L MI   + +L+ L +      RRLL+ +   +   +++P +V    R
Sbjct  189   VLNTSLELTSNALDMIDVISGILKDLNMTSFG-NRRLLSQD---KVPLDDYPSWVSEGKR  244

Query  2507  RLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRK  2328
             RLL+    S K  +VVA+DGSGQ+K++ EAL+ VP  N E  VI++KAGVY E V++   
Sbjct  245   RLLSQGTESAK--VVVAQDGSGQFKTIKEALKTVPPNNAEPYVIYVKAGVYKENVDMSML  302

Query  2327  MNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAV  2148
             M  +  +G+GPTKTR +GS +  DG+ TY TAT A+    F+A+N+GFEN+AG+ KHQAV
Sbjct  303   MTHVTIIGDGPTKTRFSGSLNYDDGVQTYKTATFAVNAANFMAKNVGFENTAGSKKHQAV  362

Query  2147  ALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVR  1968
             ALRV+AD  +F NCH+D +QDTLY  S RQFYRDC ++GTVDF+FG+A  +FQ CK+IVR
Sbjct  363   ALRVTADQAVFVNCHMDGFQDTLYAQSQRQFYRDCIVTGTVDFVFGDAVGMFQKCKLIVR  422

Query  1967  KPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKV-FLGRPWKEFSRTL  1791
             KP+  Q+CMVTA GR      +A+V Q C    +P L++    +KV +LGRPW+ FS+ +
Sbjct  423   KPLNKQKCMVTAGGRVKSDSPSALVFQGCHFTGDPELRSL--ADKVAYLGRPWRAFSKVI  480

Query  1790  IMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAK  1611
             IM + ID+I +PEG+  W G  ++DTC Y EY N+GP A T  RVKW G+K  ++ + A 
Sbjct  481   IMESQIDNIFLPEGYMGWMGISFMDTCTYYEYNNKGPDADTSSRVKWPGFKV-LTAQEAS  539

Query  1610  QFTPGPFL---MADEQ--WLGRAQIPFSPGFL  1530
              + P  F     +DE+  W+ R+++P+S G +
Sbjct  540   DYYPSKFFELANSDERDDWIVRSKVPYSLGAM  571



>emb|CDY34927.1| BnaA01g32580D [Brassica napus]
Length=559

 Score =   462 bits (1190),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 248/569 (44%), Positives = 355/569 (62%), Gaps = 26/569 (5%)
 Frame = -1

Query  3206  EQNKKVAVTGVAS--IFLvacvvaatvsvgssggGEISTASKSVKEICAPTDYKETCERS  3033
             ++ KK  + GV S  + ++   VA   S  S    EI   +K+VK +CAPTDYKETC +S
Sbjct  6     DKKKKCIIAGVVSGLLVIMVVSVAIIASKNSPNENEIRQNTKAVKTVCAPTDYKETCLKS  65

Query  3032  LAGAK-DTDDPKELIKVAFKVTVENITDAISKS--ELLKEADKDPRTSDALDTCKELLKN  2862
             L  A   + +P  LIK++F VT+++I + + K+  ++  +ADK P   DA + C++++ +
Sbjct  66    LMDASPKSTEPLALIKLSFNVTIKSIQEGLKKASEDVKHKADKHPEAKDAFELCEKVMND  125

Query  2861  SIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLL  2682
             +I DL++  +      ++ ++ +  DL+VW+SG+I  Q+TCID FE         M ++ 
Sbjct  126   AIADLKKCVD--HKVSVDEIERFIKDLRVWISGSIAFQQTCIDTFEEIKSTLKHDMINIF  183

Query  2681  KTANELSSNGLAMITHF----TELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAA  2514
             K + +LSSN LAM+T      TEL  + E    N  R+LL+ E       +  P +V   
Sbjct  184   KRSRQLSSNSLAMVTDLNSNATELTGAFE----NNARKLLSTE-------DGVPTWVGPE  232

Query  2513  TRRLLTTDPAS-IKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEV  2337
              RRL+       +K + VVA+DGSGQ+K++ +AL AVP +N    VI IK GVY E+V V
Sbjct  233   ARRLMGAPGGPPVKANAVVAQDGSGQFKTINDALNAVPKENKVPFVIHIKEGVYKEKVVV  292

Query  2336  PRKMNKIVFVGEGPTKTRITGSRSNKDG-IGTYHTATVAIQGDGFIARNIGFENSAGAAK  2160
              RKM  + F+G+GPTKT I+GS +   G + TY TA + ++G+ F A+ IG EN+AG   
Sbjct  293   TRKMPYVTFIGDGPTKTVISGSLNFGIGKVKTYLTAPLTVEGEHFTAKGIGMENTAGPEG  352

Query  2159  HQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCK  1980
              QAVALRVS D  +F +C ID YQDTLY HS RQFYRDCT+SGTVDFIFG++  + QNCK
Sbjct  353   GQAVALRVSGDYAVFFDCQIDGYQDTLYVHSQRQFYRDCTVSGTVDFIFGDSQCILQNCK  412

Query  1979  MIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFS  1800
             ++VRKPMA Q CMVTAQGR D R    IV+ +C I+ +PA       +K +LGRPWKEFS
Sbjct  413   IVVRKPMAGQSCMVTAQGRSDVREPTGIVVHNCHIVGDPAYIPVRTASKAYLGRPWKEFS  472

Query  1799  RTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPE  1620
             RT+++ T +DD++ P GW  W G   L T +YAE+ N GPGA+  +RVKW G K+ ++ E
Sbjct  473   RTIVIKTTVDDVIDPAGWLPWSGDFALKTLYYAEHLNVGPGANQAQRVKWPGIKK-LTHE  531

Query  1619  VAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
              A  +T   FL  +  W+ R Q+P++ G 
Sbjct  532   QALSYTCDRFLSGN-TWIPRTQVPYTAGM  559



>ref|NP_001060715.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAC83510.1| putative pectin methylesterase [Oryza sativa Japonica Group]
 dbj|BAF22629.1| Os07g0691100 [Oryza sativa Japonica Group]
 dbj|BAG92656.1| unnamed protein product [Oryza sativa Japonica Group]
Length=566

 Score =   456 bits (1172),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 238/543 (44%), Positives = 322/543 (59%), Gaps = 22/543 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSL--AGAKDTDDPKELIKVAFKVTVENITDAISKSE  2934
             E+ST+ KSVK  C PTDY++TCE  L  A       P +L K  F VT E I+ AIS+S 
Sbjct  37    ELSTSVKSVKAFCQPTDYQQTCEEELGKAAGNGASSPTDLAKAMFAVTSEKISKAISESS  96

Query  2933  LLKEADKDPRTSDALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAIT  2754
              L+E   D RTS AL  CKELL+ ++DDL+ SFEK+  F++    +  +DL+ WLS A+T
Sbjct  97    TLEELKNDKRTSGALQNCKELLEYAVDDLKTSFEKLGGFEMTNFHKAVDDLRTWLSAALT  156

Query  2753  QQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLL  2574
              Q TC+D F NTT D  +KMK  L ++ EL+ + LA++  F+  L SL I     +RRLL
Sbjct  157   YQGTCLDGFLNTTTDAADKMKSALNSSQELTEDILAVVDQFSATLGSLNIG----RRRLL  212

Query  2573  TAETKGeeqeeEFPGFVDAATRRLLT------TDPASIKHDIVVAKDGSGQYKSVVEALR  2412
               +          P ++    RR L         P   K D+ VA DGSG  K++ EA+ 
Sbjct  213   ADD--------GMPVWMSEGGRRQLLEAAGPEAGPVEFKPDVTVAADGSGDVKTIGEAVA  264

Query  2411  AVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTA  2232
              VP KN E   I++KAG YNE V V R    +  +G+G  KT ITG+++ K  + T  TA
Sbjct  265   KVPPKNKERYTIYVKAGTYNEYVSVGRPATNVNMIGDGIGKTIITGNKNFKMNLTTKDTA  324

Query  2231  TVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFY  2052
             T+   G+GF  R I  EN+AG   HQAVALR  +DM +F+ C  D YQDTLY H+ RQF+
Sbjct  325   TMEAIGNGFFMRGITVENTAGPENHQAVALRAQSDMAVFYQCEFDGYQDTLYPHAQRQFF  384

Query  2051  RDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEIL  1872
             RDCT+SGT+DFIFGN+ VV QNC +  RKPM NQ  ++TAQGR+++R A   V+ +C + 
Sbjct  385   RDCTVSGTIDFIFGNSQVVLQNCLLQPRKPMDNQVNIITAQGRREKRSAGGTVIHNCTVA  444

Query  1871  AEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAEYQ  1692
               P L+      K +L RPWKE+SRT+ +   I  +V P GW  W G   LDT +YAE  
Sbjct  445   PHPDLEKFTDKVKTYLARPWKEYSRTIFVQNEIGAVVDPVGWLEWNGNFALDTLYYAEVD  504

Query  1691  NRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGFLQP*NKQ  1512
             N GPGA   KR KWKG +     +V K+FT   F+   E ++ +  +P+ PG L P  +Q
Sbjct  505   NHGPGADMSKRAKWKGVQSLTYQDVQKEFTVEAFIQGQE-FIPKFGVPYIPGLL-PQTQQ  562

Query  1511  AKL  1503
              ++
Sbjct  563   GRM  565



>ref|XP_007144962.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
 gb|ESW16956.1| hypothetical protein PHAVU_007G198100g [Phaseolus vulgaris]
Length=566

 Score =   455 bits (1171),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 245/569 (43%), Positives = 357/569 (63%), Gaps = 38/569 (7%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaat--------vsvgssggGEISTASKSVKEICAPTDYKETC  3042
             +++AV GV++IFLVA VVA           +  S     + ++ K+V+ +C PT Y++ C
Sbjct  10    RRIAVIGVSTIFLVAMVVAIAFSVNYNSDSNNDSQQNNHVVSSVKAVRTLCKPTYYQKEC  69

Query  3041  ERSL-AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLK  2865
             E+SL   A +T D +ELIK+ F +T++ I     K + +  A+++PR   AL TCK+L+ 
Sbjct  70    EKSLREEAGNTTDSRELIKIVFNITMKKIGKGQHKIDHMLGAERNPRARMALATCKQLMN  129

Query  2864  NSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHL  2685
              S+ + +R+ EK+  FDL+ +      LKVWLSGAIT QETC+D F NTT   G +M++L
Sbjct  130   LSVGEFKRALEKMGKFDLDNLNNILTSLKVWLSGAITYQETCLDGFHNTTVQAGNRMRNL  189

Query  2684  LKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFV------  2523
             L T   +SSN LA+IT     +   E+  VN KR+L+  +     Q+E     +      
Sbjct  190   LTTTMHMSSNALAIITALANTVS--ELSDVN-KRQLVEDDEHVFGQDEVISSLIFDDDDD  246

Query  2522  DAATRRLLTTDPASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERV  2343
                 RRLL  +P  +K + +VAKDGS ++KS+ +AL+ VP KN +  VI+I+ GVYNE +
Sbjct  247   GGGVRRLLYQNPYKLKANAIVAKDGSEKFKSIDQALQKVPKKNKKPFVIYIREGVYNEYI  306

Query  2342  EVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAA  2163
             EV + M ++VFVG+G  KTRITG+R+  DG+ TY TA+V            GFENSAG  
Sbjct  307   EVTKTMTRVVFVGDGANKTRITGNRNFLDGLNTYKTASV------------GFENSAGPH  354

Query  2162  KHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNC  1983
             KHQAVA+RV AD +IF+ C +D Y+DTLY H+ RQFYRDCTISGT DF+FG+A  VFQNC
Sbjct  355   KHQAVAIRVQADRSIFYRCSMDGYEDTLYVHAMRQFYRDCTISGTTDFVFGDAVAVFQNC  414

Query  1982  KMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEF  1803
               +VRKP+ NQ  +VTAQGRK++   + IV+Q   I++   +K      K +L RP K +
Sbjct  415   TFVVRKPLENQPLIVTAQGRKEKHQPSGIVIQGSSIVSNHRMKF---DKKAYLARPLKNY  471

Query  1802  SRTLIMFTFIDDIVVPEGWSIW---QGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRN  1632
             SRT+ M T+++  + P+G+  W   QG   ++TC+YAEY N GPG++  KRVKW G K+ 
Sbjct  472   SRTIFMNTYMEGFIEPDGYVPWKGPQGLSGMNTCFYAEYNNSGPGSNKSKRVKWPGIKK-  530

Query  1631  ISPEVAKQFTPGPFLMADEQWLGRAQIPF  1545
             ++ + A +++P  F   D+ W+   +IP+
Sbjct  531   LNSKSASEYSPLNFFHGDD-WVKITRIPY  558



>gb|KEH37213.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=565

 Score =   454 bits (1168),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 242/563 (43%), Positives = 342/563 (61%), Gaps = 22/563 (4%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDYKETCERSL  3030
             KK A+ GV+ I LVA V    VS+   G GE    IS + K+V  +C  T +KETC ++L
Sbjct  14    KKHALLGVSCILLVAMVGVVAVSLTKGGDGEQKAHISNSQKNVDMLCQSTKFKETCHKTL  73

Query  3029  AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDD  2850
               A  ++  K  IK A   T E +   I+ S L +E   D  T  A++ C E+L  ++D 
Sbjct  74    EKASFSN-MKNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAVDG  132

Query  2849  LERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTAN  2670
             + +S   ++ FD  ++ EY  D+KVWL+G ++ Q+TC+D F NT    GE M  +LKT+ 
Sbjct  133   IHKSVGTLDQFDFHKLSEYAFDIKVWLTGTLSHQQTCLDGFVNTKTKAGETMTKVLKTSM  192

Query  2669  ELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD  2490
             ELSSN + M+   + +++          RRLL+ +          P +V    R LL   
Sbjct  193   ELSSNAIDMMDVVSHIIKGFNPSQYGVSRRLLSDD--------GIPSWVSDGHRHLLA--  242

Query  2489  PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVF  2310
               ++K + VVA+DGSGQ+K++ +AL+ VP  N    VI++KAGVY E V V ++MN +  
Sbjct  243   GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAKEMNYVTV  302

Query  2309  VGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSA  2130
             +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG  K+QAVALRV+A
Sbjct  303   IGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTNKNQAVALRVTA  362

Query  2129  DMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQ  1950
             D  IFHNC +D +QDTLY  S RQFYRDC ISGT+DF+FG+A  VFQNCK+I R P   Q
Sbjct  363   DQAIFHNCQMDGFQDTLYVQSQRQFYRDCAISGTIDFVFGDAFGVFQNCKLICRVPAKGQ  422

Query  1949  ECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFID  1770
             +C+VTA GR  +  A+A+V  S     EPAL +  P    +LGRPWK +S+ +IM + ID
Sbjct  423   KCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWKLYSKVVIMDSTID  481

Query  1769  DIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1590
              +  PEG+    G  + DTC + EY N+GPGA T+ RVKW G K  ++  VA ++ PG F
Sbjct  482   AMFAPEGYMPMVGGAFKDTCTFYEYNNKGPGADTNLRVKWHGVKV-LTSNVAAEYYPGKF  540

Query  1589  L-----MADEQWLGRAQIPFSPG  1536
                    A + W+ ++ +P+S G
Sbjct  541   FEIVNATARDTWIVKSGVPYSLG  563



>emb|CAB65291.1| pectin methyl-esterase PEF1 [Medicago truncatula]
Length=565

 Score =   454 bits (1167),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 242/563 (43%), Positives = 342/563 (61%), Gaps = 22/563 (4%)
 Frame = -1

Query  3197  KKVAVTGVASIFLvacvvaatvsvgssggGE----ISTASKSVKEICAPTDYKETCERSL  3030
             KK A+ GV+ I LVA V    VS+   G GE    IS + K+V  +C  T +KETC ++L
Sbjct  14    KKHALLGVSCILLVAMVGVVAVSLTKGGDGEQKAHISNSQKNVDMLCQSTKFKETCHKTL  73

Query  3029  AGAKDTDDPKELIKVAFKVTVENITDAISKSELLKEADKDPRTSDALDTCKELLKNSIDD  2850
               A  ++  K  IK A   T E +   I+ S L +E   D  T  A++ C E+L  ++D 
Sbjct  74    EKASFSN-MKNRIKGALGATEEELRKHINNSALYQELATDSMTKQAMEICNEVLDYAVDG  132

Query  2849  LERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTGDTGEKMKHLLKTAN  2670
             + +S   ++ FD  ++ EY  D+KVWL+G ++ Q+TC+D F NT    GE M  +LKT+ 
Sbjct  133   IHKSVGTLDQFDFHKLSEYAFDIKVWLTGTLSHQQTCLDGFVNTKTHAGETMAKVLKTSM  192

Query  2669  ELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTD  2490
             ELSSN + M+   + +L+          RRLL+ +          P +V    R LL   
Sbjct  193   ELSSNAIDMMDVVSRILKGFHPSQYGVSRRLLSDD--------GIPSWVSDGHRHLLA--  242

Query  2489  PASIKHDIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVF  2310
               ++K + VVA+DGSGQ+K++ +AL+ VP  N    VI++KAGVY E V V ++MN +  
Sbjct  243   GGNVKANAVVAQDGSGQFKTLTDALKTVPPTNAAPFVIYVKAGVYKETVNVAKEMNYVTV  302

Query  2309  VGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSA  2130
             +G+GPTKT+ TGS +  DGI TY TAT  + G  F+A++IGFEN+AG +K QAVALRV+A
Sbjct  303   IGDGPTKTKFTGSLNYADGINTYKTATFGVNGANFMAKDIGFENTAGTSKFQAVALRVTA  362

Query  2129  DMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQ  1950
             D  IFHNC +D +QDTL+  S RQFYRDC ISGT+DF+FG+A  VFQNCK+I R P   Q
Sbjct  363   DQAIFHNCQMDGFQDTLFVESQRQFYRDCAISGTIDFVFGDAFGVFQNCKLICRVPAKGQ  422

Query  1949  ECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFID  1770
             +C+VTA GR  +  A+A+V  S     EPAL +  P    +LGRPWK +S+ +IM + ID
Sbjct  423   KCLVTAGGRDKQNSASALVFLSSHFTGEPALTSVTPKLS-YLGRPWKLYSKVVIMDSTID  481

Query  1769  DIVVPEGWSIWQGTMYLDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPF  1590
              +  PEG+    G  + DTC + EY N+GPGA T+ RVKW G K  ++  VA ++ PG F
Sbjct  482   AMFAPEGYMPMVGGAFKDTCTFYEYNNKGPGADTNLRVKWHGVKV-LTSNVAAEYYPGKF  540

Query  1589  L-----MADEQWLGRAQIPFSPG  1536
                    A + W+ ++ +P+S G
Sbjct  541   FEIVNATARDTWIVKSGVPYSLG  563



>ref|XP_009369703.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   453 bits (1166),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 240/536 (45%), Positives = 339/536 (63%), Gaps = 18/536 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGA--KDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++ST+SK+V  IC PTDYKE C  SL      D+  PK+LI+ A   T++ +  AI  S 
Sbjct  37    QLSTSSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSS  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
              + ++ K   ++   A+D CK+LL+++I DL+ SF  V + ++  + +   +L+ W S  
Sbjct  97    SIAKSFKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP------G  2598
             I+ Q++C+D       +  + MK  L  A +L+SN LA+ +   ++L++  I        
Sbjct  157   ISFQQSCLDGLPQE--ELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRP  214

Query  2597  VNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVE  2421
              +  RRLL  E  G +Q   +P +  AA RRLL   D   +K + VVAKDGSGQ+K++  
Sbjct  215   TSSSRRLLEQENDGHDQ---YPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGA  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             AL A P       +I++KAGVYNE V V +    +   G+GP  T +TGS+S  DGI T 
Sbjct  272   ALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQ  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
             +TAT A  G+GF+A+ +GF+N+AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++R
Sbjct  332   NTATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYR+C ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C
Sbjct  392   QFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
              I+ E  L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YA
Sbjct  452   RIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  512   EYGNRGPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_004298254.1| PREDICTED: putative pectinesterase/pectinesterase inhibitor 28-like 
[Fragaria vesca subsp. vesca]
Length=577

 Score =   454 bits (1167),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 242/543 (45%), Positives = 333/543 (61%), Gaps = 22/543 (4%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGA--KDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++S++SK+V  +C PTDYKE C  SLAGA    +  PK+LI+ A + TV+ +  AI KS 
Sbjct  37    KLSSSSKAVIAMCEPTDYKEACVDSLAGAAKNQSASPKDLIRSAVEYTVQQVKAAIEKSG  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
             ++ +  KD  ++   A D C ELL+++I+ L+ S   + + D+ ++ E   DLK W S A
Sbjct  97    IIIKEAKDVNSTGKMAFDDCNELLESAIESLQYSLLTLVDADMPKINEKEADLKNWFSAA  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP-----GV  2595
             ++ QE+CID       D  ++M   ++ A +L+SN LA+++  + +L +  IP       
Sbjct  157   MSFQESCIDGIPYE--DLKKQMSEAMQNAEQLTSNALAIVSSLSNILGNFNIPLKPNNNP  214

Query  2594  NFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDPA---------SIKHDIVVAKDGSG  2442
             +  RRLL  E +  ++   FP +  AA R+L+              ++K + VVAKDGSG
Sbjct  215   STARRLLDVEME-TDEHGTFPTWFSAADRKLIAKQNKKNNNAGNGQAVKPNAVVAKDGSG  273

Query  2441  QYKSVVEALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSN  2262
             QYK++  AL A P       VI++KAG+YNE V V +  N +   G+GP +T +TG +S 
Sbjct  274   QYKTIGAALAAYPKGFQGRYVIYVKAGIYNEYVTVAKNQNNVFMYGDGPRETMVTGRKSF  333

Query  2261  KDGIGTYHTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDT  2082
              DGI T  TAT  + G GFIAR +GF+N+AG  KHQAVALRV +DM+ F NC +D YQDT
Sbjct  334   ADGITTQDTATFIVVGHGFIARGMGFQNTAGPEKHQAVALRVQSDMSAFFNCRMDGYQDT  393

Query  2081  LYTHSYRQFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAA  1902
             LY  +YRQFYR+C ISGTVDFIFG++  V QN  +IVRKP+ANQ+  VTA GRKD+R + 
Sbjct  394   LYVQAYRQFYRNCVISGTVDFIFGDSTTVIQNSLIIVRKPLANQKNTVTANGRKDQREST  453

Query  1901  AIVLQSCEILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMY  1722
              +V+Q+C I+ E AL         +LGRPWK +SRT+IM +   D + P GW  WQG   
Sbjct  454   GLVIQNCRIVPEEALFPLRFQIMSYLGRPWKMYSRTVIMESEFGDFIQPAGWLEWQGNFA  513

Query  1721  LDTCWYAEYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFS  1542
             LDT +YAEY NRGPGA T  RVKWKG+       VA QFTPG FL A   WL     P+ 
Sbjct  514   LDTLYYAEYANRGPGAVTTGRVKWKGFHVITDRNVALQFTPGNFL-AGGLWLKGTGAPYF  572

Query  1541  PGF  1533
              G 
Sbjct  573   LGL  575



>ref|XP_008390484.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=566

 Score =   452 bits (1162),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 241/535 (45%), Positives = 337/535 (63%), Gaps = 17/535 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGA--KDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++ST+SK+V  IC PTDYKE C  SL      D+  PK+LI+ A   T++ +  AI  S 
Sbjct  37    QLSTSSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTVKSAIENSN  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
              + ++ K   ++   A+D CK+LL+++I DL+ SF  V + ++  + +   +L+ W S  
Sbjct  97    SIAKSFKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKR-  2583
             I+ Q++C+D       +  + MK  L  A +L+SN LA+ T   ++L++  I      R 
Sbjct  157   ISFQQSCLDGIPQE--ELQKLMKDSLLNATQLTSNALAIATSIAQILENFNITLNKDLRP  214

Query  2582  ----RLLTAETKGeeqeeEFPGFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVEA  2418
                 R+L  E  G  Q   +P +  AA RRLL   D   +K + VVAKDGSGQ+K++  A
Sbjct  215   TSSSRILEQENDGHGQ---YPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGAA  271

Query  2417  LRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYH  2238
             L A P       +I++KAGVYNE V V +    +   G+GP KT +TGS+S  DGI T +
Sbjct  272   LAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQVNVFMYGDGPRKTMVTGSKSFADGITTQN  331

Query  2237  TATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQ  2058
             TAT A  G+GF+A+ +GF+N+AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++RQ
Sbjct  332   TATFAAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHRQ  391

Query  2057  FYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCE  1878
             FYR+C ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C 
Sbjct  392   FYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNCR  451

Query  1877  ILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYAE  1698
             I+ E  L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YAE
Sbjct  452   IVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYAE  511

Query  1697  YQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             Y NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL    IP+  G 
Sbjct  512   YGNRGPGAATNQRVRWKGYHV-INRNDAVQFTAGPFLLAD-RWLKTTGIPYFAGL  564



>ref|XP_009359792.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=567

 Score =   451 bits (1161),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 239/536 (45%), Positives = 339/536 (63%), Gaps = 18/536 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLAGA--KDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++ST+SK+V  IC PTDYKE C  SL      D+  PK+LI+ A   T++ +  AI  S 
Sbjct  37    QLSTSSKAVAAICDPTDYKEACIDSLGSVAKNDSATPKDLIQAAIDSTIKTMKSAIENSS  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
              + ++ K   ++   A+D CK+LL+++I DL+ SF  V + ++  + +   +L+ W S  
Sbjct  97    SIAKSFKAINSTGKMAMDDCKDLLESAIADLQASFSFVGDSNMHTMHDREEELRNWFSAV  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP------G  2598
             I+ Q++C+D       +  + MK  L  A +L+SN LA+ +   ++L++  I        
Sbjct  157   ISFQQSCLDGIPQE--ELQKLMKDSLLNATQLTSNALAIASSIAQILENFNITLNKDLRP  214

Query  2597  VNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLT-TDPASIKHDIVVAKDGSGQYKSVVE  2421
              +  RRLL  E  G +Q   +P +  AA RRLL   D   +K + VVAKDGSGQ+K++  
Sbjct  215   TSSSRRLLEQENDGHDQ---YPSWFPAADRRLLAKQDNGGVKPNAVVAKDGSGQFKTIGA  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             AL A P       +I++KAGVYNE V V +    +   G+GP  T +TGS+S  DGI T 
Sbjct  272   ALAAYPKGLQGRYIIYVKAGVYNEYVTVTKNQINVFMYGDGPRNTMVTGSKSFADGITTQ  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
             +TAT +  G+GF+A+ +GF+N+AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++R
Sbjct  332   NTATFSAIGNGFLAKGMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYAQTHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYR+C ISGTVDFIFG++P + QN  +IVRKPM NQ+  VTAQGR+DRR   AIV+Q+C
Sbjct  392   QFYRNCVISGTVDFIFGDSPTLIQNSLIIVRKPMDNQKNTVTAQGREDRRENTAIVIQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
              I+ E  L         +LGRPWK ++RT+IM + + D + P GW  W G   LDT +YA
Sbjct  452   RIVPEEVLFPLRFKIPSYLGRPWKTYARTVIMESELGDFIQPAGWLPWSGNFALDTLYYA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY NRGPGA+T++RV+WKGY   I+   A QFT GPFL+AD +WL  + IP+  G 
Sbjct  512   EYGNRGPGAATNQRVRWKGYHV-INRNDALQFTAGPFLLAD-RWLKTSGIPYFAGL  565



>ref|XP_007222606.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
 gb|EMJ23805.1| hypothetical protein PRUPE_ppa003528mg [Prunus persica]
Length=568

 Score =   451 bits (1160),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 235/536 (44%), Positives = 336/536 (63%), Gaps = 17/536 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA--GAKDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++ST+SK+V  IC PTDYKE C  SL+     ++   K+LI+ A   T+  +  AI  S 
Sbjct  37    QLSTSSKAVAAICEPTDYKEACINSLSKVAKNESATAKDLIQAAIDSTISTVKSAIDNSG  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
              + ++  +  ++   A+D CK+LL+++I DL+ SF  V + D+  + +  ++LK WLS  
Sbjct  97    NIAKSFSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAV  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP------G  2598
             I+ Q++C+D       +  ++MK  L  A +L+SN LA+ +  +E+LQS  I        
Sbjct  157   ISFQQSCLDGIPQE--ELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRN  214

Query  2597  VNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP-ASIKHDIVVAKDGSGQYKSVVE  2421
              +  RRLL        ++ ++P +  AA RRLL +     ++ + VVAKDGSGQYK++  
Sbjct  215   PSSSRRLLEHNND---EQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGA  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             AL A P       +I++KAG+YNE V V +    +   G+GP KT +TGS+S  DGI T 
Sbjct  272   ALAAYPKGLKGRYIIYVKAGIYNEYVTVTKDQVNVFMYGDGPRKTMVTGSKSWADGITTQ  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
             +TAT A  G GF+A+ +GF+N+AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++R
Sbjct  332   NTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYR+C ISGTVDFIFG++P + QNC +IVRKPM  Q+  VTAQGR+D+R    IV+Q+C
Sbjct  392   QFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
              I+ E AL       K +LGRPWK +SR +IM + + D + P GW  W G   LDT ++A
Sbjct  452   RIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY NRGPGA T+ RV+WKG+    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  512   EYGNRGPGAVTNGRVRWKGFHVIRNRNEALQFTTGPFLLGD-QWLRNTGVPYFTGL  566



>ref|XP_008223522.1| PREDICTED: pectinesterase-like [Prunus mume]
Length=568

 Score =   451 bits (1160),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 234/536 (44%), Positives = 336/536 (63%), Gaps = 17/536 (3%)
 Frame = -1

Query  3107  EISTASKSVKEICAPTDYKETCERSLA--GAKDTDDPKELIKVAFKVTVENITDAISKSE  2934
             ++ST+SK+V  IC PTDYKE C  SL+     ++   K+LI+ A   T+  +  AI  S 
Sbjct  37    QLSTSSKAVAAICEPTDYKEACINSLSKVAKNESATAKDLIQAAIDSTISTVKSAIDNSG  96

Query  2933  LLKEADKDPRTSD--ALDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGA  2760
              + ++  +  ++   A+D CK+LL+++I DL+ SF  V + D+  + +  ++LK WLS  
Sbjct  97    NIAKSFSNLNSTGKMAMDDCKDLLESAIADLQASFSYVGDGDMHTMHDREDELKNWLSAV  156

Query  2759  ITQQETCIDAFENTTGDTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIP------G  2598
             I+ Q++C+D       +  ++MK  L  A +L+SN LA+ +  +E+LQS  I        
Sbjct  157   ISFQQSCLDGIPQE--ELQKQMKDGLLNATQLTSNALAIASSISEILQSFNITLNKDLRN  214

Query  2597  VNFKRRLLTAETKGeeqeeEFPGFVDAATRRLLTTDP-ASIKHDIVVAKDGSGQYKSVVE  2421
              +  RRLL        ++ ++P +  AA RRLL +     ++ + VVAKDGSGQYK++  
Sbjct  215   PSSSRRLLEHNND---EQGQYPSWFRAADRRLLASQSNGQVRPNAVVAKDGSGQYKTIGA  271

Query  2420  ALRAVPFKNDETVVIFIKAGVYNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTY  2241
             AL A P       +I++KAG+YNE + V +    +   G+GP KT +TGS+S  DGI T 
Sbjct  272   ALAAYPKGLKGRYIIYVKAGIYNEYITVTKDQVNVFMYGDGPRKTMVTGSKSWADGITTQ  331

Query  2240  HTATVAIQGDGFIARNIGFENSAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYR  2061
             +TAT A  G GF+A+ +GF+N+AGA KHQAVALRV ++M+ F NC +DAYQDTLY  ++R
Sbjct  332   NTATFAAIGSGFLAKAMGFQNTAGAQKHQAVALRVQSEMSAFFNCRMDAYQDTLYVQTHR  391

Query  2060  QFYRDCTISGTVDFIFGNAPVVFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSC  1881
             QFYR+C ISGTVDFIFG++P + QNC +IVRKPM  Q+  VTAQGR+D+R    IV+Q+C
Sbjct  392   QFYRNCVISGTVDFIFGDSPTLIQNCLIIVRKPMDGQQNTVTAQGRQDKRETTGIVIQNC  451

Query  1880  EILAEPALKAANPPNKVFLGRPWKEFSRTLIMFTFIDDIVVPEGWSIWQGTMYLDTCWYA  1701
              I+ E AL       K +LGRPWK +SR +IM + + D + P GW  W G   LDT ++A
Sbjct  452   RIVPEQALFPTRFKTKSYLGRPWKTYSRAVIMESELGDFIQPAGWLEWSGNFALDTLYFA  511

Query  1700  EYQNRGPGASTDKRVKWKGYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPGF  1533
             EY NRGPGA T+ RV+WKG+    +   A QFT GPFL+ D QWL    +P+  G 
Sbjct  512   EYGNRGPGAVTNGRVRWKGFHVIRNRNEALQFTAGPFLLGD-QWLRNTGVPYFTGL  566



>ref|XP_007149854.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
 gb|ESW21848.1| hypothetical protein PHAVU_005G104100g [Phaseolus vulgaris]
Length=460

 Score =   446 bits (1148),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 304/457 (67%), Gaps = 18/457 (4%)
 Frame = -1

Query  2891  LDTCKELLKNSIDDLERSFEKVENFDLERVKEYTNDLKVWLSGAITQQETCIDAFENTTG  2712
             LDTCK+L+  SI +L RS   +  F+L  V++   +LKVWLSGAIT Q+TC+D FENTT 
Sbjct  3     LDTCKQLMNLSIRELTRSLNGISEFELINVEKILMNLKVWLSGAITYQDTCLDGFENTTS  62

Query  2711  DTGEKMKHLLKTANELSSNGLAMITHFTELLQSLEIPGVNFKRRLLTAETKGeeqeeEFP  2532
             + G+KMK LL    E+SSN LA++T   + + +  +  +   R L  +E+         P
Sbjct  63    EAGKKMKDLLMIGMEMSSNVLAIVTELADTITNSNVTNLLGHRHLQGSES---------P  113

Query  2531  GFVDAATRRLLTTDPASIKH--DIVVAKDGSGQYKSVVEALRAVPFKNDETVVIFIKAGV  2358
              + D    RLL  + + + H  ++ VAKDG+G +K++ EAL+ VP KN    VI+IK G+
Sbjct  114   SWNDH--HRLLNENASLVNHKPNVTVAKDGNGDFKNINEALKQVPEKNKRPFVIYIKEGI  171

Query  2357  YNERVEVPRKMNKIVFVGEGPTKTRITGSRSNKDGIGTYHTATVAIQGDGFIARNIGFEN  2178
             Y E V+V + M  +VF+G+G  KTRITG+++  DGI TY T+T+AIQGD F+A N+GFEN
Sbjct  172   YQEYVQVTKDMTHVVFIGDGGKKTRITGNKNFIDGINTYKTSTIAIQGDYFVAINMGFEN  231

Query  2177  SAGAAKHQAVALRVSADMTIFHNCHIDAYQDTLYTHSYRQFYRDCTISGTVDFIFGNAPV  1998
              AG  KHQAVALRV AD +IF+NC +D YQDTLY H+ RQFYRDCTISGT+DF+FGNA  
Sbjct  232   FAGPQKHQAVALRVQADKSIFYNCSMDGYQDTLYVHTMRQFYRDCTISGTIDFVFGNALA  291

Query  1997  VFQNCKMIVRKPMANQECMVTAQGRKDRRGAAAIVLQSCEILAEPALKAANPPNKVFLGR  1818
             VFQNC  +VRKP+ NQ+C+VTAQGRK+++  + IV+Q   I+++P   +    NK +L R
Sbjct  292   VFQNCTFVVRKPLKNQQCIVTAQGRKEKQQPSGIVIQGGSIVSDPEFYSIRFENKAYLAR  351

Query  1817  PWKEFSRTLIMFTFIDDIVVPEGWSIWQGT---MYLDTCWYAEYQNRGPGASTDKRVKWK  1647
             PWK +SRT+IM T+IDD++  +G+  WQG      +DTC+YAEY N GPG++  KRV W 
Sbjct  352   PWKNYSRTIIMDTYIDDLIHADGYLPWQGLEGPSGMDTCFYAEYHNTGPGSNKSKRVHWS  411

Query  1646  GYKRNISPEVAKQFTPGPFLMADEQWLGRAQIPFSPG  1536
             G   N++ +    F+P  F    + W+    IP  PG
Sbjct  412   GI-WNLNSKAIHWFSPSKFFHGTD-WIHVTGIPCFPG  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10679970720120